2TRCB

Phosducin/transducin beta-gamma complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
340
structure length
340
Chain Sequence
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSDUCIN
publication title Crystal structure at 2.4 angstroms resolution of the complex of transducin betagamma and its regulator, phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Complex (transducer/transduction)
total genus 111
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2trcB00
5IC7A 2IUQA 1SHYB 5FLXg 3EG6A 2CN3A 3HFQA 1N6EA 5GMKn 2O9KA 4LG9A 1B9YA 5FKQA 4AEZA 2GC7A 2AGWA 3IIWA 3EI1B 2GC4A 4CY5A 4QQEA 4ZOXA 1N6DA 3GFCA 4JT5C 2HKMA 3UKRC 3PXWD 3ULEC 3VGZA 1MG3A 4GM3A 5FKSA 1JOFA 4CI2A 3F3PA 2J57G 1VYHC 4XEIC 3UKUC 1FWXA 1QNIA 3SFZA 3SHFA 5FKTA 3KRXB 5TDHB 3EI1A 3ORVD 4O1QD 2Q7QA 2YNOA 3DSMA 3RN0D 2OVPB 4CY1A 4LG8A 4J8BA 2B5NA 4O9DA 3NVNA 4PBZA 5I5JA 1PBYB 2OVRB 4H5JA 3EU7A 4FA5D 4ZOVA 2I3SA 1XKSA 4CI8A 3JAMg 3C9CA 4JSVC 3SBPA 3C5MA 5I5MA 4QT8A 3C75H 3EI4B 2CO0C 4GGAA 4FAVD 5EMLB 3A0FA 4PSWB 3E0CA 3MKSB 3F3FA 2BCJB 4A08B 3BG0A 3SBQA 3OTTA 3EWEA 5AFU3 2B4EA 4J0XA 3EI4A 3I2NA 4J77A 2PM6B 3V5WB 3I7OA 3NVQA 3MZKA 2G99A 5AJAA 3SCYA 4Y7RA 2OK6A 4PC0A 5EM2B 4A08A 5GXIA 3JZGA 4PBYA 3ZWLB 1K8KC 1U2VC 2J55H 4I79A 3JPXA 3PSCB 2B5MA 2P9UC 3UR4A 4BUJC 3K27A 2I0RA 3RLMD 2W18A 3BWSA 1GG2B 3RN1D 2IAAA 5K19A 2CE9A 5EMKB 4JT6C 4FA9D 1MG2A 3I7KA 4K3JB 2P9SC 4QRJA 4O45A 4R7AB 4O3UB 3L4MD 5EM2A 5TF2A 5FQDA 2CNXA 2I3TA 2BBKH 2YB8B 4L1QD 3I89A 4H5IA 3SMRA 5EARA 1P22A 4CC9A 1NR0A 4CY3A 5EMMB 3RFGA 4A09B 5HE1B 2YNPA 4GZ8A 2CO0A 1NEXB 3DWLC 3JZHA 3ODTA 4L3HD 2H6NA 1GOTB 3B7FA 4A2LA 2IUPA 4CZXA 3DXKC 2HYEA 3RRMC 4J87A 4JSXC 4O3TB 5FA5B 4IMMA 5C2VB 1PEVA 2PM9B 4QL1A 4A0AB 4A09A 2UZXB 2CE8A 3OW8A 4ZOYA 2HESX 5HYNB 3P4FA 4HDJA 3JZNA 1RI6A 4J73A 2H6QA 3UVLA 4D6VA 2I0SA 1B9XA 3AFCA 3AL9A 4BL0A 2P9PC 1JJUB 3I8EA 4GM9A 4CZYA 5KDOB 3EI3B 3FRXA 2Z2NA 4PSXB 2PM9A 2XL3A 2OJYA 2H13A 4PNKB 5HE3B 4A0AA 1JMZB 2HXCA 1TBGA 1OLZA 5CYKB 3CIKB 3MXXA 3NVXA 4L9OA 3FM0A 4J79A 5IGOA 2H68A 4JXMA 2H14A 3I7LA 4FB1D 4GGDA 3BG1A 2H6KA 3IIYA 4GQ2P 2XYIA 4JD2C 4IA9A 4ZN4A 5IT9g 4J84A 5FXYA 3N0EA 5HQGA 2AGXA 2PBIB 3EI3A 4GGCA 3DXMC 1OMWB 1XIPA 4GM8A 1YFQA 5TEEA 3JROA 3MKQA 2IWFA 2QXVA 3IJ0A 3PXSD 5CYKA 3SVWD 2MTAH 2IUVA 4U1EI 4A2MA 4FWWA 5SXMA 4J0WA 4CZVA 4ERQA 4ESGA 3MMYA 3JB9L 1A0RB 2AGZA 1Q47A 3J80g 4A0BB 1K32A 3UVMA 2H9NA 1R5MA 4X63B 4ERZA 3PXTD 5AMSA 3CFSB 3GREA 3EI2B 4NSXA 5HE0B 2Z2OA 1L0QA 2P9NC 4CY2A 2OVQB 3C99A 4J8GA 2EBSA 1MDAH 1TYQC 4GQ1A 5K1CC 5IJ7E 2HKRA 3PE7A 4A0BA 2H9PA 3OKWA 5EAMA 3VA6A 3N0DA 3OKTA 5GXHA 3EI2A 3VH0A 4FAND 3L4OD 4D0KA 3SXTD 4Y5RD 3FGBA 2AH1A 5A2Qg 2XU7A 5CXBB 2CN2A 3SWSD 4L3GD 4X3EA 2H47A 5I5IA 2P9LC 5H17A 4J78A 2PM7B 3OKYB 4G56B 3V9FA 4GQBB 4J81A 2YMUA 4CI1A 3UVOA 2H9LA 3CFVA 3F3GA 5THAA 4E5ZB 2P9IC 5CXBA 3MZLA 1PGUA 2IURA 1U4CA 3PVWB 4UI9R 4FA4D 3UVNA 1N6FA 2J56H 3OKYA 4XYIA 5EMJB 4A7JA 2OIZA 4EWRA 3J81g 3I7NA 4J86A 3AL8B 2OK4A 2Z2PA 4LGNA 2TRCB 4E5ZA 1ERJA 2H3XA 1PI6A 2YNNA 1SQJA 2AQ5A 4FHLA 5TEFA 4J82A 2QC5A 3W15A 4JSNC 5B4WA 4OZUA 5CXCB 5GSAA 4JSPC 4GMBA 4U7AA 3SJLD 3PSLA 5H14A 4A11B 1S4UX 3V7DB 3AL8A 3IKOA 4OWRA 3RFHA 4ZOZA 2IWKA 2AH0A 2H9MA 2XL2A 4ES0A 3PVUB 2B5LA 3OL2B 4K3ID 5EAPA 3JRPA 3RMZD 4CI3A 2HJ4A 4PXWA 4BH6A 3EMHA 3SLED 4E54B 3IJCA 4MK0B 5CXCA 3K26A 5FKRA 1JMXB 3SBRA 1GP2B 4X61B 3I7PA 2GNQA 4A11A 5JWZA 5HE2B 5IGQA 4X60B 4FA1D 2G9AA 5IJ8E 3KRWB 2AGLA 1XHMA 4KFMB 3OL2A 1SQ9A 3I8CA 4TZ4A 2UZYB 4ERYA 4AOWA 3SN6B 3U4YA 5EALA 2P9KC 2YBAA 3RSEC 5C9ZB 2AGYA 5H1MA 4E54A 4XYHA 4YVDA 3I7HA 3IJ1A 1GXRA 5C2WB 4N14A 3AH8B 4Z8LA 3UVKA 2HJBA 3DM0A 2I0TA
