2TN4A

Four calcium tnc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
155
structure length
155
Chain Sequence
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Contractile system protein
total genus 57
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1997-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2tn4A00
1ZOTB 1KQMC 4C0KA 2L0PA 1XO5A 1FW4A 1NSHA 1L7ZA 1F4OA 1SK6D 2JT0A 1C7WA 1IWQA 1PSBA 1JF0A 1OMRA 5FYXA 1XFXO 1F71A 1UHJA 4D1EA 2LHIA 1UURA 3DD4A 1NX0A 2OTGB 2WORA 2BKIB 2HF5A 1YVHA 2LCPA 2LLTA 3C1VA 4WQ2A 1JWDA 2M8UA 1B8LA 1SCMB 3ZNIA 1N2DA 1MF8B 2PVBA 1A4PA 1J7QA 1MQ1A 1F55A 1ODBA 1YX7A 1AP4A 1IRJA 1UUSA 3PALA 1DJYA 4OV2A 2I94A 4GUKA 1J1EA 2LMVA 4NDDA 1KFXS 1CLBA 2O5GA 4F0ZB 4PE0A 1RJVA 4GFTA 1TRFA 1YUUA 3SG2A 2HPSA 1MHOA 2DOQA 1SPYA 1TNPA 1RWYA 2JXLA 1QXPA 2MHHA 1QASA 1MXEA 1PULA 3DF0A 3SG3A 2L4HA 3I5FC 2MJWB 3DVEA 3O4YA 2BL0C 1SNLA 1NX3A 1LVCD 2B1UA 2JTTA 2ZFDA 3KEVA 1FBVA 5JJGA 1TCFA 4N5XA 4ORAB 2ZRSA 4YBHB 1DJHA 2LMTA 1QVIY 1EJ3A 1EG4A 2KQYA 2LVKA 2H61A 4MSPA 1SKTA 3SIBA 5HYDA 1A2XA 1L2OB 4MZKA 1S36A 1RFJA 2MA2A 1SR6C 2IS9A 1TN4A 5CPVA 5J3XA 2A4JA 3NXAA 1FF1A 1F8HA 1KK7Z 1FI5A 3EKJA 1PVAA 1QX5B 4MRXA 1A75B 3FWBA 4A4BA 1OSAA 1XVJA 3PN7B 2BKHB 1GQMA 3DVKA 4QJ4B 4OR9B 3VGOA 2KI4C 1WRKA 4R1EA 2HETA 3ZWHA 1K9UA 3RM1A 1YRUB 1NUBA 1Q80A 2BCBA 4I5KA 3I5HB 2JNFA 2K61A 4ORBB 3BQ3A 4OVNF 2H61C 2AUCA 4GGNA 5DKNA 3PSRA 5IBWA 1WDCC 5ER4X 2JT3A 2KFFA 4PHJA 2LVVA 4YRUA 2OTGC 4JPZB 1DF0A 1U5IB 3SJSA 1QX7A 2LNKA 2LVIA 1F54A 1ZACA 2LC5A 1SCMC 2NZ0A 3BUXB 2M3WA 3CR2A 1S6JA 3BOWB 5KU1A 4ORCB 1XFYO 1CFFA 1DJXA 2CXJA 4I5LB 5GQQC 3LL8B 1OE9B 1Y1UA 2CT9A 3BUMB 1AUIB 3OX5A 2MAZA 1BOCA 1V1FA 1TCOB 1K9PA 2K7OA 4I5JA 4PE4A 1CDMA 2F2PA 5CSIA 1PALA 1S1EA 1V1GA 2L2EA 3TUYC 4DCKA 1J7OA 4NDCA 5G08A 4ZCVA 3TDZA 1W7JB 3GK1A 4GAOA 2FCDA 3EK7A 3AKAA 1EG3A 1R6PA 1LKJA 4FTGA 4BY4A 3NSKA 3VRRA 4YGBB 2EHBA 3OX6A 2KSPA 2LP2A 1GJYA 3OB2B 2ZNEA 4P2YB 2FCEA 1B4CA 2L5XB 2Y1MA 3I5GB 1TTXA 1UWOA 3SIAA 1PK0D 5D69A 3GOFA 2LAPA 1QLSA 3DVMA 1QVIZ 1CFPA 1E8AA 1EXRA 3JVTC 4XYNA 1ALWA 3LK0A 4DS7A 1QV0A 4USLA 3WHTB 1B7TY 1M39A 3EK8A 1IKUA 1CMFA 2QPTA 3A4UB 1KWOC 4MBEA 4XJKA 3PLFB 2WCFA 2WCBA 1TNWA 2JULA 1XK4C 2ZN9A 3AKBA 1S6CA 1C07A 4QJ5B 1NCYA 2LLUA 2LLSA 3PN7C 5F6TA 3TDUA 1N65A 1J7RA 1SL7A 1HQVA 2M29A 1CMGA 2Q4UA 3TS5C 5B8IB 1CFDA 2H2KA 1CFCA 2BECA 4MZJA 3JTDB 1DJGA 1QX2A 4M2QA 1XFWO 1N0YA 4GBAA 2WCEA 1WRLA 1Y6WA 2JTZA 4M2PA 4AQJA 1YVLA 2KNEA 1WLMA 5HLVA 2JPTA 1QS7A 3K21A 1BODA 1G4YR 1B1GA 1SL9A 4NDBA 4N1FA 4WRIA 3VROA 5I2LA 5DKRA 3PFVA 2GV5A 2JXCA 4CLNA 1IQ5A 5ER5A 4CFQA 2ZKMX 1FI6A 2JQ6A 2M49B 1W7IB 4ZCUA 4UPGA 2I2RE 2KI6D 1YRTB 3IF7A 2JU0A 4M2OA 2O60A 2M97A 3LCPC 1OZOA 3SG7A 4CIDA 2CCMA 1NX1A 1DF0B 1B9AA 2PMYA 4GGFC 4PALA 4HRGA 3H4SE 2OS8B 4MVFA 2LUXA 1M31A 2KYFA 5K89A 2EC6C 2ZN8A 3OP0A 3CGAA 2LE9B 1KQMB 5I8NA 1NPQA 5DKQA 1SW8A 1ZFSA 3CR5X 1MXLC 2K2FA 4C0LA 1MR8A 1CB1A 2HQ8A 3BXKA 1JF2A 4IL1A 2V53A 1K8UA 2KBIA 1VRKA 1SYMA 3E3RA 3VRQA 3DVJA 5I2QA 3KO0A 1B7TZ 2LM5A 2L98A 4PCWA 5TNCA 4DIRA 2MLFC 4MRYA 1CM4A 2KFHA 1YUTA 2BCAA 2WNDA 1K9KA 2JRFA 2P6BB 2L50A 2RGIA 2ISDA 2K7BA 2KAVA 2NXQA 5AFPA 3OB1B 4GPLB 1CDLA 1KFUL 2KFGA 1F70A 4YGAA 1RECA 1XFZO 1XFUO 1YX8A 1X02A 2COLB 2MRDA 3BUNB 5HKYA 1K94A 2BBNA 3O78A 5CSJA 1SBJA 1JBAA 1K2HA 1KCYA 1MWNA 3VRPA 3O6BA 4YGEB 5KSZA 1S6IA 2K7DA 2F3ZA 1J55A 2BL0B 2QACA 1PVBA 3D10A 4MLWA 1S3PA 4I5NB 3RLZA 1XK4A 2KGBC 4OKHA 1OMVA 2I18A 2K8MB 2LP3A 1DJZA 2KI6C 2LMUA 3PATA 1UHHA 3O2PA 4GNKB 1OOJA 3EVUA 4PHKA 4YI8A 1IJ5A 2KBMA 3SG4A 1CKKA 2M7LA 5HLOA 2PALA 1ZUZA 3LLEA 1YTZC 1XA5A 3D0YA 1YR5A 3AAKA 5JOLA 1NX2A 4HSZA 1QV1A 2LV7A 1SR6B 2FJUB 4PDZA 1NP8A 4YGDB 1BT6A 3F45A 4JWQA 4P5OE 2K7CA 2BE6A 1L2OC 1JFKA 1A29A 3CR4X 3DF0B 1M63B 3IQOA 1KFUS 1JSAA 3A8RA 1AJ5A 3CTNA 1U5IA 2D8NA 1QLKA 2M1UA 3GK4X 3BYAA 1BR1B 3MSEB 1D1OA 4CPVA 1DJWA 2LVJA 1F4QA 4MZLA 1M45A 2M0RA 2BBMA 1DMOA 1LA0A 1DT7B 3BOWA 1Y0VH 3I5IB 1G8IA 3LK1A 5AXIA 1QJTA 1MUXA 5AEQA 2SASA 2E30A 1GGZA 2WC8A 1BF5A 2EGDA 1DGUA 1WDCB 3I5HC 4MEWA 2PASA 4L9MA 2Y5IA 4HRHA 1S5GZ 2M1KB 5BPJA 1PSRA 1KK8B 1AHRA 2F3YA 1B47A 4GGFA 3IQQA 4NQGA 2LHLA 2GGZA 3KHEA 2Y1NA 1H4BA 2M9GA 1B8CA 4AQIA 2G9BA 2NLNA 2JT8A 5HKZA 4DRWA 1AJ4A 4C0JA 1KSMA 1LXFC 2L4IA 2ZNDA 2KQ6A 3AAJA 1WY9A 1OMDA 2MLEC 3NSLA 5I2OA 1FPWA 3OHMB 1H8BA 2K0JA 3EVRA 1CNPA 2CNPA 3PM8A 1SRAA 2SCPA 1DJIA 4PHMA 1NIWA 2F2OA 1UHKA 2KDHA 4YGCB 3TUYB 1TNQA 2LUCA 4ICBA 4YI9A 1Y1AA 3EVVA 1CTRA 1GGWA 2JNXA 4HREE 1NYAA 1HT9A 1LINA 1AK8A 1JC2A 1NCZA 1CDPA 2BE4A 2GGMA 4BY5A 2NCOA 2BCXA 1OZSA 1TNXA 1UP5A 1JUOA 2KAYA 1WLZA 4WQ3A 3BUOB 1RROA 1A03A 2F33A 5AERA 4OCIA 1BJFA 1RK9A 1SY9A 2Q91A 3HX4A 4Q04A 3JVTB 1CLMA 3HCMA 4JQ0D 3I5GC 3ICBA 4MN0A 1IQ3A 1BU3A 2KHNA 1M46A 1K93D 3QRXA 1TOPA 2I7AA 1J7PA 1PRWA 1QATA 3KF9A 2M7NA 2G2BA 1KWOB 2LANA 3BUWB 1S5GY 1SCVA 3FS7A 3WNXB 4AOMA 1R2UA 4U8DA 1DTLA 4E68A 3NSOA 2FOTA 2VRGA 2KAXA 4PE7A 1YUSA 2WOSA 2CBLA 1UHNA 3KPXA 1AVSA 4FQOA 1CM1A 1EL4A 2JZIA 1SL8A 2Y4QA 3SG5A 3D0YB 3TDIA 5AANA 3TS5B 1K95A 2L51A 3M0WA 1YURA 5CSNA 4N1GA 3I5IC 3VRNA 2NCPA 1ALVA 2ZRTA 1BMOA 1NWDA 1K96A 3SG6A 4PE1A 1DGVA 2F8PA 5D7FA 1DVIA 3JTDC 1NCXA 2R2IA 3I5FB 4XJKB 2OPOA 1CDNA 1KK8C 1QIVA 2AAOA 2HQWA 1IH0A 1BG1A 1IGVA 2KYCA 1IJ6A 3FIAA 4ETOA 1WRZA 5PALA 1A75A 4A4CA 3NSIA 2KGRA 2JWWA 3FWCA 1IG5A 1EH2A 1J1DA 3CLNA 4PHNA 4QJ3B 5CSFA 2MBXA 1QIWA 1RTP1 5HKWA 1C7VA 1OQPA 2PSRA 1KSOA 3GK2A 1BLQA 3CZTX 1Y1XA 3WXAA 1JFJA 2K2AA 1KQVA 2PRUA 1BR4B 1QTXA 1B8RA 1XYDA 1G33A 1SMGA 2JOJA 5KTYA 1ZMZA 1S26D 3EKHA 1TIZA 1KFXL 1UHIA 4TNCA 2E6WA 3CWGA 3EK4A 3WHUB 1KK7Y 2EC6B 1K90D 1CLLA 4DUQA 2TN4A 2OS8C 1LA3A 2KOTA 3TZ1A 2CTNA 2KI4B 1XFVO 2JC2A 4CFRA 3CS1A 2AMIA
