2TRCB

Phosducin/transducin beta-gamma complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
340
Chain Sequence
b'MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSDUCIN
molecule tags Complex (transducer/transduction)
source organism Rattus norvegicus
publication title Crystal structure at 2.4 angstroms resolution of the complex of transducin betagamma and its regulator, phosducin.
pubmed doi rcsb
total genus 111
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2trcB00
3JZNA 4BH6A 2I0RA 4A11A 3MZLA 4GGDA 4CY1A 2CE9A 2XYIA 3UKUC 3UVLA 3I89A 2OVQB 2AH1A 3AH8B 3V7DB 1R5MA 4J82A 2CNXA 2YBAA 4Y5RD 4J78A 3BG1A 4FAVD 3C99A 3OKTA 3RRMC 2H6QA 4FA1D 4FA9D 4JT5C 1JJUB 2YNNA 3EI3B 3SXTD 4J84A 4ERZA 4GGCA 1XHMA 3SVWD 4FAND 2TRCB 3UVKA 2YMUA 5EM2B 3I7PA 3UVOA 2H9NA 1U2VC 4CC9A 2HXCA 3JZHA 3SHFA 4H5IA 2AQ5A 2OVRB 3BG0A 5EAPA 4ESGA 4GM3A 2QC5A 4FB1D 4E54B 4NSXA 3RMZD 4AEZA 3N0EA 4A2MA 2OK6A 4A0BA 1VYHC 4GQ2P 2H6KA 1OMWB 2IWFA 3PXTD 5IT9g 1NR0A 4A7JA 5TDHB 1JMXB 3OW8A 3DWLC 3EI4B 3J81g 4GMBA 3EMHA 4PSWB 1SQ9A 2P9LC 5EARA 3VA6A 4J0XA 5FA5B 1PEVA 3FRXA 3N0DA 3CFSB 5CXBB 5EM2A 3IIYA 3B7FA 4QQEA 3JB9L 2B5LA 3IJCA 3EWEA 2OJYA 3PSCB 3UR4A 2H14A 3PVWB 4ERQA 3RFGA 4X60B 3I8CA 2P9PC 3AFCA 4QL1A 5C9ZB 1B9YA 4A11B 4OWRA 5I5MA 5CXCA 5GMKn 2B5NA 2GC7A 3RFHA 4LGNA 2AGXA 3PXWD 4O9DA 3J80g 4XEIC 2IURA 3I8EA 3EU7A 4J0WA 2OVPB 2OK4A 5H14A 2YNPA 3ULEC 3P4FA 1XKSA 1U4CA 4A09B 4BUJC 2IAAA 3E0CA 1NEXB 1S4UX 4L1QD 2G99A 3F3PA 1B9XA 4GGAA 2OIZA 1Q47A 3JAMg 4ZOVA 2AGLA 4O1QD 4UI9R 2EBSA 3MXXA 4ZOZA 1XIPA 3DM0A 5SXMA 5HYNB 4GZ8A 2Z2NA 5THAA 2IWKA 3L4OD 5IGQA 4PNKB 5IGOA 1N6FA 2P9SC 4PBZA 4JSPC 4O3UB 4QT8A 3MMYA 5GSAA 5EMJB 3C75H 3ORVD 3L4MD 1TBGA 3EI2B 4U1EI 4IMMA 1PBYB 3OKYB 2H13A 2H9LA 5FKSA 3JRPA 3IJ1A 5IJ8E 4TZ4A 2XL2A 4CY5A 5CYKB 4CZVA 3EI2A 1FWXA 4GM8A 3UVNA 1JMZB 4L3HD 2YB8B 4CI2A 5TF2A 4FA4D 2P9KC 5EMMB 3I2NA 5CYKA 2HJ4A 4I79A 1P22A 3K26A 2CN3A 2Q7QA 3SJLD 4EWRA 3EI1A 1RI6A 4FA5D 4CI3A 3PXSD 3F3FA 3JROA 2Z2PA 2B5MA 2MTAH 4D0KA 2H9PA 5FKQA 2P9UC 4JSXC 4LG9A 3I7NA 2GNQA 4A2LA 1MG2A 5K19A 2W18A 5I5JA 3IKOA 2HKRA 3I7HA 2H68A 4N14A 4QRJA 5FKTA 5GXHA 5EMLB 2IUPA 4O3TB 5AMSA 3SBQA 3F3GA 4LG8A 4PXWA 2O9KA 5KDOB 2PBIB 2XU7A 1MDAH 5CXCB 4ERYA 5C2WB 3V5WB 1N6DA 5TEFA 5TEEA 4CY2A 4ES0A 2PM6B 1YFQA 3K27A 4K3JB 5AJAA 3PE7A 4JSNC 5CXBA 2QXVA 4L9OA 5HQGA 4XYHA 2H6NA 3SFZA 2CO0C 2AH0A 3OL2B 2J57G 2BBKH 2Z2OA 3UKRC 4YVDA 1TYQC 3JZGA 5HE0B 5GXIA 1ERJA 5EMKB 2CO0A 3MKSB 3UVMA 4A0BB 1GXRA 3DXKC 3JPXA 2I0SA 4OZUA 2HJBA 5FQDA 4PC0A 1GG2B 3U4YA 3EI4A 2J56H 4CI1A 4J77A 3MKQA 3PVUB 5H1MA 2UZXB 4E54A 4J87A 3RN1D 3EI3A 4JSVC 1OLZA 5K1CC 4ZOXA 3ODTA 3GFCA 4GM9A 3PSLA 3IIWA 4H5JA 4JD2C 3EG6A 4Z8LA 4E5ZA 4R7AB 3DXMC 1MG3A 3A0FA 3NVNA 1SQJA 3OL2A 3EI1B 3OKYA 4JXMA 3I7LA 4GQBB 3SMRA 4CI8A 4A0AA 3NVXA 2PM9B 3MZKA 3OTTA 3RSEC 3C9CA 4ZOYA 5AFU3 2I3TA 3FGBA 3SWSD 2P9IC 2J55H 3I7OA 2AGWA 3AL8A 5IJ7E 5HE3B 4X63B 3SLED 3SN6B 3CIKB 3SBRA 4JT6C 4CY3A 4O45A 4K3ID 4J81A 4CZYA 4J8BA 4U7AA 4A08A 3KRXB 3AL9A 3KRWB 5HE1B 5FKRA 2HKMA 4A09A 5HE2B 3AL8B 2YNOA 1A0RB 4D6VA 3C5MA 3RLMD 1QNIA 1JOFA 3IJ0A 2UZYB 2G9AA 4FWWA 3HFQA 4A0AB 4J79A 4FHLA 4AOWA 2H9MA 1GP2B 3SBPA 3GREA 5EALA 1PGUA 4GQ1A 3FM0A 2IUQA 3W15A 4J73A 4Y7RA 2B4EA 2XL3A 3BWSA 4ZN4A 2PM9A 4HDJA 1K8KC 5B4WA 3OKWA 2CE8A 3NVQA 5IC7A 4G56B 5EAMA 2I0TA 2AGYA 1GOTB 2BCJB 4X61B 4IA9A 2H3XA 4BL0A 5H17A 1PI6A 2H47A 3VGZA 4XYIA 2IUVA 5C2VB 3CFVA 4E5ZB 4A08B 3VH0A 4CZXA 1N6EA 4X3EA 3RN0D 1L0QA 1SHYB 4PSXB 2P9NC 1K32A 4L3GD 3SCYA 2HESX 4J86A 2GC4A 5FLXg 5JWZA 4MK0B 4KFMB 4PBYA 4J8GA 3I7KA 2HYEA 2AGZA 5I5IA 3DSMA 3V9FA 2I3SA 5FXYA 3ZWLB 5A2Qg 2PM7B 2CN2A
