2TRSA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
262
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 93
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2trsA00
2ALDA 1ZALA 3KXQA 3ELFA 4A21A 1R47A 1OX5A 3QPZA 3GXNA 4IMDA 2QJHA 5BOOA 4EVZA 1FCUA 1XCFA 3MI2A 1S5VA 3HPSA 3FJLA 1DV7A 4PCFA 2V5LA 4EOUA 1H1YA 1MO0A 4JEQA 4MY8A 1GG0A 2ZZ7A 2YZRA 4NVTA 1Z41A 3EWBX 3LTSA 3I7QA 4QSHA 5BNKA 1PCWA 5G4WA 2H90A 3Q58A 4HT3A 3NQGA 3L0NA 1ZCOA 3PULA 1W5QA 4JR5A 4IXHA 2TRSA 3DFSA 4AAJA 4X9SA 3TQKA 4HNVA 1QFEA 4O13A 1H61A 3SGZA 3M5VA 2UV8G 1FX6A 4ML9A 4UTTC 5CZJA 2GVLA 4HKPA 3W7HA 3IV3A 3W86A 2FPYA 2VFIA 3STGA 1P0NA 4O8RA 4NNAA 3STFA 3P8IA 5DBTA 2GPTA 3W7DA 1S5WA 2WOQA 1NAL1 1YTEA 3IEBA 4JYDA 1TRDA 3TIMA 3BVJA 3HB9A 1W5MA 2BX7A 4LVDA 4MYAA 3WJWA 3W73A 4GUJA 5D30A 3LCWA 5LKYA 3GXTA 1J4EA 4A3UA 3F4WA 1GZGA 2A6NA 1I4NA 5J5RA 3LRKA 3E49A 3B04A 2YPIA 1OFDA 1GEQA 3TCEA 3W1UA 2RH9A 4HSNA 3NA8A 3NQDA 5HUOA 5AHNA 3SFKA 2FB2A 5DN1A 4O57A 5HULA 3E96A 3JR2A 5CGQA 2Q8LA 3NL6A 2QKFA 3DGRA 3M5XA 3FIGA 3UWVA 2VFFA 3TSBA 3L5MA 2GJNA 1F6KA 1K3UA 3T44A 1KV5A 5FF4A 2EF9A 1SO4A 3W2KA 3P5YA 2PURA 3C2FA 2ISVA 2NWRA 1BEUA 3NYZA 5D2TA 4OV9A 2QJGA 3MYPA 3N3MA 2VFDA 4HNUA 2A85A 1OX4B 3GDRA 5FF0A 3UD6A 1MEHA 3PSVA 3NNTA 4UTHA 2FIQA 3VCRA 3G22A 3ZFHA 2V82A 1JUBA 3KRZA 1GQNA 3G3MA 2A2IA 1IXOA 2VEKA 2I9EA 5AHEA 3SECA 2DP3A 4O4WA 4NNCA 1KFLA 4K8EA 2H3DA 4WY0B 1JCMP 3N19B 4BR1A 2XN2A 1V7YA 4Z0JA 3TSDA 2A5HA 4Z1CA 2NX9A 5D2YA 3VE9A 1AG1O 4AHQA 1EPXA 2H8XA 4TX9A 3TFXA 5I3GA 5CPLA 2DU2A 1X6UA 1SR9A 4FB7A 3QMSA 4RKAA 2XN0A 2JGYA 3EXSA 4CCEA 3HPXA 3LLFA 1GG1A 4Y96A 3B03A 4WXZA 1GVRA 2WPBA 3R89A 3OHIA 3GDTA 5GVJA 1UUMA 1N7KA 4M19A 1SFJA 4FNRA 2AGKA 1OFAA 4LVFA 3MP5A 3NR0A 1TV7A 4JIPA 3PY2A 3LX9A 1N55A 3HGOA 4O4VA 1TPUA 3R5EA 5CZTA 3GZ3A 4JTGA 1W5PA 2V0TA 4PL2A 1IXNA 1YXYA 1JRBA 2Y7GA 1JUKA 