chains in the Genus database with same CATH superfamily
3O4HA 5IC7A 2IUQA 1SHYB 5FLXg 3EG6A 3NIDA 2CN3A 3HFQA 3NIFA 3VI3A 1N6EA 5GMKn 2O9KA 4AMZA 3IUNA 4LG9A 1B9YA 2VDQA 5FKQA 4AEZA 2GC7A 2AGWA 3IIWA 3K72A 3EI1B 2GC4A 4CY5A 4QQEA 4AX4A 4ZOXA 1N6DA 3ZE2A 3GFCA 4JT5C 5C92A 2HKMA 4UM8A 3UKRC 3PXWD 3K6SA 3ULEC 3VGZA 1MG3A 4RE5A 4GM3A 5FKSA 1JOFA 4CI2A 3F3PA 2J57G 1VYHC 4XEIC 3UKUC 1FWXA 1QNIA 3SFZA 4WK0A 3SHFA 5FKTA 3KRXB 5TDHB 3EI1A 3ORVD 4O1QD 2Q7QA 2YNOA 3DSMA 3RN0D 2OVPB 4CY1A 4LG8A 4J8BA 2B5NA 4O9DA 2XE4A 3IVMA 3NVNA 4PBZA 5I5JA 1O6FA 3IUJA 1PBYB 2OVRB 1BPOA 4H5JA 3EU7A 4FA5D 4ZOVA 2I3SA 1XKSA 4CI8A 3JAMg 3C9CA 4JSVC 3SBPA 3C5MA 5I5MA 4QT8A 3C75H 2XDWA 3EI4B 2CO0C 4GGAA 3ZE1A 4RE6A 4FAVD 5EMLB 4Z7NA 3A0FA 4PSWB 3E0CA 5M5VA 3MKSB 3F3FA 2BCJB 4A08B 5M61A 3BG0A 3SBQA 2VZ3A 3OTTA 1UOOA 3EWEA 5AFU3 5E6SA 4O02A 4WK2A 3O4GA 2B4EA 4J0XA 3EI4A 4DNVA 1C9LA 3I2NA 5M5SA 2EIDA 4J77A 1U8CA 4NENA 2PM6B 4BP8A 3V5WB 3I7OA 3NVQA 3ZDZA 3MZKA 2G99A 5AJAA 4MMYA 3SCYA 2VDKA 4Y7RA 2OK6A 4PC0A 3T3MA 5EM2B 3VI4A 4A08A 5GXIA 3FCUA 3JZGA 4PBYA 3ZWLB 3IUMA 1K8KC 1U2VC 2J55H 4AN1A 4I79A 3JPXA 3PSCB 1M1XA 2B5MA 2P9UC 3NIGA 3UR4A 2VDNA 3GD1I 3K27A 4BUJC 2I0RA 3RLMD 2W18A 1GOGA 3BWSA 3OF7A 1GG2B 3RN1D 2IAAA 5K19A 2CE9A 5EMKB 2QR5A 2BKLA 4JT6C 4FA9D 1VZ3A 1MG2A 3I7KA 4K3JB 2P9SC 4QRJA 4O45A 4R7AB 4O3UB 3L4MD 5EM2A 5TF2A 5FQDA 2CNXA 2I3TA 2BBKH 2YB8B 3IJEA 4L1QD 3I89A 4H5IA 1VE6A 3SMRA 4BP9A 5EARA 1P22A 4CC9A 1NR0A 4CY3A 5EMMB 3RFGA 4A09B 5HE1B 2VDRA 2YNPA 4AN0A 4GZ8A 2VZ1A 2CO0A 4DNUA 4MMZA 5FFOA 5M5TA 1NEXB 3DWLC 3JZHA 3ODTA 4L3HD 2H6NA 1GOTB 3B7FA 4A2LA 1JTDB 2IUPA 4CZXA 3DXKC 2HYEA 3RRMC 1E8NA 4J87A 5E6UA 5M5RA 4JSXC 4O3TB 5FA5B 4IMMA 5C2VB 1PEVA 2PM9B 4QL1A 4A0AB 4A09A 2UZXB 1VE7A 2CE8A 2WQ8A 3OW8A 4ZOYA 2HESX 5HYNB 3P4FA 4HDJA 1H2ZA 3MVDK 3V4PA 3IUQA 3JZNA 1RI6A 4J73A 5HDBA 1UTCA 2H6QA 3UVLA 4D6VA 2I0SA 4NC4A 1B9XA 3AFCA 3AL9A 4BL0A 1A12A 2P9PC 1JJUB 3I8EA 4GM9A 4CZYA 5KDOB 1K3IA 3EI3B 3FRXA 2Z2NA 4PSXB 2PM9A 2XL3A 2OJYA 1T2XA 2H13A 4PNKB 5HE3B 4A0AA 2JKXA 1JMZB 4NAAA 2HXCA 3EQ7A 1TBGA 1OLZA 2HU8A 5CYKB 3CIKB 3MXXA 3NVXA 4L9OA 3FM0A 4J79A 5IGOA 2H68A 4JXMA 2H14A 3I7LA 4FB1D 4GGDA 3MUNA 3BG1A 2H6KA 1O6GA 3IIYA 4GQ2P 4UM9A 2XYIA 4JD2C 5M5UA 4IA9A 1C9IA 4ZN4A 5IT9g 4J84A 5FXYA 3N0EA 5HQGA 2AGXA 2PBIB 3EI3A 4GGCA 3DXMC 1OMWB 1XIPA 3O4IA 4GM8A 1YFQA 5TEEA 4JHNA 3MKQA 3JROA 2IWFA 2QXVA 3IJ0A 3PXSD 5CYKA 3SVWD 2MTAH 2IUVA 4U1EI 2VDOA 4A2MA 4FWWA 4Z7QA 5SXMA 4J0WA 4D9SA 4CZVA 4ERQA 3IURA 4ESGA 3MMYA 3JB9L 1A0RB 2AGZA 1Q47A 3J80g 4A0BB 1K32A 3UVMA 2H9NA 1R5MA 4G1EA 4X63B 4ERZA 3PXTD 5AMSA 3CFSB 3GREA 3EI2B 4NSXA 5HE0B 2Z2OA 3EQ9A 1L0QA 2P9NC 4WK4A 3EQ8A 3C99A 4J8GA 2OVQB 4CY2A 2HU5A 2EBSA 1MDAH 1TYQC 4Z7OA 3GC3B 4GQ1A 5K1CC 5IJ7E 2HKRA 1E8MA 3PE7A 4A0BA 2H9PA 3OKWA 5EAMA 3VA6A 3N0DA 3OKTA 5GXHA 4AMYA 5C86A 3EI2A 3VH0A 4FAND 1QFSA 3L4OD 4JHPC 4D0KA 3SXTD 4G55A 4MMXA 5E6RA 4Y5RD 3FGBA 2AH1A 1H2WA 4WJKA 3ZDXA 5A2Qg 2XU7A 3KCIA 5CXBB 2CN2A 4NBMA 3SWSD 4L3GD 4X3EA 2H47A 5I5IA 2P9LC 5H17A 4J78A 3QI0A 2PM7B 3OKYB 4G56B 3V9FA 4GQBB 4J81A 2YMUA 