chains in the Genus database with same CATH superfamily
3JZNA 4BH6A 2I0RA 4G1MA 4A11A 3MUNA 1QFSA 3MZLA 4GGDA 4CY1A 2CE9A 2XYIA 3IUQA 3UKUC 1GOHA 3I89A 3UVLA 2OVQB 4BCCA 2QZPA 2AH1A 3AH8B 3V7DB 1R5MA 4J82A 2CNXA 2YBAA 4D9SA 4Y5RD 4J78A 4AN1A 3BG1A 4FAVD 3C99A 1VE7A 3OKTA 3RRMC 3FCSA 2H6QA 4FA1D 4FA9D 4JT5C 3IVMA 1JJUB 5M5TA 4L1MA 2YNNA 3EI3B 5E6SA 4BP9A 3SXTD 4DNVA 4J84A 4ERZA 3NIDA 4GGCA 1XHMA 3SVWD 4FAND 2BKLA 2TRCB 3UVKA 2YMUA 5EM2B 3I7PA 3UVOA 2H9NA 1U2VC 4AN0A 4CC9A 2HXCA 3JZHA 3SHFA 4H5IA 2AQ5A 2OVRB 4AMYA 3BG0A 5EAPA 4ESGA 4GM3A 2QC5A 4FB1D 4E54B 4NSXA 2VDLA 3RMZD 4MMYA 4AEZA 1UOQA 3N0EA 3OF7A 4A2MA 2OK6A 4A0BA 3O4JA 1VYHC 4GQ2P 2H6KA 1OMWB 2IWFA 3PXTD 5IT9g 1NR0A 1H2ZA 4A7JA 5TDHB 3GC3B 3OW8A 1JMXB 3DWLC 3EI4B 3J81g 4GMBA 3EMHA 4PSWB 1SQ9A 2P9LC 5EARA 3VA6A 4J0XA 5FA5B 1PEVA 3FRXA 3N0DA 1UOPA 3CFSB 5CXBB 3NIGA 5EM2A 4IRZA 3IIYA 3B7FA 4QQEA 3JB9L 2B5LA 3IJCA 4Z7OA 3EWEA 2OJYA 3PSCB 3UR4A 2H14A 3PVWB 4ERQA 2XZGA 3RFGA 4X60B 3I8CA 1E8MA 2VC2A 1L5GA 5C86A 2P9PC 3AFCA 4QL1A 5C9ZB 2VDQA 1B9YA 3EQ8A 4A11B 4OWRA 5I5MA 3ZE1A 5CXCA 5GMKn 2B5NA 2GC7A 3RFHA 4LGNA 5C92A 2AGXA 3PXWD 4O9DA 3J80g 4XEIC 2IURA 3I8EA 3EU7A 4J0WA 2OVPB 2OK4A 5H14A 2YNPA 2VDRA 4Z7NA 1C9LA 3ULEC 1VE6A 3P4FA 1VZ3A 1XKSA 2VZ1A 2VDMA 3O4IA 1U4CA 4A09B 4BUJC 2IAAA 4BP8A 3E0CA 1NEXB 1S4UX 4L1QD 2G99A 3F3PA 1B9XA 4GGAA 2OIZA 1Q47A 3JAMg 4ZOVA 2HU5A 5HDBA 2AGLA 4O1QD 3EQ9A 2EIEA 4UI9R 2HU7A 2EBSA 3MXXA 4ZOZA 3ZE0A 1XIPA 1E5TA 3DM0A 5SXMA 4GZ8A 5HYNB 2Z2NA 5THAA 3IUJA 2IWKA 3L4OD 3IJEA 5IGQA 4PNKB 5IGOA 1N6FA 2P9SC 4PBZA 3QI0A 4JSPC 4WJKA 3K71A 4O3UB 5FFOA 4QT8A 3T3MA 3MMYA 5GSAA 5EMJB 3C75H 1GOGA 3ORVD 3L4MD 1TBGA 3EI2B 4U1EI 3OKYB 1PBYB 4IMMA 2H13A 2H9LA 4MMZA 5FKSA 3JRPA 3IJ1A 1JTDB 5IJ8E 4DNUA 4TZ4A 2XL2A 4CY5A 5CYKB 4CZVA 3EI2A 3K6SA 1FWXA 4GM8A 3UVNA 1JMZB 4L3HD 2YB8B 4AMZA 4CI2A 5TF2A 4FA4D 2P9KC 3VI4A 5EMMB 3I2NA 5CYKA 2HJ4A 1P22A 3K26A 2CN3A 4I79A 2Q7QA 3SJLD 4EWRA 3EI1A 4JHPC 1RI6A 4FA5D 4CI3A 3PXSD 3F3FA 2VDNA 3JROA 2HU8A 2Z2PA 2B5MA 2MTAH 4D0KA 3IUNA 2H9PA 5FKQA 2P9UC 4JSXC 1O6FA 4LG9A 3I7NA 2GNQA 4A2LA 1MG2A 5K19A 3ZE2A 4BCBA 2W18A 5I5JA 3IKOA 2HKRA 3I7HA 2H68A 2JKXA 4N14A 4QRJA 1T2XA 5FKTA 5M5SA 5GXHA 5EMLB 2IUPA 4G55A 4O3TB 5AMSA 2EIDA 4O2WA 3SBQA 3F3GA 4LG8A 4PXWA 4NC4A 2O9KA 5KDOB 2PBIB 2XU7A 1MDAH 4NENA 5CXCB 4ERYA 5C2WB 3V5WB 4G1EA 1N6DA 5TEFA 5TEEA 4CY2A 4ES0A 3IUMA 2PM6B 1YFQA 3K27A 3NIFA 1QFMA 1TYEA 4K3JB 5AJAA 3PE7A 2VDPA 4JSNC 5E6RA 5CXBA 2QXVA 4L9OA 5HQGA 4XYHA 2H6NA 3SFZA 2CO0C 2AH0A 2QR5A 3OL2B 2J57G 2BBKH 3MVDK 2Z2OA 3UKRC 1I2MB 4YVDA 1TYQC 1UOOA 3JZGA 5HE0B 5GXIA 1ERJA 5EMKB 2CO0A 3MKSB 4RE6A 3UVMA 2EIBA 4A0BB 1GXRA 3DXKC 3JPXA 2I0SA 4OZUA 2HJBA 4RE5A 1BPOA 5FQDA 4PC0A 1GG2B 3FCUA 3U4YA 3EI4A 4O02A 2J56H 4CI1A 2VDOA 4J77A 3MKQA 3PVUB 5H1MA 1H2XA 5M5UA 2XE4A 2VZ3A 2UZXB 3ZDYA 4E54A 4J87A 3RN1D 3EI3A 4JSVC 1OLZA 5K1CC 4ZOXA 3ODTA 4AX4A 3GFCA 4GM9A 3PSLA 3IIWA 5FFGA 4H5JA 4NBMA 5M5VA 3O4GA 4JD2C 3EG6A 4Z8LA 3V4VA 4E5ZA 5M61A 3ZDZA 4R7AB 3DXMC 1MG3A 3NVNA 3A0FA 1SQJA 3OL2A 4WK2A 3EI1B 1A12A 3OKYA 4JXMA 3I7LA 4GQBB 