2HMCA 3TV8A 1HL2A 3NVTA 3FS2A 3M16A 3NQCA 3VI2A 1F73A 4DO4A 2YX0A 3M1ZA 4LS0A 5G4EA 1QCWA 1IGSA 2QR6A 5LNUA 2OCZA 4ADTA 1LOLA 3T4CA 2QF7A 3FYPA 3L68A 2VFHA 1P0KA 3SJ3A 1H51A 4WQ6A 4UNLA 4LUJA 1KM6A 3DKJA 2CLIA 3EWYA 2QCMA 4LVGA 3E0IA 4U28A 3U8GA 5DXYA 4UFJA 1R2SA 1A50A 4A2SA 4JD4A 1U5JA 4WY0F 4HSOA 1TYGA 1K8YA 4MPQA 1A5CA 1IIGA 4LVBA 1AMKA 3RF9A 3TFCA 4LS2A 2ZRUA 1EP1A 2EPHA 3CQ0A 4KFNA 3LHYA 3Q37A 3ABSA 1ZY9A 3EXRA 4XBKA 5CZ0A 1EIXA 5AHFA 1AL8A 3I68A 4ZQNA 1TTQA 3W7QA 1PCKA 3GR8A 4O1BA 2A0NA 4LTSA 3MMTA 3EKZA 2A1YA 4PFMA 3E12A 4BI7A 2BXVA 1M7PA 3BG9A 4MVAA 4RXFA 3W7KA 3O06A 3EWWA 2EKCA 2GVJA 1W54A 4WXYA 4XTDA 4UTWA 5G2HA 1J2WA 3HIJA 2VFEA 3EX1A 4ADSA 2C19A 3MWAA 4PODA 4H4IA 5F4WA 1THFD 4PC8A 4RR4A 2HTMA 2Y7DA 1QAPA 3GDMA 4OGZA 3S1UA 3TK7A 3W22A 3TROA 3W88A 4MJMA 3I6RA 1RQEA 4RK8A 1HO4A 3NPXA 4YLWA 2QDGA 4KFOA 2RDTA 1YADA 2Z0IA 5AHIA 3UY8A 2VOMA 2PCQA 4N02A 4MIMA 1PVNA 2QCEA 1GYNA 4K38A 4RCXA 3QSRA 5D02A 5LGXA 3B4UA 1P1XA 4JDBA 1LRQA 2YW4A 3CEUA 1OABA 2ZRWA 2V2HA 2F7FA 5CSRA 3UPBA 2GUUA 1V5XA 1YTDA 4M7SA 3W83A 4O53A 3GKAA 4RZ6A 2Q3OA 2YYUA 1O4UA 1HFBA 1G7VA 2Z6JA 3L2IA 1XL9A 3UY7A 1EX5A 2Y7EA 3B0VC 1H7XA 3EWZA 3MBDA 3O6CA 3S5NA 1PHQA 1KM1A 5MHBA 5LSMA 3A21A 3W1TA 2QCLA 4EIVA 3M47A 4CNOA 4BWLC 5D05A 5L6UA 3S0CA 4RZ5A 1TB3A 1Q3NA 1KTBA 2J9XA 3DFPA 4TMCA 2CU0A 4LT9A 4CCCA 3W23A 4TO8A 3P84A 1AK5A 4ADUA 1TJPA 4JX6A 4ZVJA 4JS3A 4UTLA 4OV4A 2DJXA 3W7LA 5H2ZA 3IGXA 5FI8A 1K7FA 4MZYA 1L6YA 1KBJA 5EL1A 5TIMA 4NZFA 1XDLA 2B4GA 2QCNA 3NPVA 1XFBA 2Y89A 1TPH1 1DVJA 4BI5A 5DY2A 1G4PA 4JICA 4LNYA 1ZAJA 5IBXA 1IXQA 4H6KA 4N4PA 3QJAA 3T78A 3DHDA 2QCDB 3CHVA 3EWUA 1G4SA 2C18A 3NZ1A 3DFOA 4A22A 3O15A 4R7JA 3Q94A 5D04C 3KFTA 1DQXA 1OVDA 2PRMA 3TW7A 4AB4A 2Y85A 5AOUA 3F1QA 3HMJG 4LU0A 4WZHA 1J5TA 4OBTA 3CIXA 4BI6A 5H91A 3VFLA 2BZNA 3SW6A 5EMUA 1SUXA 3IVSA 4NXKA 3S1XA 2DZTA 1LORA 