2TN4A

Four calcium tnc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
155
structure length
155
Chain Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Contractile system protein
total genus 57
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1997-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2tn4A00
4NDDA 1NX2A 2JT8A 1BG1A 1SL9A 3A8RA 1RWYA 2KFHA 4PE1A 3CR5X 1NX3A 1IJ6A 1PULA 3EK8A 4N1GA 4Q04A 2HQ8A 4I5KA 1CFFA 1BU3A 1J7QA 2AMIA 1F4OA 2I94A 1OZSA 1KFXL 5DKRA 3LK0A 2KOTA 1XFXO 5HKZA 2BBNA 2L51A 3O6BA 2M0RA 1DTLA 1EL4A 1S1EA 3PN7B 1TNWA 3OHMB 1YVHA 1FF1A 2L5XB 1IWQA 2DOQA 2JXCA 4AQIA 1QVIY 4ORCB 5K89A 5AERA 1B7TZ 3TUYB 1LKJA 1S26D 3I5FB 2LHIA 5KTYA 3KF9A 1NSHA 1H4BA 2CBLA 3PN7C 2MBXA 4ICBA 1F70A 1LA3A 1LINA 1JSAA 4OV2A 3OP0A 1J7PA 1RTP1 1GGWA 2K7BA 4A4CA 1ZUZA 2K7DA 3TUYC 2JNFA 3I5FC 2MRDA 3QRXA 1F54A 1Y6WA 5HYDA 1SYMA 2M29A 3O78A 1CNPA 1BMOA 1EG4A 1KK7Z 4PE4A 5D7FA 3SG6A 3DVMA 4NDCA 4C0LA 1SY9A 2HETA 1G4YR 1UUSA 1ZMZA 3OX6A 2BCXA 2WCBA 1TOPA 3EKJA 1F55A 5CSIA 1YURA 4DS7A 2KHNA 1K95A 4NDBA 3LLEA 1QATA 2MA2A 2OS8B 2RGIA 3KPXA 1NIWA 1QV0A 1QLKA 2SASA 3TS5B 4DIRA 2WOSA 1FW4A 3WHUB 1SL8A 1N0YA 4YGEB 1BJFA 2LP2A 3F45A 5AEQA 1XFYO 2LANA 1TIZA 3CTNA 5ER4X 4CLNA 5I2QA 3I5IB 2L4IA 3KO0A 3DVEA 2FOTA 2EGDA 2OS8C 3AAJA 3HCMA 4R1EA 1BODA 3TS5C 1TCFA 1X02A 3H4SE 1NPQA 4PDZA 2MHHA 2ZN8A 1B47A 2KGRA 1JC2A 2V53A 1FI6A 2M3WA 3I5IC 2JXLA 4HRGA 2K8MB 2PASA 1K9PA 1AJ4A 1TTXA 1M39A 1QX7A 2G2BA 3SG7A 2GV5A 2LVKA 3DD4A 1SPYA 1A4PA 2TN4A 2KQ6A 4AQJA 3SG3A 3GK1A 4MN0A 4UPGA 2PVBA 2JQ6A 4PHKA 1DJGA 1CFPA 2KGBC 1M63B 1XFUO 5DKQA 3IQQA 1SBJA 1WRZA 1DF0A 3NSKA 1SMGA 2KBMA 3BXKA 4L9MA 1HQVA 1KK8B 2JT3A 2R2IA 4I5NB 3OB1B 1KWOB 3PATA 2Y4QA 1BOCA 3SG4A 1AJ5A 5JOLA 1AVSA 1SK6D 2LCPA 4PHJA 4D1EA 3SJSA 1H8BA 1LVCD 1BR4B 1QIWA 3VRRA 1W7IB 2ZFDA 1FI5A 1DF0B 1R2UA 1UP5A 2LLTA 3SIBA 3VRNA 4E68A 1KQVA 1IG5A 1KK8C 1RECA 1KWOC 1JWDA 5HLOA 1CDMA 2BL0B 1BR1B 2MAZA 1F4QA 4PHMA 1G33A 4WRIA 1YX7A 2LMTA 5GQQC 1KK7Y 2KAVA 5DKNA 4CIDA 2D8NA 1J1EA 1OQPA 1Y1UA 1B8CA 1V1FA 4GUKA 1AP4A 5CPVA 1DGVA 2BL0C 4GGNA 1MF8B 2FJUB 3VROA 4U8DA 1PRWA 1M31A 1NX0A 3EK7A 1AHRA 3KEVA 1Y0VH 3PM8A 4BY4A 4M2PA 3IF7A 4XYNA 4MZLA 1IH0A 2L50A 2I7AA 5KSZA 2VRGA 3E3RA 1CM4A 4N1FA 1CMFA 1DVIA 1UHIA 1B8LA 1B4CA 2KQYA 4N5XA 1BLQA 2KFGA 2L98A 5CSFA 3TDUA 3CWGA 4DRWA 3TDZA 4M2OA 2LAPA 2PRUA 4YRUA 1CDNA 1WLMA 3BOWA 2I18A 1EXRA 1DJIA 1KFUL 4WQ2A 4M2QA 1BT6A 3D0YA 3LK1A 3AAKA 2K0JA 3PFVA 2BBMA 5I8NA 2P6BB 2ZNDA 2MJWB 4GGFA 1K93D 2E30A 2WNDA 2Y1MA 5HKWA 3TDIA 2K2AA 1QX5B 3BOWB 1S6JA 4DCKA 1KFXS 1PVBA 3DF0A 2WORA 1DMOA 1SW8A 1XYDA 1ZFSA 1YX8A 2KYFA 1D1OA 3D0YB 3OB2B 1F8HA 2LE9B 2ZKMX 4OVNF 1XFWO 1QV1A 2ZNEA 4OCIA 5IBWA 3CGAA 1KSMA 1DJZA 1YTZC 3RLZA 2A4JA 1PVAA 1RJVA 2SCPA 1J1DA 3M0WA 1B1GA 2AUCA 1ODBA 4JQ0D 3DF0B 1YRUB 3NSIA 1S6IA 2KFFA 3EK4A 3NSLA 1CLLA 4GNKB 2L0PA 1BF5A 2CNPA 5I2OA 1OMDA 2M8UA 3TZ1A 4GGFC 1JFJA 1UWOA 4I5JA 1SR6B 2OPOA 1QASA 3HX4A 1W7JB 3SG2A 2IS9A 1N65A 1WRLA 3IQOA 2Q91A 3NXAA 2M1KB 2JZIA 2COLB 1LXFC 4PHNA 5JJGA 3BUXB 1K90D 2F33A 2KAYA 4QJ3B 4ORBB 1PSBA 1CKKA 2H61A 2G9BA 1SR6C 4OKHA 1IJ5A 2JNXA 1G8IA 2LUXA 3JTDC 1PSRA 1WY9A 1B9AA 2JT0A 3CR2A 4MRYA 1YRTB 2EC6B 1TNQA 2CT9A 4MEWA 2WCFA 1UHKA 5PALA 2BE4A 1NCXA 1ALVA 1MHOA 4GFTA 2KAXA 3CZTX 3EKHA 1OMVA 3DVKA 4P5OE 1KCYA 1DGUA 1TN4A 2EC6C 5AFPA 1OMRA 1CDPA 5TNCA 2MLFC 1SKTA 1K8UA 1Q80A 1K9KA 4WQ3A 2CTNA 4HRHA 2H61C 1K94A 2JTZA 1ALWA 1GGZA 4XJKA 2O60A 2F3ZA 1A2XA 2M97A 1ZOTB 1V1GA 2Y1NA 1KSOA 2QACA 1OSAA 2KI6C 4OR9B 1YUTA 2FCEA 1SL7A 2Q4UA 3VRQA 2KYCA 4YI9A 4XJKB 2JC2A 4HREE 4CFRA 2KI4B 3BUMB 2HPSA 3DVJA 4ZCUA 2BECA 3EVUA 1XK4A 3KHEA 1IQ3A 1SCVA 1QTXA 4YGDB 4TNCA 2M9GA 1JFKA 2AAOA 2Y5IA 3CR4X 3VRPA 2MLEC 1GQMA 2CCMA 2H2KA 1TNXA 4USLA 5B8IB 5BPJA 1MUXA 2KI4C 4YGBB 2M49B 4GBAA 4GPLB 1CTRA 3BQ3A 1C07A 3O2PA 2B1UA 4MSPA 3RM1A 4MLWA 1UHNA 1XVJA 2NZ0A 1EG3A 1NP8A 1DJXA 4FTGA 3WNXB 1S6CA 2BCBA 1MQ1A 4MZKA 3WHTB 1XK4C 1NUBA 1S3PA 1XO5A 3GK4X 1GJYA 1DJHA 1CMGA 1YUUA 1L2OB 4QJ4B 2WCEA 1JUOA 4PCWA 1NCZA 4NQGA 2KDHA 3LCPC 2LHLA 4GAOA 2JULA 3PSRA 2LLUA 3ICBA 4CFQA 2ZN9A 1CFCA 1C7WA 3ZWHA 4YI8A 1CDLA 1J7OA 2O5GA 2JTTA 3OX5A 1EJ3A 1L2OC 1CB1A 2F2OA 1A75A 3VGOA 5KU1A 2NCOA 2JU0A 2JRFA 4HSZA 5AANA 5I2LA 3GOFA 2LC5A 4MZJA 1OOJA 3EVVA 1YR5A 4FQOA 1LA0A 1MXEA 1QJTA 2KI6D 4ORAB 1J55A 5D69A 2L2EA 1M46A 3C1VA 1DT7B 2JPTA 2JOJA 2LVVA 1PALA 2WC8A 5HLVA 1U5IA 3CLNA 4QJ5B 1A75B 2LVIA 1NYAA 3ZNIA 1CM1A 1JF0A 4C0KA 1VRKA 1YUSA 3FS7A 2F3YA 1KQMB 1QX2A 2M1UA 1B8RA 1K96A 3BUWB 1Y1AA 2F8PA 1NCYA 1RROA 4ZCVA 2M7LA 1U5IB 3D10A 1K2HA 3I5GB 2LLSA 2LV7A 1UURA 1CLMA 1KQMC 3LL8B 1AUIB 2PSRA 3JTDB 1TRFA 2GGMA 3FWBA 2FCDA 2K7OA 3SG5A 1KFUS 4MRXA 5AXIA 1QXPA 2QPTA 2LVJA 3MSEB 3AKAA 3I5GC 3EVRA 1HT9A 1C7VA 1SCMB 4MVFA 1Y1XA 2LNKA 3I5HB 3BUNB 1UHHA 4I5LB 4PALA 1WDCB 5CSNA 1PK0D 2PALA 1F71A 2F2PA 1MR8A 2BE6A 3WXAA 2LUCA 2NLNA 1FBVA 2ZRSA 1N2DA 5ER5A 1CLBA 1QVIZ 1S5GY 1AK8A 1SCMC 5J3XA 1MXLC 1XFVO 1L7ZA 1IGVA 3I5HC 1JBAA 2CXJA 1JF2A 1RK9A 1WDCC 3BYAA 1J7RA 4ETOA 2KNEA 1A03A 3AKBA 1YVLA 1IQ5A 4F0ZB 2BCAA 4AOMA 1A29A 1QIVA 2K61A 3BUOB 4P2YB 3JVTB 2JWWA 2PMYA 4YBHB 2E6WA 1K9UA 1WLZA 1S36A 2L4HA 1ZACA 2K2FA 2LP3A 2LM5A 2OTGB 1TCOB 1RFJA 4DUQA 1M45A 1NWDA 3PLFB 3CS1A 1OZOA 4YGCB 2K7CA 3JVTC 2ISDA 1SNLA 2EHBA 2LMVA 1QS7A 3O4YA 5F6TA 4CPVA 1QLSA 2HQWA 4BY5A 1IRJA 2OTGC 3NSOA 4A4BA 1B7TY 2KSPA 1TNPA 1CFDA 1XFZO 4JPZB 1EH2A 3FWCA 1DJYA 1XA5A 2NCPA 4PE7A 4IL1A 4JWQA 1MWNA 3SIAA 1FPWA 1E8AA 2BKIB 4MBEA 1UHJA 5FYXA 2HF5A 5CSJA 4C0JA 2LMUA 3GK2A 2ZRTA 3FIAA 3PALA 5G08A 2GGZA 1S5GZ 1R6PA 5HKYA 1WRKA 1IKUA 2KBIA 2M7NA 4PE0A 3A4UB 4YGAA 2BKHB 3K21A 2I2RE 1SRAA 1DJWA 1OE9B 1NX1A 2NXQA