chains in the Genus database with same CATH superfamily
1ZOTB 1KQMC 4C0KA 1C3YA 2L0PA 1Z4HA 1XO5A 1FW4A 1NSHA 1L7ZA 1F4OA 1SK6D 2JT0A 4OZDA 1C7WA 1IWQA 1PSBA 1JF0A 1OMRA 2KLEA 5FYXA 1XFXO 1F71A 1UHJA 4D1EA 2LHIA 1UURA 3DD4A 1NX0A 2OTGB 2WORA 2BKIB 2HF5A 1YVHA 2LCPA 2LLTA 3C1VA 4WQ2A 1JWDA 2M8UA 1B8LA 1SCMB 3ZNIA 1N2DA 1MF8B 2PVBA 1A4PA 2QEHA 1J7QA 1MQ1A 3CYZA 1F55A 1ODBA 1YX7A 1AP4A 1IRJA 1UUSA 3PALA 1DJYA 4OV2A 2I94A 4GUKA 1J1EA 2LMVA 4NDDA 1KFXS 1CLBA 5HL1A 3EG5B 2O5GA 4F0ZB 4PE0A 1RJVA 4GFTA 1TRFA 1YUUA 3SG2A 2HPSA 1MHOA 2DOQA 1SPYA 1TNPA 1RWYA 3SS4A 2JXLA 1QXPA 2MHHA 1QASA 1MXEA 1PULA 3DF0A 3SG3A 2L4HA 3I5FC 2MJWB 3DVEA 3O4YA 2BL0C 1GM0A 1SNLA 1NX3A 1LVCD 2B1UA 2JTTA 3B6XA 3DZTA 2ZFDA 3KEVA 1FBVA 5JJGA 1TCFA 4N5XA 4ORAB 2PYQA 2ZRSA 3CZ0A 4YBHB 1DJHA 1LS8A 1QVIY 1EJ3A 1EG4A 2KQYA 2LMTA 2H61A 2LVKA 1SKTA 4IJ7A 4MSPA 3SIBA 5HYDA 1A2XA 3UO9A 1L2OB 4MZKA 1S36A 1RFJA 2MA2A 1SR6C 2IS9A 1TN4A 3FE9A 5CPVA 5J3XA 2A4JA 3BJHA 3NXAA 1FF1A 1F8HA 5FI7A 1KK7Z 1FI5A 3EKJA 1PVAA 1QX5B 4MRXA 1A75B 3FWBA 4A4BA 1C3ZA 1OSAA 1XVJA 3PN7B 2BKHB 1GQMA 3DVKA 4QJ4B 4OR9B 3VGOA 2KI4C 1WRKA 4R1EA 3OBVA 2HETA 3ZWHA 1K9UA 3RM1A 1YRUB 1OOGA 1NUBA 1Q80A 2BCBA 4I5KA 3I5HB 2JNFA 2K61A 4ORBB 3BQ3A 4OVNF 3O4XA 2H61C 3PJIA 2AUCA 4KYNA 4GGNA 5DKNA 3PSRA 5IBWA 1WDCC 5ER4X 2JT3A 3N7HA 2KFFA 4PHJA 2LVVA 4YRUA 2OTGC 4JPZB 1DF0A 1U5IB 3SJSA 1QX7A 2LNKA 2LVIA 1F54A 1ZACA 2LC5A 1SCMC 2QDIA 2NZ0A 3BUXB 2M3WA 3CR2A 1S6JA 3BOWB 2KLDA 5KU1A 4ORCB 1XFYO 1CFFA 1DJXA 2CXJA 4I5LB 5GQQC 3LL8B 1OE9B 1Y1UA 2CT9A 3BUMB 1AUIB 3OX5A 2MAZA 1BOCA 1V1FA 2QEVA 1TCOB 1K9PA 2K7OA 4I5JA 4PE4A 1CDMA 2F2PA 1DQEA 5CSIA 1PALA 1S1EA 1V1GA 2L2EA 3TUYC 4DCKA 1J7OA 4NDCA 5G08A 4ZCVA 1OW4A 3TDZA 1W7JB 2L5YA 3GK1A 4GAOA 2FCDA 3EK7A 3AKAA 1EG3A 1R6PA 1LKJA 4FTGA 4BY4A 3NSKA 3VRRA 4YGBB 3PM2A 2EHBA 3OX6A 2KSPA 2LP2A 1GJYA 3OB2B 2ZNEA 3S0EA 2PQLA 4P2YB 2FCEA 1B4CA 2L5XB 2Y1MA 3I5GB 3L47A 1TTXA 1UWOA 3SIAA 1PK0D 5D69A 2WCMA 3GOFA 2LAPA 1QLSA 3DVMA 1QVIZ 1CFPA 1E8AA 1EXRA 2P70A 3JVTC 4XYNA 5D3OA 1ALWA 3LK0A 4DS7A 1QV0A 4USLA 3WHTB 1B7TY 1M39A 2BNXA 3CABA 3EK8A 1IKUA 1CMFA 2QPTA 3A4UB 1KWOC 3R1OA 4MBEA 4XJKA 3PLFB 2WCFA 2WCBA 1TNWA 2JULA 1XK4C 2ZN9A 3AKBA 1S6CA 1C07A 4QJ5B 1OOIX 1NCYA 2LLUA 2LLSA 3PN7C 5F6TA 3TDUA 1N65A 1J7RA 1SL7A 3B88A 1HQVA 2M29A 3D76A 1CMGA 2Q4UA 3TS5C 5B8IB 1CFDA 1SSEB 2H2KA 1CFCA 2BECA 4MZJA 3JTDB 4F7FA 1DJGA 1QX2A 4M2QA 1XFWO 1N0YA 4GBAA 2WCEA 1WRLA 1OOHA 1Y6WA 2JTZA 3RZSA 4M2PA 4AQJA 1YVLA 4JKTA 2KNEA 1WLMA 5HLVA 2JPTA 1QS7A 3D77A 3K21A 1G4YR 1BODA 1B1GA 1SL9A 4NDBA 4N1FA 4WRIA 3VROA 5I2LA 5DKRA 3PFVA 3QMEA 2GV5A 2JXCA 4CLNA 1IQ5A 1P28A 3D78A 5ER5A 4CFQA 2ZKMX 1FI6A 2JQ6A 2M49B 1W7IB 2WCKA 4ZCUA 4UPGA 2I2RE 2KI6D 1YRTB 3IF7A 1Z2CB 2JU0A 4M2OA 3L4AA 2O60A 2M97A 3LCPC 1OZOA 3SG7A 4CIDA 2CCMA 3S0FA 1NX1A 1DF0B 1B9AA 2PMYA 4GGFC 3D75A 4HRGA 4PALA 3H4SE 2OS8B 4MVFA 2LUXA 1M31A 2KYFA 3S0BA 3VB1A 5K89A 2EC6C 2ZN8A 3OP0A 3CGAA 2LE9B 1KQMB 5I8NA 1NPQA 5DKQA 1SW8A 1ZFSA 3CR5X 3R1PA 1MXLC 2K2FA 4C0LA 1MR8A 1QWVA 3OGNA 1CB1A 2HQ8A 2WCHA 3BXKA 1JF2A 4IL1A 3S0GA 2QEBA 3R1VA 2V53A 1K8UA 2KBIA 1VRKA 1SYMA 3B7AA 3E3RA 3VRQA 5DICA 3DVJA 5I2QA 3KO0A 2P71A 1B7TZ 2LM5A 2L98A 3DYEA 4PCWA 5TNCA 4DIRA 2MLFC 4MRYA 2KPHA 1CM4A 2KFHA 1TUZA 1YUTA 2BCAA 2WNDA 1K9KA 2JRFA 2P6BB 2L50A 2RGIA 1T14A 2K7BA 2KAVA 2ISDA 2NXQA 5AFPA 3OB1B 4GPLB 3D73A 3IVTA 3FE8A 1CDLA 1KFUL 2KFGA 3K1EA 1F70A 4YGAA 2QEOA 1RECA 1XFZO 4INXA 1XFUO 1YX8A 1X02A 2COLB 2MRDA 3BUNB 3UNWA 5HKYA 1K94A 2BBNA 3O78A 5CSJA 1SBJA 1JBAA 1K2HA 1KCYA 1MWNA 2FJYA 3VRPA 3O6BA 2WCJA 4YGEB 5KSZA 1S6IA 2K7DA 2F3ZA 1J55A 2BL0B 2QACA 1PVBA 2YGUA 3D10A 4MLWA 1S3PA 4I5NB 3RLZA 1XK4A 2KGBC 4OKHA 1OMVA 2I18A 2K8MB 2LP3A 1DJZA 3R72A 2KI6C 2LMUA 3PATA 1UHHA 3O2PA 4GNKB 1OOJA 3EVUA 4PHKA 4YI8A 1IJ5A 2KBMA 3SG4A 1CKKA 4FQTA 2M7LA 5HLOA 2PALA 1ZUZA 3LLEA 1YTZC 1XA5A 3D0YA 1YR5A 3AAKA 5JOLA 3CZ1A 1NX2A 4HSZA 1QV1A 2LV7A 1SR6B 2FJUB 3DXLA 1NP8A 4PDZA 1BT6A 4YGDB 3F45A 2H8VA 4JWQA 4P5OE 2K7CA 3BFHA 2BE6A 1L2OC 1JFKA 1A29A 3CR4X 3DF0B 1M63B 3IQOA 1KFUS 1JSAA 3A8RA 1AJ5A 3CTNA 1U5IA 2D8NA 1QLKA 2M1UA 3GK4X 3BYAA 1BR1B 3MSEB 1D1OA 4CPVA 3CZ2A 1DJWA 2LVJA 1F4QA 4MZLA 1M45A 2M0RA 2BBMA 3V2LA 1DMOA 1LA0A 1DT7B 3BOWA 1Y0VH 3I5IB 1G8IA 2WC5A 3LK1A 5AXIA 1QJTA 1MUXA 5AEQA 2SASA 2E30A 1GGZA 2WC8A 1DELA 3Q8IA 1BF5A 2EGDA 1DGUA 2K60A 1WDCB 3I5HC 4MEWA 2PASA 4L9MA 3NGVA 2Y5IA 3NHIA 4HRHA 1S5GZ 2M1KB 5BPJA 1PSRA 1KK8B 1AHRA 2F3YA 1B47A 4GGFA 3B87A 3IQQA 4NQGA 2LHLA 2WCLA 2GGZA 3KHEA 2Y1NA 3B86A 1H4BA 2M9GA 1B8CA 4AQIA 2G9BA 2NLNA 1TUJA 2JT8A 5HKZA 4DRWA 1AJ4A 4C0JA 5I94A 2L2CA 1KSMA 1LXFC 2L4IA 2ZNDA 2KQ6A 3AAJA 1WY9A 1OMDA 2MLEC 3NSLA 5I2OA 1FPWA 3OHMB 1H8BA 2K0JA 3EVRA 1CNPA 2CNPA 3PM8A 1SRAA 2SCPA 1DJIA 3SS3A 4PHMA 1IIOA 1NIWA 5EL2A 3SS5A 2F2OA 1UHKA 2KDHA 4YGCB 3TUYB 1TNQA 2LUCA 4ICBA 4YI9A 1Y1AA 3EVVA 1CTRA 1GGWA 2JNXA 4HREE 1NYAA 1HT9A 1LINA 2JPOA 4PT1A 1AK8A 1JC2A 1NCZA 1CDPA 2BE4A 2GGMA 4BY5A 2NCOA 1W9ZA 2BCXA 1OZSA 1TNXA 1UP5A 1JUOA 2KAYA 1WLZA 3CDNA 4WQ3A 3BUOB 