3NQ7A 1QNVA 2ZA1A 4PH6A 4O12A 3W71A 4JTHA 4NUWA 5HR7A 1OFQA 1F5ZA 3O6YX 5C55A 3PSWA 3VKJA 4IWWA 4N6FA 2QDHA 1I2RA 3MHFA 2NV1A 2J88A 1YPFA 8TIMA 3CWOX 4WOQA 3M41A 1B57A 1ME9A 2PRHA 2CLOA 2CLKA 3P80A 3CC1A 2A7NA 4XZ9A 1NEYA 3W07A 1OJXA 2RDWA 4XWUA 2E5BA 3DBPA 1TREA 3UZJA 1A5SA 1YXCA 1EA0A 1SW3A 2NXGA 4UUIA 5EA9A 3INPA 1TJRA 3AJXA 4GC4A 4LWWA 1LYXA 2YXGA 5AHLA 1KM5A 3QEZA 1JCLA 4IXXA 4LC8A 2WSYA 2B7NA 3DI1A 1JJKA 1DJNA 2DZPA 3CIWA 3PVFA 1PS9A 4DQWA 1H50A 5LZLA 1Q6LA 1LOQA 4IJBA 4W9TA 3THQA 1QPNA 3RK8A 3CM4A 3NZRA 4C1LA 2WKJA 3DU0A 3DFTA 2DZWA 2A21A 1YTKA 4HN4A 3LCIA 2X1RA 4AHPA 3CEPA 1TTJA 1WXJA 5A5WA 4AWSA 1UCWA 1PV8A 3M5YA 4IMGA 5IM51 3LXAA 2W6RA 5I3JA 1OX4A 3OVPA 3P67A 5HINA 4M5PA 5AC8A 4A2RA 4O54A 3DFNA 2AAMA 5K9CA 3W7GA 4IX0A 4N4QA 5DXXA 4NX5A 5DCEA 1G67A 1W3IA 2CZDA 5FF7A 1CW2A 4CNNA 3LTPA 4QIUA 2IQTA 4R33A 3M9YA 4JYFA 3TH6A 4Q33A 1OYBA 1DOSA 3ATYA 4Y9AA 1QMLA 2ZA2A 1EEPA 5L9FA 2V81A 4UFIA 3WK2A 5CPMA 3SGUA 1R2RA 3CLMA 4NJKA 4ZQCA 2FB3A 1FWSA 5DCBA 2PRLA 3MP3A 3ATZA 5F1VA 4N9CA 1FBAA 3W1QA 1M5WA 3NQVA 5EBUA 2P10A 2ZFAA 4PL1A 5T26A 3B05A 4YWIA 3T7VA 3C0JA 3D0CA 6TIMA 2ZRVA 1I8JA 3W72A 4ALDA 1S5TA 2DZUA 1T0OA 1EUAA 3SSJA 5LNWA 5K2ZA 4QJ1A 1FDJA 5LNSA 1Z48A 3NL5A 3N14A 4XQ6A 4E38A 1WOAA 4BWLA 1B9BA 2PE4A 3C2RA 4AVFA 1KM2A 1SSDA 3C8FA 3CWNA 3LXBA 3LXCA 2WJZA 3GVGA 3W75A 2C6QA 3O07A 3LOTA 3GKFA 4GUFA 5HQEA 4DXVA 5BRBA 3QFEA 2OX1A 3FLUA 2QUTA 5EKYA 1WBJA 4XUGA 1R2TA 3DKLA 4HNNA 1UBSA 1O5KA 4PTNA 3QRHA 5KMYA 4UTWC 4IMEA 4GXMA 3MHUA 5K9XA 4DO6A 5DLCA 1JR1A 3M43A 3QQ0A 3R8RA 1OF6A 3EXTA 3GDKA 3W1RA 3EB2A 2HS8A 3IVTA 1FUYA 3S1WA 4DPQA 1T8XA 4K7VA 3O8AA 2VENA 3S5YA 1DBTA 1RZMA 1KLZA 1VRDA 3LBCA 1ZHAA 2H6RA 3HG2A 3HG3A 4U4MA 2JKPA 4DF2A 3P82A 4AF0B 2FLIA 5CPNA 1SW7A 4UFLA 3JRKA 1F05A 1QO2A 2QEZA 3BLIA 3L67A 4YCOA 1H7PA 5F2GA 3PUOA 2VXNA 3E9AA 4ZQRA 2YR1A 5F2MA 3TAOA 