3KCIA 1UTCA 5M5RA 3SMRA 4CI8A 4A0AA 3NVXA 2PM9B 1E8NA 3MZKA 3OTTA 3RSEC 3C9CA 1JV2A 4ZOYA 5AFU3 2I3TA 3FGBA 3SWSD 2P9IC 3DDUA 3O4HA 1U8CA 2J55H 3I7OA 2AGWA 3AL8A 5IJ7E 4QAMA 5HE3B 4WK0A 3K72A 4X63B 3SLED 4MMXA 3SN6B 3CIKB 3SBRA 4JT6C 4CY3A 4O45A 3VI3A 4K3ID 4J81A 1H2YA 4BCDA 4CZYA 4J8BA 4U7AA 4A08A 3KRXB 3AL9A 3KRWB 5HE1B 5FKRA 2HKMA 4A09A 5HE2B 3AL8B 2YNOA 1A0RB 4D6VA 3C5MA 3RLMD 3MUOA 1QNIA 1JOFA 3IJ0A 2UZYB 2G9AA 4FWWA 3HFQA 4A0AB 4J79A 4FHLA 4AOWA 3QHYB 2H9MA 1GP2B 1H2WA 3SBPA 1C9IA 3GREA 5EALA 3T3PA 1PGUA 4GQ1A 3FM0A 2IUQA 3W15A 4UM8A 4J73A 4Y7RA 2B4EA 2XL3A 3BWSA 4ZN4A 2PM9A 3IULA 4HDJA 2XDWA 3V4PA 4UM9A 1GOFA 1K8KC 5B4WA 3OKWA 2CE8A 3NVQA 5IC7A 4G56B 5EAMA 2I0TA 2VDKA 2AGYA 1GOTB 2BCJB 4X61B 4IA9A 2H3XA 4BL0A 4DNWA 5H17A 1PI6A 4WK4A 2H47A 3VGZA 2WQ8A 4XYIA 2IUVA 5C2VB 3CFVA 4JHNA 4E5ZB 1M1XA 4A08B 3VH0A 4NAAA 4CZXA 1N6EA 4X3EA 3RN0D 1L0QA 1SHYB 4PSXB 3IURA 3ZDXA 2P9NC 4Z7QA 1K32A 4L3GD 3SCYA 2HESX 1YR2A 4J86A 2GC4A 5FLXg 5E6UA 3GD1I 5JWZA 4MK0B 4KFMB 4PBYA 4J8GA 3I7KA 2HYEA 2AGZA 5I5IA 3DSMA 3EQ7A 3V9FA 1VZ2A 1K3IA 2I3SA 1O6GA 5FXYA 3ZWLB 5A2Qg 2PM7B 2EICA 2CN2A
chains in the Genus database with same CATH topology
3JZNA 4BH6A 2I0RA 4A11A 3MZLA 4GGDA 4CY1A 2CE9A 2XYIA 3UKUC 3UVLA 3I89A 2OVQB 2AH1A 3AH8B 3V7DB 1R5MA 4J82A 2CNXA 2YBAA 4Y5RD 4J78A 3BG1A 4FAVD 3C99A 3OKTA 3RRMC 2H6QA 4FA1D 4FA9D 4JT5C 1JJUB 2YNNA 3EI3B 3SXTD 4J84A 4ERZA 4GGCA 1XHMA 3SVWD 4FAND 2TRCB 3UVKA 2YMUA 5EM2B 3I7PA 3UVOA 2H9NA 1U2VC 4CC9A 2HXCA 3JZHA 3SHFA 4H5IA 2AQ5A 2OVRB 3BG0A 5EAPA 4ESGA 4GM3A 2QC5A 4FB1D 4E54B 4NSXA 3RMZD 4AEZA 3N0EA 4A2MA 2OK6A 4A0BA 1VYHC 4GQ2P 2H6KA 1OMWB 2IWFA 3PXTD 5IT9g 1NR0A 4A7JA 5TDHB 1JMXB 3OW8A 3DWLC 3EI4B 3J81g 4GMBA 3EMHA 4PSWB 1SQ9A 2P9LC 5EARA 3VA6A 4J0XA 5FA5B 1PEVA 3FRXA 3N0DA 3CFSB 5CXBB 5EM2A 3IIYA 3B7FA 4QQEA 3JB9L 2B5LA 3IJCA 3EWEA 2OJYA 3PSCB 3UR4A 2H14A 3PVWB 4ERQA 3RFGA 4X60B 3I8CA 2P9PC 3AFCA 4QL1A 5C9ZB 1B9YA 4A11B 4OWRA 5I5MA 5CXCA 5GMKn 2B5NA 2GC7A 3RFHA 4LGNA 2AGXA 3PXWD 4O9DA 3J80g 4XEIC 2IURA 3I8EA 3EU7A 4J0WA 2OVPB 2OK4A 5H14A 2YNPA 3ULEC 3P4FA 1XKSA 1U4CA 4A09B 4BUJC 2IAAA 3E0CA 1NEXB 1S4UX 4L1QD 2G99A 3F3PA 1B9XA 4GGAA 2OIZA 1Q47A 3JAMg 4ZOVA 2AGLA 4O1QD 4UI9R 2EBSA 3MXXA 4ZOZA 1XIPA 3DM0A 5SXMA 5HYNB 4GZ8A 2Z2NA 5THAA 2IWKA 3L4OD 5IGQA 4PNKB 5IGOA 1N6FA 2P9SC 4PBZA 4JSPC 4O3UB 4QT8A 3MMYA 5GSAA 5EMJB 3C75H 3ORVD 3L4MD 1TBGA 3EI2B 4U1EI 4IMMA 1PBYB 3OKYB 2H13A 2H9LA 5FKSA 3JRPA 3IJ1A 5IJ8E 4TZ4A 2XL2A 4CY5A 5CYKB 4CZVA 3EI2A 1FWXA 4GM8A 3UVNA 1JMZB 4L3HD 2YB8B 4CI2A 5TF2A 4FA4D 2P9KC 5EMMB 3I2NA 5CYKA 2HJ4A 4I79A 1P22A 3K26A 2CN3A 2Q7QA 3SJLD 4EWRA 3EI1A 1RI6A 4FA5D 4CI3A 3PXSD 3F3FA 3JROA 2Z2PA 2B5MA 2MTAH 4D0KA 2H9PA 5FKQA 2P9UC 4JSXC 4LG9A 3I7NA 2GNQA 4A2LA 1MG2A 5K19A 2W18A 5I5JA 3IKOA 2HKRA 3I7HA 2H68A 4N14A 4QRJA 5FKTA 5GXHA 5EMLB 2IUPA 4O3TB 5AMSA 3SBQA 3F3GA 4LG8A 4PXWA 2O9KA 5KDOB 2PBIB 2XU7A 1MDAH 5CXCB 4ERYA 5C2WB 3V5WB 1N6DA 5TEFA 5TEEA 4CY2A 4ES0A 2PM6B 1YFQA 3K27A 4K3JB 5AJAA 3PE7A 4JSNC 5CXBA 2QXVA 4L9OA 5HQGA 4XYHA 2H6NA 3SFZA 2CO0C 2AH0A 3OL2B 2J57G 2BBKH 2Z2OA 3UKRC 4YVDA 1TYQC 3JZGA 5HE0B 5GXIA 1ERJA 5EMKB 2CO0A 3MKSB 3UVMA 4A0BB 1GXRA 3DXKC 3JPXA 2I0SA 4OZUA 2HJBA 5FQDA 4PC0A 1GG2B 3U4YA 3EI4A 2J56H 4CI1A 4J77A 3MKQA 3PVUB 5H1MA 2UZXB 4E54A 4J87A 3RN1D 3EI3A 4JSVC 1OLZA 5K1CC 4ZOXA 3ODTA 3GFCA 4GM9A 3PSLA 3IIWA 4H5JA 