chains in the Genus database with same CATH superfamily
4NDDA 1NX2A 2JT8A 1BG1A 1SL9A 3A8RA 1RWYA 4F7FA 2KFHA 3NGVA 4PE1A 3CR5X 1NX3A 1IJ6A 1PULA 3EK8A 4N1GA 4Q04A 2HQ8A 3PM2A 4I5KA 1CFFA 1BU3A 1DQEA 1J7QA 2GTEA 2AMIA 1F4OA 2I94A 3R1OA 1OZSA 1KFXL 2JPOA 5DKRA 3LK0A 3RZSA 2KOTA 1XFXO 2H8VA 2BBNA 2L51A 5HKZA 3O6BA 2M0RA 1DTLA 1EL4A 1S1EA 3PN7B 1TNWA 3OHMB 1YVHA 1FF1A 2L5XB 2QEVA 1IWQA 2DOQA 2JXCA 4AQIA 1QVIY 4ORCB 5K89A 5AERA 1B7TZ 5FI7A 3TUYB 3SS3A 1LKJA 1S26D 3I5FB 2LHIA 2P71A 5KTYA 3FE9A 1NSHA 3KF9A 3R1PA 1H4BA 2CBLA 3PN7C 2MBXA 4ICBA 1F70A 1LA3A 1LINA 1JSAA 4OV2A 3OP0A 1J7PA 1RTP1 1GGWA 2K7BA 3S0DA 4A4CA 1ZUZA 2K7DA 3TUYC 2JNFA 3I5FC 2MRDA 3QRXA 1F54A 1Y6WA 5HYDA 1SYMA 2M29A 3O78A 1CNPA 1BMOA 1EG4A 1KK7Z 4PE4A 5D7FA 3SG6A 1ORGA 3DVMA 4NDCA 2PYQA 4C0LA 1SY9A 2HETA 1G4YR 1UUSA 1ZMZA 1TUJA 3OX6A 2BCXA 2WCBA 1TOPA 3EKJA 2BNXA 1F55A 5CSIA 1YURA 2P70A 4DS7A 2KHNA 1K95A 1Z2CB 4NDBA 3LLEA 1QATA 2MA2A 2OS8B 2RGIA 3KPXA 1NIWA 1QV0A 1QLKA 2SASA 3CYZA 3TS5B 4DIRA 2WOSA 3S0AA 1FW4A 3WHUB 1SL8A 1N0YA 4YGEB 1BJFA 2LP2A 3F45A 5AEQA 1XFYO 2LANA 1TIZA 2WCKA 3CTNA 3D78A 5ER4X 4CLNA 5I2QA 3I5IB 5EL2A 2L4IA 3KO0A 3DVEA 2FOTA 2EGDA 2OS8C 3AAJA 3HCMA 4R1EA 1BODA 3TS5C 1TCFA 1X02A 3H4SE 1NPQA 4PT1A 4PDZA 2MHHA 2ZN8A 1B47A 2KGRA 2KPHA 1JC2A 2V53A 1FI6A 2M3WA 3CDNA 3I5IC 2JXLA 4HRGA 2K8MB 2PASA 2ERBA 4IJ7A 1K9PA 1AJ4A 1TTXA 1M39A 1QX7A 2KLEA 2G2BA 3SG7A 2GV5A 2LVKA 4INWA 3DD4A 1SPYA 1A4PA 2TN4A 2KQ6A 4AQJA 3SG3A 3GK1A 3BFAA 4MN0A 2FJYA 2PVBA 2JQ6A 4UPGA 4PHKA 1DJGA 1CFPA 2KGBC 1XFUO 1M63B 1OOFA 5DKQA 3IQQA 1SBJA 1WRZA 1DF0A 3NSKA 1SMGA 2KBMA 3BXKA 4L9MA 1HQVA 1KK8B 2JT3A 2R2IA 2YGUA 4I5NB 3OB1B 1KWOB 3PATA 2Y4QA 1BOCA 3SG4A 1LS8A 1AJ5A 3V2LA 5JOLA 1AVSA 1SK6D 1DELA 2LCPA 4PHJA 4D1EA 3SJSA 1H8BA 1LVCD 1BR4B 1QIWA 3VRRA 1W7IB 2ZFDA 1FI5A 3UO9A 1DF0B 1R2UA 1UP5A 2LLTA 3SIBA 3VRNA 4E68A 1KQVA 1IG5A 1KK8C 3R72A 1RECA 1KWOC 1JWDA 5HLOA 2BAPA 1CDMA 2BL0B 1BR1B 2MAZA 1F4QA 4PHMA 1G33A 4WRIA 1YX7A 2LMTA 5GQQC 1KK7Y 2KAVA 5DKNA 3BFBA 4CIDA 2D8NA 3SS4A 1J1EA 1OQPA 3D75A 1Y1UA 1B8CA 1V1FA 2WCJA 4GUKA 1AP4A 5CPVA 1DGVA 2BL0C 3PJIA 4GGNA 1MF8B 2FJUB 3L47A 4U8DA 1T14A 3SS5A 3VROA 1PRWA 5I94A 1M31A 1NX0A 3N7HA 3S0FA 3EK7A 1AHRA 3KEVA 1Y0VH 3PM8A 4BY4A 3UNWA 4OZDA 4M2PA 3IF7A 4XYNA 4MZLA 1IH0A 2WCMA 2L50A 2I7AA 5KSZA 2VRGA 1DC1A 3E3RA 1CM4A 4N1FA 1CMFA 1DVIA 1UHIA 1B8LA 3D73A 1B4CA 2KQYA 3B88A 4N5XA 5D3OA 1BLQA 2KFGA 2QEHA 2L98A 5CSFA 3TDUA 3CWGA 4DRWA 3TDZA 4M2OA 2LAPA 2PRUA 4YRUA 1CDNA 1WLMA 3BOWA 2I18A 1EXRA 1DJIA 1KFUL 4WQ2A 4M2QA 1BT6A 3D0YA 3LK1A 3AAKA 2K0JA 3B6XA 3PFVA 2BBMA 5I8NA 2P6BB 2ZNDA 2MJWB 4GGFA 1K93D 3L4LA 2QEBA 2E30A 2WNDA 2Y1MA 5HKWA 3TDIA 2K2AA 1QX5B 3BOWB 1S6JA 4DCKA 1KFXS 1PVBA 3DF0A 5FI2A 2WORA 1DMOA 1SW8A 1XYDA 1ZFSA 1YX8A 2KYFA 1D1OA 3D0YB 3OB2B 1F8HA 2LE9B 2ZKMX 4OVNF 1XFWO 1QV1A 2ZNEA 4OCIA 5IBWA 3CZ0A 3CGAA 1KSMA 3B86A 1DJZA 1YTZC 3RLZA 2A4JA 1PVAA 1RJVA 2SCPA 2PQLA 1J1DA 3M0WA 1B1GA 2AUCA 1ODBA 4JQ0D 3DF0B 1YRUB 3NSIA 1S6IA 2KFFA 3EK4A 3NSLA 1CLLA 4GNKB 1QWVA 2L0PA 3DY9A 1BF5A 2CNPA 5I2OA 1OMDA 1W9ZA 3BFHA 2M8UA 3TZ1A 4GGFC 1JFJA 1UWOA 4I5JA 1SR6B 2OPOA 1QASA 3HX4A 1W7JB 3SG2A 2IS9A 1N65A 1WRLA 3IQOA 1P28A 2Q91A 3NXAA 2M1KB 2JZIA 2COLB 1LXFC 4PHNA 5JJGA 3BUXB 1K90D 2F33A 2KAYA 4QJ3B 4ORBB 1PSBA 1CKKA 2H61A 2G9BA 1SR6C 4OKHA 1IJ5A 2JNXA 1G8IA 2LUXA 3JTDC 1PSRA 1WY9A 1B9AA 2JT0A 3CR2A 4MRYA 1YRTB 3VB1A 2EC6B 4JKTA 1TNQA 2CT9A 4MEWA 2WCFA 1UHKA 5PALA 2BE4A 1NCXA 1ALVA 1MHOA 3OGNA 2KAXA 3CZTX 3EKHA 1OMVA 3CZ2A 3DVKA 4GFTA 4P5OE 1KCYA 1DGUA 3Q8IA 1TN4A 2EC6C 5AFPA 1OMRA 1CDPA 5TNCA 2MLFC 1SKTA 1K8UA 1Q80A 1K9KA 4WQ3A 1OOHA 2CTNA 4HRHA 2H61C 1K94A 1TUZA 1ALWA 1GGZA 2JTZA 4XJKA 2O60A 2F3ZA 1A2XA 2M97A 1ZOTB 1V1GA 2Y1NA 1KSOA 2QACA 1OSAA 2KI6C 4OR9B 1YUTA 2FCEA 1SL7A 2Q4UA 3VRQA 2KYCA 4YI9A 4KYNA 1TWOA 4XJKB 2JC2A 4HREE 4CFRA 2KI4B 3BUMB 2HPSA 3DVJA 4ZCUA 3R1VA 2BECA 3EVUA 1XK4A 3KHEA 1IQ3A 1SCVA 1QTXA 3CABA 4YGDB 4TNCA 2M9GA 1JFKA 2AAOA 2Y5IA 3CR4X 3VRPA 1C3YA 2MLEC 1GQMA 2CCMA 2H2KA 1TNXA 4USLA 2WCLA 5B8IB 5BPJA 1MUXA 2KI4C 2L5YA 4YGBB 2M49B 4GBAA 4GPLB 1CTRA 3BQ3A 3FE8A 3O2PA 1C07A 2B1UA 4MSPA 3RM1A 1DEKA 3IVTA 4MLWA 1UHNA 1XVJA 2NZ0A 1EG3A 3B7AA 1NP8A 1DJXA 4FTGA 3WNXB 1S6CA 3QMEA 2BCBA 1MQ1A 3B87A 4MZKA 3WHTB 1XK4C 1NUBA 1S3PA 1XO5A 3GK4X 1GJYA 1DJHA 1CMGA 1YUUA 5FI6A 1L2OB 2QDIA 4QJ4B 2WCEA 1JUOA 4PCWA 1NCZA 4NQGA 2KDHA 3LCPC 2LHLA 3DXLA 4GAOA 2JULA 3PSRA 2LLUA 3ICBA 4CFQA 3NHIA 3CZ1A 2ZN9A 1CFCA 1C7WA 3ZWHA 4YI8A 1CDLA 4JD9A 2O5GA 1J7OA 2JTTA 3OX5A 2WCHA 1EJ3A 3D77A 1L2OC 1CB1A 2F2OA 1A75A 4INXA 3VGOA 5KU1A 2NCOA 2JU0A 2JRFA 2K60A 4HSZA 5AANA 5I2LA 3GOFA 2LC5A 4MZJA 1OOJA 3EVVA 3S0EA 1YR5A 4FQOA 1LA0A 1MXEA 1QJTA 2KI6D 4ORAB 1J55A 5D69A 2L2EA 5HL1A 1M46A 3C1VA 1DT7B 2JPTA 2JOJA 2LVVA 1OOGA 1PALA 2WC8A 1U5IA 3CLNA 5HLVA 1A75B 4QJ5B 2LVIA 1NYAA 3ZNIA 1CM1A 1JF0A 4C0KA 1VRKA 1YUSA 3FS7A 2F3YA 1KQMB 1QX2A 2M1UA 1Z4HA 1B8RA 1K96A 3BUWB 1Y1AA 3L4AA 3D76A 2F8PA 1NCYA 1RROA 4ZCVA 2M7LA 1U5IB 3D10A 1K2HA 3I5GB 2LLSA 2WC5A 1OOIX 1XFRA 3DZTA 