3ZDYA 4CI1A 3UVOA 3FCSA 2H9LA 1UOPA 3CFVA 3F3GA 5FFGA 5THAA 2EIEA 4E5ZB 2P9IC 5CXBA 3MZLA 4BCBA 1PGUA 2IURA 1U4CA 3PVWB 4UI9R 4FA4D 3UVNA 1N6FA 2J56H 2VDMA 3OKYA 4XYIA 1H2XA 5EMJB 4A7JA 2VDPA 4BCDA 2OIZA 4EWRA 3J81g 1YR2A 3I7NA 4J86A 3AL8B 2OK4A 2Z2PA 1UOQA 4LGNA 2TRCB 1VZ2A 4E5ZA 1ERJA 2H3XA 1TYEA 1PI6A 2YNNA 1SQJA 2AQ5A 4FHLA 5TEFA 4QAMA 3IULA 4J82A 1GOHA 2QC5A 2VDLA 3MUOA 3W15A 1E5TA 4JSNC 2EICA 5B4WA 4OZUA 5CXCB 5GSAA 4JSPC 4GMBA 4U7AA 3SJLD 2QZPA 3PSLA 5H14A 4A11B 1S4UX 3V7DB 1H2YA 3AL8A 1I2MB 3ZE0A 3IKOA 4OWRA 3RFHA 4ZOZA 2IWKA 2EIBA 2AH0A 2H9MA 2XL2A 4ES0A 3PVUB 2B5LA 3OL2B 4K3ID 5EAPA 3T3PA 3JRPA 2XZGA 3RMZD 1JV2A 4CI3A 1QFMA 2HJ4A 3QHYB 4L1MA 4PXWA 4BH6A 3EMHA 3SLED 4E54B 3IJCA 4MK0B 3DDUA 5CXCA 3K26A 5FKRA 1JMXB 3SBRA 1GP2B 4DNWA 4X61B 3I7PA 2GNQA 4A11A 5JWZA 3V4VA 4G1MA 5HE2B 5IGQA 4X60B 4FA1D 2G9AA 5IJ8E 3KRWB 2AGLA 1XHMA 4KFMB 3OL2A 1SQ9A 3I8CA 4TZ4A 2UZYB 4ERYA 4AOWA 3K71A 3SN6B 3U4YA 5EALA 2P9KC 2VC2A 2YBAA 4O2WA 3RSEC 5C9ZB 2AGYA 5H1MA 4E54A 4XYHA 3O4JA 4YVDA 3I7HA 4BCCA 3IJ1A 1GXRA 1GOFA 5C2WB 4IRZA 2HU7A 1L5GA 4N14A 3AH8B 4Z8LA 3UVKA 2HJBA 3DM0A 2I0TA
chains in the Genus database with same CATH topology
5IC7A 2IUQA 1SHYB 5FLXg 3EG6A 2CN3A 3HFQA 1N6EA 5GMKn 2O9KA 4LG9A 1B9YA 5FKQA 4AEZA 2GC7A 2AGWA 3IIWA 3EI1B 2GC4A 4CY5A 4QQEA 4ZOXA 1N6DA 3GFCA 4JT5C 2HKMA 3UKRC 3PXWD 3ULEC 3VGZA 1MG3A 4GM3A 5FKSA 1JOFA 4CI2A 3F3PA 2J57G 1VYHC 4XEIC 3UKUC 1FWXA 1QNIA 3SFZA 3SHFA 5FKTA 3KRXB 5TDHB 3EI1A 3ORVD 4O1QD 2Q7QA 2YNOA 3DSMA 3RN0D 2OVPB 4CY1A 4LG8A 4J8BA 2B5NA 4O9DA 3NVNA 4PBZA 5I5JA 1PBYB 2OVRB 4H5JA 3EU7A 4FA5D 4ZOVA 2I3SA 1XKSA 4CI8A 3JAMg 3C9CA 4JSVC 3SBPA 3C5MA 5I5MA 4QT8A 3C75H 3EI4B 2CO0C 4GGAA 4FAVD 5EMLB 3A0FA 4PSWB 3E0CA 3MKSB 3F3FA 2BCJB 4A08B 3BG0A 3SBQA 3OTTA 3EWEA 5AFU3 2B4EA 4J0XA 3EI4A 3I2NA 4J77A 2PM6B 3V5WB 3I7OA 3NVQA 3MZKA 2G99A 5AJAA 3SCYA 4Y7RA 2OK6A 4PC0A 5EM2B 4A08A 5GXIA 3JZGA 4PBYA 3ZWLB 1K8KC 1U2VC 2J55H 4I79A 3JPXA 3PSCB 2B5MA 2P9UC 3UR4A 4BUJC 3K27A 2I0RA 3RLMD 2W18A 3BWSA 1GG2B 3RN1D 2IAAA 5K19A 2CE9A 5EMKB 4JT6C 4FA9D 1MG2A 3I7KA 4K3JB 2P9SC 4QRJA 4O45A 4R7AB 4O3UB 3L4MD 5EM2A 5TF2A 5FQDA 2CNXA 2I3TA 2BBKH 2YB8B 4L1QD 3I89A 4H5IA 3SMRA 5EARA 1P22A 4CC9A 1NR0A 4CY3A 5EMMB 3RFGA 4A09B 5HE1B 2YNPA 4GZ8A 2CO0A 1NEXB 3DWLC 3JZHA 3ODTA 4L3HD 2H6NA 1GOTB 3B7FA 4A2LA 2IUPA 4CZXA 3DXKC 2HYEA 3RRMC 4J87A 4JSXC 4O3TB 5FA5B 4IMMA 5C2VB 1PEVA 2PM9B 4QL1A 4A0AB 4A09A 2UZXB 2CE8A 3OW8A 4ZOYA 2HESX 5HYNB 3P4FA 4HDJA 3JZNA 1RI6A 4J73A 2H6QA 3UVLA 4D6VA 2I0SA 1B9XA 3AFCA 3AL9A 4BL0A 2P9PC 1JJUB 3I8EA 4GM9A 4CZYA 5KDOB 3EI3B 3FRXA 2Z2NA 4PSXB 2PM9A 2XL3A 2OJYA 2H13A 4PNKB 5HE3B 4A0AA 1JMZB 2HXCA 1TBGA 1OLZA 5CYKB 3CIKB 3MXXA 3NVXA 4L9OA 3FM0A 4J79A 5IGOA 2H68A 4JXMA 2H14A 3I7LA 4FB1D 4GGDA 3BG1A 2H6KA 3IIYA 4GQ2P 2XYIA 4JD2C 4IA9A 4ZN4A 5IT9g 4J84A 5FXYA 3N0EA 5HQGA 2AGXA 2PBIB 3EI3A 4GGCA 3DXMC 1OMWB 1XIPA 4GM8A 1YFQA 5TEEA 3JROA 3MKQA 2IWFA 2QXVA 3IJ0A 3PXSD 5CYKA 3SVWD 2MTAH 2IUVA 4U1EI 4A2MA 4FWWA 5SXMA 4J0WA 4CZVA 4ERQA 4ESGA 3MMYA 3JB9L 1A0RB 2AGZA 1Q47A 3J80g 4A0BB 1K32A 3UVMA 2H9NA 1R5MA 4X63B 4ERZA 3PXTD 5AMSA 3CFSB 3GREA 3EI2B 4NSXA 5HE0B 2Z2OA 1L0QA 2P9NC 4CY2A 2OVQB 3C99A 4J8GA 2EBSA 1MDAH 1TYQC 4GQ1A 5K1CC 5IJ7E 2HKRA 3PE7A 4A0BA 2H9PA 3OKWA 5EAMA 3VA6A 3N0DA 3OKTA 5GXHA 3EI2A 3VH0A 4FAND 3L4OD 4D0KA 3SXTD 4Y5RD 3FGBA 2AH1A 5A2Qg 2XU7A 