4FNPA 2RHGA 1ZNNA 3IIOA 1WA3A 5CG7A 4EWND 1QOPA 3RU6A 4YL2A 4FIQA 3QQ1A 1NFBA 3W7IA 4WD0A 1SQ7A 3BG5A 2G96A 3W7MA 3LM7A 1VQTA 1VHNA 3HF3A 3W1LA 2ZZ4A 4UMCA 4IQLA 3I65A 3TQ0A 3W2LA 4QITA 1G4TA 5G1YA 3RFAA 1JCNA 5D32A 3W76A 1AW2A 1TCDA 3KAOA 4JY8A 2NX1A 1Q45A 2NUWA 1TPDA 2Y61A 3ZS4A 2EHHA 3A24A 1OG0A 4MFEA 3O1NA 5E0KA 2R14A 3TA6A 2ISSA 1SPQA 3TSMA 3PB0A 2FPVA 3UXDA 4TIMA 2Y6ZA 4K7YA 2E5DA 3CT7A 4X2RA 5IBXC 1N8FA 3K30A 3VE7A 4AXKA 5KZDA 1A5BA 3W7CA 3TJXA 1ALDA 4FHAA 4Z0SA 1K02A 3LI1A 1GVQA 1T96A 3LHUA 1LTDA 2V9DA 3TXVA 2TSYA 1VCGA 5F2IA 4R53A 3BV4A 1BWKA 1EWDA 4ONVA 4UTMA 3R2GA 3TMLA 2E77A 4RZ4A 3S5OA 3O16A 5LHFA 2QUVA 4KWVA 1KA9F 3B0PA 2HSAA 3PS7A 1FCVA 1YLVA 3LHTA 1ZFJA 3L9CA 3TX9A 1GVSA 2Q3RA 1GVOA 1L6WA 3H53A 3A23A 1F2JA 2EGZA 4X22A 1W1ZA 5C54A 2EAWA 2WQPA 3ANYA 1GTEA 3N9RA 4FXRA 2YGYA 2BLEA 1F7BA 1HG3A 2TMDA 2A7PA 3LLDA 3HGJA 2ZQ0A 4GFSA 4K8HA 4P61A 3QF0A 1SZFA 4GUGA 1NF0A 3TNOA 1YDNA 3U2OA 1H63A 1PL9A 3UNDA 2X1TA 3U6WA 2VEIA 2V2DA 5CZSA 1GJPA 1LZOA 2QCDA 1JCYA 2WO5A 4ORMA 1VPXA 3GK0A 4O19A 1JULA 4N2YA 4K39A 3W7RA 4Z1BA 4EF8A 3OVQA 1W37A 3S6DA 2FQIA 3PBWA 5K4XA 4RLIA 2Z1BA 3G3DA 4JTIA 3EX6A 4MZ8A 4C1KA 4N9DA 3H54A 4JX4A 1TQJA 1GVFA 1VYPX 1L2UA 2OJPA 1HTIA 1OK6A 3TR2A 3NOEA 1O94A 3RLVA 4UC5A 4QQ3A 1XUZA 3ABOA 3GNNA 1QDSA 2NXIA 2ZRXA 3L0GA 4JTLA 2J6XA 3TC6A 3EX4A 3JS3A 4OE7A 4CQ9A 1W3TA 2V5BA 3WK3A 1YPIA 2ABAA 2GQ8A 1WX0A 2R94A 1VYRA 5LNRA 2NUYA 5G2WA 1M6JA 3DFQA 3OVRA 4OWGA 5I3FA 1BWLA 1RVGA 1H7OA 4FX8A 4BK9A 3MHGA 2VELA 3DHFA 4QNWA 3V75A 5HNRA 2Z6IA 1ZJIA 3QPYA 1OK4A 5F4SA 5EY5A 4LW7A 1OFRA 3IIPA 4PEKA 4CCDA 2FPTA 2WSQA 2E09A 3FOKA 3GAYA 4LC6A 3SIZA 4TR9A 3G18A 3MI6A 5HMSA 3C2EA 4MZ1A 4GRSA 4N9EA 3PF3A 2X16A 4NJHA 5LHEA 4RJEA 4O14A 4HIBA 1A53A 3IIXA 4K37A 3C3NA 2XN1A 4DBEA 5E1QA 3KVJA 4N9BA 3EX2A 4HNTA 1TRIA 2GQ9A 5DELA 1JCJA 4JXCA 3OBKA 4Z08A 1A5AA 