2LV7A 1UURA 3S0GA 1CLMA 1KQMC 3LL8B 1AUIB 2PSRA 3JTDB 3NHTA 1TRFA 2GGMA 3FWBA 3OBVA 2FCDA 2K7OA 3SG5A 1KFUS 4MRXA 5AXIA 1QXPA 2QPTA 2LVJA 3MSEB 1OW4A 3AKAA 3I5GC 3EVRA 1HT9A 3FE6A 1SCMB 1C7VA 4MVFA 1Y1XA 2LNKA 3I5HB 3BUNB 1UHHA 4I5LB 4PALA 1WDCB 5CSNA 1PK0D 2L2CA 2PALA 2F2PA 1F71A 1MR8A 2BE6A 3EG5B 3WXAA 2LUCA 2NLNA 1FBVA 2ZRSA 1N2DA 5ER5A 1CLBA 1QVIZ 1S5GY 3BJHA 1AK8A 1SCMC 5J3XA 1MXLC 1XFVO 1GM0A 1L7ZA 1IGVA 3I5HC 1JBAA 2CXJA 1JF2A 1RK9A 1WDCC 3BYAA 1J7RA 4ETOA 2KNEA 1A03A 3AKBA 1YVLA 1IQ5A 4F0ZB 4FQTA 2BCAA 4AOMA 1A29A 1QIVA 2K61A 2WC6A 3BUOB 3JVTB 2JWWA 2PMYA 4P2YB 4YBHB 2E6WA 1K9UA 1WLZA 1S36A 2L4HA 1ZACA 2K2FA 2LP3A 2LM5A 2OTGB 1TCOB 1RFJA 3DYEA 4DUQA 1M45A 1NWDA 3PLFB 3CS1A 1OZOA 4YGCB 2K7CA 3JVTC 2ISDA 3S0BA 5DICA 1SNLA 2EHBA 2LMVA 1QS7A 3O4YA 5F6TA 4CPVA 1QLSA 2HQWA 4BY5A 1IRJA 2QEOA 3D74A 2OTGC 3NSOA 4A4BA 1B7TY 2KSPA 1TNPA 1CFDA 1XFZO 4JPZB 1EH2A 3FWCA 1DJYA 1XA5A 2NCPA 3K1EA 1C3ZA 4PE7A 4IL1A 4JWQA 1MWNA 3SIAA 1FPWA 1E8AA 2BKIB 4MBEA 1UHJA 5FYXA 2HF5A 5CSJA 4C0JA 1IIOA 2LMUA 3GK2A 2ZRTA 3FIAA 3PALA 5G08A 2GGZA 1S5GZ 1R6PA 5HKYA 1WRKA 1IKUA 2KLDA 2KBIA 2M7NA 4PE0A 3A4UB 4YGAA 2BKHB 3K21A 3O4XA 2I2RE 1SRAA 1SSEB 1DJWA 1OE9B 1NX1A 2NXQA
chains in the Genus database with same CATH topology
4NDDA 1NX2A 2JT8A 1BG1A 1SL9A 3A8RA 1RWYA 2KFHA 4PE1A 3CR5X 1NX3A 1IJ6A 1PULA 3EK8A 4N1GA 4Q04A 2HQ8A 4I5KA 1CFFA 1BU3A 1J7QA 2AMIA 1F4OA 2I94A 1OZSA 1KFXL 5DKRA 3LK0A 2KOTA 1XFXO 5HKZA 2BBNA 2L51A 3O6BA 2M0RA 1DTLA 1EL4A 1S1EA 3PN7B 1TNWA 3OHMB 1YVHA 1FF1A 2L5XB 1IWQA 2DOQA 2JXCA 4AQIA 1QVIY 4ORCB 5K89A 5AERA 1B7TZ 3TUYB 1LKJA 1S26D 3I5FB 2LHIA 5KTYA 3KF9A 1NSHA 1H4BA 2CBLA 3PN7C 2MBXA 4ICBA 1F70A 1LA3A 1LINA 1JSAA 4OV2A 3OP0A 1J7PA 1RTP1 1GGWA 2K7BA 4A4CA 1ZUZA 2K7DA 3TUYC 2JNFA 3I5FC 2MRDA 3QRXA 1F54A 1Y6WA 5HYDA 1SYMA 2M29A 3O78A 1CNPA 1BMOA 1EG4A 1KK7Z 4PE4A 5D7FA 3SG6A 3DVMA 4NDCA 4C0LA 1SY9A 2HETA 1G4YR 1UUSA 1ZMZA 3OX6A 2BCXA 2WCBA 1TOPA 3EKJA 1F55A 5CSIA 1YURA 4DS7A 2KHNA 1K95A 4NDBA 3LLEA 1QATA 2MA2A 2OS8B 2RGIA 3KPXA 1NIWA 1QV0A 1QLKA 2SASA 3TS5B 4DIRA 2WOSA 1FW4A 3WHUB 1SL8A 1N0YA 4YGEB 1BJFA 2LP2A 3F45A 5AEQA 1XFYO 2LANA 1TIZA 3CTNA 5ER4X 4CLNA 5I2QA 3I5IB 2L4IA 3KO0A 3DVEA 2FOTA 2EGDA 2OS8C 3AAJA 3HCMA 4R1EA 1BODA 3TS5C 1TCFA 1X02A 3H4SE 1NPQA 4PDZA 2MHHA 2ZN8A 1B47A 2KGRA 1JC2A 2V53A 1FI6A 2M3WA 3I5IC 2JXLA 4HRGA 2K8MB 2PASA 1K9PA 1AJ4A 1TTXA 1M39A 1QX7A 2G2BA 3SG7A 2GV5A 2LVKA 3DD4A 1SPYA 1A4PA 2TN4A 2KQ6A 4AQJA 3SG3A 3GK1A 4MN0A 4UPGA 2PVBA 2JQ6A 4PHKA 1DJGA 1CFPA 2KGBC 1M63B 1XFUO 5DKQA 3IQQA 1SBJA 1WRZA 1DF0A 3NSKA 1SMGA 2KBMA 3BXKA 4L9MA 1HQVA 1KK8B 2JT3A 2R2IA 4I5NB 3OB1B 1KWOB 3PATA 2Y4QA 1BOCA 3SG4A 1AJ5A 5JOLA 1AVSA 1SK6D 2LCPA 4PHJA 4D1EA 3SJSA 1H8BA 1LVCD 1BR4B 1QIWA 3VRRA 1W7IB 2ZFDA 1FI5A 1DF0B 1R2UA 1UP5A 2LLTA 3SIBA 3VRNA 4E68A 1KQVA 1IG5A 1KK8C 1RECA 1KWOC 1JWDA 5HLOA 1CDMA 2BL0B 1BR1B 2MAZA 1F4QA 4PHMA 1G33A 4WRIA 1YX7A 2LMTA 5GQQC 1KK7Y 2KAVA 5DKNA 4CIDA 2D8NA 1J1EA 1OQPA 1Y1UA 1B8CA 1V1FA 4GUKA 1AP4A 5CPVA 1DGVA 2BL0C 4GGNA 1MF8B 2FJUB 3VROA 4U8DA 1PRWA 1M31A 1NX0A 3EK7A 1AHRA 3KEVA 1Y0VH 3PM8A 4BY4A 4M2PA 3IF7A 4XYNA 4MZLA 1IH0A 2L50A 2I7AA 5KSZA 2VRGA 3E3RA 1CM4A 4N1FA 1CMFA 1DVIA 1UHIA 1B8LA 1B4CA 2KQYA 4N5XA 1BLQA 2KFGA 2L98A 5CSFA 3TDUA 3CWGA 4DRWA 3TDZA 4M2OA 2LAPA 2PRUA 4YRUA 1CDNA 1WLMA 3BOWA 2I18A 1EXRA 1DJIA 1KFUL 4WQ2A 4M2QA 1BT6A 3D0YA 3LK1A 3AAKA 2K0JA 3PFVA 2BBMA 5I8NA 2P6BB 2ZNDA 2MJWB 4GGFA 1K93D 2E30A 2WNDA 2Y1MA 5HKWA 3TDIA 2K2AA 1QX5B 3BOWB 1S6JA 4DCKA 1KFXS 1PVBA 3DF0A 2WORA 1DMOA 1SW8A 1XYDA 1ZFSA 1YX8A 2KYFA 1D1OA 3D0YB 3OB2B 1F8HA 2LE9B 2ZKMX 4OVNF 1XFWO 1QV1A 2ZNEA 4OCIA 5IBWA 3CGAA 1KSMA 1DJZA 1YTZC 3RLZA 2A4JA 1PVAA 1RJVA 2SCPA 1J1DA 3M0WA 1B1GA 2AUCA 1ODBA 4JQ0D 3DF0B 1YRUB 3NSIA 1S6IA 2KFFA 3EK4A 3NSLA 1CLLA 4GNKB 2L0PA 1BF5A 2CNPA 5I2OA 1OMDA 2M8UA 3TZ1A 4GGFC 1JFJA 1UWOA 4I5JA 1SR6B 2OPOA 1QASA 3HX4A 1W7JB 3SG2A 2IS9A 1N65A 1WRLA 3IQOA 2Q91A 3NXAA 2M1KB 2JZIA 2COLB 1LXFC 4PHNA 5JJGA 3BUXB 1K90D 2F33A 2KAYA 4QJ3B 4ORBB 1PSBA 1CKKA 2H61A 2G9BA 1SR6C 4OKHA 1IJ5A 2JNXA 1G8IA 2LUXA 3JTDC 1PSRA 1WY9A 1B9AA 2JT0A 3CR2A 4MRYA 1YRTB 2EC6B 1TNQA 2CT9A 4MEWA 2WCFA 1UHKA 5PALA 2BE4A 1NCXA 1ALVA 1MHOA 4GFTA 2KAXA 3CZTX 3EKHA 1OMVA 3DVKA 4P5OE 1KCYA 1DGUA 1TN4A 2EC6C 5AFPA 1OMRA 1CDPA 5TNCA 2MLFC 1SKTA 1K8UA 1Q80A 1K9KA 4WQ3A 2CTNA 4HRHA 2H61C 1K94A 2JTZA 1ALWA 1GGZA 4XJKA 2O60A 2F3ZA 1A2XA 2M97A 1ZOTB 1V1GA 2Y1NA 1KSOA 2QACA 1OSAA 2KI6C 4OR9B 1YUTA 2FCEA 1SL7A 2Q4UA 3VRQA 2KYCA 4YI9A 4XJKB 2JC2A 4HREE 4CFRA 2KI4B 3BUMB 2HPSA 3DVJA 4ZCUA 2BECA 3EVUA 1XK4A 3KHEA 1IQ3A 1SCVA 1QTXA 4YGDB 4TNCA 2M9GA 1JFKA 2AAOA 2Y5IA 3CR4X 3VRPA 2MLEC 1GQMA 2CCMA 2H2KA 1TNXA 4USLA 5B8IB 5BPJA 1MUXA 2KI4C 4YGBB 2M49B 4GBAA 4GPLB 1CTRA 3BQ3A 1C07A 3O2PA 2B1UA 4MSPA 3RM1A 4MLWA 1UHNA 1XVJA 2NZ0A 1EG3A 1NP8A 1DJXA 4FTGA 3WNXB 1S6CA 2BCBA 1MQ1A 4MZKA 3WHTB 1XK4C 1NUBA 1S3PA 1XO5A 3GK4X 1GJYA 1DJHA 1CMGA 1YUUA 1L2OB 4QJ4B 2WCEA 1JUOA 4PCWA 1NCZA 4NQGA 2KDHA 3LCPC 2LHLA 4GAOA 2JULA 3PSRA 2LLUA 3ICBA 4CFQA 2ZN9A 1CFCA 1C7WA 3ZWHA 4YI8A 1CDLA 1J7OA 2O5GA 2JTTA 3OX5A 1EJ3A 1L2OC 1CB1A 2F2OA 1A75A 3VGOA 5KU1A 2NCOA 2JU0A 2JRFA 4HSZA 5AANA 5I2LA 3GOFA 2LC5A 4MZJA 1OOJA 3EVVA 1YR5A 4FQOA 1LA0A 1MXEA 1QJTA 2KI6D 4ORAB 1J55A 5D69A 2L2EA 1M46A 3C1VA 1DT7B 2JPTA 2JOJA 2LVVA 1PALA 2WC8A 5HLVA 1U5IA 3CLNA 4QJ5B 