5CXBB 2CN2A 3SWSD 4L3GD 4X3EA 2H47A 5I5IA 2P9LC 5H17A 4J78A 2PM7B 3OKYB 4G56B 3V9FA 4GQBB 4J81A 2YMUA 4CI1A 3UVOA 2H9LA 3CFVA 3F3GA 5THAA 4E5ZB 2P9IC 5CXBA 3MZLA 1PGUA 2IURA 1U4CA 3PVWB 4UI9R 4FA4D 3UVNA 1N6FA 2J56H 3OKYA 4XYIA 5EMJB 4A7JA 2OIZA 4EWRA 3J81g 3I7NA 4J86A 3AL8B 2OK4A 2Z2PA 4LGNA 2TRCB 4E5ZA 1ERJA 2H3XA 1PI6A 2YNNA 1SQJA 2AQ5A 4FHLA 5TEFA 4J82A 2QC5A 3W15A 4JSNC 5B4WA 4OZUA 5CXCB 5GSAA 4JSPC 4GMBA 4U7AA 3SJLD 3PSLA 5H14A 4A11B 1S4UX 3V7DB 3AL8A 3IKOA 4OWRA 3RFHA 4ZOZA 2IWKA 2AH0A 2H9MA 2XL2A 4ES0A 3PVUB 2B5LA 3OL2B 4K3ID 5EAPA 3JRPA 3RMZD 4CI3A 2HJ4A 4PXWA 4BH6A 3EMHA 3SLED 4E54B 3IJCA 4MK0B 5CXCA 3K26A 5FKRA 1JMXB 3SBRA 1GP2B 4X61B 3I7PA 2GNQA 4A11A 5JWZA 5HE2B 5IGQA 4X60B 4FA1D 2G9AA 5IJ8E 3KRWB 2AGLA 1XHMA 4KFMB 3OL2A 1SQ9A 3I8CA 4TZ4A 2UZYB 4ERYA 4AOWA 3SN6B 3U4YA 5EALA 2P9KC 2YBAA 3RSEC 5C9ZB 2AGYA 5H1MA 4E54A 4XYHA 4YVDA 3I7HA 3IJ1A 1GXRA 5C2WB 4N14A 3AH8B 4Z8LA 3UVKA 2HJBA 3DM0A 2I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IC7 A;  2IUQ A;  1SHY B;  5FLX g;  3EG6 A;  2CN3 A;  3HFQ A;  1N6E A;  5GMK n;  2O9K A;  4LG9 A;  1B9Y A;  5FKQ A;  4AEZ A;  2GC7 A;  2AGW A;  3IIW A;  3EI1 B;  2GC4 A;  4CY5 A;  4QQE A;  4ZOX A;  1N6D A;  3GFC A;  4JT5 C;  2HKM A;  3UKR C;  3PXW D;  3ULE C;  3VGZ A;  1MG3 A;  4GM3 A;  5FKS A;  1JOF A;  4CI2 A;  3F3P A;  2J57 G;  1VYH C;  4XEI C;  3UKU C;  1FWX A;  1QNI A;  3SFZ A;  3SHF A;  5FKT A;  3KRX B;  5TDH B;  3EI1 A;  3ORV D;  4O1Q D;  2Q7Q A;  2YNO A;  3DSM A;  3RN0 D;  2OVP B;  4CY1 A;  4LG8 A;  4J8B A;  2B5N A;  4O9D A;  3NVN A;  4PBZ A;  5I5J A;  1PBY B;  2OVR B;  4H5J A;  3EU7 A;  4FA5 D;  4ZOV A;  2I3S A;  1XKS A;  4CI8 A;  3JAM g;  3C9C A;  4JSV C;  3SBP A;  3C5M A;  5I5M A;  4QT8 A;  3C75 H;  3EI4 B;  2CO0 C;  4GGA A;  4FAV D;  5EML B;  3A0F A;  4PSW B;  3E0C A;  3MKS B;  3F3F A;  2BCJ B;  4A08 B;  3BG0 A;  3SBQ A;  3OTT A;  3EWE A;  5AFU 3;  2B4E A;  4J0X A;  3EI4 A;  3I2N A;  4J77 A;  2PM6 B;  3V5W B;  3I7O A;  3NVQ A;  3MZK A;  2G99 A;  5AJA A;  3SCY A;  4Y7R A;  2OK6 A;  4PC0 A;  5EM2 B;  4A08 A;  5GXI A;  3JZG A;  4PBY A;  3ZWL B;  1K8K C;  1U2V C;  2J55 H;  4I79 A;  3JPX A;  3PSC B;  2B5M A;  2P9U C;  3UR4 A;  4BUJ C;  3K27 A;  2I0R A;  3RLM D;  2W18 A;  3BWS A;  1GG2 B;  3RN1 D;  2IAA A;  5K19 A;  2CE9 A;  5EMK B;  4JT6 C;  4FA9 D;  1MG2 A;  3I7K A;  4K3J B;  2P9S C;  4QRJ A;  4O45 A;  4R7A B;  4O3U B;  3L4M D;  5EM2 A;  5TF2 A;  5FQD A;  2CNX A;  2I3T A;  2BBK H;  2YB8 B;  4L1Q D;  3I89 A;  4H5I A;  3SMR A;  5EAR A;  1P22 A;  4CC9 A;  1NR0 A;  4CY3 A;  5EMM B;  3RFG A;  4A09 B;  5HE1 B;  2YNP A;  4GZ8 A;  2CO0 A;  1NEX B;  3DWL C;  3JZH A;  3ODT A;  4L3H D;  2H6N A;  1GOT B;  3B7F A;  4A2L A;  2IUP A;  4CZX A;  3DXK C;  2HYE A;  3RRM C;  4J87 A;  4JSX C;  4O3T B;  5FA5 B;  4IMM A;  5C2V B;  1PEV A;  2PM9 B;  4QL1 A;  4A0A B;  4A09 A;  2UZX B;  2CE8 A;  3OW8 A;  4ZOY A;  2HES X;  5HYN B;  3P4F A;  4HDJ A;  3JZN A;  1RI6 A;  4J73 A;  2H6Q A;  3UVL A;  4D6V A;  2I0S A;  1B9X A;  3AFC A;  3AL9 A;  4BL0 A;  2P9P C;  1JJU B;  3I8E A;  4GM9 A;  4CZY A;  5KDO B;  3EI3 B;  3FRX A;  2Z2N A;  4PSX B;  2PM9 A;  2XL3 A;  2OJY A;  2H13 A;  4PNK B;  5HE3 B;  4A0A A;  1JMZ B;  2HXC A;  1TBG A;  1OLZ A;  5CYK B;  3CIK B;  3MXX A;  3NVX A;  4L9O A;  3FM0 A;  4J79 A;  5IGO A;  2H68 A;  4JXM A;  2H14 A;  3I7L