1RROA 1A03A 2F33A 3S0DA 5AERA 4OCIA 1BJFA 1RK9A 1SY9A 2Q91A 3HX4A 4Q04A 3JVTB 1CLMA 3HCMA 4JQ0D 5FI2A 3I5GC 3ICBA 4MN0A 1IQ3A 1BU3A 2KHNA 3BFBA 1M46A 1K93D 5FI6A 3QRXA 2ERBA 1TOPA 2I7AA 1J7PA 2GTEA 1PRWA 1QATA 1XFRA 3KF9A 2M7NA 2G2BA 1KWOB 2LANA 3BUWB 1S5GY 1SCVA 3FS7A 3L4LA 4JD9A 3WNXB 1R2UA 4AOMA 4U8DA 1DTLA 4E68A 3NSOA 2FOTA 2VRGA 2KAXA 4PE7A 1YUSA 2WOSA 2CBLA 1UHNA 3KPXA 1AVSA 4FQOA 3FE6A 1CM1A 1EL4A 2JZIA 1SL8A 2Y4QA 3SG5A 3D0YB 3TDIA 5AANA 3TS5B 1K95A 2L51A 3M0WA 1YURA 5CSNA 4N1GA 3I5IC 3VRNA 2NCPA 3NHTA 1ALVA 2ZRTA 1BMOA 1NWDA 1K96A 3SG6A 4PE1A 1DGVA 2F8PA 5D7FA 3S0AA 1DVIA 3JTDC 1OOFA 1NCXA 2R2IA 3I5FB 4XJKB 2OPOA 1DC1A 1CDNA 1KK8C 1QIVA 2AAOA 2HQWA 1IH0A 1BG1A 1TWOA 4INWA 1IGVA 2KYCA 1IJ6A 3FIAA 4ETOA 3DY9A 1WRZA 5PALA 1A75A 4A4CA 3NSIA 3BFAA 2KGRA 2JWWA 3FWCA 1IG5A 1EH2A 1J1DA 3CLNA 4PHNA 1DEKA 3D74A 4QJ3B 5CSFA 2MBXA 1QIWA 1RTP1 5HKWA 1C7VA 1OQPA 2PSRA 1KSOA 3GK2A 1BLQA 3CZTX 1Y1XA 3WXAA 1JFJA 2K2AA 1KQVA 2PRUA 1BR4B 1QTXA 1B8RA 1XYDA 1G33A 1SMGA 2JOJA 5KTYA 1ZMZA 1S26D 3EKHA 1TIZA 1KFXL 1UHIA 4TNCA 2E6WA 3CWGA 3EK4A 3WHUB 1KK7Y 2EC6B 1K90D 2WC6A 1CLLA 4DUQA 2TN4A 2OS8C 1LA3A 2BAPA 1ORGA 2KOTA 3TZ1A 2CTNA 2KI4B 1XFVO 2JC2A 4CFRA 3CS1A 2AMIA
chains in the Genus database with same CATH topology
1ZOTB 1KQMC 4C0KA 2L0PA 1XO5A 1FW4A 1NSHA 1L7ZA 1F4OA 1SK6D 2JT0A 1C7WA 1IWQA 1PSBA 1JF0A 1OMRA 5FYXA 1XFXO 1F71A 1UHJA 4D1EA 2LHIA 1UURA 3DD4A 1NX0A 2OTGB 2WORA 2BKIB 2HF5A 1YVHA 2LCPA 2LLTA 3C1VA 4WQ2A 1JWDA 2M8UA 1B8LA 1SCMB 3ZNIA 1N2DA 1MF8B 2PVBA 1A4PA 1J7QA 1MQ1A 1F55A 1ODBA 1YX7A 1AP4A 1IRJA 1UUSA 3PALA 1DJYA 4OV2A 2I94A 4GUKA 1J1EA 2LMVA 4NDDA 1KFXS 1CLBA 2O5GA 4F0ZB 4PE0A 1RJVA 4GFTA 1TRFA 1YUUA 3SG2A 2HPSA 1MHOA 2DOQA 1SPYA 1TNPA 1RWYA 2JXLA 1QXPA 2MHHA 1QASA 1MXEA 1PULA 3DF0A 3SG3A 2L4HA 3I5FC 2MJWB 3DVEA 3O4YA 2BL0C 1SNLA 1NX3A 1LVCD 2B1UA 2JTTA 2ZFDA 3KEVA 1FBVA 5JJGA 1TCFA 4N5XA 4ORAB 2ZRSA 4YBHB 1DJHA 2LMTA 1QVIY 1EJ3A 1EG4A 2KQYA 2LVKA 2H61A 4MSPA 1SKTA 3SIBA 5HYDA 1A2XA 1L2OB 4MZKA 1S36A 1RFJA 2MA2A 1SR6C 2IS9A 1TN4A 5CPVA 5J3XA 2A4JA 3NXAA 1FF1A 1F8HA 1KK7Z 1FI5A 3EKJA 1PVAA 1QX5B 4MRXA 1A75B 3FWBA 4A4BA 1OSAA 1XVJA 3PN7B 2BKHB 1GQMA 3DVKA 4QJ4B 4OR9B 3VGOA 2KI4C 1WRKA 4R1EA 2HETA 3ZWHA 1K9UA 3RM1A 1YRUB 1NUBA 1Q80A 2BCBA 4I5KA 3I5HB 2JNFA 2K61A 4ORBB 3BQ3A 4OVNF 2H61C 2AUCA 4GGNA 5DKNA 3PSRA 5IBWA 1WDCC 5ER4X 2JT3A 2KFFA 4PHJA 2LVVA 4YRUA 2OTGC 4JPZB 1DF0A 1U5IB 3SJSA 1QX7A 2LNKA 2LVIA 1F54A 1ZACA 2LC5A 1SCMC 2NZ0A 3BUXB 2M3WA 3CR2A 1S6JA 3BOWB 5KU1A 4ORCB 1XFYO 1CFFA 1DJXA 2CXJA 4I5LB 5GQQC 3LL8B 1OE9B 1Y1UA 2CT9A 3BUMB 1AUIB 3OX5A 2MAZA 1BOCA 1V1FA 1TCOB 1K9PA 2K7OA 4I5JA 4PE4A 1CDMA 2F2PA 5CSIA 1PALA 1S1EA 1V1GA 2L2EA 3TUYC 4DCKA 1J7OA 4NDCA 5G08A 4ZCVA 3TDZA 1W7JB 3GK1A 4GAOA 2FCDA 3EK7A 3AKAA 1EG3A 1R6PA 1LKJA 4FTGA 4BY4A 3NSKA 3VRRA 4YGBB 2EHBA 3OX6A 2KSPA 2LP2A 1GJYA 3OB2B 2ZNEA 4P2YB 2FCEA 1B4CA 2L5XB 2Y1MA 3I5GB 1TTXA 1UWOA 3SIAA 1PK0D 5D69A 3GOFA 2LAPA 1QLSA 3DVMA 1QVIZ 1CFPA 1E8AA 1EXRA 3JVTC 4XYNA 1ALWA 3LK0A 4DS7A 1QV0A 4USLA 3WHTB 1B7TY 1M39A 3EK8A 1IKUA 1CMFA 2QPTA 3A4UB 1KWOC 4MBEA 4XJKA 3PLFB 2WCFA 2WCBA 1TNWA 2JULA 1XK4C 2ZN9A 3AKBA 1S6CA 1C07A 4QJ5B 1NCYA 2LLUA 2LLSA 3PN7C 5F6TA 3TDUA 1N65A 1J7RA 1SL7A 1HQVA 2M29A 1CMGA 2Q4UA 3TS5C 5B8IB 1CFDA 2H2KA 1CFCA 2BECA 4MZJA 3JTDB 1DJGA 1QX2A 4M2QA 1XFWO 1N0YA 4GBAA 2WCEA 1WRLA 1Y6WA 2JTZA 4M2PA 4AQJA 1YVLA 2KNEA 1WLMA 5HLVA 2JPTA 1QS7A 3K21A 1BODA 1G4YR 1B1GA 1SL9A 4NDBA 4N1FA 4WRIA 3VROA 5I2LA 5DKRA 3PFVA 2GV5A 2JXCA 4CLNA 1IQ5A 5ER5A 4CFQA 2ZKMX 1FI6A 2JQ6A 2M49B 1W7IB 4ZCUA 4UPGA 2I2RE 2KI6D 1YRTB 3IF7A 2JU0A 4M2OA 2O60A 2M97A 3LCPC 1OZOA 3SG7A 4CIDA 2CCMA 1NX1A 1DF0B 1B9AA 2PMYA 4GGFC 4PALA 4HRGA 3H4SE 2OS8B 4MVFA 2LUXA 1M31A 2KYFA 5K89A 2EC6C 2ZN8A 3OP0A 3CGAA 2LE9B 1KQMB 5I8NA 1NPQA 5DKQA 1SW8A 1ZFSA 3CR5X 1MXLC 2K2FA 4C0LA 1MR8A 1CB1A 2HQ8A 3BXKA 1JF2A 4IL1A 2V53A 1K8UA 2KBIA 1VRKA 1SYMA 3E3RA 3VRQA 3DVJA 5I2QA 3KO0A 1B7TZ 2LM5A 2L98A 4PCWA 5TNCA 4DIRA 2MLFC 4MRYA 1CM4A 2KFHA 1YUTA 2BCAA 2WNDA 1K9KA 2JRFA 2P6BB 2L50A 2RGIA 2ISDA 2K7BA 2KAVA 2NXQA 5AFPA 3OB1B 4GPLB 1CDLA 1KFUL 2KFGA 1F70A 4YGAA 1RECA 1XFZO 1XFUO 1YX8A 1X02A 2COLB 2MRDA 3BUNB 5HKYA 1K94A 2BBNA 3O78A 5CSJA 1SBJA 1JBAA 1K2HA 1KCYA 1MWNA 3VRPA 3O6BA 4YGEB 5KSZA 1S6IA 2K7DA 2F3ZA 1J55A 2BL0B 2QACA 1PVBA 3D10A 4MLWA 1S3PA 4I5NB 3RLZA 1XK4A 2KGBC 4OKHA 1OMVA 2I18A 2K8MB 2LP3A 1DJZA 2KI6C 2LMUA 3PATA 1UHHA 3O2PA 4GNKB 1OOJA 3EVUA 4PHKA 4YI8A 1IJ5A 2KBMA 3SG4A 1CKKA 2M7LA 5HLOA 2PALA 1ZUZA 3LLEA 1YTZC 1XA5A 3D0YA 1YR5A 3AAKA 5JOLA 1NX2A 4HSZA 1QV1A 2LV7A 1SR6B 2FJUB 4PDZA 1NP8A 4YGDB 1BT6A 3F45A 4JWQA 4P5OE 2K7CA 2BE6A 1L2OC 1JFKA 1A29A 3CR4X 3DF0B 1M63B 3IQOA 1KFUS 1JSAA 3A8RA 1AJ5A 3CTNA 1U5IA 2D8NA 1QLKA 2M1UA 3GK4X 3BYAA 1BR1B 3MSEB 1D1OA 4CPVA 1DJWA 2LVJA 1F4QA 4MZLA 1M45A 2M0RA 2BBMA 1DMOA 1LA0A 1DT7B 3BOWA 1Y0VH 3I5IB 1G8IA 3LK1A 5AXIA 1QJTA 1MUXA 5AEQA 2SASA 2E30A 1GGZA 2WC8A 1BF5A 2EGDA 1DGUA 1WDCB 3I5HC 4MEWA 2PASA 4L9MA 2Y5IA 4HRHA 1S5GZ 2M1KB 5BPJA 1PSRA 1KK8B 1AHRA 2F3YA 1B47A 4GGFA 3IQQA 4NQGA 2LHLA 2GGZA 3KHEA 2Y1NA 1H4BA 2M9GA 1B8CA 4AQIA 2G9BA 2NLNA 2JT8A 5HKZA 4DRWA 1AJ4A 4C0JA 1KSMA 1LXFC 2L4IA 2ZNDA 2KQ6A 3AAJA 1WY9A 1OMDA 2MLEC 3NSLA 5I2OA 1FPWA 3OHMB 1H8BA 2K0JA 3EVRA 1CNPA 2CNPA 3PM8A 1SRAA 2SCPA 1DJIA 4PHMA 1NIWA 2F2OA 1UHKA 2KDHA 4YGCB 3TUYB 1TNQA 