3BO9A 1OYCA 3WJSA 5EYWA 3UWZA 5SWUA 1QWGA 1SFLA 4LV4A 5FEXA 3G1YA 2ATSA 1XM3A 4O50A 5G1TA 4RX0A 4E2BA 5KZMA 3M7WA 4LRTA 1D3GA 3PM6A 3WK1A 4M6QA 4MOZA 3DENA 1FY6A 1H62A 3IGSA 4JIQA 5LGZA 4G1KA 4S1FA 1GYLA 1I45A 3BGJA 5KITA 4I9AA 4FX6M 1MSSA 2YSWA 1LBMA 4ICNA 5D38A 1K03A 3LCGA 4NXSA 2QCHA 4IX2A 4AEOA 3F03K 1KFEA 2JKEA 2V8ZA 2Y62A 3DAQA 1C9DA 3R12A 5AYYA 3BLEA 2O7QA 2BWGA 4P2VA 2FJKA 3TKFA 4L4MA 5AC6A 1I2PA 2G95A 3W7OA 3MP4A 1VCFA 4UIOA 5U7SA 1DHPA 4MY9A 4NJGA 2OT1A 1W31A 1Y0EA 4XTIA 2DZXA 1GPWA 4FX7A 1VLIA 3SR7A 2NWSA 4A29A 3UWQA 1RV8A 1XI3A 5FESA 2CLEA 3P7YA 3QZEA 1CI1A 1D9EA 3MYOA 3KX6A 1KFJA 3IVUA 2YDAA 3DXIA 1LLZA 2E1DA 4RXGA 4JTKA 4Q32A 3S1VA 3TXZA 4AHOA 3KVKA 2AQWA 4WJEA 2E5CA 1TTIA 3UXAA 1B4EA 3R13A 1XKYA 3LI0A 4I7UA 4FXSA 3KOFA 1ICQA 1ONRA 2H3BA 4CQAA 1HUVA 4IMCA 4ZQOA 3LGEA 2V30A 3P61A 1Q6RA 3G1SA 1RPXA 5K4ZA 1PHWA 3DI0A 2Y7FA 4JTEA 5KTLA 3LHVA 5FEPA 3W1NA 1ME8A 1QPQA 3P74A 4OQVA 4AF0A 1GOXA 1KFKA 2CZ5A 2ZDRA 5D2WA 2A6LA 1JUEA 1QPRA 1BTMA 2WNQA 2WNNA 2ZZ2A 2C13A 2DZSA 4XKYB 3EEGA 5I3IA 3UZ5A 2X30A 3DZ1A 3W1MA 1AL7A 2GJLA 1TTPA 3A22A 3HQ1A 3M0ZA 3S9YA 3N34A 3UWUA 1OFPA 3QW4B 4HHPA 3PC0A 2X1UA 2RKXA 5AFDA 3NM3A 1XBXA 1GT8A 1KW1A 1RD5A 5A8GA 3W7JA 1SW0A 2Z2UA 4WX2A 3GLCA 4WY0A 3GIYA 1KBIA 1MEIA 3G24A 3BLFA 1K8XA 3P8JA 5HWJA 1SZNA 4O18A 4JTSA 4LVAA 5HWMA 3C4UA 2E6DA 3TE9A 2W0UA 2E6AA 3EKLA 2V2CA 1LM1A 2VKZG 3NQFA 1SO5A 4GBUA 2B0MA 5FEZA 4FNQA 4DBDA 1Z44A 1R46A 2ISWA 3VNDA 4BFAA 4DELA 2P1FA 4GUHA 3NQ6A 4E2DA 2R91A 2VEMA 1GTHA 2ZYFA 4FNSA 1B4KA 3WFAA 1VLWA 4JX5A 3PG8A 3W7EA 1TIMA 4DEFA 3P81A 5G5IA 4Y90A 1G6CA 4D2JA 4UFKA 2W79A 3PUDA 3G0XA 1H60A 1KTNA 1FCQA 1DL3A 4N6EA 3TJLA 3NO5A 3G1XA 4FNTA 5HJLA 3WK0A 4CNPA 1JQXA 3LERA 3PG9A 4UMBA 5AYXA 4AH7A 3NQEA 4IMFA 3IRDA 3PBUA 4UTKA 2ZZ6A 3M6YA 2OZ0A 4O16A 3FA5A 1B3OA 3LBMA 3L65A 2ZRYA 1FWNA 2J24A 4IGHA 2ZTJA 1VZWA 