A;  4FB1 D;  4GGD A;  3BG1 A;  2H6K A;  3IIY A;  4GQ2 P;  2XYI A;  4JD2 C;  4IA9 A;  4ZN4 A;  5IT9 g;  4J84 A;  5FXY A;  3N0E A;  5HQG A;  2AGX A;  2PBI B;  3EI3 A;  4GGC A;  3DXM C;  1OMW B;  1XIP A;  4GM8 A;  1YFQ A;  5TEE A;  3JRO A;  3MKQ A;  2IWF A;  2QXV A;  3IJ0 A;  3PXS D;  5CYK A;  3SVW D;  2MTA H;  2IUV A;  4U1E I;  4A2M A;  4FWW A;  5SXM A;  4J0W A;  4CZV A;  4ERQ A;  4ESG A;  3MMY A;  3JB9 L;  1A0R B;  2AGZ A;  1Q47 A;  3J80 g;  4A0B B;  1K32 A;  3UVM A;  2H9N A;  1R5M A;  4X63 B;  4ERZ A;  3PXT D;  5AMS A;  3CFS B;  3GRE A;  3EI2 B;  4NSX A;  5HE0 B;  2Z2O A;  1L0Q A;  2P9N C;  4CY2 A;  2OVQ B;  3C99 A;  4J8G A;  2EBS A;  1MDA H;  1TYQ C;  4GQ1 A;  5K1C C;  5IJ7 E;  2HKR A;  3PE7 A;  4A0B A;  2H9P A;  3OKW A;  5EAM A;  3VA6 A;  3N0D A;  3OKT A;  5GXH A;  3EI2 A;  3VH0 A;  4FAN D;  3L4O D;  4D0K A;  3SXT D;  4Y5R D;  3FGB A;  2AH1 A;  5A2Q g;  2XU7 A;  5CXB B;  2CN2 A;  3SWS D;  4L3G D;  4X3E A;  2H47 A;  5I5I A;  2P9L C;  5H17 A;  4J78 A;  2PM7 B;  3OKY B;  4G56 B;  3V9F A;  4GQB B;  4J81 A;  2YMU A;  4CI1 A;  3UVO A;  2H9L A;  3CFV A;  3F3G A;  5THA A;  4E5Z B;  2P9I C;  5CXB A;  3MZL A;  1PGU A;  2IUR A;  1U4C A;  3PVW B;  4UI9 R;  4FA4 D;  3UVN A;  1N6F A;  2J56 H;  3OKY A;  4XYI A;  5EMJ B;  4A7J A;  2OIZ A;  4EWR A;  3J81 g;  3I7N A;  4J86 A;  3AL8 B;  2OK4 A;  2Z2P A;  4LGN A;  2TRC B;  4E5Z A;  1ERJ A;  2H3X A;  1PI6 A;  2YNN A;  1SQJ A;  2AQ5 A;  4FHL A;  5TEF A;  4J82 A;  2QC5 A;  3W15 A;  4JSN C;  5B4W A;  4OZU A;  5CXC B;  5GSA A;  4JSP C;  4GMB A;  4U7A A;  3SJL D;  3PSL A;  5H14 A;  4A11 B;  1S4U X;  3V7D B;  3AL8 A;  3IKO A;  4OWR A;  3RFH A;  4ZOZ A;  2IWK A;  2AH0 A;  2H9M A;  2XL2 A;  4ES0 A;  3PVU B;  2B5L A;  3OL2 B;  4K3I D;  5EAP A;  3JRP A;  3RMZ D;  4CI3 A;  2HJ4 A;  4PXW A;  4BH6 A;  3EMH A;  3SLE D;  4E54 B;  3IJC A;  4MK0 B;  5CXC A;  3K26 A;  5FKR A;  1JMX B;  3SBR A;  1GP2 B;  4X61 B;  3I7P A;  2GNQ A;  4A11 A;  5JWZ A;  5HE2 B;  5IGQ A;  4X60 B;  4FA1 D;  2G9A A;  5IJ8 E;  3KRW B;  2AGL A;  1XHM A;  4KFM B;  3OL2 A;  1SQ9 A;  3I8C A;  4TZ4 A;  2UZY B;  4ERY A;  4AOW A;  3SN6 B;  3U4Y A;  5EAL A;  2P9K C;  2YBA A;  3RSE C;  5C9Z B;  2AGY A;  5H1M A;  4E54 A;  4XYH A;  4YVD A;  3I7H A;  3IJ1 A;  1GXR A;  5C2W B;  4N14 A;  3AH8 B;  4Z8L A;  3UVK A;  2HJB A;  3DM0 A;  2I0T A; 
#chains in the Genus database with same CATH topology
 3O4H A;  5IC7 A;  2IUQ A;  1SHY B;  5FLX g;  3EG6 A;  3NID A;  2CN3 A;  3HFQ A;  3NIF A;  3VI3 A;  1N6E A;  5GMK n;  2O9K A;  4AMZ A;  3IUN A;  4LG9 A;  1B9Y A;  2VDQ A;  5FKQ A;  4AEZ A;  2GC7 A;  2AGW A;  3IIW A;  3K72 A;  3EI1 B;  2GC4 A;  4CY5 A;  4QQE A;  4AX4 A;  4ZOX A;  1N6D A;  3ZE2 A;  3GFC A;  4JT5 C;  5C92 A;  2HKM A;  4UM8 A;  3UKR C;  3PXW D;  3K6S A;  3ULE C;  3VGZ A;  1MG3 A;  4RE5 A;  4GM3 A;  5FKS A;  1JOF A;  4CI2 A;  3F3P A;  2J57 G;  1VYH C;  4XEI C;  3UKU C;  1FWX A;  1QNI A;  3SFZ A;  4WK0 A;  3SHF A;  5FKT A;  3KRX B;  5TDH B;  3EI1 A;  3ORV D;  4O1Q D;  2Q7Q A;  2YNO A;  3DSM A;  3RN0 D;  2OVP B;  4CY1 A;  4LG8 A;  4J8B A;  2B5N A;  4O9D A;  2XE4 A;  3IVM A;  3NVN A;  4PBZ A;  5I5J A;  1O6F A;  3IUJ A;  1PBY B;  2OVR B;  1BPO A;  4H5J A;  3EU7 A;  4FA5 D;  4ZOV A;  2I3S A;  1XKS A;  4CI8 A;  3JAM g;  3C9C A;  4JSV C;  3SBP A;  3C5M A;  5I5M A;  4QT8 A;  3C75 H;  2XDW A;  3EI4 B;  