4JD2C 3EG6A 4Z8LA 4E5ZA 4R7AB 3DXMC 1MG3A 3A0FA 3NVNA 1SQJA 3OL2A 3EI1B 3OKYA 4JXMA 3I7LA 4GQBB 3SMRA 4CI8A 4A0AA 3NVXA 2PM9B 3MZKA 3OTTA 3RSEC 3C9CA 4ZOYA 5AFU3 2I3TA 3FGBA 3SWSD 2P9IC 2J55H 3I7OA 2AGWA 3AL8A 5IJ7E 5HE3B 4X63B 3SLED 3SN6B 3CIKB 3SBRA 4JT6C 4CY3A 4O45A 4K3ID 4J81A 4CZYA 4J8BA 4U7AA 4A08A 3KRXB 3AL9A 3KRWB 5HE1B 5FKRA 2HKMA 4A09A 5HE2B 3AL8B 2YNOA 1A0RB 4D6VA 3C5MA 3RLMD 1QNIA 1JOFA 3IJ0A 2UZYB 2G9AA 4FWWA 3HFQA 4A0AB 4J79A 4FHLA 4AOWA 2H9MA 1GP2B 3SBPA 3GREA 5EALA 1PGUA 4GQ1A 3FM0A 2IUQA 3W15A 4J73A 4Y7RA 2B4EA 2XL3A 3BWSA 4ZN4A 2PM9A 4HDJA 1K8KC 5B4WA 3OKWA 2CE8A 3NVQA 5IC7A 4G56B 5EAMA 2I0TA 2AGYA 1GOTB 2BCJB 4X61B 4IA9A 2H3XA 4BL0A 5H17A 1PI6A 2H47A 3VGZA 4XYIA 2IUVA 5C2VB 3CFVA 4E5ZB 4A08B 3VH0A 4CZXA 1N6EA 4X3EA 3RN0D 1L0QA 1SHYB 4PSXB 2P9NC 1K32A 4L3GD 3SCYA 2HESX 4J86A 2GC4A 5FLXg 5JWZA 4MK0B 4KFMB 4PBYA 4J8GA 3I7KA 2HYEA 2AGZA 5I5IA 3DSMA 3V9FA 2I3SA 5FXYA 3ZWLB 5A2Qg 2PM7B 2CN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZN A;  4BH6 A;  2I0R A;  4A11 A;  3MZL A;  4GGD A;  4CY1 A;  2CE9 A;  2XYI A;  3UKU C;  3UVL A;  3I89 A;  2OVQ B;  2AH1 A;  3AH8 B;  3V7D B;  1R5M A;  4J82 A;  2CNX A;  2YBA A;  4Y5R D;  4J78 A;  3BG1 A;  4FAV D;  3C99 A;  3OKT A;  3RRM C;  2H6Q A;  4FA1 D;  4FA9 D;  4JT5 C;  1JJU B;  2YNN A;  3EI3 B;  3SXT D;  4J84 A;  4ERZ A;  4GGC A;  1XHM A;  3SVW D;  4FAN D;  2TRC B;  3UVK A;  2YMU A;  5EM2 B;  3I7P A;  3UVO A;  2H9N A;  1U2V C;  4CC9 A;  2HXC A;  3JZH A;  3SHF A;  4H5I A;  2AQ5 A;  2OVR B;  3BG0 A;  5EAP A;  4ESG A;  4GM3 A;  2QC5 A;  4FB1 D;  4E54 B;  4NSX A;  3RMZ D;  4AEZ A;  3N0E A;  4A2M A;  2OK6 A;  4A0B A;  1VYH C;  4GQ2 P;  2H6K A;  1OMW B;  2IWF A;  3PXT D;  5IT9 g;  1NR0 A;  4A7J A;  5TDH B;  1JMX B;  3OW8 A;  3DWL C;  3EI4 B;  3J81 g;  4GMB A;  3EMH A;  4PSW B;  1SQ9 A;  2P9L C;  5EAR A;  3VA6 A;  4J0X A;  5FA5 B;  1PEV A;  3FRX A;  3N0D A;  3CFS B;  5CXB B;  5EM2 A;  3IIY A;  3B7F A;  4QQE A;  3JB9 L;  2B5L A;  3IJC A;  3EWE A;  2OJY A;  3PSC B;  3UR4 A;  2H14 A;  3PVW B;  4ERQ A;  3RFG A;  4X60 B;  3I8C A;  2P9P C;  3AFC A;  4QL1 A;  5C9Z B;  1B9Y A;  4A11 B;  4OWR A;  5I5M A;  5CXC A;  5GMK n;  2B5N A;  2GC7 A;  3RFH A;  4LGN A;  2AGX A;  3PXW D;  4O9D A;  3J80 g;  4XEI C;  2IUR A;  3I8E A;  3EU7 A;  4J0W A;  2OVP B;  2OK4 A;  5H14 A;  2YNP A;  3ULE C;  3P4F A;  1XKS A;  1U4C A;  4A09 B;  4BUJ C;  2IAA A;  3E0C A;  1NEX B;  1S4U X;  4L1Q D;  2G99 A;  3F3P A;  1B9X A;  4GGA A;  2OIZ A;  1Q47 A;  3JAM g;  4ZOV A;  2AGL A;  4O1Q D;  4UI9 R;  2EBS A;  3MXX A;  4ZOZ A;  1XIP A;  3DM0 A;  5SXM A;  5HYN B;  4GZ8 A;  2Z2N A;  5THA A;  2IWK A;  3L4O D;  5IGQ A;  4PNK B;  5IGO A;  1N6F A;  2P9S C;  4PBZ A;  4JSP C;  4O3U B;  4QT8 A;  3MMY A;  5GSA A;  5EMJ B;  3C75 H;  3ORV D;  3L4M D;  1TBG A;  3EI2 B;  4U1E I;  4IMM A;  1PBY B;  3OKY B;  2H13 A;  2H9L A;  5FKS A;  3JRP A;  3IJ1 A;  5IJ8 E;  4TZ4 A;  2XL2 A;  4CY5 A;  5CYK B;  4CZV A;  3EI2 A;  1FWX A;  4GM8 A;  3UVN A;  1JMZ B;  4L3H D;  2YB8 B;  4CI2 A;  5TF2 A;  4FA4 D;  2P9K C;  5EMM B;  3I2N A;  5CYK A;  2HJ4 A;  4I79 A;  1P22 A;  3K26 A;  2CN3 A;  2Q7Q A;  3SJL D;  4EWR A;  3EI1 A;  1RI6 A;  4FA5 D;  4CI3 A;  3PXS D;  3F3F A;  3JRO A;  2Z2P A;  2B5M A;  2MTA H;  4D0K A;  2H9P A;  5FKQ A;  2P9U C;  4JSX C;  4LG9 A;  3I7N A;  2GNQ A;  4A2L A;  1MG2 