2LUCA 4ICBA 4YI9A 1Y1AA 3EVVA 1CTRA 1GGWA 2JNXA 4HREE 1NYAA 1HT9A 1LINA 1AK8A 1JC2A 1NCZA 1CDPA 2BE4A 2GGMA 4BY5A 2NCOA 2BCXA 1OZSA 1TNXA 1UP5A 1JUOA 2KAYA 1WLZA 4WQ3A 3BUOB 1RROA 1A03A 2F33A 5AERA 4OCIA 1BJFA 1RK9A 1SY9A 2Q91A 3HX4A 4Q04A 3JVTB 1CLMA 3HCMA 4JQ0D 3I5GC 3ICBA 4MN0A 1IQ3A 1BU3A 2KHNA 1M46A 1K93D 3QRXA 1TOPA 2I7AA 1J7PA 1PRWA 1QATA 3KF9A 2M7NA 2G2BA 1KWOB 2LANA 3BUWB 1S5GY 1SCVA 3FS7A 3WNXB 4AOMA 1R2UA 4U8DA 1DTLA 4E68A 3NSOA 2FOTA 2VRGA 2KAXA 4PE7A 1YUSA 2WOSA 2CBLA 1UHNA 3KPXA 1AVSA 4FQOA 1CM1A 1EL4A 2JZIA 1SL8A 2Y4QA 3SG5A 3D0YB 3TDIA 5AANA 3TS5B 1K95A 2L51A 3M0WA 1YURA 5CSNA 4N1GA 3I5IC 3VRNA 2NCPA 1ALVA 2ZRTA 1BMOA 1NWDA 1K96A 3SG6A 4PE1A 1DGVA 2F8PA 5D7FA 1DVIA 3JTDC 1NCXA 2R2IA 3I5FB 4XJKB 2OPOA 1CDNA 1KK8C 1QIVA 2AAOA 2HQWA 1IH0A 1BG1A 1IGVA 2KYCA 1IJ6A 3FIAA 4ETOA 1WRZA 5PALA 1A75A 4A4CA 3NSIA 2KGRA 2JWWA 3FWCA 1IG5A 1EH2A 1J1DA 3CLNA 4PHNA 4QJ3B 5CSFA 2MBXA 1QIWA 1RTP1 5HKWA 1C7VA 1OQPA 2PSRA 1KSOA 3GK2A 1BLQA 3CZTX 1Y1XA 3WXAA 1JFJA 2K2AA 1KQVA 2PRUA 1BR4B 1QTXA 1B8RA 1XYDA 1G33A 1SMGA 2JOJA 5KTYA 1ZMZA 1S26D 3EKHA 1TIZA 1KFXL 1UHIA 4TNCA 2E6WA 3CWGA 3EK4A 3WHUB 1KK7Y 2EC6B 1K90D 1CLLA 4DUQA 2TN4A 2OS8C 1LA3A 2KOTA 3TZ1A 2CTNA 2KI4B 1XFVO 2JC2A 4CFRA 3CS1A 2AMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOT B;  1KQM C;  4C0K A;  2L0P A;  1XO5 A;  1FW4 A;  1NSH A;  1L7Z A;  1F4O A;  1SK6 D;  2JT0 A;  1C7W A;  1IWQ A;  1PSB A;  1JF0 A;  1OMR A;  5FYX A;  1XFX O;  1F71 A;  1UHJ A;  4D1E A;  2LHI A;  1UUR A;  3DD4 A;  1NX0 A;  2OTG B;  2WOR A;  2BKI B;  2HF5 A;  1YVH A;  2LCP A;  2LLT A;  3C1V A;  4WQ2 A;  1JWD A;  2M8U A;  1B8L A;  1SCM B;  3ZNI A;  1N2D A;  1MF8 B;  2PVB A;  1A4P A;  1J7Q A;  1MQ1 A;  1F55 A;  1ODB A;  1YX7 A;  1AP4 A;  1IRJ A;  1UUS A;  3PAL A;  1DJY A;  4OV2 A;  2I94 A;  4GUK A;  1J1E A;  2LMV A;  4NDD A;  1KFX S;  1CLB A;  2O5G A;  4F0Z B;  4PE0 A;  1RJV A;  4GFT A;  1TRF A;  1YUU A;  3SG2 A;  2HPS A;  1MHO A;  2DOQ A;  1SPY A;  1TNP A;  1RWY A;  2JXL A;  1QXP A;  2MHH A;  1QAS A;  1MXE A;  1PUL A;  3DF0 A;  3SG3 A;  2L4H A;  3I5F C;  2MJW B;  3DVE A;  3O4Y A;  2BL0 C;  1SNL A;  1NX3 A;  1LVC D;  2B1U A;  2JTT A;  2ZFD A;  3KEV A;  1FBV A;  5JJG A;  1TCF A;  4N5X A;  4ORA B;  2ZRS A;  4YBH B;  1DJH A;  2LMT A;  1QVI Y;  1EJ3 A;  1EG4 A;  2KQY A;  2LVK A;  2H61 A;  4MSP A;  1SKT A;  3SIB A;  5HYD A;  1A2X A;  1L2O B;  4MZK A;  1S36 A;  1RFJ A;  2MA2 A;  1SR6 C;  2IS9 A;  1TN4 A;  5CPV A;  5J3X A;  2A4J A;  3NXA A;  1FF1 A;  1F8H A;  1KK7 Z;  1FI5 A;  3EKJ A;  1PVA A;  1QX5 B;  4MRX A;  1A75 B;  3FWB A;  4A4B A;  1OSA A;  1XVJ A;  3PN7 B;  2BKH B;  1GQM A;  3DVK A;  4QJ4 B;  4OR9 B;  3VGO A;  2KI4 C;  1WRK A;  4R1E A;  2HET A;  3ZWH A;  1K9U A;  3RM1 A;  1YRU B;  1NUB A;  1Q80 A;  2BCB A;  4I5K A;  3I5H B;  2JNF A;  2K61 A;  4ORB B;  3BQ3 A;  4OVN F;  2H61 C;  2AUC A;  4GGN A;  5DKN A;  3PSR A;  5IBW A;  1WDC C;  5ER4 X;  2JT3 A;  2KFF A;  4PHJ A;  2LVV A;  4YRU A;  2OTG C;  4JPZ B;  1DF0 A;  1U5I B;  3SJS A;  1QX7 A;  2LNK A;  2LVI A;  1F54 A;  1ZAC A;  2LC5 A;  1SCM C;  2NZ0 A;  3BUX B;  2M3W A;  3CR2 A;  1S6J A;  3BOW B;  5KU1 A;  4ORC B;  1XFY O;  1CFF A;  1DJX A;  2CXJ A;  4I5L B;  5GQQ C;  3LL8 B;  1OE9 B;  1Y1U A;  2CT9 A;  3BUM B;  1AUI B;  3OX5 A;  2MAZ A;  1BOC A;  1V1F A;  1TCO B;  1K9P A;  2K7O A;  4I5J A;  4PE4 A;  1CDM A;  2F2P A;  5CSI A;  1PAL A;  1S1E A;  1V1G A;  2L2E A;  3TUY C;  4DCK A;  1J7O A;  4NDC A;  5G08 A;  4ZCV A;  3TDZ A;  1W7J B;  3GK1 A;  4GAO A;  2FCD A;  3EK7 A;  3AKA A;  1EG3 A;  1R6P A;  1LKJ A;  4FTG A;  4BY4 A;  3NSK A;  3VRR A;  4YGB B;  2EHB A;  3OX6 A;  2KSP A;  2LP2 A;  1GJY A;  3OB2 B;  2ZNE A;  4P2Y B;  2FCE A;  1B4C A;  2L5X B;  2Y1M A;  3I5G B;  1TTX A;  1UWO A;  3SIA A;  1PK0 D;  5D69 A;  3GOF A;  2LAP A;  1QLS A;  3DVM A;  1QVI Z;  1CFP A;  1E8A A;  1EXR A;  3JVT C;  4XYN A;  1ALW A;  3LK0 A;  4DS7 A;  1QV0 A;  4USL A;  3WHT B;  1B7T Y;  1M39 A;  3EK8 A;  1IKU A;  1CMF A;  2QPT A;  3A4U B;  1KWO C;  4MBE A;  4XJK A;  3PLF B;  2WCF A;  2WCB A;  1TNW A;  2JUL A;  1XK4 C;  2ZN9 A;  3AKB A;  1S6C A;  1C07 A;  4QJ5 B;  1NCY A;  2LLU A;  2LLS A;  3PN7 C;  5F6T A;  3TDU A;  1N65 A;  1J7R A;  1SL7 A;  1HQV A;  2M29 A;  1CMG A;  2Q4U A;  3TS5 C;  5B8I B;  1CFD A;  2H2K A;  1CFC A;  2BEC A;  4MZJ A;  3JTD B;  1DJG A;  1QX2 A;  4M2Q A;  1XFW O;  1N0Y A;  4GBA A;  2WCE A;  1WRL A;  1Y6W A;  2JTZ A;  4M2P A;  4AQJ A;  1YVL A;  2KNE A;  1WLM A;  5HLV A;  2JPT A;  1QS7 A;  3K21 A;  1BOD A;  1G4Y R;  1B1G A;  1SL9 A;  4NDB A;  4N1F A;  4WRI A;  3VRO A;  5I2L A;  5DKR A;  3PFV A;  2GV5 A;  2JXC A;  4CLN A;  1IQ5 A;  5ER5 A;  4CFQ A;  2ZKM X;  1FI6 A;  2JQ6 A;  2M49 B;  1W7I B;  4ZCU A;  4UPG A;  2I2R E;  2KI6 D;  1YRT B;  3IF7 A;  2JU0 A;  4M2O A;  2O60 A;  2M97 A;  3LCP C;  1OZO A;  3SG7 A;  4CID A;  2CCM A;  1NX1 A;  1DF0 B;  1B9A A;  2PMY A;  4GGF C;  4PAL A;  4HRG A;  3H4S E;  2OS8 B;  4MVF A;  2LUX A;  1M31 A;  2KYF A;  5K89 A;  2EC6 C;  2ZN8 A;  3OP0 A;  3CGA A;  2LE9 B;  1KQM B;  5I8N A;  1NPQ A;  5DKQ A;  1SW8 A;  1ZFS A;  3CR5 X;  1MXL C;  2K2F A;  4C0L A;  1MR8 A;  1CB1 A;  2HQ8 A;  3BXK A;  1JF2 A;  4IL1 A;  2V53 A;  1K8U A;  2KBI A;  1VRK A;  1SYM A;  3E3R A;  3VRQ A;  3DVJ A;  5I2Q A;  3KO0 A;  1B7T Z;  2LM5 A;  2L98 A;  4PCW A;  