2CO0 C;  4GGA A;  3ZE1 A;  4RE6 A;  4FAV D;  5EML B;  4Z7N A;  3A0F A;  4PSW B;  3E0C A;  5M5V A;  3MKS B;  3F3F A;  2BCJ B;  4A08 B;  5M61 A;  3BG0 A;  3SBQ A;  2VZ3 A;  3OTT A;  1UOO A;  3EWE A;  5AFU 3;  5E6S A;  4O02 A;  4WK2 A;  3O4G A;  2B4E A;  4J0X A;  3EI4 A;  4DNV A;  1C9L A;  3I2N A;  5M5S A;  2EID A;  4J77 A;  1U8C A;  4NEN A;  2PM6 B;  4BP8 A;  3V5W B;  3I7O A;  3NVQ A;  3ZDZ A;  3MZK A;  2G99 A;  5AJA A;  4MMY A;  3SCY A;  2VDK A;  4Y7R A;  2OK6 A;  4PC0 A;  3T3M A;  5EM2 B;  3VI4 A;  4A08 A;  5GXI A;  3FCU A;  3JZG A;  4PBY A;  3ZWL B;  3IUM A;  1K8K C;  1U2V C;  2J55 H;  4AN1 A;  4I79 A;  3JPX A;  3PSC B;  1M1X A;  2B5M A;  2P9U C;  3NIG A;  3UR4 A;  2VDN A;  3GD1 I;  3K27 A;  4BUJ C;  2I0R A;  3RLM D;  2W18 A;  1GOG A;  3BWS A;  3OF7 A;  1GG2 B;  3RN1 D;  2IAA A;  5K19 A;  2CE9 A;  5EMK B;  2QR5 A;  2BKL A;  4JT6 C;  4FA9 D;  1VZ3 A;  1MG2 A;  3I7K A;  4K3J B;  2P9S C;  4QRJ A;  4O45 A;  4R7A B;  4O3U B;  3L4M D;  5EM2 A;  5TF2 A;  5FQD A;  2CNX A;  2I3T A;  2BBK H;  2YB8 B;  3IJE A;  4L1Q D;  3I89 A;  4H5I A;  1VE6 A;  3SMR A;  4BP9 A;  5EAR A;  1P22 A;  4CC9 A;  1NR0 A;  4CY3 A;  5EMM B;  3RFG A;  4A09 B;  5HE1 B;  2VDR A;  2YNP A;  4AN0 A;  4GZ8 A;  2VZ1 A;  2CO0 A;  4DNU A;  4MMZ A;  5FFO A;  5M5T A;  1NEX B;  3DWL C;  3JZH A;  3ODT A;  4L3H D;  2H6N A;  1GOT B;  3B7F A;  4A2L A;  1JTD B;  2IUP A;  4CZX A;  3DXK C;  2HYE A;  3RRM C;  1E8N A;  4J87 A;  5E6U A;  5M5R A;  4JSX C;  4O3T B;  5FA5 B;  4IMM A;  5C2V B;  1PEV A;  2PM9 B;  4QL1 A;  4A0A B;  4A09 A;  2UZX B;  1VE7 A;  2CE8 A;  2WQ8 A;  3OW8 A;  4ZOY A;  2HES X;  5HYN B;  3P4F A;  4HDJ A;  1H2Z A;  3MVD K;  3V4P A;  3IUQ A;  3JZN A;  1RI6 A;  4J73 A;  5HDB A;  1UTC A;  2H6Q A;  3UVL A;  4D6V A;  2I0S A;  4NC4 A;  1B9X A;  3AFC A;  3AL9 A;  4BL0 A;  1A12 A;  2P9P C;  1JJU B;  3I8E A;  4GM9 A;  4CZY A;  5KDO B;  1K3I A;  3EI3 B;  3FRX A;  2Z2N A;  4PSX B;  2PM9 A;  2XL3 A;  2OJY A;  1T2X A;  2H13 A;  4PNK B;  5HE3 B;  4A0A A;  2JKX A;  1JMZ B;  4NAA A;  2HXC A;  3EQ7 A;  1TBG A;  1OLZ A;  2HU8 A;  5CYK B;  3CIK B;  3MXX A;  3NVX A;  4L9O A;  3FM0 A;  4J79 A;  5IGO A;  2H68 A;  4JXM A;  2H14 A;  3I7L A;  4FB1 D;  4GGD A;  3MUN A;  3BG1 A;  2H6K A;  1O6G A;  3IIY A;  4GQ2 P;  4UM9 A;  2XYI A;  4JD2 C;  5M5U A;  4IA9 A;  1C9I A;  4ZN4 A;  5IT9 g;  4J84 A;  5FXY A;  3N0E A;  5HQG A;  2AGX A;  2PBI B;  3EI3 A;  4GGC A;  3DXM C;  1OMW B;  1XIP A;  3O4I A;  4GM8 A;  1YFQ A;  5TEE A;  4JHN A;  3MKQ A;  3JRO A;  2IWF A;  2QXV A;  3IJ0 A;  3PXS D;  5CYK A;  3SVW D;  2MTA H;  2IUV A;  4U1E I;  2VDO A;  4A2M A;  4FWW A;  4Z7Q A;  5SXM A;  4J0W A;  4D9S A;  4CZV A;  4ERQ A;  3IUR A;  4ESG A;  3MMY A;  3JB9 L;  1A0R B;  2AGZ A;  1Q47 A;  3J80 g;  4A0B B;  1K32 A;  3UVM A;  2H9N A;  1R5M A;  4G1E A;  4X63 B;  4ERZ A;  3PXT D;  5AMS A;  3CFS B;  3GRE A;  3EI2 B;  4NSX A;  5HE0 B;  2Z2O A;  3EQ9 A;  1L0Q A;  2P9N C;  4WK4 A;  3EQ8 A;  3C99 A;  4J8G A;  2OVQ B;  4CY2 A;  2HU5 A;  2EBS A;  1MDA H;  1TYQ C;  4Z7O A;  3GC3 B;  4GQ1 A;  5K1C C;  5IJ7 E;  2HKR A;  1E8M A;  3PE7 A;  4A0B A;  2H9P A;  3OKW A;  5EAM A;  3VA6 A;  3N0D A;  3OKT A;  5GXH A;  4AMY A;  5C86 A;  3EI2 A;  3VH0 A;  4FAN D;  1QFS A;  3L4O D;  4JHP C;  4D0K A;  3SXT D;  4G55 A;  4MMX A;  5E6R A;  4Y5R D;  3FGB A;  2AH1 A;  1H2W A;  4WJK A;  3ZDX A;  5A2Q g;  2XU7 A;  3KCI A;  5CXB B;  2CN2 A;  4NBM A;  3SWS D;  4L3G D;  4X3E A;  2H47 A;  5I5I A;  2P9L C;  5H17 A;  4J78 A;  3QI0 A;  2PM7 B;  3OKY B;  4G56 B;  3V9F A;  4GQB B;  4J81 A;  2YMU A;  3ZDY A;  4CI1 A;  3UVO A;  3FCS A;  2H9L A;  1UOP A;  3CFV A;  3F3G A;  5FFG A;  5THA A;  2EIE A;  4E5Z B;  2P9I C;  5CXB A;  3MZL A;  4BCB A;  1PGU A;  2IUR A;  1U4C A;  3PVW B;  4UI9 R;  4FA4 D;  3UVN A;  1N6F A;  2J56 H;  2VDM A;  3OKY A;  4XYI A;  1H2X A;  5EMJ B;  4A7J A;  2VDP A;  4BCD A;  2OIZ A;  4EWR A;  3J81 g;  1YR2 A;  3I7N A;  4J86 A;  3AL8 B;  2OK4 A;  2Z2P A;  1UOQ A;  4LGN A;  2TRC B;  1VZ2 A;  4E5Z A;  1ERJ A;  2H3X A;  1TYE A;  1PI6 A;  2YNN A;  1SQJ A;  2AQ5 A;  4FHL A;  5TEF A;  4QAM A;  3IUL A;  4J82 A;  1GOH A;  2QC5 A;  2VDL A;  3MUO A;  3W15 A;  1E5T A;  4JSN C;  2EIC A;  5B4W A;  4OZU A;  5CXC B;  5GSA A;  4JSP C;  4GMB A;  4U7A A;  3SJL D;  2QZP A;  3PSL A;  5H14 A;  4A11 B;  1S4U X;  3V7D B;  1H2Y A;  3AL8 A;  1I2M B;  3ZE0 A;  3IKO A;  4OWR A;  3RFH A;  4ZOZ A;  2IWK A;  2EIB A;  2AH0 A;  2H9M A;  2XL2 A;  4ES0 A;  3PVU B;  2B5L A;  3OL2 B;  4K3I D;  5EAP A;  3T3P A;  3JRP A;  2XZG A;  3RMZ D;  1JV2 A;  4CI3 A;  1QFM A;  2HJ4 A;  3QHY B;  4L1M A;  4PXW A;  4BH6 A;  3EMH A;  3SLE D;  4E54 B;  3IJC A;  4MK0 B;  3DDU A;  5CXC A;  3K26 A;  5FKR A;  1JMX B;  3SBR A;  1GP2 B;  4DNW A;  4X61 B;  3I7P A;  2GNQ A;  4A11 A;  5JWZ A;  3V4V A;  4G1M A;  5HE2 B;  5IGQ A;  4X60 B;  4FA1 D;  2G9A A;  5IJ8 E;  3KRW B;  2AGL A;  1XHM A;  4KFM B;  3OL2 A;  1SQ9 A;  3I8C A;  4TZ4 A;  2UZY B;  4ERY A;  4AOW A;  3K71 A;  3SN6 B;  3U4Y A;  5EAL A;  2P9K C;  2VC2 A;  2YBA A;  4O2W A;  3RSE C;  5C9Z B;  2AGY A;  5H1M A;  4E54 A;  4XYH A;  3O4J A;  4YVD A;  3I7H A;  4BCC A;  3IJ1 A;  1GXR A;  1GOF A;  5C2W B;  4IRZ A;  2HU7 A;  1L5G A;  4N14 A;  3AH8 B;  4Z8L A;  3UVK A;  2HJB A;  3DM0 A;  2I0T A; 
#chains in the Genus database with same CATH homology
 5IC7 A;  2IUQ A;  1SHY B;  5FLX g;  3EG6 A;  2CN3 A;  3HFQ A;  1N6E A;  5GMK n;  2O9K A;  4LG9 A;  1B9Y A;  5FKQ A;  4AEZ A;  2GC7 A;  2AGW A;  3IIW A;  3EI1 B;  2GC4 A;  4CY5 A;  4QQE A;  4ZOX A;  1N6D A;  3GFC A;  4JT5 C;  2HKM A;  3UKR C;  3PXW D;  3ULE C;  3VGZ A;  1MG3 A;  4GM3 A;  5FKS A;  1JOF A;  4CI2 A;  3F3P A;  2J57 G;  1VYH C;  4XEI C;  3UKU C;  1FWX A;  1QNI A;  3SFZ A;  3SHF A;  5FKT A;  3KRX B;  5TDH B;  3EI1 A;  3ORV D;  4O1Q D;  2Q7Q A;  2YNO A;  3DSM A;  3RN0 D;  2OVP B;  4CY1 A;  4LG8 A;  4J8B A;  2B5N A;  4O9D A;  3NVN A;  4PBZ A;  5I5J A;  1PBY B;  2OVR B;  4H5J A;  3EU7 A;  4FA5 D;  4ZOV A;  2I3S A;  1XKS A;  4CI8 A;  3JAM g;  3C9C A;  4JSV C;  3SBP A;  3C5M A;  5I5M A;  4QT8 A;  3C75 H;  3EI4 B;  2CO0 C;  4GGA A;  4FAV D;  5EML B;  3A0F A;  4PSW B;  3E0C A;  3MKS B;  3F3F A;  2BCJ B;  4A08 B;  3BG0 A;  3SBQ A;  3OTT A;  3EWE A;  5AFU 3;  2B4E A;  4J0X A;  3EI4 A;  3I2N A;  4J77 A;  2PM6 B;  3V5W B;  3I7O A;  3NVQ A;  3MZK A;  2G99 A;  5AJA A;  3SCY A;  4Y7R A;  2OK6 A;  4PC0 A;  5EM2 B;  4A08 A;  5GXI A;  3JZG A;  4PBY A;  3ZWL B;  1K8K C;  1U2V C;  2J55 H;  4I79 A;  3JPX A;  3PSC B;  2B5M A;  2P9U C;  3UR4 A;  4BUJ C;  3K27 A;  2I0R A;  3RLM D;  2W18 A;  3BWS A;  1GG2 B;  3RN1 D;  2IAA A;  5K19 A;  2CE9 A;  5EMK B;  4JT6 C;  4FA9 D;  1MG2 A;  3I7K A;  4K3J B;  2P9S C;  4QRJ A;  4O45 A;  