A;  5K19 A;  2W18 A;  5I5J A;  3IKO A;  2HKR A;  3I7H A;  2H68 A;  4N14 A;  4QRJ A;  5FKT A;  5GXH A;  5EML B;  2IUP A;  4O3T B;  5AMS A;  3SBQ A;  3F3G A;  4LG8 A;  4PXW A;  2O9K A;  5KDO B;  2PBI B;  2XU7 A;  1MDA H;  5CXC B;  4ERY A;  5C2W B;  3V5W B;  1N6D A;  5TEF A;  5TEE A;  4CY2 A;  4ES0 A;  2PM6 B;  1YFQ A;  3K27 A;  4K3J B;  5AJA A;  3PE7 A;  4JSN C;  5CXB A;  2QXV A;  4L9O A;  5HQG A;  4XYH A;  2H6N A;  3SFZ A;  2CO0 C;  2AH0 A;  3OL2 B;  2J57 G;  2BBK H;  2Z2O A;  3UKR C;  4YVD A;  1TYQ C;  3JZG A;  5HE0 B;  5GXI A;  1ERJ A;  5EMK B;  2CO0 A;  3MKS B;  3UVM A;  4A0B B;  1GXR A;  3DXK C;  3JPX A;  2I0S A;  4OZU A;  2HJB A;  5FQD A;  4PC0 A;  1GG2 B;  3U4Y A;  3EI4 A;  2J56 H;  4CI1 A;  4J77 A;  3MKQ A;  3PVU B;  5H1M A;  2UZX B;  4E54 A;  4J87 A;  3RN1 D;  3EI3 A;  4JSV C;  1OLZ A;  5K1C C;  4ZOX A;  3ODT A;  3GFC A;  4GM9 A;  3PSL A;  3IIW A;  4H5J A;  4JD2 C;  3EG6 A;  4Z8L A;  4E5Z A;  4R7A B;  3DXM C;  1MG3 A;  3A0F A;  3NVN A;  1SQJ A;  3OL2 A;  3EI1 B;  3OKY A;  4JXM A;  3I7L A;  4GQB B;  3SMR A;  4CI8 A;  4A0A A;  3NVX A;  2PM9 B;  3MZK A;  3OTT A;  3RSE C;  3C9C A;  4ZOY A;  5AFU 3;  2I3T A;  3FGB A;  3SWS D;  2P9I C;  2J55 H;  3I7O A;  2AGW A;  3AL8 A;  5IJ7 E;  5HE3 B;  4X63 B;  3SLE D;  3SN6 B;  3CIK B;  3SBR A;  4JT6 C;  4CY3 A;  4O45 A;  4K3I D;  4J81 A;  4CZY A;  4J8B A;  4U7A A;  4A08 A;  3KRX B;  3AL9 A;  3KRW B;  5HE1 B;  5FKR A;  2HKM A;  4A09 A;  5HE2 B;  3AL8 B;  2YNO A;  1A0R B;  4D6V A;  3C5M A;  3RLM D;  1QNI A;  1JOF A;  3IJ0 A;  2UZY B;  2G9A A;  4FWW A;  3HFQ A;  4A0A B;  4J79 A;  4FHL A;  4AOW A;  2H9M A;  1GP2 B;  3SBP A;  3GRE A;  5EAL A;  1PGU A;  4GQ1 A;  3FM0 A;  2IUQ A;  3W15 A;  4J73 A;  4Y7R A;  2B4E A;  2XL3 A;  3BWS A;  4ZN4 A;  2PM9 A;  4HDJ A;  1K8K C;  5B4W A;  3OKW A;  2CE8 A;  3NVQ A;  5IC7 A;  4G56 B;  5EAM A;  2I0T A;  2AGY A;  1GOT B;  2BCJ B;  4X61 B;  4IA9 A;  2H3X A;  4BL0 A;  5H17 A;  1PI6 A;  2H47 A;  3VGZ A;  4XYI A;  2IUV A;  5C2V B;  3CFV A;  4E5Z B;  4A08 B;  3VH0 A;  4CZX A;  1N6E A;  4X3E A;  3RN0 D;  1L0Q A;  1SHY B;  4PSX B;  2P9N C;  1K32 A;  4L3G D;  3SCY A;  2HES X;  4J86 A;  2GC4 A;  5FLX g;  5JWZ A;  4MK0 B;  4KFM B;  4PBY A;  4J8G A;  3I7K A;  2HYE A;  2AGZ A;  5I5I A;  3DSM A;  3V9F A;  2I3S A;  5FXY A;  3ZWL B;  5A2Q g;  2PM7 B;  2CN2 A; 
#chains in the Genus database with same CATH topology
 3JZN A;  4BH6 A;  2I0R A;  4G1M A;  4A11 A;  3MUN A;  1QFS A;  3MZL A;  4GGD A;  4CY1 A;  2CE9 A;  2XYI A;  3IUQ A;  3UKU C;  1GOH A;  3I89 A;  3UVL A;  2OVQ B;  4BCC A;  2QZP A;  2AH1 A;  3AH8 B;  3V7D B;  1R5M A;  4J82 A;  2CNX A;  2YBA A;  4D9S A;  4Y5R D;  4J78 A;  4AN1 A;  3BG1 A;  4FAV D;  3C99 A;  1VE7 A;  3OKT A;  3RRM C;  3FCS A;  2H6Q A;  4FA1 D;  4FA9 D;  4JT5 C;  3IVM A;  1JJU B;  5M5T A;  4L1M A;  2YNN A;  3EI3 B;  5E6S A;  4BP9 A;  3SXT D;  4DNV A;  4J84 A;  4ERZ A;  3NID A;  4GGC A;  1XHM A;  3SVW D;  4FAN D;  2BKL A;  2TRC B;  3UVK A;  2YMU A;  5EM2 B;  3I7P A;  3UVO A;  2H9N A;  1U2V C;  4AN0 A;  4CC9 A;  2HXC A;  3JZH A;  3SHF A;  4H5I A;  2AQ5 A;  2OVR B;  4AMY A;  3BG0 A;  5EAP A;  4ESG A;  4GM3 A;  2QC5 A;  4FB1 D;  4E54 B;  4NSX A;  2VDL A;  3RMZ D;  4MMY A;  4AEZ A;  1UOQ A;  3N0E A;  3OF7 A;  4A2M A;  2OK6 A;  4A0B A;  3O4J A;  1VYH C;  4GQ2 P;  2H6K A;  1OMW B;  2IWF A;  3PXT D;  