5TNC A;  4DIR A;  2MLF C;  4MRY A;  1CM4 A;  2KFH A;  1YUT A;  2BCA A;  2WND A;  1K9K A;  2JRF A;  2P6B B;  2L50 A;  2RGI A;  2ISD A;  2K7B A;  2KAV A;  2NXQ A;  5AFP A;  3OB1 B;  4GPL B;  1CDL A;  1KFU L;  2KFG A;  1F70 A;  4YGA A;  1REC A;  1XFZ O;  1XFU O;  1YX8 A;  1X02 A;  2COL B;  2MRD A;  3BUN B;  5HKY A;  1K94 A;  2BBN A;  3O78 A;  5CSJ A;  1SBJ A;  1JBA A;  1K2H A;  1KCY A;  1MWN A;  3VRP A;  3O6B A;  4YGE B;  5KSZ A;  1S6I A;  2K7D A;  2F3Z A;  1J55 A;  2BL0 B;  2QAC A;  1PVB A;  3D10 A;  4MLW A;  1S3P A;  4I5N B;  3RLZ A;  1XK4 A;  2KGB C;  4OKH A;  1OMV A;  2I18 A;  2K8M B;  2LP3 A;  1DJZ A;  2KI6 C;  2LMU A;  3PAT A;  1UHH A;  3O2P A;  4GNK B;  1OOJ A;  3EVU A;  4PHK A;  4YI8 A;  1IJ5 A;  2KBM A;  3SG4 A;  1CKK A;  2M7L A;  5HLO A;  2PAL A;  1ZUZ A;  3LLE A;  1YTZ C;  1XA5 A;  3D0Y A;  1YR5 A;  3AAK A;  5JOL A;  1NX2 A;  4HSZ A;  1QV1 A;  2LV7 A;  1SR6 B;  2FJU B;  4PDZ A;  1NP8 A;  4YGD B;  1BT6 A;  3F45 A;  4JWQ A;  4P5O E;  2K7C A;  2BE6 A;  1L2O C;  1JFK A;  1A29 A;  3CR4 X;  3DF0 B;  1M63 B;  3IQO A;  1KFU S;  1JSA A;  3A8R A;  1AJ5 A;  3CTN A;  1U5I A;  2D8N A;  1QLK A;  2M1U A;  3GK4 X;  3BYA A;  1BR1 B;  3MSE B;  1D1O A;  4CPV A;  1DJW A;  2LVJ A;  1F4Q A;  4MZL A;  1M45 A;  2M0R A;  2BBM A;  1DMO A;  1LA0 A;  1DT7 B;  3BOW A;  1Y0V H;  3I5I B;  1G8I A;  3LK1 A;  5AXI A;  1QJT A;  1MUX A;  5AEQ A;  2SAS A;  2E30 A;  1GGZ A;  2WC8 A;  1BF5 A;  2EGD A;  1DGU A;  1WDC B;  3I5H C;  4MEW A;  2PAS A;  4L9M A;  2Y5I A;  4HRH A;  1S5G Z;  2M1K B;  5BPJ A;  1PSR A;  1KK8 B;  1AHR A;  2F3Y A;  1B47 A;  4GGF A;  3IQQ A;  4NQG A;  2LHL A;  2GGZ A;  3KHE A;  2Y1N A;  1H4B A;  2M9G A;  1B8C A;  4AQI A;  2G9B A;  2NLN A;  2JT8 A;  5HKZ A;  4DRW A;  1AJ4 A;  4C0J A;  1KSM A;  1LXF C;  2L4I A;  2ZND A;  2KQ6 A;  3AAJ A;  1WY9 A;  1OMD A;  2MLE C;  3NSL A;  5I2O A;  1FPW A;  3OHM B;  1H8B A;  2K0J A;  3EVR A;  1CNP A;  2CNP A;  3PM8 A;  1SRA A;  2SCP A;  1DJI A;  4PHM A;  1NIW A;  2F2O A;  1UHK A;  2KDH A;  4YGC B;  3TUY B;  1TNQ A;  2LUC A;  4ICB A;  4YI9 A;  1Y1A A;  3EVV A;  1CTR A;  1GGW A;  2JNX A;  4HRE E;  1NYA A;  1HT9 A;  1LIN A;  1AK8 A;  1JC2 A;  1NCZ A;  1CDP A;  2BE4 A;  2GGM A;  4BY5 A;  2NCO A;  2BCX A;  1OZS A;  1TNX A;  1UP5 A;  1JUO A;  2KAY A;  1WLZ A;  4WQ3 A;  3BUO B;  1RRO A;  1A03 A;  2F33 A;  5AER A;  4OCI A;  1BJF A;  1RK9 A;  1SY9 A;  2Q91 A;  3HX4 A;  4Q04 A;  3JVT B;  1CLM A;  3HCM A;  4JQ0 D;  3I5G C;  3ICB A;  4MN0 A;  1IQ3 A;  1BU3 A;  2KHN A;  1M46 A;  1K93 D;  3QRX A;  1TOP A;  2I7A A;  1J7P A;  1PRW A;  1QAT A;  3KF9 A;  2M7N A;  2G2B A;  1KWO B;  2LAN A;  3BUW B;  1S5G Y;  1SCV A;  3FS7 A;  3WNX B;  4AOM A;  1R2U A;  4U8D A;  1DTL A;  4E68 A;  3NSO A;  2FOT A;  2VRG A;  2KAX A;  4PE7 A;  1YUS A;  2WOS A;  2CBL A;  1UHN A;  3KPX A;  1AVS A;  4FQO A;  1CM1 A;  1EL4 A;  2JZI A;  1SL8 A;  2Y4Q A;  3SG5 A;  3D0Y B;  3TDI A;  5AAN A;  3TS5 B;  1K95 A;  2L51 A;  3M0W A;  1YUR A;  5CSN A;  4N1G A;  3I5I C;  3VRN A;  2NCP A;  1ALV A;  2ZRT A;  1BMO A;  1NWD A;  1K96 A;  3SG6 A;  4PE1 A;  1DGV A;  2F8P A;  5D7F A;  1DVI A;  3JTD C;  1NCX A;  2R2I A;  3I5F B;  4XJK B;  2OPO A;  1CDN A;  1KK8 C;  1QIV A;  2AAO A;  2HQW A;  1IH0 A;  1BG1 A;  1IGV A;  2KYC A;  1IJ6 A;  3FIA A;  4ETO A;  1WRZ A;  5PAL A;  1A75 A;  4A4C A;  3NSI A;  2KGR A;  2JWW A;  3FWC A;  1IG5 A;  1EH2 A;  1J1D A;  3CLN A;  4PHN A;  4QJ3 B;  5CSF A;  2MBX A;  1QIW A;  1RTP 1;  5HKW A;  1C7V A;  1OQP A;  2PSR A;  1KSO A;  3GK2 A;  1BLQ A;  3CZT X;  1Y1X A;  3WXA A;  1JFJ A;  2K2A A;  1KQV A;  2PRU A;  1BR4 B;  1QTX A;  1B8R A;  1XYD A;  1G33 A;  1SMG A;  2JOJ A;  5KTY A;  1ZMZ A;  1S26 D;  3EKH A;  1TIZ A;  1KFX L;  1UHI A;  4TNC A;  2E6W A;  3CWG A;  3EK4 A;  3WHU B;  1KK7 Y;  2EC6 B;  1K90 D;  1CLL A;  4DUQ A;  2TN4 A;  2OS8 C;  1LA3 A;  2KOT A;  3TZ1 A;  2CTN A;  2KI4 B;  1XFV O;  2JC2 A;  4CFR A;  3CS1 A;  2AMI A; 
#chains in the Genus database with same CATH topology
 1ZOT B;  1KQM C;  4C0K A;  1C3Y A;  2L0P A;  1Z4H A;  1XO5 A;  1FW4 A;  1NSH A;  1L7Z A;  1F4O A;  1SK6 D;  2JT0 A;  4OZD A;  1C7W A;  1IWQ A;  1PSB A;  1JF0 A;  1OMR A;  2KLE A;  5FYX A;  1XFX O;  1F71 A;  1UHJ A;  4D1E A;  2LHI A;  1UUR A;  3DD4 A;  1NX0 A;  2OTG B;  2WOR A;  2BKI B;  2HF5 A;  1YVH A;  2LCP A;  2LLT A;  3C1V A;  4WQ2 A;  1JWD A;  2M8U A;  1B8L A;  1SCM B;  3ZNI A;  1N2D A;  1MF8 B;  2PVB A;  1A4P A;  2QEH A;  1J7Q A;  1MQ1 A;  3CYZ A;  1F55 A;  1ODB A;  1YX7 A;  1AP4 A;  1IRJ A;  1UUS A;  3PAL A;  1DJY A;  4OV2 A;  2I94 A;  4GUK A;  1J1E A;  2LMV A;  4NDD A;  1KFX S;  1CLB A;  5HL1 A;  3EG5 B;  2O5G A;  4F0Z B;  4PE0 A;  1RJV A;  4GFT A;  1TRF A;  1YUU A;  3SG2 A;  2HPS A;  1MHO A;  2DOQ A;  1SPY A;  1TNP A;  1RWY A;  3SS4 A;  2JXL A;  1QXP A;  2MHH A;  1QAS A;  1MXE A;  1PUL A;  3DF0 A;  3SG3 A;  2L4H A;  3I5F C;  2MJW B;  3DVE A;  3O4Y A;  2BL0 C;  1GM0 A;  1SNL A;  1NX3 A;  1LVC D;  2B1U A;  2JTT A;  3B6X A;  3DZT A;  2ZFD A;  3KEV A;  1FBV A;  5JJG A;  1TCF A;  4N5X A;  4ORA B;  2PYQ A;  2ZRS A;  3CZ0 A;  4YBH B;  1DJH A;  1LS8 A;  1QVI Y;  1EJ3 A;  1EG4 A;  2KQY A;  2LMT A;  2H61 A;  2LVK A;  1SKT A;  4IJ7 A;  4MSP A;  3SIB A;  5HYD A;  1A2X A;  3UO9 A;  1L2O B;  4MZK A;  1S36 A;  1RFJ A;  2MA2 A;  1SR6 C;  2IS9 A;  1TN4 A;  3FE9 A;  