1A75B 2LVIA 1NYAA 3ZNIA 1CM1A 1JF0A 4C0KA 1VRKA 1YUSA 3FS7A 2F3YA 1KQMB 1QX2A 2M1UA 1B8RA 1K96A 3BUWB 1Y1AA 2F8PA 1NCYA 1RROA 4ZCVA 2M7LA 1U5IB 3D10A 1K2HA 3I5GB 2LLSA 2LV7A 1UURA 1CLMA 1KQMC 3LL8B 1AUIB 2PSRA 3JTDB 1TRFA 2GGMA 3FWBA 2FCDA 2K7OA 3SG5A 1KFUS 4MRXA 5AXIA 1QXPA 2QPTA 2LVJA 3MSEB 3AKAA 3I5GC 3EVRA 1HT9A 1C7VA 1SCMB 4MVFA 1Y1XA 2LNKA 3I5HB 3BUNB 1UHHA 4I5LB 4PALA 1WDCB 5CSNA 1PK0D 2PALA 1F71A 2F2PA 1MR8A 2BE6A 3WXAA 2LUCA 2NLNA 1FBVA 2ZRSA 1N2DA 5ER5A 1CLBA 1QVIZ 1S5GY 1AK8A 1SCMC 5J3XA 1MXLC 1XFVO 1L7ZA 1IGVA 3I5HC 1JBAA 2CXJA 1JF2A 1RK9A 1WDCC 3BYAA 1J7RA 4ETOA 2KNEA 1A03A 3AKBA 1YVLA 1IQ5A 4F0ZB 2BCAA 4AOMA 1A29A 1QIVA 2K61A 3BUOB 4P2YB 3JVTB 2JWWA 2PMYA 4YBHB 2E6WA 1K9UA 1WLZA 1S36A 2L4HA 1ZACA 2K2FA 2LP3A 2LM5A 2OTGB 1TCOB 1RFJA 4DUQA 1M45A 1NWDA 3PLFB 3CS1A 1OZOA 4YGCB 2K7CA 3JVTC 2ISDA 1SNLA 2EHBA 2LMVA 1QS7A 3O4YA 5F6TA 4CPVA 1QLSA 2HQWA 4BY5A 1IRJA 2OTGC 3NSOA 4A4BA 1B7TY 2KSPA 1TNPA 1CFDA 1XFZO 4JPZB 1EH2A 3FWCA 1DJYA 1XA5A 2NCPA 4PE7A 4IL1A 4JWQA 1MWNA 3SIAA 1FPWA 1E8AA 2BKIB 4MBEA 1UHJA 5FYXA 2HF5A 5CSJA 4C0JA 2LMUA 3GK2A 2ZRTA 3FIAA 3PALA 5G08A 2GGZA 1S5GZ 1R6PA 5HKYA 1WRKA 1IKUA 2KBIA 2M7NA 4PE0A 3A4UB 4YGAA 2BKHB 3K21A 2I2RE 1SRAA 1DJWA 1OE9B 1NX1A 2NXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDD A;  1NX2 A;  2JT8 A;  1BG1 A;  1SL9 A;  3A8R A;  1RWY A;  2KFH A;  4PE1 A;  3CR5 X;  1NX3 A;  1IJ6 A;  1PUL A;  3EK8 A;  4N1G A;  4Q04 A;  2HQ8 A;  4I5K A;  1CFF A;  1BU3 A;  1J7Q A;  2AMI A;  1F4O A;  2I94 A;  1OZS A;  1KFX L;  5DKR A;  3LK0 A;  2KOT A;  1XFX O;  5HKZ A;  2BBN A;  2L51 A;  3O6B A;  2M0R A;  1DTL A;  1EL4 A;  1S1E A;  3PN7 B;  1TNW A;  3OHM B;  1YVH A;  1FF1 A;  2L5X B;  1IWQ A;  2DOQ A;  2JXC A;  4AQI A;  1QVI Y;  4ORC B;  5K89 A;  5AER A;  1B7T Z;  3TUY B;  1LKJ A;  1S26 D;  3I5F B;  2LHI A;  5KTY A;  3KF9 A;  1NSH A;  1H4B A;  2CBL A;  3PN7 C;  2MBX A;  4ICB A;  1F70 A;  1LA3 A;  1LIN A;  1JSA A;  4OV2 A;  3OP0 A;  1J7P A;  1RTP 1;  1GGW A;  2K7B A;  4A4C A;  1ZUZ A;  2K7D A;  3TUY C;  2JNF A;  3I5F C;  2MRD A;  3QRX A;  1F54 A;  1Y6W A;  5HYD A;  1SYM A;  2M29 A;  3O78 A;  1CNP A;  1BMO A;  1EG4 A;  1KK7 Z;  4PE4 A;  5D7F A;  3SG6 A;  3DVM A;  4NDC A;  4C0L A;  1SY9 A;  2HET A;  1G4Y R;  1UUS A;  1ZMZ A;  3OX6 A;  2BCX A;  2WCB A;  1TOP A;  3EKJ A;  1F55 A;  5CSI A;  1YUR A;  4DS7 A;  2KHN A;  1K95 A;  4NDB A;  3LLE A;  1QAT A;  2MA2 A;  2OS8 B;  2RGI A;  3KPX A;  1NIW A;  1QV0 A;  1QLK A;  2SAS A;  3TS5 B;  4DIR A;  2WOS A;  1FW4 A;  3WHU B;  1SL8 A;  1N0Y A;  4YGE B;  1BJF A;  2LP2 A;  3F45 A;  5AEQ A;  1XFY O;  2LAN A;  1TIZ A;  3CTN A;  5ER4 X;  4CLN A;  5I2Q A;  3I5I B;  2L4I A;  3KO0 A;  3DVE A;  2FOT A;  2EGD A;  2OS8 C;  3AAJ A;  3HCM A;  4R1E A;  1BOD A;  3TS5 C;  1TCF A;  1X02 A;  3H4S E;  1NPQ A;  4PDZ A;  2MHH A;  2ZN8 A;  1B47 A;  2KGR A;  1JC2 A;  2V53 A;  1FI6 A;  2M3W A;  3I5I C;  2JXL A;  4HRG A;  2K8M B;  2PAS A;  1K9P A;  1AJ4 A;  1TTX A;  1M39 A;  1QX7 A;  2G2B A;  3SG7 A;  2GV5 A;  2LVK A;  3DD4 A;  1SPY A;  1A4P A;  2TN4 A;  2KQ6 A;  4AQJ A;  3SG3 A;  3GK1 A;  4MN0 A;  4UPG A;  2PVB A;  2JQ6 A;  4PHK A;  1DJG A;  1CFP A;  2KGB C;  1M63 B;  1XFU O;  5DKQ A;  3IQQ A;  1SBJ A;  1WRZ A;  1DF0 A;  3NSK A;  1SMG A;  2KBM A;  3BXK A;  4L9M A;  1HQV A;  1KK8 B;  2JT3 A;  2R2I A;  4I5N B;  3OB1 B;  1KWO B;  3PAT A;  2Y4Q A;  1BOC A;  3SG4 A;  1AJ5 A;  5JOL A;  1AVS A;  1SK6 D;  2LCP A;  4PHJ A;  4D1E A;  3SJS A;  1H8B A;  1LVC D;  1BR4 B;  1QIW A;  3VRR A;  1W7I B;  2ZFD A;  1FI5 A;  1DF0 B;  1R2U A;  1UP5 A;  2LLT A;  3SIB A;  3VRN A;  4E68 A;  1KQV A;  1IG5 A;  1KK8 C;  1REC A;  1KWO C;  1JWD A;  5HLO A;  1CDM A;  2BL0 B;  1BR1 B;  2MAZ A;  1F4Q A;  4PHM A;  1G33 A;  4WRI A;  1YX7 A;  2LMT A;  5GQQ C;  1KK7 Y;  2KAV A;  5DKN A;  4CID A;  2D8N A;  1J1E A;  1OQP A;  1Y1U A;  1B8C A;  1V1F A;  4GUK A;  1AP4 A;  5CPV A;  1DGV A;  2BL0 C;  4GGN A;  1MF8 B;  2FJU B;  3VRO A;  4U8D A;  1PRW A;  1M31 A;  1NX0 A;  3EK7 A;  1AHR A;  3KEV A;  1Y0V H;  3PM8 A;  4BY4 A;  4M2P A;  3IF7 A;  4XYN A;  4MZL A;  1IH0 A;  2L50 A;  2I7A A;  5KSZ A;  2VRG A;  3E3R A;  1CM4 A;  4N1F A;  1CMF A;  1DVI A;  1UHI A;  1B8L A;  1B4C A;  2KQY A;  4N5X A;  1BLQ A;  2KFG A;  2L98 A;  5CSF A;  3TDU A;  3CWG A;  4DRW A;  3TDZ A;  4M2O A;  2LAP A;  2PRU A;  4YRU A;  1CDN A;  1WLM A;  3BOW A;  2I18 A;  1EXR A;  1DJI A;  1KFU L;  4WQ2 A;  4M2Q A;  1BT6 A;  3D0Y A;  3LK1 A;  3AAK A;  2K0J A;  3PFV A;  2BBM A;  5I8N A;  2P6B B;  2ZND A;  2MJW B;  4GGF A;  1K93 D;  2E30 A;  2WND A;  2Y1M A;  5HKW A;  3TDI A;  2K2A A;  1QX5 B;  3BOW B;  1S6J A;  4DCK A;  1KFX S;  1PVB A;  3DF0 A;  2WOR A;  1DMO A;  1SW8 A;  1XYD A;  1ZFS A;  1YX8 A;  2KYF A;  1D1O A;  3D0Y B;  3OB2 B;  1F8H A;  2LE9 B;  2ZKM X;  4OVN F;  1XFW O;  1QV1 A;  2ZNE A;  4OCI A;  5IBW A;  3CGA A;  1KSM A;  1DJZ A;  1YTZ C;  3RLZ A;  2A4J A;  1PVA A;  1RJV A;  2SCP A;  1J1D A;  3M0W A;  1B1G A;  2AUC A;  1ODB A;  4JQ0 D;  3DF0 B;  1YRU B;  3NSI A;  1S6I A;  2KFF A;  3EK4 A;  3NSL A;  1CLL A;  4GNK B;  2L0P A;  1BF5 A;  2CNP A;  5I2O A;  1OMD A;  2M8U A;  3TZ1 A;  4GGF C;  1JFJ A;  1UWO A;  4I5J A;  1SR6 B;  2OPO A;  1QAS A;  3HX4 A;  1W7J B;  3SG2 A;  2IS9 A;  1N65 A;  1WRL A;  3IQO A;  2Q91 A;  3NXA A;  2M1K B;  2JZI A;  2COL B;  1LXF