5IT9 g;  1NR0 A;  1H2Z A;  4A7J A;  5TDH B;  3GC3 B;  3OW8 A;  1JMX B;  3DWL C;  3EI4 B;  3J81 g;  4GMB A;  3EMH A;  4PSW B;  1SQ9 A;  2P9L C;  5EAR A;  3VA6 A;  4J0X A;  5FA5 B;  1PEV A;  3FRX A;  3N0D A;  1UOP A;  3CFS B;  5CXB B;  3NIG A;  5EM2 A;  4IRZ A;  3IIY A;  3B7F A;  4QQE A;  3JB9 L;  2B5L A;  3IJC A;  4Z7O A;  3EWE A;  2OJY A;  3PSC B;  3UR4 A;  2H14 A;  3PVW B;  4ERQ A;  2XZG A;  3RFG A;  4X60 B;  3I8C A;  1E8M A;  2VC2 A;  1L5G A;  5C86 A;  2P9P C;  3AFC A;  4QL1 A;  5C9Z B;  2VDQ A;  1B9Y A;  3EQ8 A;  4A11 B;  4OWR A;  5I5M A;  3ZE1 A;  5CXC A;  5GMK n;  2B5N A;  2GC7 A;  3RFH A;  4LGN A;  5C92 A;  2AGX A;  3PXW D;  4O9D A;  3J80 g;  4XEI C;  2IUR A;  3I8E A;  3EU7 A;  4J0W A;  2OVP B;  2OK4 A;  5H14 A;  2YNP A;  2VDR A;  4Z7N A;  1C9L A;  3ULE C;  1VE6 A;  3P4F A;  1VZ3 A;  1XKS A;  2VZ1 A;  2VDM A;  3O4I A;  1U4C A;  4A09 B;  4BUJ C;  2IAA A;  4BP8 A;  3E0C A;  1NEX B;  1S4U X;  4L1Q D;  2G99 A;  3F3P A;  1B9X A;  4GGA A;  2OIZ A;  1Q47 A;  3JAM g;  4ZOV A;  2HU5 A;  5HDB A;  2AGL A;  4O1Q D;  3EQ9 A;  2EIE A;  4UI9 R;  2HU7 A;  2EBS A;  3MXX A;  4ZOZ A;  3ZE0 A;  1XIP A;  1E5T A;  3DM0 A;  5SXM A;  4GZ8 A;  5HYN B;  2Z2N A;  5THA A;  3IUJ A;  2IWK A;  3L4O D;  3IJE A;  5IGQ A;  4PNK B;  5IGO A;  1N6F A;  2P9S C;  4PBZ A;  3QI0 A;  4JSP C;  4WJK A;  3K71 A;  4O3U B;  5FFO A;  4QT8 A;  3T3M A;  3MMY A;  5GSA A;  5EMJ B;  3C75 H;  1GOG A;  3ORV D;  3L4M D;  1TBG A;  3EI2 B;  4U1E I;  3OKY B;  1PBY B;  4IMM A;  2H13 A;  2H9L A;  4MMZ A;  5FKS A;  3JRP A;  3IJ1 A;  1JTD B;  5IJ8 E;  4DNU A;  4TZ4 A;  2XL2 A;  4CY5 A;  5CYK B;  4CZV A;  3EI2 A;  3K6S A;  1FWX A;  4GM8 A;  3UVN A;  1JMZ B;  4L3H D;  2YB8 B;  4AMZ A;  4CI2 A;  5TF2 A;  4FA4 D;  2P9K C;  3VI4 A;  5EMM B;  3I2N A;  5CYK A;  2HJ4 A;  1P22 A;  3K26 A;  2CN3 A;  4I79 A;  2Q7Q A;  3SJL D;  4EWR A;  3EI1 A;  4JHP C;  1RI6 A;  4FA5 D;  4CI3 A;  3PXS D;  3F3F A;  2VDN A;  3JRO A;  2HU8 A;  2Z2P A;  2B5M A;  2MTA H;  4D0K A;  3IUN A;  2H9P A;  5FKQ A;  2P9U C;  4JSX C;  1O6F A;  4LG9 A;  3I7N A;  2GNQ A;  4A2L A;  1MG2 A;  5K19 A;  3ZE2 A;  4BCB A;  2W18 A;  5I5J A;  3IKO A;  2HKR A;  3I7H A;  2H68 A;  2JKX A;  4N14 A;  4QRJ A;  1T2X A;  5FKT A;  5M5S A;  5GXH A;  5EML B;  2IUP A;  4G55 A;  4O3T B;  5AMS A;  2EID A;  4O2W A;  3SBQ A;  3F3G A;  4LG8 A;  4PXW A;  4NC4 A;  2O9K A;  5KDO B;  2PBI B;  2XU7 A;  1MDA H;  4NEN A;  5CXC B;  4ERY A;  5C2W B;  3V5W B;  4G1E A;  1N6D A;  5TEF A;  5TEE A;  4CY2 A;  4ES0 A;  3IUM A;  2PM6 B;  1YFQ A;  3K27 A;  3NIF A;  1QFM A;  1TYE A;  4K3J B;  5AJA A;  3PE7 A;  2VDP A;  4JSN C;  5E6R A;  5CXB A;  2QXV A;  4L9O A;  5HQG A;  4XYH A;  2H6N A;  3SFZ A;  2CO0 C;  2AH0 A;  2QR5 A;  3OL2 B;  2J57 G;  2BBK H;  3MVD K;  2Z2O A;  3UKR C;  1I2M B;  4YVD A;  1TYQ C;  1UOO A;  3JZG A;  5HE0 B;  5GXI A;  1ERJ A;  5EMK B;  2CO0 A;  3MKS B;  4RE6 A;  3UVM A;  2EIB A;  4A0B B;  1GXR A;  3DXK C;  3JPX A;  2I0S A;  4OZU A;  2HJB A;  4RE5 A;  1BPO A;  5FQD A;  4PC0 A;  1GG2 B;  3FCU A;  3U4Y A;  3EI4 A;  4O02 A;  2J56 H;  4CI1 A;  2VDO A;  4J77 A;  3MKQ A;  3PVU B;  5H1M A;  1H2X A;  5M5U A;  2XE4 A;  2VZ3 A;  2UZX B;  3ZDY A;  4E54 A;  4J87 A;  3RN1 D;  3EI3 A;  4JSV C;  1OLZ A;  5K1C C;  4ZOX A;  3ODT A;  4AX4 A;  3GFC A;  4GM9 A;  3PSL A;  3IIW A;  5FFG A;  4H5J A;  4NBM A;  