4R7A B;  4O3U B;  3L4M D;  5EM2 A;  5TF2 A;  5FQD A;  2CNX A;  2I3T A;  2BBK H;  2YB8 B;  4L1Q D;  3I89 A;  4H5I A;  3SMR A;  5EAR A;  1P22 A;  4CC9 A;  1NR0 A;  4CY3 A;  5EMM B;  3RFG A;  4A09 B;  5HE1 B;  2YNP A;  4GZ8 A;  2CO0 A;  1NEX B;  3DWL C;  3JZH A;  3ODT A;  4L3H D;  2H6N A;  1GOT B;  3B7F A;  4A2L A;  2IUP A;  4CZX A;  3DXK C;  2HYE A;  3RRM C;  4J87 A;  4JSX C;  4O3T B;  5FA5 B;  4IMM A;  5C2V B;  1PEV A;  2PM9 B;  4QL1 A;  4A0A B;  4A09 A;  2UZX B;  2CE8 A;  3OW8 A;  4ZOY A;  2HES X;  5HYN B;  3P4F A;  4HDJ A;  3JZN A;  1RI6 A;  4J73 A;  2H6Q A;  3UVL A;  4D6V A;  2I0S A;  1B9X A;  3AFC A;  3AL9 A;  4BL0 A;  2P9P C;  1JJU B;  3I8E A;  4GM9 A;  4CZY A;  5KDO B;  3EI3 B;  3FRX A;  2Z2N A;  4PSX B;  2PM9 A;  2XL3 A;  2OJY A;  2H13 A;  4PNK B;  5HE3 B;  4A0A A;  1JMZ B;  2HXC A;  1TBG A;  1OLZ A;  5CYK B;  3CIK B;  3MXX A;  3NVX A;  4L9O A;  3FM0 A;  4J79 A;  5IGO A;  2H68 A;  4JXM A;  2H14 A;  3I7L A;  4FB1 D;  4GGD A;  3BG1 A;  2H6K A;  3IIY A;  4GQ2 P;  2XYI A;  4JD2 C;  4IA9 A;  4ZN4 A;  5IT9 g;  4J84 A;  5FXY A;  3N0E A;  5HQG A;  2AGX A;  2PBI B;  3EI3 A;  4GGC A;  3DXM C;  1OMW B;  1XIP A;  4GM8 A;  1YFQ A;  5TEE A;  3JRO A;  3MKQ A;  2IWF A;  2QXV A;  3IJ0 A;  3PXS D;  5CYK A;  3SVW D;  2MTA H;  2IUV A;  4U1E I;  4A2M A;  4FWW A;  5SXM A;  4J0W A;  4CZV A;  4ERQ A;  4ESG A;  3MMY A;  3JB9 L;  1A0R B;  2AGZ A;  1Q47 A;  3J80 g;  4A0B B;  1K32 A;  3UVM A;  2H9N A;  1R5M A;  4X63 B;  4ERZ A;  3PXT D;  5AMS A;  3CFS B;  3GRE A;  3EI2 B;  4NSX A;  5HE0 B;  2Z2O A;  1L0Q A;  2P9N C;  4CY2 A;  2OVQ B;  3C99 A;  4J8G A;  2EBS A;  1MDA H;  1TYQ C;  4GQ1 A;  5K1C C;  5IJ7 E;  2HKR A;  3PE7 A;  4A0B A;  2H9P A;  3OKW A;  5EAM A;  3VA6 A;  3N0D A;  3OKT A;  5GXH A;  3EI2 A;  3VH0 A;  4FAN D;  3L4O D;  4D0K A;  3SXT D;  4Y5R D;  3FGB A;  2AH1 A;  5A2Q g;  2XU7 A;  5CXB B;  2CN2 A;  3SWS D;  4L3G D;  4X3E A;  2H47 A;  5I5I A;  2P9L C;  5H17 A;  4J78 A;  2PM7 B;  3OKY B;  4G56 B;  3V9F A;  4GQB B;  4J81 A;  2YMU A;  4CI1 A;  3UVO A;  2H9L A;  3CFV A;  3F3G A;  5THA A;  4E5Z B;  2P9I C;  5CXB A;  3MZL A;  1PGU A;  2IUR A;  1U4C A;  3PVW B;  4UI9 R;  4FA4 D;  3UVN A;  1N6F A;  2J56 H;  3OKY A;  4XYI A;  5EMJ B;  4A7J A;  2OIZ A;  4EWR A;  3J81 g;  3I7N A;  4J86 A;  3AL8 B;  2OK4 A;  2Z2P A;  4LGN A;  2TRC B;  4E5Z A;  1ERJ A;  2H3X A;  1PI6 A;  2YNN A;  1SQJ A;  2AQ5 A;  4FHL A;  5TEF A;  4J82 A;  2QC5 A;  3W15 A;  4JSN C;  5B4W A;  4OZU A;  5CXC B;  5GSA A;  4JSP C;  4GMB A;  4U7A A;  3SJL D;  3PSL A;  5H14 A;  4A11 B;  1S4U X;  3V7D B;  3AL8 A;  3IKO A;  4OWR A;  3RFH A;  4ZOZ A;  2IWK A;  2AH0 A;  2H9M A;  2XL2 A;  4ES0 A;  3PVU B;  2B5L A;  3OL2 B;  4K3I D;  5EAP A;  3JRP A;  3RMZ D;  4CI3 A;  2HJ4 A;  4PXW A;  4BH6 A;  3EMH A;  3SLE D;  4E54 B;  3IJC A;  4MK0 B;  5CXC A;  3K26 A;  5FKR A;  1JMX B;  3SBR A;  1GP2 B;  4X61 B;  3I7P A;  2GNQ A;  4A11 A;  5JWZ A;  5HE2 B;  5IGQ A;  4X60 B;  4FA1 D;  2G9A A;  5IJ8 E;  3KRW B;  2AGL A;  1XHM A;  4KFM B;  3OL2 A;  1SQ9 A;  3I8C A;  4TZ4 A;  2UZY B;  4ERY A;  4AOW A;  3SN6 B;  3U4Y A;  5EAL A;  2P9K C;  2YBA A;  3RSE C;  5C9Z B;  2AGY A;  5H1M A;  4E54 A;  4XYH A;  4YVD A;  3I7H A;  3IJ1 A;  1GXR A;  5C2W B;  4N14 A;  3AH8 B;  4Z8L A;  3UVK A;  2HJB A;  3DM0 A;  2I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...