C;  4PHN A;  5JJG A;  3BUX B;  1K90 D;  2F33 A;  2KAY A;  4QJ3 B;  4ORB B;  1PSB A;  1CKK A;  2H61 A;  2G9B A;  1SR6 C;  4OKH A;  1IJ5 A;  2JNX A;  1G8I A;  2LUX A;  3JTD C;  1PSR A;  1WY9 A;  1B9A A;  2JT0 A;  3CR2 A;  4MRY A;  1YRT B;  2EC6 B;  1TNQ A;  2CT9 A;  4MEW A;  2WCF A;  1UHK A;  5PAL A;  2BE4 A;  1NCX A;  1ALV A;  1MHO A;  4GFT A;  2KAX A;  3CZT X;  3EKH A;  1OMV A;  3DVK A;  4P5O E;  1KCY A;  1DGU A;  1TN4 A;  2EC6 C;  5AFP A;  1OMR A;  1CDP A;  5TNC A;  2MLF C;  1SKT A;  1K8U A;  1Q80 A;  1K9K A;  4WQ3 A;  2CTN A;  4HRH A;  2H61 C;  1K94 A;  2JTZ A;  1ALW A;  1GGZ A;  4XJK A;  2O60 A;  2F3Z A;  1A2X A;  2M97 A;  1ZOT B;  1V1G A;  2Y1N A;  1KSO A;  2QAC A;  1OSA A;  2KI6 C;  4OR9 B;  1YUT A;  2FCE A;  1SL7 A;  2Q4U A;  3VRQ A;  2KYC A;  4YI9 A;  4XJK B;  2JC2 A;  4HRE E;  4CFR A;  2KI4 B;  3BUM B;  2HPS A;  3DVJ A;  4ZCU A;  2BEC A;  3EVU A;  1XK4 A;  3KHE A;  1IQ3 A;  1SCV A;  1QTX A;  4YGD B;  4TNC A;  2M9G A;  1JFK A;  2AAO A;  2Y5I A;  3CR4 X;  3VRP A;  2MLE C;  1GQM A;  2CCM A;  2H2K A;  1TNX A;  4USL A;  5B8I B;  5BPJ A;  1MUX A;  2KI4 C;  4YGB B;  2M49 B;  4GBA A;  4GPL B;  1CTR A;  3BQ3 A;  1C07 A;  3O2P A;  2B1U A;  4MSP A;  3RM1 A;  4MLW A;  1UHN A;  1XVJ A;  2NZ0 A;  1EG3 A;  1NP8 A;  1DJX A;  4FTG A;  3WNX B;  1S6C A;  2BCB A;  1MQ1 A;  4MZK A;  3WHT B;  1XK4 C;  1NUB A;  1S3P A;  1XO5 A;  3GK4 X;  1GJY A;  1DJH A;  1CMG A;  1YUU A;  1L2O B;  4QJ4 B;  2WCE A;  1JUO A;  4PCW A;  1NCZ A;  4NQG A;  2KDH A;  3LCP C;  2LHL A;  4GAO A;  2JUL A;  3PSR A;  2LLU A;  3ICB A;  4CFQ A;  2ZN9 A;  1CFC A;  1C7W A;  3ZWH A;  4YI8 A;  1CDL A;  1J7O A;  2O5G A;  2JTT A;  3OX5 A;  1EJ3 A;  1L2O C;  1CB1 A;  2F2O A;  1A75 A;  3VGO A;  5KU1 A;  2NCO A;  2JU0 A;  2JRF A;  4HSZ A;  5AAN A;  5I2L A;  3GOF A;  2LC5 A;  4MZJ A;  1OOJ A;  3EVV A;  1YR5 A;  4FQO A;  1LA0 A;  1MXE A;  1QJT A;  2KI6 D;  4ORA B;  1J55 A;  5D69 A;  2L2E A;  1M46 A;  3C1V A;  1DT7 B;  2JPT A;  2JOJ A;  2LVV A;  1PAL A;  2WC8 A;  5HLV A;  1U5I A;  3CLN A;  4QJ5 B;  1A75 B;  2LVI A;  1NYA A;  3ZNI A;  1CM1 A;  1JF0 A;  4C0K A;  1VRK A;  1YUS A;  3FS7 A;  2F3Y A;  1KQM B;  1QX2 A;  2M1U A;  1B8R A;  1K96 A;  3BUW B;  1Y1A A;  2F8P A;  1NCY A;  1RRO A;  4ZCV A;  2M7L A;  1U5I B;  3D10 A;  1K2H A;  3I5G B;  2LLS A;  2LV7 A;  1UUR A;  1CLM A;  1KQM C;  3LL8 B;  1AUI B;  2PSR A;  3JTD B;  1TRF A;  2GGM A;  3FWB A;  2FCD A;  2K7O A;  3SG5 A;  1KFU S;  4MRX A;  5AXI A;  1QXP A;  2QPT A;  2LVJ A;  3MSE B;  3AKA A;  3I5G C;  3EVR A;  1HT9 A;  1C7V A;  1SCM B;  4MVF A;  1Y1X A;  2LNK A;  3I5H B;  3BUN B;  1UHH A;  4I5L B;  4PAL A;  1WDC B;  5CSN A;  1PK0 D;  2PAL A;  1F71 A;  2F2P A;  1MR8 A;  2BE6 A;  3WXA A;  2LUC A;  2NLN A;  1FBV A;  2ZRS A;  1N2D A;  5ER5 A;  1CLB A;  1QVI Z;  1S5G Y;  1AK8 A;  1SCM C;  5J3X A;  1MXL C;  1XFV O;  1L7Z A;  1IGV A;  3I5H C;  1JBA A;  2CXJ A;  1JF2 A;  1RK9 A;  1WDC C;  3BYA A;  1J7R A;  4ETO A;  2KNE A;  1A03 A;  3AKB A;  1YVL A;  1IQ5 A;  4F0Z B;  2BCA A;  4AOM A;  1A29 A;  1QIV A;  2K61 A;  3BUO B;  4P2Y B;  3JVT B;  2JWW A;  2PMY A;  4YBH B;  2E6W A;  1K9U A;  1WLZ A;  1S36 A;  2L4H A;  1ZAC A;  2K2F A;  2LP3 A;  2LM5 A;  2OTG B;  1TCO B;  1RFJ A;  4DUQ A;  1M45 A;  1NWD A;  3PLF B;  3CS1 A;  1OZO A;  4YGC B;  2K7C A;  3JVT C;  2ISD A;  1SNL A;  2EHB A;  2LMV A;  1QS7 A;  3O4Y A;  5F6T A;  4CPV A;  1QLS A;  2HQW A;  4BY5 A;  1IRJ A;  2OTG C;  3NSO A;  4A4B A;  1B7T Y;  2KSP A;  1TNP A;  1CFD A;  1XFZ O;  4JPZ B;  1EH2 A;  3FWC A;  1DJY A;  1XA5 A;  2NCP A;  4PE7 A;  4IL1 A;  4JWQ A;  1MWN A;  3SIA A;  1FPW A;  1E8A A;  2BKI B;  4MBE A;  1UHJ A;  5FYX A;  2HF5 A;  5CSJ A;  4C0J A;  2LMU A;  3GK2 A;  2ZRT A;  3FIA A;  3PAL A;  5G08 A;  2GGZ A;  1S5G Z;  1R6P A;  5HKY A;  1WRK A;  1IKU A;  2KBI A;  2M7N A;  4PE0 A;  3A4U B;  4YGA A;  2BKH B;  3K21 A;  2I2R E;  1SRA A;  1DJW A;  1OE9 B;  1NX1 A;  2NXQ A; 
#chains in the Genus database with same CATH topology
 4NDD A;  1NX2 A;  2JT8 A;  1BG1 A;  1SL9 A;  3A8R A;  1RWY A;  4F7F A;  2KFH A;  3NGV A;  4PE1 A;  3CR5 X;  1NX3 A;  1IJ6 A;  1PUL A;  3EK8 A;  4N1G A;  4Q04 A;  2HQ8 A;  3PM2 A;  4I5K A;  1CFF A;  1BU3 A;  1DQE A;  1J7Q A;  2GTE A;  2AMI A;  1F4O A;  2I94 A;  3R1O A;  1OZS A;  1KFX L;  2JPO A;  5DKR A;  3LK0 A;  3RZS A;  2KOT A;  1XFX O;  2H8V A;  2BBN A;  2L51 A;  5HKZ A;  3O6B A;  2M0R A;  1DTL A;  1EL4 A;  1S1E A;  3PN7 B;  1TNW A;  3OHM B;  1YVH A;  1FF1 A;  2L5X B;  2QEV A;  1IWQ A;  2DOQ A;  2JXC A;  4AQI A;  1QVI Y;  4ORC B;  5K89 A;  5AER A;  1B7T Z;  5FI7 A;  3TUY B;  3SS3 A;  1LKJ A;  1S26 D;  3I5F B;  2LHI A;  2P71 A;  5KTY A;  3FE9 A;  1NSH A;  3KF9 A;  3R1P A;  1H4B A;  2CBL A;  3PN7 C;  2MBX A;  4ICB A;  1F70 A;  1LA3 A;  1LIN A;  1JSA A;  4OV2 A;  3OP0 A;  1J7P A;  1RTP 1;  1GGW A;  2K7B A;  3S0D A;  4A4C A;  1ZUZ A;  2K7D A;  3TUY C;  2JNF A;  3I5F C;  2MRD A;  3QRX A;  1F54 A;  1Y6W A;  5HYD A;  1SYM A;  2M29 A;  3O78 A;  1CNP A;  1BMO A;  1EG4 A;  1KK7 Z;  4PE4 A;  5D7F A;  3SG6 A;  1ORG A;  3DVM A;  4NDC A;  2PYQ A;  4C0L A;  1SY9 A;  2HET A;  1G4Y R;  1UUS A;  1ZMZ A;  1TUJ A;  3OX6 A;  2BCX A;  2WCB A;  1TOP A;  3EKJ A;  2BNX A;  1F55 A;  5CSI A;  1YUR A;  2P70 A;  4DS7 A;  2KHN A;  1K95 A;  1Z2C B;  4NDB A;  3LLE A;  1QAT A;  2MA2 A;  2OS8 