5CPV A;  5J3X A;  2A4J A;  3BJH A;  3NXA A;  1FF1 A;  1F8H A;  5FI7 A;  1KK7 Z;  1FI5 A;  3EKJ A;  1PVA A;  1QX5 B;  4MRX A;  1A75 B;  3FWB A;  4A4B A;  1C3Z A;  1OSA A;  1XVJ A;  3PN7 B;  2BKH B;  1GQM A;  3DVK A;  4QJ4 B;  4OR9 B;  3VGO A;  2KI4 C;  1WRK A;  4R1E A;  3OBV A;  2HET A;  3ZWH A;  1K9U A;  3RM1 A;  1YRU B;  1OOG A;  1NUB A;  1Q80 A;  2BCB A;  4I5K A;  3I5H B;  2JNF A;  2K61 A;  4ORB B;  3BQ3 A;  4OVN F;  3O4X A;  2H61 C;  3PJI A;  2AUC A;  4KYN A;  4GGN A;  5DKN A;  3PSR A;  5IBW A;  1WDC C;  5ER4 X;  2JT3 A;  3N7H A;  2KFF A;  4PHJ A;  2LVV A;  4YRU A;  2OTG C;  4JPZ B;  1DF0 A;  1U5I B;  3SJS A;  1QX7 A;  2LNK A;  2LVI A;  1F54 A;  1ZAC A;  2LC5 A;  1SCM C;  2QDI A;  2NZ0 A;  3BUX B;  2M3W A;  3CR2 A;  1S6J A;  3BOW B;  2KLD A;  5KU1 A;  4ORC B;  1XFY O;  1CFF A;  1DJX A;  2CXJ A;  4I5L B;  5GQQ C;  3LL8 B;  1OE9 B;  1Y1U A;  2CT9 A;  3BUM B;  1AUI B;  3OX5 A;  2MAZ A;  1BOC A;  1V1F A;  2QEV A;  1TCO B;  1K9P A;  2K7O A;  4I5J A;  4PE4 A;  1CDM A;  2F2P A;  1DQE A;  5CSI A;  1PAL A;  1S1E A;  1V1G A;  2L2E A;  3TUY C;  4DCK A;  1J7O A;  4NDC A;  5G08 A;  4ZCV A;  1OW4 A;  3TDZ A;  1W7J B;  2L5Y A;  3GK1 A;  4GAO A;  2FCD A;  3EK7 A;  3AKA A;  1EG3 A;  1R6P A;  1LKJ A;  4FTG A;  4BY4 A;  3NSK A;  3VRR A;  4YGB B;  3PM2 A;  2EHB A;  3OX6 A;  2KSP A;  2LP2 A;  1GJY A;  3OB2 B;  2ZNE A;  3S0E A;  2PQL A;  4P2Y B;  2FCE A;  1B4C A;  2L5X B;  2Y1M A;  3I5G B;  3L47 A;  1TTX A;  1UWO A;  3SIA A;  1PK0 D;  5D69 A;  2WCM A;  3GOF A;  2LAP A;  1QLS A;  3DVM A;  1QVI Z;  1CFP A;  1E8A A;  1EXR A;  2P70 A;  3JVT C;  4XYN A;  5D3O A;  1ALW A;  3LK0 A;  4DS7 A;  1QV0 A;  4USL A;  3WHT B;  1B7T Y;  1M39 A;  2BNX A;  3CAB A;  3EK8 A;  1IKU A;  1CMF A;  2QPT A;  3A4U B;  1KWO C;  3R1O A;  4MBE A;  4XJK A;  3PLF B;  2WCF A;  2WCB A;  1TNW A;  2JUL A;  1XK4 C;  2ZN9 A;  3AKB A;  1S6C A;  1C07 A;  4QJ5 B;  1OOI X;  1NCY A;  2LLU A;  2LLS A;  3PN7 C;  5F6T A;  3TDU A;  1N65 A;  1J7R A;  1SL7 A;  3B88 A;  1HQV A;  2M29 A;  3D76 A;  1CMG A;  2Q4U A;  3TS5 C;  5B8I B;  1CFD A;  1SSE B;  2H2K A;  1CFC A;  2BEC A;  4MZJ A;  3JTD B;  4F7F A;  1DJG A;  1QX2 A;  4M2Q A;  1XFW O;  1N0Y A;  4GBA A;  2WCE A;  1WRL A;  1OOH A;  1Y6W A;  2JTZ A;  3RZS A;  4M2P A;  4AQJ A;  1YVL A;  4JKT A;  2KNE A;  1WLM A;  5HLV A;  2JPT A;  1QS7 A;  3D77 A;  3K21 A;  1G4Y R;  1BOD A;  1B1G A;  1SL9 A;  4NDB A;  4N1F A;  4WRI A;  3VRO A;  5I2L A;  5DKR A;  3PFV A;  3QME A;  2GV5 A;  2JXC A;  4CLN A;  1IQ5 A;  1P28 A;  3D78 A;  5ER5 A;  4CFQ A;  2ZKM X;  1FI6 A;  2JQ6 A;  2M49 B;  1W7I B;  2WCK A;  4ZCU A;  4UPG A;  2I2R E;  2KI6 D;  1YRT B;  3IF7 A;  1Z2C B;  2JU0 A;  4M2O A;  3L4A A;  2O60 A;  2M97 A;  3LCP C;  1OZO A;  3SG7 A;  4CID A;  2CCM A;  3S0F A;  1NX1 A;  1DF0 B;  1B9A A;  2PMY A;  4GGF C;  3D75 A;  4HRG A;  4PAL A;  3H4S E;  2OS8 B;  4MVF A;  2LUX A;  1M31 A;  2KYF A;  3S0B A;  3VB1 A;  5K89 A;  2EC6 C;  2ZN8 A;  3OP0 A;  3CGA A;  2LE9 B;  1KQM B;  5I8N A;  1NPQ A;  5DKQ A;  1SW8 A;  1ZFS A;  3CR5 X;  3R1P A;  1MXL C;  2K2F A;  4C0L A;  1MR8 A;  1QWV A;  3OGN A;  1CB1 A;  2HQ8 A;  2WCH A;  3BXK A;  1JF2 A;  4IL1 A;  3S0G A;  2QEB A;  3R1V A;  2V53 A;  1K8U A;  2KBI A;  1VRK A;  1SYM A;  3B7A A;  3E3R A;  3VRQ A;  5DIC A;  3DVJ A;  5I2Q A;  3KO0 A;  2P71 A;  1B7T Z;  2LM5 A;  2L98 A;  3DYE A;  4PCW A;  5TNC A;  4DIR A;  2MLF C;  4MRY A;  2KPH A;  1CM4 A;  2KFH A;  1TUZ A;  1YUT A;  2BCA A;  2WND A;  1K9K A;  2JRF A;  2P6B B;  2L50 A;  2RGI A;  1T14 A;  2K7B A;  2KAV A;  2ISD A;  2NXQ A;  5AFP A;  3OB1 B;  4GPL B;  3D73 A;  3IVT A;  3FE8 A;  1CDL A;  1KFU L;  2KFG A;  3K1E A;  1F70 A;  4YGA A;  2QEO A;  1REC A;  1XFZ O;  4INX A;  1XFU O;  1YX8 A;  1X02 A;  2COL B;  2MRD A;  3BUN B;  3UNW A;  5HKY A;  1K94 A;  2BBN A;  3O78 A;  5CSJ A;  1SBJ A;  1JBA A;  1K2H A;  1KCY A;  1MWN A;  2FJY A;  3VRP A;  3O6B A;  2WCJ A;  4YGE B;  5KSZ A;  1S6I A;  2K7D A;  2F3Z A;  1J55 A;  2BL0 B;  2QAC A;  1PVB A;  2YGU A;  3D10 A;  4MLW A;  1S3P A;  4I5N B;  3RLZ A;  1XK4 A;  2KGB C;  4OKH A;  1OMV A;  2I18 A;  2K8M B;  2LP3 A;  1DJZ A;  3R72 A;  2KI6 C;  2LMU A;  3PAT A;  1UHH A;  3O2P A;  4GNK B;  1OOJ A;  3EVU A;  4PHK A;  4YI8 A;  1IJ5 A;  2KBM A;  3SG4 A;  1CKK A;  4FQT A;  2M7L A;  5HLO A;  2PAL A;  1ZUZ A;  3LLE A;  1YTZ C;  1XA5 A;  3D0Y A;  1YR5 A;  3AAK A;  5JOL A;  3CZ1 A;  1NX2 A;  4HSZ A;  1QV1 A;  2LV7 A;  1SR6 B;  2FJU B;  3DXL A;  1NP8 A;  4PDZ A;  1BT6 A;  4YGD B;  3F45 A;  2H8V A;  4JWQ A;  4P5O E;  2K7C A;  3BFH A;  2BE6 A;  1L2O C;  1JFK A;  1A29 A;  3CR4 X;  3DF0 B;  1M63 B;  3IQO A;  1KFU S;  1JSA A;  3A8R A;  1AJ5 A;  3CTN A;  1U5I A;  2D8N A;  1QLK A;  2M1U A;  3GK4 X;  3BYA A;  1BR1 B;  3MSE B;  1D1O A;  4CPV A;  3CZ2 A;  1DJW A;  2LVJ A;  1F4Q A;  4MZL A;  1M45 A;  2M0R A;  2BBM A;  3V2L A;  1DMO A;  1LA0 A;  1DT7 B;  3BOW A;  1Y0V H;  3I5I B;  1G8I A;  2WC5 A;  3LK1 A;  5AXI A;  1QJT A;  1MUX A;  5AEQ A;  2SAS A;  2E30 A;  1GGZ A;  2WC8 A;  1DEL A;  3Q8I A;  1BF5 A;  2EGD A;  1DGU A;  2K60 A;  1WDC B;  3I5H C;  4MEW A;  2PAS A;  4L9M A;  3NGV A;  2Y5I A;  3NHI A;  4HRH A;  1S5G Z;  2M1K B;  5BPJ A;  1PSR A;  1KK8 B;  1AHR A;  2F3Y A;  1B47 A;  4GGF A;  3B87 A;  3IQQ A;  4NQG A;  2LHL A;  2WCL A;  2GGZ A;  3KHE A;  2Y1N A;  3B86 A;  1H4B