5M5V A;  3O4G A;  4JD2 C;  3EG6 A;  4Z8L A;  3V4V A;  4E5Z A;  5M61 A;  3ZDZ A;  4R7A B;  3DXM C;  1MG3 A;  3NVN A;  3A0F A;  1SQJ A;  3OL2 A;  4WK2 A;  3EI1 B;  1A12 A;  3OKY A;  4JXM A;  3I7L A;  4GQB B;  3KCI A;  1UTC A;  5M5R A;  3SMR A;  4CI8 A;  4A0A A;  3NVX A;  2PM9 B;  1E8N A;  3MZK A;  3OTT A;  3RSE C;  3C9C A;  1JV2 A;  4ZOY A;  5AFU 3;  2I3T A;  3FGB A;  3SWS D;  2P9I C;  3DDU A;  3O4H A;  1U8C A;  2J55 H;  3I7O A;  2AGW A;  3AL8 A;  5IJ7 E;  4QAM A;  5HE3 B;  4WK0 A;  3K72 A;  4X63 B;  3SLE D;  4MMX A;  3SN6 B;  3CIK B;  3SBR A;  4JT6 C;  4CY3 A;  4O45 A;  3VI3 A;  4K3I D;  4J81 A;  1H2Y A;  4BCD A;  4CZY A;  4J8B A;  4U7A A;  4A08 A;  3KRX B;  3AL9 A;  3KRW B;  5HE1 B;  5FKR A;  2HKM A;  4A09 A;  5HE2 B;  3AL8 B;  2YNO A;  1A0R B;  4D6V A;  3C5M A;  3RLM D;  3MUO A;  1QNI A;  1JOF A;  3IJ0 A;  2UZY B;  2G9A A;  4FWW A;  3HFQ A;  4A0A B;  4J79 A;  4FHL A;  4AOW A;  3QHY B;  2H9M A;  1GP2 B;  1H2W A;  3SBP A;  1C9I A;  3GRE A;  5EAL A;  3T3P A;  1PGU A;  4GQ1 A;  3FM0 A;  2IUQ A;  3W15 A;  4UM8 A;  4J73 A;  4Y7R A;  2B4E A;  2XL3 A;  3BWS A;  4ZN4 A;  2PM9 A;  3IUL A;  4HDJ A;  2XDW A;  3V4P A;  4UM9 A;  1GOF A;  1K8K C;  5B4W A;  3OKW A;  2CE8 A;  3NVQ A;  5IC7 A;  4G56 B;  5EAM A;  2I0T A;  2VDK A;  2AGY A;  1GOT B;  2BCJ B;  4X61 B;  4IA9 A;  2H3X A;  4BL0 A;  4DNW A;  5H17 A;  1PI6 A;  4WK4 A;  2H47 A;  3VGZ A;  2WQ8 A;  4XYI A;  2IUV A;  5C2V B;  3CFV A;  4JHN A;  4E5Z B;  1M1X A;  4A08 B;  3VH0 A;  4NAA A;  4CZX A;  1N6E A;  4X3E A;  3RN0 D;  1L0Q A;  1SHY B;  4PSX B;  3IUR A;  3ZDX A;  2P9N C;  4Z7Q A;  1K32 A;  4L3G D;  3SCY A;  2HES X;  1YR2 A;  4J86 A;  2GC4 A;  5FLX g;  5E6U A;  3GD1 I;  5JWZ A;  4MK0 B;  4KFM B;  4PBY A;  4J8G A;  3I7K A;  2HYE A;  2AGZ A;  5I5I A;  3DSM A;  3EQ7 A;  3V9F A;  1VZ2 A;  1K3I A;  2I3S A;  1O6G A;  5FXY A;  3ZWL B;  5A2Q g;  2PM7 B;  2EIC A;  2CN2 A; 
#chains in the Genus database with same CATH homology
 3JZN A;  4BH6 A;  2I0R A;  4A11 A;  3MZL A;  4GGD A;  4CY1 A;  2CE9 A;  2XYI A;  3UKU C;  3UVL A;  3I89 A;  2OVQ B;  2AH1 A;  3AH8 B;  3V7D B;  1R5M A;  4J82 A;  2CNX A;  2YBA A;  4Y5R D;  4J78 A;  3BG1 A;  4FAV D;  3C99 A;  3OKT A;  3RRM C;  2H6Q A;  4FA1 D;  4FA9 D;  4JT5 C;  1JJU B;  2YNN A;  3EI3 B;  3SXT D;  4J84 A;  4ERZ A;  4GGC A;  1XHM A;  3SVW D;  4FAN D;  2TRC B;  3UVK A;  2YMU A;  5EM2 B;  3I7P A;  3UVO A;  2H9N A;  1U2V C;  4CC9 A;  2HXC A;  3JZH A;  3SHF A;  4H5I A;  2AQ5 A;  2OVR B;  3BG0 A;  5EAP A;  4ESG A;  4GM3 A;  2QC5 A;  4FB1 D;  4E54 B;  4NSX A;  3RMZ D;  4AEZ A;  3N0E A;  4A2M A;  2OK6 A;  4A0B A;  1VYH C;  4GQ2 P;  2H6K A;  1OMW B;  2IWF A;  3PXT D;  5IT9 g;  1NR0 A;  4A7J A;  5TDH B;  1JMX B;  3OW8 A;  3DWL C;  3EI4 B;  3J81 g;  4GMB A;  3EMH A;  4PSW B;  1SQ9 A;  2P9L C;  5EAR A;  3VA6 A;  4J0X A;  5FA5 B;  1PEV A;  3FRX A;  3N0D A;  3CFS B;  5CXB B;  5EM2 A;  3IIY A;  3B7F A;  4QQE A;  3JB9 L;  2B5L A;  3IJC A;  3EWE A;  2OJY A;  3PSC B;  3UR4 A;  2H14 A;  3PVW B;  4ERQ A;  3RFG A;  4X60 B;  3I8C A;  2P9P C;  3AFC A;  4QL1 A;  5C9Z B;  1B9Y A;  4A11 B;  4OWR A;  5I5M A;  5CXC A;  5GMK n;  2B5N A;  2GC7 A;  3RFH A;  4LGN A;  2AGX A;  3PXW D;  4O9D A;  3J80 g;  4XEI C;  2IUR A;  3I8E A;  3EU7 A;  4J0W A;  2OVP B;  2OK4 A;  5H14 A;  2YNP A;  3ULE C;  3P4F A;  1XKS A;  1U4C A;  4A09 B;  4BUJ C;  2IAA A;  3E0C A;  1NEX B;  1S4U X;  4L1Q D;  2G99 A;  3F3P A;  1B9X A;  4GGA A;  2OIZ A;  1Q47 A;  3JAM g;  4ZOV A;  2AGL A;  4O1Q D;  4UI9 R;  2EBS A;  3MXX A;  4ZOZ A;  1XIP A;  3DM0 A;  5SXM A;  5HYN B;  4GZ8 A;  2Z2N A;  5THA A;  2IWK A;  3L4O D;  5IGQ A;  4PNK B;  5IGO A;  1N6F A;  2P9S C;  4PBZ A;  4JSP C;  4O3U B;  4QT8 A;  3MMY A;  5GSA A;  5EMJ B;  3C75 H;  3ORV D;  3L4M D;  1TBG A;  3EI2 B;  4U1E I;  4IMM A;  1PBY B;  3OKY B;  2H13 A;  2H9L A;  5FKS A;  3JRP A;  3IJ1 A;  5IJ8 E;  4TZ4 A;  2XL2 A;  4CY5 A;  5CYK B;  4CZV A;  3EI2 A;  1FWX A;  4GM8 A;  3UVN A;  1JMZ B;  4L3H D;  2YB8 B;  4CI2 A;  5TF2 A;  4FA4 D;  2P9K C;  5EMM B;  3I2N A;  5CYK A;  2HJ4 A;  4I79 A;  1P22 A;  3K26 A;  2CN3 A;  2Q7Q A;  3SJL D;  4EWR A;  3EI1 A;  1RI6 A;  4FA5 D;  4CI3 A;  3PXS D;  3F3F A;  3JRO A;  2Z2P A;  2B5M A;  2MTA H;  4D0K A;  2H9P A;  5FKQ A;  2P9U C;  4JSX C;  4LG9 A;  3I7N A;  2GNQ A;  4A2L A;  1MG2 A;  5K19 A;  2W18 A;  5I5J A;  3IKO A;  2HKR A;  3I7H A;  2H68 A;  4N14 A;  4QRJ A;  5FKT A;  5GXH A;  5EML B;  2IUP A;  4O3T B;  5AMS A;  3SBQ A;  3F3G A;  4LG8 A;  4PXW A;  2O9K A;  5KDO B;  2PBI B;  2XU7 A;  1MDA H;  5CXC B;  4ERY A;  5C2W B;  3V5W B;  1N6D A;  5TEF A;  5TEE A;  4CY2 A;  4ES0 A;  2PM6 B;  1YFQ A;  3K27 A;  4K3J B;  5AJA A;  3PE7 A;  4JSN C;  5CXB A;  2QXV A;  4L9O A;  5HQG A;  4XYH A;  2H6N A;  3SFZ A;  2CO0 C;  2AH0 A;  3OL2 B;  2J57 G;  2BBK H;  2Z2O A;  3UKR C;  4YVD A;  1TYQ C;  3JZG A;  5HE0 B;  5GXI A;  1ERJ A;  5EMK B;  2CO0 A;  3MKS B;  3UVM A;  4A0B B;  1GXR A;  3DXK C;  3JPX A;  2I0S A;  4OZU A;  2HJB A;  5FQD A;  4PC0 A;  1GG2 B;  3U4Y A;  3EI4 A;  2J56 H;  4CI1 A;  4J77 A;  3MKQ A;  3PVU B;  5H1M A;  2UZX B;  4E54 A;  4J87 A;  3RN1 D;  3EI3 A;  4JSV C;  1OLZ A;  5K1C C;  4ZOX A;  3ODT A;  3GFC A;  4GM9 A;  3PSL A;  3IIW A;  4H5J A;  4JD2 C;  3EG6 A;  4Z8L A;  4E5Z A;  4R7A B;  3DXM C;  1MG3 A;  3A0F A;  3NVN A;  1SQJ A;  3OL2 A;  3EI1 B;  3OKY A;  4JXM A;  3I7L A;  4GQB B;  3SMR A;  4CI8 A;  4A0A A;  3NVX A;  2PM9 B;  3MZK A;  3OTT A;  3RSE C;  3C9C A;  4ZOY A;  5AFU 3;  2I3T A;  3FGB A;  3SWS D;  2P9I C;  2J55 H;  3I7O A;  2AGW A;  3AL8 A;  5IJ7 E;  5HE3 B;  4X63 B;  3SLE D;  3SN6 B;  3CIK B;  3SBR A;  4JT6 C;  4CY3 A;  4O45 A;  4K3I D;  4J81 A;  4CZY A;  4J8B A;  4U7A A;  4A08 A;  3KRX B;  3AL9 A;  3KRW B;  5HE1 B;  5FKR A;  2HKM A;  4A09 A;  5HE2 B;  3AL8 B;  2YNO A;  1A0R B;  4D6V A;  3C5M A;  3RLM D;  1QNI A;  1JOF A;  3IJ0 A;  2UZY B;  2G9A A;  4FWW A;  3HFQ A;  4A0A B;  4J79 A;  4FHL A;  4AOW A;  2H9M A;  1GP2 B;  3SBP A;  3GRE A;  5EAL A;  1PGU A;  4GQ1 A;  3FM0 A;  2IUQ A;  3W15 A;  4J73 A;  4Y7R A;  2B4E A;  2XL3 A;  3BWS A;  4ZN4 A;  2PM9 A;  4HDJ A;  1K8K C;  5B4W A;  3OKW A;  2CE8 A;  3NVQ A;  5IC7 A;  4G56 B;  5EAM A;  2I0T A;  2AGY A;  1GOT B;  2BCJ B;  4X61 B;  4IA9 A;  2H3X A;  4BL0 A;  5H17 A;  1PI6 A;  2H47 A;  3VGZ A;  4XYI A;  2IUV A;  5C2V B;  3CFV A;  4E5Z B;  4A08 B;  3VH0 A;  4CZX A;  1N6E A;  4X3E A;  3RN0 D;  1L0Q A;  1SHY B;  4PSX B;  2P9N C;  1K32 A;  4L3G D;  3SCY A;  2HES X;  4J86 A;  2GC4 A;  5FLX g;  5JWZ A;  4MK0 B;  4KFM B;  4PBY A;  4J8G A;  3I7K A;  2HYE A;  2AGZ A;  5I5I A;  3DSM A;  3V9F A;  2I3S A;  5FXY A;  3ZWL B;  5A2Q g;  2PM7 B;  2CN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...