B;  2RGI A;  3KPX A;  1NIW A;  1QV0 A;  1QLK A;  2SAS A;  3CYZ A;  3TS5 B;  4DIR A;  2WOS A;  3S0A A;  1FW4 A;  3WHU B;  1SL8 A;  1N0Y A;  4YGE B;  1BJF A;  2LP2 A;  3F45 A;  5AEQ A;  1XFY O;  2LAN A;  1TIZ A;  2WCK A;  3CTN A;  3D78 A;  5ER4 X;  4CLN A;  5I2Q A;  3I5I B;  5EL2 A;  2L4I A;  3KO0 A;  3DVE A;  2FOT A;  2EGD A;  2OS8 C;  3AAJ A;  3HCM A;  4R1E A;  1BOD A;  3TS5 C;  1TCF A;  1X02 A;  3H4S E;  1NPQ A;  4PT1 A;  4PDZ A;  2MHH A;  2ZN8 A;  1B47 A;  2KGR A;  2KPH A;  1JC2 A;  2V53 A;  1FI6 A;  2M3W A;  3CDN A;  3I5I C;  2JXL A;  4HRG A;  2K8M B;  2PAS A;  2ERB A;  4IJ7 A;  1K9P A;  1AJ4 A;  1TTX A;  1M39 A;  1QX7 A;  2KLE A;  2G2B A;  3SG7 A;  2GV5 A;  2LVK A;  4INW A;  3DD4 A;  1SPY A;  1A4P A;  2TN4 A;  2KQ6 A;  4AQJ A;  3SG3 A;  3GK1 A;  3BFA A;  4MN0 A;  2FJY A;  2PVB A;  2JQ6 A;  4UPG A;  4PHK A;  1DJG A;  1CFP A;  2KGB C;  1XFU O;  1M63 B;  1OOF A;  5DKQ A;  3IQQ A;  1SBJ A;  1WRZ A;  1DF0 A;  3NSK A;  1SMG A;  2KBM A;  3BXK A;  4L9M A;  1HQV A;  1KK8 B;  2JT3 A;  2R2I A;  2YGU A;  4I5N B;  3OB1 B;  1KWO B;  3PAT A;  2Y4Q A;  1BOC A;  3SG4 A;  1LS8 A;  1AJ5 A;  3V2L A;  5JOL A;  1AVS A;  1SK6 D;  1DEL A;  2LCP A;  4PHJ A;  4D1E A;  3SJS A;  1H8B A;  1LVC D;  1BR4 B;  1QIW A;  3VRR A;  1W7I B;  2ZFD A;  1FI5 A;  3UO9 A;  1DF0 B;  1R2U A;  1UP5 A;  2LLT A;  3SIB A;  3VRN A;  4E68 A;  1KQV A;  1IG5 A;  1KK8 C;  3R72 A;  1REC A;  1KWO C;  1JWD A;  5HLO A;  2BAP A;  1CDM A;  2BL0 B;  1BR1 B;  2MAZ A;  1F4Q A;  4PHM A;  1G33 A;  4WRI A;  1YX7 A;  2LMT A;  5GQQ C;  1KK7 Y;  2KAV A;  5DKN A;  3BFB A;  4CID A;  2D8N A;  3SS4 A;  1J1E A;  1OQP A;  3D75 A;  1Y1U A;  1B8C A;  1V1F A;  2WCJ A;  4GUK A;  1AP4 A;  5CPV A;  1DGV A;  2BL0 C;  3PJI A;  4GGN A;  1MF8 B;  2FJU B;  3L47 A;  4U8D A;  1T14 A;  3SS5 A;  3VRO A;  1PRW A;  5I94 A;  1M31 A;  1NX0 A;  3N7H A;  3S0F A;  3EK7 A;  1AHR A;  3KEV A;  1Y0V H;  3PM8 A;  4BY4 A;  3UNW A;  4OZD A;  4M2P A;  3IF7 A;  4XYN A;  4MZL A;  1IH0 A;  2WCM A;  2L50 A;  2I7A A;  5KSZ A;  2VRG A;  1DC1 A;  3E3R A;  1CM4 A;  4N1F A;  1CMF A;  1DVI A;  1UHI A;  1B8L A;  3D73 A;  1B4C A;  2KQY A;  3B88 A;  4N5X A;  5D3O A;  1BLQ A;  2KFG A;  2QEH A;  2L98 A;  5CSF A;  3TDU A;  3CWG A;  4DRW A;  3TDZ A;  4M2O A;  2LAP A;  2PRU A;  4YRU A;  1CDN A;  1WLM A;  3BOW A;  2I18 A;  1EXR A;  1DJI A;  1KFU L;  4WQ2 A;  4M2Q A;  1BT6 A;  3D0Y A;  3LK1 A;  3AAK A;  2K0J A;  3B6X A;  3PFV A;  2BBM A;  5I8N A;  2P6B B;  2ZND A;  2MJW B;  4GGF A;  1K93 D;  3L4L A;  2QEB A;  2E30 A;  2WND A;  2Y1M A;  5HKW A;  3TDI A;  2K2A A;  1QX5 B;  3BOW B;  1S6J A;  4DCK A;  1KFX S;  1PVB A;  3DF0 A;  5FI2 A;  2WOR A;  1DMO A;  1SW8 A;  1XYD A;  1ZFS A;  1YX8 A;  2KYF A;  1D1O A;  3D0Y B;  3OB2 B;  1F8H A;  2LE9 B;  2ZKM X;  4OVN F;  1XFW O;  1QV1 A;  2ZNE A;  4OCI A;  5IBW A;  3CZ0 A;  3CGA A;  1KSM A;  3B86 A;  1DJZ A;  1YTZ C;  3RLZ A;  2A4J A;  1PVA A;  1RJV A;  2SCP A;  2PQL A;  1J1D A;  3M0W A;  1B1G A;  2AUC A;  1ODB A;  4JQ0 D;  3DF0 B;  1YRU B;  3NSI A;  1S6I A;  2KFF A;  3EK4 A;  3NSL A;  1CLL A;  4GNK B;  1QWV A;  2L0P A;  3DY9 A;  1BF5 A;  2CNP A;  5I2O A;  1OMD A;  1W9Z A;  3BFH A;  2M8U A;  3TZ1 A;  4GGF C;  1JFJ A;  1UWO A;  4I5J A;  1SR6 B;  2OPO A;  1QAS A;  3HX4 A;  1W7J B;  3SG2 A;  2IS9 A;  1N65 A;  1WRL A;  3IQO A;  1P28 A;  2Q91 A;  3NXA A;  2M1K B;  2JZI A;  2COL B;  1LXF C;  4PHN A;  5JJG A;  3BUX B;  1K90 D;  2F33 A;  2KAY A;  4QJ3 B;  4ORB B;  1PSB A;  1CKK A;  2H61 A;  2G9B A;  1SR6 C;  4OKH A;  1IJ5 A;  2JNX A;  1G8I A;  2LUX A;  3JTD C;  1PSR A;  1WY9 A;  1B9A A;  2JT0 A;  3CR2 A;  4MRY A;  1YRT B;  3VB1 A;  2EC6 B;  4JKT A;  1TNQ A;  2CT9 A;  4MEW A;  2WCF A;  1UHK A;  5PAL A;  2BE4 A;  1NCX A;  1ALV A;  1MHO A;  3OGN A;  2KAX A;  3CZT X;  3EKH A;  1OMV A;  3CZ2 A;  3DVK A;  4GFT A;  4P5O E;  1KCY A;  1DGU A;  3Q8I A;  1TN4 A;  2EC6 C;  5AFP A;  1OMR A;  1CDP A;  5TNC A;  2MLF C;  1SKT A;  1K8U A;  1Q80 A;  1K9K A;  4WQ3 A;  1OOH A;  2CTN A;  4HRH A;  2H61 C;  1K94 A;  1TUZ A;  1ALW A;  1GGZ A;  2JTZ A;  4XJK A;  2O60 A;  2F3Z A;  1A2X A;  2M97 A;  1ZOT B;  1V1G A;  2Y1N A;  1KSO A;  2QAC A;  1OSA A;  2KI6 C;  4OR9 B;  1YUT A;  2FCE A;  1SL7 A;  2Q4U A;  3VRQ A;  2KYC A;  4YI9 A;  4KYN A;  1TWO A;  4XJK B;  2JC2 A;  4HRE E;  4CFR A;  2KI4 B;  3BUM B;  2HPS A;  3DVJ A;  4ZCU A;  3R1V A;  2BEC A;  3EVU A;  1XK4 A;  3KHE A;  1IQ3 A;  1SCV A;  1QTX A;  3CAB A;  4YGD B;  4TNC A;  2M9G A;  1JFK A;  2AAO A;  2Y5I A;  3CR4 X;  3VRP A;  1C3Y A;  2MLE C;  1GQM A;  2CCM A;  2H2K A;  1TNX A;  4USL A;  2WCL A;  5B8I B;  5BPJ A;  1MUX A;  2KI4 C;  2L5Y A;  4YGB B;  2M49 B;  4GBA A;  4GPL B;  1CTR A;  3BQ3 A;  3FE8 A;  3O2P A;  1C07 A;  2B1U A;  4MSP A;  3RM1 A;  1DEK A;  3IVT A;  4MLW A;  1UHN A;  1XVJ A;  2NZ0 A;  1EG3 A;  3B7A A;  1NP8 A;  1DJX A;  4FTG A;  3WNX B;  1S6C A;  3QME A;  2BCB A;  1MQ1 A;  3B87 A;  4MZK A;  3WHT B;  1XK4 C;  1NUB A;  1S3P A;  1XO5 A;  3GK4 X;  1GJY A;  1DJH A;  1CMG A;  1YUU A;  5FI6 A;  1L2O B;  2QDI A;  4QJ4 B;  2WCE A;  1JUO A;  4PCW A;  1NCZ A;  4NQG A;  2KDH A;  3LCP C;  2LHL A;  3DXL A;  4GAO A;  2JUL A;  3PSR A;  2LLU A;  3ICB A;  4CFQ A;  3NHI A;  3CZ1 A;  2ZN9 A;  1CFC A;  1C7W A;  3ZWH A;  4YI8 A;  1CDL A;  4JD9 A;  2O5G A;  1J7O A;  2JTT A;  3OX5 A;  2WCH