A;  2M9G A;  1B8C A;  4AQI A;  2G9B A;  2NLN A;  1TUJ A;  2JT8 A;  5HKZ A;  4DRW A;  1AJ4 A;  4C0J A;  5I94 A;  2L2C A;  1KSM A;  1LXF C;  2L4I A;  2ZND A;  2KQ6 A;  3AAJ A;  1WY9 A;  1OMD A;  2MLE C;  3NSL A;  5I2O A;  1FPW A;  3OHM B;  1H8B A;  2K0J A;  3EVR A;  1CNP A;  2CNP A;  3PM8 A;  1SRA A;  2SCP A;  1DJI A;  3SS3 A;  4PHM A;  1IIO A;  1NIW A;  5EL2 A;  3SS5 A;  2F2O A;  1UHK A;  2KDH A;  4YGC B;  3TUY B;  1TNQ A;  2LUC A;  4ICB A;  4YI9 A;  1Y1A A;  3EVV A;  1CTR A;  1GGW A;  2JNX A;  4HRE E;  1NYA A;  1HT9 A;  1LIN A;  2JPO A;  4PT1 A;  1AK8 A;  1JC2 A;  1NCZ A;  1CDP A;  2BE4 A;  2GGM A;  4BY5 A;  2NCO A;  1W9Z A;  2BCX A;  1OZS A;  1TNX A;  1UP5 A;  1JUO A;  2KAY A;  1WLZ A;  3CDN A;  4WQ3 A;  3BUO B;  1RRO A;  1A03 A;  2F33 A;  3S0D A;  5AER A;  4OCI A;  1BJF A;  1RK9 A;  1SY9 A;  2Q91 A;  3HX4 A;  4Q04 A;  3JVT B;  1CLM A;  3HCM A;  4JQ0 D;  5FI2 A;  3I5G C;  3ICB A;  4MN0 A;  1IQ3 A;  1BU3 A;  2KHN A;  3BFB A;  1M46 A;  1K93 D;  5FI6 A;  3QRX A;  2ERB A;  1TOP A;  2I7A A;  1J7P A;  2GTE A;  1PRW A;  1QAT A;  1XFR A;  3KF9 A;  2M7N A;  2G2B A;  1KWO B;  2LAN A;  3BUW B;  1S5G Y;  1SCV A;  3FS7 A;  3L4L A;  4JD9 A;  3WNX B;  1R2U A;  4AOM A;  4U8D A;  1DTL A;  4E68 A;  3NSO A;  2FOT A;  2VRG A;  2KAX A;  4PE7 A;  1YUS A;  2WOS A;  2CBL A;  1UHN A;  3KPX A;  1AVS A;  4FQO A;  3FE6 A;  1CM1 A;  1EL4 A;  2JZI A;  1SL8 A;  2Y4Q A;  3SG5 A;  3D0Y B;  3TDI A;  5AAN A;  3TS5 B;  1K95 A;  2L51 A;  3M0W A;  1YUR A;  5CSN A;  4N1G A;  3I5I C;  3VRN A;  2NCP A;  3NHT A;  1ALV A;  2ZRT A;  1BMO A;  1NWD A;  1K96 A;  3SG6 A;  4PE1 A;  1DGV A;  2F8P A;  5D7F A;  3S0A A;  1DVI A;  3JTD C;  1OOF A;  1NCX A;  2R2I A;  3I5F B;  4XJK B;  2OPO A;  1DC1 A;  1CDN A;  1KK8 C;  1QIV A;  2AAO A;  2HQW A;  1IH0 A;  1BG1 A;  1TWO A;  4INW A;  1IGV A;  2KYC A;  1IJ6 A;  3FIA A;  4ETO A;  3DY9 A;  1WRZ A;  5PAL A;  1A75 A;  4A4C A;  3NSI A;  3BFA A;  2KGR A;  2JWW A;  3FWC A;  1IG5 A;  1EH2 A;  1J1D A;  3CLN A;  4PHN A;  1DEK A;  3D74 A;  4QJ3 B;  5CSF A;  2MBX A;  1QIW A;  1RTP 1;  5HKW A;  1C7V A;  1OQP A;  2PSR A;  1KSO A;  3GK2 A;  1BLQ A;  3CZT X;  1Y1X A;  3WXA A;  1JFJ A;  2K2A A;  1KQV A;  2PRU A;  1BR4 B;  1QTX A;  1B8R A;  1XYD A;  1G33 A;  1SMG A;  2JOJ A;  5KTY A;  1ZMZ A;  1S26 D;  3EKH A;  1TIZ A;  1KFX L;  1UHI A;  4TNC A;  2E6W A;  3CWG A;  3EK4 A;  3WHU B;  1KK7 Y;  2EC6 B;  1K90 D;  2WC6 A;  1CLL A;  4DUQ A;  2TN4 A;  2OS8 C;  1LA3 A;  2BAP A;  1ORG A;  2KOT A;  3TZ1 A;  2CTN A;  2KI4 B;  1XFV O;  2JC2 A;  4CFR A;  3CS1 A;  2AMI A; 
#chains in the Genus database with same CATH homology
 1ZOT B;  1KQM C;  4C0K A;  2L0P A;  1XO5 A;  1FW4 A;  1NSH A;  1L7Z A;  1F4O A;  1SK6 D;  2JT0 A;  1C7W A;  1IWQ A;  1PSB A;  1JF0 A;  1OMR A;  5FYX A;  1XFX O;  1F71 A;  1UHJ A;  4D1E A;  2LHI A;  1UUR A;  3DD4 A;  1NX0 A;  2OTG B;  2WOR A;  2BKI B;  2HF5 A;  1YVH A;  2LCP A;  2LLT A;  3C1V A;  4WQ2 A;  1JWD A;  2M8U A;  1B8L A;  1SCM B;  3ZNI A;  1N2D A;  1MF8 B;  2PVB A;  1A4P A;  1J7Q A;  1MQ1 A;  1F55 A;  1ODB A;  1YX7 A;  1AP4 A;  1IRJ A;  1UUS A;  3PAL A;  1DJY A;  4OV2 A;  2I94 A;  4GUK A;  1J1E A;  2LMV A;  4NDD A;  1KFX S;  1CLB A;  2O5G A;  4F0Z B;  4PE0 A;  1RJV A;  4GFT A;  1TRF A;  1YUU A;  3SG2 A;  2HPS A;  1MHO A;  2DOQ A;  1SPY A;  1TNP A;  1RWY A;  2JXL A;  1QXP A;  2MHH A;  1QAS A;  1MXE A;  1PUL A;  3DF0 A;  3SG3 A;  2L4H A;  3I5F C;  2MJW B;  3DVE A;  3O4Y A;  2BL0 C;  1SNL A;  1NX3 A;  1LVC D;  2B1U A;  2JTT A;  2ZFD A;  3KEV A;  1FBV A;  5JJG A;  1TCF A;  4N5X A;  4ORA B;  2ZRS A;  4YBH B;  1DJH A;  2LMT A;  1QVI Y;  1EJ3 A;  1EG4 A;  2KQY A;  2LVK A;  2H61 A;  4MSP A;  1SKT A;  3SIB A;  5HYD A;  1A2X A;  1L2O B;  4MZK A;  1S36 A;  1RFJ A;  2MA2 A;  1SR6 C;  2IS9 A;  1TN4 A;  5CPV A;  5J3X A;  2A4J A;  3NXA A;  1FF1 A;  1F8H A;  1KK7 Z;  1FI5 A;  3EKJ A;  1PVA A;  1QX5 B;  4MRX A;  1A75 B;  3FWB A;  4A4B A;  1OSA A;  1XVJ A;  3PN7 B;  2BKH B;  1GQM A;  3DVK A;  4QJ4 B;  4OR9 B;  3VGO A;  2KI4 C;  1WRK A;  4R1E A;  2HET A;  3ZWH A;  1K9U A;  3RM1 A;  1YRU B;  1NUB A;  1Q80 A;  2BCB A;  4I5K A;  3I5H B;  2JNF A;  2K61 A;  4ORB B;  3BQ3 A;  4OVN F;  2H61 C;  2AUC A;  4GGN A;  5DKN A;  3PSR A;  5IBW A;  1WDC C;  5ER4 X;  2JT3 A;  2KFF A;  4PHJ A;  2LVV A;  4YRU A;  2OTG C;  4JPZ B;  1DF0 A;  1U5I B;  3SJS A;  1QX7 A;  2LNK A;  2LVI A;  1F54 A;  1ZAC A;  2LC5 A;  1SCM C;  2NZ0 A;  3BUX B;  2M3W A;  3CR2 A;  1S6J A;  3BOW B;  5KU1 A;  4ORC B;  1XFY O;  1CFF A;  1DJX A;  2CXJ A;  4I5L B;  5GQQ C;  3LL8 B;  1OE9 B;  1Y1U A;  2CT9 A;  3BUM B;  1AUI B;  3OX5 A;  2MAZ A;  1BOC A;  1V1F A;  1TCO B;  1K9P A;  2K7O A;  4I5J A;  4PE4 A;  1CDM A;  2F2P A;  5CSI A;  1PAL A;  1S1E A;  1V1G A;  2L2E A;  3TUY C;  4DCK A;  1J7O A;  4NDC A;  5G08 A;  4ZCV A;  3TDZ A;  1W7J B;  3GK1 A;  4GAO A;  2FCD A;  3EK7 A;  3AKA A;  1EG3 A;  1R6P A;  1LKJ A;  4FTG A;  4BY4 A;  3NSK A;  3VRR A;  4YGB B;  2EHB A;  3OX6 A;  2KSP A;  2LP2 A;  1GJY A;  3OB2 B;  2ZNE A;  4P2Y B;  2FCE A;  1B4C A;  2L5X B;  2Y1M A;  3I5G B;  1TTX A;  1UWO A;  3SIA A;  1PK0 D;  5D69 A;  3GOF A;  2LAP A;  1QLS A;  3DVM A;  1QVI Z;  1CFP A;  1E8A A;  1EXR A;  3JVT C;  4XYN A;  1ALW A;  3LK0 A;  4DS7 A;  1QV0 A;  4USL A;  3WHT B;  1B7T Y;  1M39 A;  3EK8 A;  1IKU A;  1CMF