A;  1EJ3 A;  3D77 A;  1L2O C;  1CB1 A;  2F2O A;  1A75 A;  4INX A;  3VGO A;  5KU1 A;  2NCO A;  2JU0 A;  2JRF A;  2K60 A;  4HSZ A;  5AAN A;  5I2L A;  3GOF A;  2LC5 A;  4MZJ A;  1OOJ A;  3EVV A;  3S0E A;  1YR5 A;  4FQO A;  1LA0 A;  1MXE A;  1QJT A;  2KI6 D;  4ORA B;  1J55 A;  5D69 A;  2L2E A;  5HL1 A;  1M46 A;  3C1V A;  1DT7 B;  2JPT A;  2JOJ A;  2LVV A;  1OOG A;  1PAL A;  2WC8 A;  1U5I A;  3CLN A;  5HLV A;  1A75 B;  4QJ5 B;  2LVI A;  1NYA A;  3ZNI A;  1CM1 A;  1JF0 A;  4C0K A;  1VRK A;  1YUS A;  3FS7 A;  2F3Y A;  1KQM B;  1QX2 A;  2M1U A;  1Z4H A;  1B8R A;  1K96 A;  3BUW B;  1Y1A A;  3L4A A;  3D76 A;  2F8P A;  1NCY A;  1RRO A;  4ZCV A;  2M7L A;  1U5I B;  3D10 A;  1K2H A;  3I5G B;  2LLS A;  2WC5 A;  1OOI X;  1XFR A;  3DZT A;  2LV7 A;  1UUR A;  3S0G A;  1CLM A;  1KQM C;  3LL8 B;  1AUI B;  2PSR A;  3JTD B;  3NHT A;  1TRF A;  2GGM A;  3FWB A;  3OBV A;  2FCD A;  2K7O A;  3SG5 A;  1KFU S;  4MRX A;  5AXI A;  1QXP A;  2QPT A;  2LVJ A;  3MSE B;  1OW4 A;  3AKA A;  3I5G C;  3EVR A;  1HT9 A;  3FE6 A;  1SCM B;  1C7V A;  4MVF A;  1Y1X A;  2LNK A;  3I5H B;  3BUN B;  1UHH A;  4I5L B;  4PAL A;  1WDC B;  5CSN A;  1PK0 D;  2L2C A;  2PAL A;  2F2P A;  1F71 A;  1MR8 A;  2BE6 A;  3EG5 B;  3WXA A;  2LUC A;  2NLN A;  1FBV A;  2ZRS A;  1N2D A;  5ER5 A;  1CLB A;  1QVI Z;  1S5G Y;  3BJH A;  1AK8 A;  1SCM C;  5J3X A;  1MXL C;  1XFV O;  1GM0 A;  1L7Z A;  1IGV A;  3I5H C;  1JBA A;  2CXJ A;  1JF2 A;  1RK9 A;  1WDC C;  3BYA A;  1J7R A;  4ETO A;  2KNE A;  1A03 A;  3AKB A;  1YVL A;  1IQ5 A;  4F0Z B;  4FQT A;  2BCA A;  4AOM A;  1A29 A;  1QIV A;  2K61 A;  2WC6 A;  3BUO B;  3JVT B;  2JWW A;  2PMY A;  4P2Y B;  4YBH B;  2E6W A;  1K9U A;  1WLZ A;  1S36 A;  2L4H A;  1ZAC A;  2K2F A;  2LP3 A;  2LM5 A;  2OTG B;  1TCO B;  1RFJ A;  3DYE A;  4DUQ A;  1M45 A;  1NWD A;  3PLF B;  3CS1 A;  1OZO A;  4YGC B;  2K7C A;  3JVT C;  2ISD A;  3S0B A;  5DIC A;  1SNL A;  2EHB A;  2LMV A;  1QS7 A;  3O4Y A;  5F6T A;  4CPV A;  1QLS A;  2HQW A;  4BY5 A;  1IRJ A;  2QEO A;  3D74 A;  2OTG C;  3NSO A;  4A4B A;  1B7T Y;  2KSP A;  1TNP A;  1CFD A;  1XFZ O;  4JPZ B;  1EH2 A;  3FWC A;  1DJY A;  1XA5 A;  2NCP A;  3K1E A;  1C3Z A;  4PE7 A;  4IL1 A;  4JWQ A;  1MWN A;  3SIA A;  1FPW A;  1E8A A;  2BKI B;  4MBE A;  1UHJ A;  5FYX A;  2HF5 A;  5CSJ A;  4C0J A;  1IIO A;  2LMU A;  3GK2 A;  2ZRT A;  3FIA A;  3PAL A;  5G08 A;  2GGZ A;  1S5G Z;  1R6P A;  5HKY A;  1WRK A;  1IKU A;  2KLD A;  2KBI A;  2M7N A;  4PE0 A;  3A4U B;  4YGA A;  2BKH B;  3K21 A;  3O4X A;  2I2R E;  1SRA A;  1SSE B;  1DJW A;  1OE9 B;  1NX1 A;  2NXQ A; 
#chains in the Genus database with same CATH homology
 4NDD A;  1NX2 A;  2JT8 A;  1BG1 A;  1SL9 A;  3A8R A;  1RWY A;  2KFH A;  4PE1 A;  3CR5 X;  1NX3 A;  1IJ6 A;  1PUL A;  3EK8 A;  4N1G A;  4Q04 A;  2HQ8 A;  4I5K A;  1CFF A;  1BU3 A;  1J7Q A;  2AMI A;  1F4O A;  2I94 A;  1OZS A;  1KFX L;  5DKR A;  3LK0 A;  2KOT A;  1XFX O;  5HKZ A;  2BBN A;  2L51 A;  3O6B A;  2M0R A;  1DTL A;  1EL4 A;  1S1E A;  3PN7 B;  1TNW A;  3OHM B;  1YVH A;  1FF1 A;  2L5X B;  1IWQ A;  2DOQ A;  2JXC A;  4AQI A;  1QVI Y;  4ORC B;  5K89 A;  5AER A;  1B7T Z;  3TUY B;  1LKJ A;  1S26 D;  3I5F B;  2LHI A;  5KTY A;  3KF9 A;  1NSH A;  1H4B A;  2CBL A;  3PN7 C;  2MBX A;  4ICB A;  1F70 A;  1LA3 A;  1LIN A;  1JSA A;  4OV2 A;  3OP0 A;  1J7P A;  1RTP 1;  1GGW A;  2K7B A;  4A4C A;  1ZUZ A;  2K7D A;  3TUY C;  2JNF A;  3I5F C;  2MRD A;  3QRX A;  1F54 A;  1Y6W A;  5HYD A;  1SYM A;  2M29 A;  3O78 A;  1CNP A;  1BMO A;  1EG4 A;  1KK7 Z;  4PE4 A;  5D7F A;  3SG6 A;  3DVM A;  4NDC A;  4C0L A;  1SY9 A;  2HET A;  1G4Y R;  1UUS A;  1ZMZ A;  3OX6 A;  2BCX A;  2WCB A;  1TOP A;  3EKJ A;  1F55 A;  5CSI A;  1YUR A;  4DS7 A;  2KHN A;  1K95 A;  4NDB A;  3LLE A;  1QAT A;  2MA2 A;  2OS8 B;  2RGI A;  3KPX A;  1NIW A;  1QV0 A;  1QLK A;  2SAS A;  3TS5 B;  4DIR A;  2WOS A;  1FW4 A;  3WHU B;  1SL8 A;  1N0Y A;  4YGE B;  1BJF A;  2LP2 A;  3F45 A;  5AEQ A;  1XFY O;  2LAN A;  1TIZ A;  3CTN A;  5ER4 X;  4CLN A;  5I2Q A;  3I5I B;  2L4I A;  3KO0 A;  3DVE A;  2FOT A;  2EGD A;  2OS8 C;  3AAJ A;  3HCM A;  4R1E A;  1BOD A;  3TS5 C;  1TCF A;  1X02 A;  3H4S E;  1NPQ A;  4PDZ A;  2MHH A;  2ZN8 A;  1B47 A;  2KGR A;  1JC2 A;  2V53 A;  1FI6 A;  2M3W A;  3I5I C;  2JXL A;  4HRG A;  2K8M B;  2PAS A;  1K9P A;  1AJ4 A;  1TTX A;  1M39 A;  1QX7 A;  2G2B A;  3SG7 A;  2GV5 A;  2LVK A;  3DD4 A;  1SPY A;  1A4P A;  2TN4 A;  2KQ6 A;  4AQJ A;  3SG3 A;  3GK1 A;  4MN0 A;  4UPG A;  2PVB A;  2JQ6 A;  4PHK A;  1DJG A;  1CFP A;  2KGB C;  1M63 B;  1XFU O;  5DKQ A;  3IQQ A;  1SBJ A;  1WRZ A;  1DF0 A;  3NSK A;  1SMG A;  2KBM A;  3BXK A;  4L9M A;  1HQV A;  1KK8 B;  2JT3 A;  2R2I A;  4I5N B;  3OB1 B;  1KWO B;  3PAT A;  2Y4Q A;  1BOC A;  3SG4 A;  1AJ5 A;  5JOL A;  1AVS A;  1SK6 D;  2LCP A;  4PHJ A;  4D1E A;  3SJS A;  1H8B A;  1LVC D;  1BR4 B;  1QIW A;  3VRR A;  1W7I B;  2ZFD A;  1FI5 A;  1DF0 B;  1R2U A;  1UP5 A;  2LLT A;  3SIB A;  3VRN A;  4E68 A;  1KQV A;  1IG5 A;  1KK8 C;  1REC A;  1KWO C;  1JWD A;  5HLO A;  1CDM A;  2BL0 B;  1BR1 B;  2MAZ A;  1F4Q A;  4PHM A;  1G33 A;  4WRI A;  1YX7 A;  2LMT A;  5GQQ C;  1KK7 Y;  2KAV A;  5DKN A;  4CID A;  2D8N A;  1J1E A;  1OQP A;  1Y1U A;  1B8C A;  1V1F A;  4GUK A;  1AP4 A;  5CPV A;  1DGV A;  2BL0 C;  4GGN A;  1MF8 B;  2FJU B;  3VRO A;  4U8D A;  1PRW A;  1M31 A;  1NX0 A;  3EK7 A;  1AHR A;  3KEV A;  1Y0V H;  3PM8 A;  4BY4 A;  4M2P A;  3IF7 A;  4XYN A;  4MZL A;  1IH0 A;  2L50 A;  2I7A A;  5KSZ A;  2VRG A;  3E3R A;  1CM4 A;  4N1F A;  1CMF A;  1DVI A;  1UHI A;  1B8L A;  1B4C A;  2KQY A;  4N5X A;  1BLQ A;  2KFG A;  2L98 A;  5CSF A;  3TDU A;  3CWG A;  4DRW A;  3TDZ A;  4M2O A;  2LAP A;  2PRU A;  4YRU A;  1CDN A;  1WLM A;  3BOW A;  2I18 A;  1EXR A;  1DJI A;  1KFU L;  4WQ2 A;  4M2Q A;  1BT6 A;  3D0Y A;  3LK1 A;  3AAK A;  2K0J A;  3PFV A;  2BBM A;  5I8N A;  2P6B B;  2ZND A;  2MJW B;  4GGF A;  1K93 D;  2E30 A;  2WND A;  2Y1M A;  5HKW A;  3TDI A;  2K2A A;  1QX5 B;  3BOW B;  1S6J A;  4DCK A;  1KFX S;  1PVB A;  3DF0 A;  2WOR A;  1DMO A;  1SW8 A;  1XYD A;  1ZFS A;  1YX8 A;  2KYF A;  1D1O A;  3D0Y B;  3OB2 B;  1F8H A;  2LE9 B;  2ZKM X;  4OVN F;  1XFW O;  1QV1 A;  2ZNE A;  4OCI A;  5IBW A;  3CGA A;  1KSM A;  1DJZ A;  1YTZ C;  3RLZ A;  2A4J A;  1PVA A;  1RJV A;  2SCP A;  1J1D A;  3M0W A;  1B1G A;  2AUC A;  1ODB A;  4JQ0 D;  3DF0 B;  1YRU B;  3NSI A;  1S6I A;  2KFF A;  3EK4 A;  3NSL A;  1CLL A;  4GNK B;  2L0P A;  1BF5 A;  2CNP A;  5I2O A;  1OMD A;  2M8U A;  3TZ1 A;  4GGF C;  1JFJ A;  1UWO A;  4I5J A;  1SR6 B;  2OPO A;  1QAS A;  3HX4 A;  1W7J B;  3SG2 A;  2IS9 A;  1N65 A;  1WRL A;  3IQO A;  2Q91 A;  3NXA A;  2M1K B;  2JZI A;  2COL B;  1LXF C;  4PHN A;  5JJG A;  3BUX B;  1K90 D;  2F33 A;  2KAY A;  4QJ3 B;  4ORB B;  1PSB A;  1CKK A;  2H61 A;  2G9B A;  1SR6 C;  4OKH A;  1IJ5 A;  2JNX A;  1G8I A;  2LUX A;  3JTD C;  1PSR A;  1WY9 A;  1B9A A;  2JT0 A;  3CR2 A;  4MRY A;  1YRT B;  2EC6 B;  1TNQ A;  2CT9 A;  4MEW A;  2WCF A;  1UHK A;  5PAL A;  2BE4 A;  1NCX A;  1ALV A;  1MHO A;  4GFT A;  2KAX A;  3CZT X;  3EKH A;  1OMV A;  3DVK A;  4P5O E;  1KCY A;  1DGU A;  1TN4 A;  2EC6 C;  5AFP A;  1OMR A;  1CDP A;  5TNC A;  2MLF C;  1SKT A;  1K8U A;  1Q80 A;  1K9K A;  4WQ3 A;  2CTN A;  4HRH A;  2H61 C;  1K94 A;  2JTZ A;  1ALW A;  1GGZ A;  4XJK A;  2O60 A;  2F3Z A;  1A2X A;  2M97 A;  1ZOT B;  1V1G A;  2Y1N A;  1KSO A;  2QAC A;  1OSA A;  2KI6 C;  4OR9 B;  1YUT A;  2FCE A;  1SL7 A;  2Q4U A;  3VRQ A;  2KYC A;  4YI9 A;  4XJK B;  2JC2 A;  4HRE E;  4CFR A;  2KI4 B;  3BUM B;  2HPS A;  3DVJ A;  4ZCU A;  2BEC A;  3EVU A;  1XK4 A;  3KHE A;  1IQ3 A;  1SCV A;  1QTX A;  4YGD B;  4TNC A;  2M9G A;  1JFK A;  2AAO A;  2Y5I A;  3CR4 X;  3VRP A;  2MLE C;  1GQM A;  2CCM A;  2H2K A;  1TNX A;  4USL A;  5B8I B;  5BPJ A;  1MUX A;  2KI4 C;  4YGB B;  2M49 B;  4GBA A;  4GPL B;  1CTR A;  3BQ3 A;  1C07 A;  3O2P A;  2B1U A;  4MSP A;  3RM1 A;  4MLW A;  1UHN A;  1XVJ A;  2NZ0 A;  1EG3 A;  1NP8 A;  1DJX A;  4FTG A;  3WNX B;  1S6C A;  2BCB A;  1MQ1 A;  4MZK A;  3WHT B;  1XK4 C;  1NUB A;  1S3P A;  1XO5 A;  3GK4 X;  1GJY A;  1DJH A;  1CMG A;  1YUU A;  1L2O B;  4QJ4 B;  2WCE A;  1JUO A;  4PCW A;  1NCZ A;  4NQG A;  2KDH A;  3LCP C;  2LHL A;  4GAO A;  2JUL A;  3PSR A;  2LLU A;  3ICB A;  4CFQ A;  2ZN9 A;  1CFC A;  1C7W A;  3ZWH A;  4YI8 A;  1CDL A;  1J7O A;  2O5G A;  2JTT A;  3OX5 A;  1EJ3 A;  1L2O C;  1CB1 A;  2F2O A;  1A75 A;  3VGO A;  5KU1 A;  2NCO A;  2JU0 A;  2JRF A;  4HSZ A;  5AAN A;  5I2L A;  3GOF A;  2LC5 A;  4MZJ A;  1OOJ A;  3EVV A;  1YR5 A;  4FQO A;  1LA0 A;  1MXE A;  1QJT A;  2KI6 D;  4ORA B;  1J55 A;  5D69 A;  2L2E A;  1M46 A;  3C1V A;  1DT7 B;  2JPT A;  2JOJ A;  2LVV A;  1PAL A;  2WC8 A;  5HLV A;  1U5I A;  3CLN A;  4QJ5 B;  1A75 B;  2LVI A;  1NYA A;  3ZNI A;  1CM1 A;  1JF0 A;  4C0K A;  1VRK A;  1YUS A;  3FS7 A;  2F3Y A;  1KQM B;  1QX2 A;  2M1U A;  1B8R A;  1K96 A;  3BUW B;  1Y1A A;  2F8P A;  1NCY A;  1RRO A;  4ZCV A;  2M7L A;  1U5I B;  3D10 A;  1K2H A;  3I5G B;  2LLS A;  2LV7 A;  1UUR A;  1CLM A;  1KQM C;  3LL8 B;  1AUI B;  2PSR A;  3JTD B;  1TRF A;  2GGM A;  3FWB A;  2FCD A;  2K7O A;  3SG5 A;  1KFU S;  4MRX A;  5AXI A;  1QXP A;  2QPT A;  2LVJ A;  3MSE B;  3AKA A;  3I5G C;  3EVR A;  1HT9 A;  1C7V A;  1SCM B;  4MVF A;  1Y1X A;  2LNK A;  3I5H B;  3BUN B;  1UHH A;  4I5L B;  4PAL A;  1WDC B;  5CSN A;  1PK0 D;  2PAL A;  1F71 A;  2F2P A;  1MR8 A;  2BE6 A;  3WXA A;  2LUC A;  2NLN A;  1FBV A;  2ZRS A;  1N2D A;  5ER5 A;  1CLB A;  1QVI Z;  1S5G Y;  1AK8 A;  1SCM C;  5J3X A;  1MXL C;  1XFV O;  1L7Z A;  1IGV A;  3I5H C;  1JBA A;  2CXJ A;  1JF2 A;  1RK9 A;  1WDC C;  3BYA A;  1J7R A;  4ETO A;  2KNE A;  1A03 A;  3AKB A;  1YVL A;  1IQ5 A;  4F0Z B;  2BCA A;  4AOM A;  1A29 A;  1QIV A;  2K61 A;  3BUO B;  4P2Y B;  3JVT B;  2JWW A;  2PMY A;  4YBH B;  2E6W A;  1K9U A;  1WLZ A;  1S36 A;  2L4H A;  1ZAC A;  2K2F A;  2LP3 A;  2LM5 A;  2OTG B;  1TCO B;  1RFJ A;  4DUQ A;  1M45 A;  1NWD A;  3PLF B;  3CS1 A;  1OZO A;  4YGC B;  2K7C A;  3JVT C;  2ISD A;  1SNL A;  2EHB A;  2LMV A;  1QS7 A;  3O4Y A;  5F6T A;  4CPV A;  1QLS A;  2HQW A;  4BY5 A;  1IRJ A;  2OTG C;  3NSO A;  4A4B A;  1B7T Y;  2KSP A;  1TNP A;  1CFD A;  1XFZ O;  4JPZ B;  1EH2 A;  3FWC A;  1DJY A;  1XA5 A;  2NCP A;  4PE7 A;  4IL1 A;  4JWQ A;  1MWN A;  3SIA A;  1FPW A;  1E8A A;  2BKI B;  4MBE A;  1UHJ A;  5FYX A;  2HF5 A;  5CSJ A;  4C0J A;  2LMU A;  3GK2 A;  2ZRT A;  3FIA A;  3PAL A;  5G08 A;  2GGZ A;  1S5G Z;  1R6P A;  5HKY A;  1WRK A;  1IKU A;  2KBI A;  2M7N A;  4PE0 A;  3A4U B;  4YGA A;  2BKH B;  3K21 A;  2I2R E;  1SRA A;  1DJW A;  1OE9 B;  1NX1 A;  2NXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...