A;  2QPT A;  3A4U B;  1KWO C;  4MBE A;  4XJK A;  3PLF B;  2WCF A;  2WCB A;  1TNW A;  2JUL A;  1XK4 C;  2ZN9 A;  3AKB A;  1S6C A;  1C07 A;  4QJ5 B;  1NCY A;  2LLU A;  2LLS A;  3PN7 C;  5F6T A;  3TDU A;  1N65 A;  1J7R A;  1SL7 A;  1HQV A;  2M29 A;  1CMG A;  2Q4U A;  3TS5 C;  5B8I B;  1CFD A;  2H2K A;  1CFC A;  2BEC A;  4MZJ A;  3JTD B;  1DJG A;  1QX2 A;  4M2Q A;  1XFW O;  1N0Y A;  4GBA A;  2WCE A;  1WRL A;  1Y6W A;  2JTZ A;  4M2P A;  4AQJ A;  1YVL A;  2KNE A;  1WLM A;  5HLV A;  2JPT A;  1QS7 A;  3K21 A;  1BOD A;  1G4Y R;  1B1G A;  1SL9 A;  4NDB A;  4N1F A;  4WRI A;  3VRO A;  5I2L A;  5DKR A;  3PFV A;  2GV5 A;  2JXC A;  4CLN A;  1IQ5 A;  5ER5 A;  4CFQ A;  2ZKM X;  1FI6 A;  2JQ6 A;  2M49 B;  1W7I B;  4ZCU A;  4UPG A;  2I2R E;  2KI6 D;  1YRT B;  3IF7 A;  2JU0 A;  4M2O A;  2O60 A;  2M97 A;  3LCP C;  1OZO A;  3SG7 A;  4CID A;  2CCM A;  1NX1 A;  1DF0 B;  1B9A A;  2PMY A;  4GGF C;  4PAL A;  4HRG A;  3H4S E;  2OS8 B;  4MVF A;  2LUX A;  1M31 A;  2KYF A;  5K89 A;  2EC6 C;  2ZN8 A;  3OP0 A;  3CGA A;  2LE9 B;  1KQM B;  5I8N A;  1NPQ A;  5DKQ A;  1SW8 A;  1ZFS A;  3CR5 X;  1MXL C;  2K2F A;  4C0L A;  1MR8 A;  1CB1 A;  2HQ8 A;  3BXK A;  1JF2 A;  4IL1 A;  2V53 A;  1K8U A;  2KBI A;  1VRK A;  1SYM A;  3E3R A;  3VRQ A;  3DVJ A;  5I2Q A;  3KO0 A;  1B7T Z;  2LM5 A;  2L98 A;  4PCW A;  5TNC A;  4DIR A;  2MLF C;  4MRY A;  1CM4 A;  2KFH A;  1YUT A;  2BCA A;  2WND A;  1K9K A;  2JRF A;  2P6B B;  2L50 A;  2RGI A;  2ISD A;  2K7B A;  2KAV A;  2NXQ A;  5AFP A;  3OB1 B;  4GPL B;  1CDL A;  1KFU L;  2KFG A;  1F70 A;  4YGA A;  1REC A;  1XFZ O;  1XFU O;  1YX8 A;  1X02 A;  2COL B;  2MRD A;  3BUN B;  5HKY A;  1K94 A;  2BBN A;  3O78 A;  5CSJ A;  1SBJ A;  1JBA A;  1K2H A;  1KCY A;  1MWN A;  3VRP A;  3O6B A;  4YGE B;  5KSZ A;  1S6I A;  2K7D A;  2F3Z A;  1J55 A;  2BL0 B;  2QAC A;  1PVB A;  3D10 A;  4MLW A;  1S3P A;  4I5N B;  3RLZ A;  1XK4 A;  2KGB C;  4OKH A;  1OMV A;  2I18 A;  2K8M B;  2LP3 A;  1DJZ A;  2KI6 C;  2LMU A;  3PAT A;  1UHH A;  3O2P A;  4GNK B;  1OOJ A;  3EVU A;  4PHK A;  4YI8 A;  1IJ5 A;  2KBM A;  3SG4 A;  1CKK A;  2M7L A;  5HLO A;  2PAL A;  1ZUZ A;  3LLE A;  1YTZ C;  1XA5 A;  3D0Y A;  1YR5 A;  3AAK A;  5JOL A;  1NX2 A;  4HSZ A;  1QV1 A;  2LV7 A;  1SR6 B;  2FJU B;  4PDZ A;  1NP8 A;  4YGD B;  1BT6 A;  3F45 A;  4JWQ A;  4P5O E;  2K7C A;  2BE6 A;  1L2O C;  1JFK A;  1A29 A;  3CR4 X;  3DF0 B;  1M63 B;  3IQO A;  1KFU S;  1JSA A;  3A8R A;  1AJ5 A;  3CTN A;  1U5I A;  2D8N A;  1QLK A;  2M1U A;  3GK4 X;  3BYA A;  1BR1 B;  3MSE B;  1D1O A;  4CPV A;  1DJW A;  2LVJ A;  1F4Q A;  4MZL A;  1M45 A;  2M0R A;  2BBM A;  1DMO A;  1LA0 A;  1DT7 B;  3BOW A;  1Y0V H;  3I5I B;  1G8I A;  3LK1 A;  5AXI A;  1QJT A;  1MUX A;  5AEQ A;  2SAS A;  2E30 A;  1GGZ A;  2WC8 A;  1BF5 A;  2EGD A;  1DGU A;  1WDC B;  3I5H C;  4MEW A;  2PAS A;  4L9M A;  2Y5I A;  4HRH A;  1S5G Z;  2M1K B;  5BPJ A;  1PSR A;  1KK8 B;  1AHR A;  2F3Y A;  1B47 A;  4GGF A;  3IQQ A;  4NQG A;  2LHL A;  2GGZ A;  3KHE A;  2Y1N A;  1H4B A;  2M9G A;  1B8C A;  4AQI A;  2G9B A;  2NLN A;  2JT8 A;  5HKZ A;  4DRW A;  1AJ4 A;  4C0J A;  1KSM A;  1LXF C;  2L4I A;  2ZND A;  2KQ6 A;  3AAJ A;  1WY9 A;  1OMD A;  2MLE C;  3NSL A;  5I2O A;  1FPW A;  3OHM B;  1H8B A;  2K0J A;  3EVR A;  1CNP A;  2CNP A;  3PM8 A;  1SRA A;  2SCP A;  1DJI A;  4PHM A;  1NIW A;  2F2O A;  1UHK A;  2KDH A;  4YGC B;  3TUY B;  1TNQ A;  2LUC A;  4ICB A;  4YI9 A;  1Y1A A;  3EVV A;  1CTR A;  1GGW A;  2JNX A;  4HRE E;  1NYA A;  1HT9 A;  1LIN A;  1AK8 A;  1JC2 A;  1NCZ A;  1CDP A;  2BE4 A;  2GGM A;  4BY5 A;  2NCO A;  2BCX A;  1OZS A;  1TNX A;  1UP5 A;  1JUO A;  2KAY A;  1WLZ A;  4WQ3 A;  3BUO B;  1RRO A;  1A03 A;  2F33 A;  5AER A;  4OCI A;  1BJF A;  1RK9 A;  1SY9 A;  2Q91 A;  3HX4 A;  4Q04 A;  3JVT B;  1CLM A;  3HCM A;  4JQ0 D;  3I5G C;  3ICB A;  4MN0 A;  1IQ3 A;  1BU3 A;  2KHN A;  1M46 A;  1K93 D;  3QRX A;  1TOP A;  2I7A A;  1J7P A;  1PRW A;  1QAT A;  3KF9 A;  2M7N A;  2G2B A;  1KWO B;  2LAN A;  3BUW B;  1S5G Y;  1SCV A;  3FS7 A;  3WNX B;  4AOM A;  1R2U A;  4U8D A;  1DTL A;  4E68 A;  3NSO A;  2FOT A;  2VRG A;  2KAX A;  4PE7 A;  1YUS A;  2WOS A;  2CBL A;  1UHN A;  3KPX A;  1AVS A;  4FQO A;  1CM1 A;  1EL4 A;  2JZI A;  1SL8 A;  2Y4Q A;  3SG5 A;  3D0Y B;  3TDI A;  5AAN A;  3TS5 B;  1K95 A;  2L51 A;  3M0W A;  1YUR A;  5CSN A;  4N1G A;  3I5I C;  3VRN A;  2NCP A;  1ALV A;  2ZRT A;  1BMO A;  1NWD A;  1K96 A;  3SG6 A;  4PE1 A;  1DGV A;  2F8P A;  5D7F A;  1DVI A;  3JTD C;  1NCX A;  2R2I A;  3I5F B;  4XJK B;  2OPO A;  1CDN A;  1KK8 C;  1QIV A;  2AAO A;  2HQW A;  1IH0 A;  1BG1 A;  1IGV A;  2KYC A;  1IJ6 A;  3FIA A;  4ETO A;  1WRZ A;  5PAL A;  1A75 A;  4A4C A;  3NSI A;  2KGR A;  2JWW A;  3FWC A;  1IG5 A;  1EH2 A;  1J1D A;  3CLN A;  4PHN A;  4QJ3 B;  5CSF A;  2MBX A;  1QIW A;  1RTP 1;  5HKW A;  1C7V A;  1OQP A;  2PSR A;  1KSO A;  3GK2 A;  1BLQ A;  3CZT X;  1Y1X A;  3WXA A;  1JFJ A;  2K2A A;  1KQV A;  2PRU A;  1BR4 B;  1QTX A;  1B8R A;  1XYD A;  1G33 A;  1SMG A;  2JOJ A;  5KTY A;  1ZMZ A;  1S26 D;  3EKH A;  1TIZ A;  1KFX L;  1UHI A;  4TNC A;  2E6W A;  3CWG A;  3EK4 A;  3WHU B;  1KK7 Y;  2EC6 B;  1K90 D;  1CLL A;  4DUQ A;  2TN4 A;  2OS8 C;  1LA3 A;  2KOT A;  3TZ1 A;  2CTN A;  2KI4 B;  1XFV O;  2JC2 A;  4CFR A;  3CS1 A;  2AMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...