3O63A 1FWRA 1OF8A 4IUOA 2I14A 1S3HA 1X7FA 4IPJA 3BW3A 1OX6A 4LS1A 1K7EA 4JYEA 1KM3A 3STEA 1FDZA 3ZWSA 1TPEA 2ZCGA 2RFGA 3NQMA 2KZHA 4O52A 2WNZA 5D37A 3W2UA 1I2OA 3M44A 1FXPA 1KFCA 3Q2DA 1W56A 4UTJA 4YMZA 5E93A 4M6VA 3W70A 5F1UA 3PUEA 3USBA 3FKKA 4KWWA 1Z42A 2CZEA 3HJZA 3NGJA 3SI9A 1W5OA 1H7RA 1WQ5A 7TIMA 1ICPA 1SO3A 4LRSA 4H3DA 1BKSA 3TAKA 1O95A 2DORA 2Y63A 5KZEA 3KRSA 1WYIA 5HWNA 5TQLA 5K9DA 3C52A 3W1AA 3AO0A 2VC6A 3HG5A 3TUUA 3KVMA 1O60A 4MLJA 4Z1AA 4KFPA 3PR2A 2VEPA 5BW6A 4MKNA 4ZQPA 1RR2A 1IIHA 3M5ZA 1MZHA 3CU2A 5K7JA 3HO8A 2WV8A 5AN7A 3LV6A 2Q8ZA 2X1SA 1YXDA 5AYZA 5BMWA 1AW5A 2F84A 1OFBA 3RLUA 1NSJA 3CB8A 1DJQA 3TMQA 4Z1DA 4MLRA 3LCHA 3LRMA 3N2XA 4NU7A 5U4NA 4E0CA 5FEWA 4O17A 2O7SA 4GNJA 4Y6GA 1EUNA 1K7XA 1GWJA 3B8DA 4IPIA 4JDYA 1Q6QA 2FTPA 1QOQA 2JK2A 6ALDA 4UMAA 3B06A 1RQBA 1W0MA 1CX9A 4NT0A 3A5FA 2DJLA 4BF9A 1FCBA 4O11A 5D03A 3KRUA 1X8FA 1OFOA 4R34A 3MO7A 1ML1A 1FWTA 1LRTA 5C2XA 4L4LA 1SU5A 1XXXA 5LNVA 5HR6A 2G97A 3QC3A 1DKWA 3STCA 3G1FA 3CPRA 3O05A 1VR6A 4MYXA 4M6PA 5CKSA 3G8EA 1EP3A 1KM0A 3G8RA 3GX9A 1VS1A 3ABQA 3LTYA 2FDSA 1FWWA 4MJZA 4YCPA 2OMAA 2VFGA 1D3HA 2QUUA 3V1PA 5DCDA 4ZQMA 1QR7A 1UASA 3UPWA 2J27A 3WJXA 1YDVA 5I3KA 1XBVA 1DQWA 1LBFA 2NXHA 4Q4KA 2CFFA 3BARA 3QYQA 3GR7A 1NVMA 4AWTA 3IIVA 4K6AA 3S42A 3QH2A 3HOJA 1ADOA 3A9IA 4TMBA 3ABRA 4M7TA 3GNDA 5BMXA 4UFMA 1XC4A 4QISA 3N2MA 3LCLA 3LHWA 2NX3A 1OFEA 5F2LA 1FDYA 2CLLA 2ATMA 4HPJA 3YPIA 3L21A 4UNKA 2G5WA 2R8WA 3H55A 3KVLA 1KLYA 1Q6OA 3MI3A 1MXSA 1TV8A 3QW3A 3C56A 1ME7A 4FF7A 1W3NA 2PC4A 1OHLA 2QCCA 3EX3A 4GWEA 2QJIA 3GDLA 3QSTA 1I2QA 2GOUA 1IF2A 3W2MA 4O1CA 1IXPA 2BSLA 4I7VA 4UFHA 4XBSA 4KKXA 4WUIA 3L5LA 5FF3A 3QMRA 3BK0A 5ABTA 4RV8A 4GJ1A 3NQ2A 1AW1A 3T55A 1MEWA 2GQAA 3W9ZA 3N9SA 1TMHA 3G1HA 3W7NA 5K3VA 2CLMA 4O1DA 5AB3A 1OYAA 5EPDA 4JTFA 4HPXA 3L5AA 2NZLA 3P60A 2A7RA 5FF2A 1UJPA 4O0ZA 5J5DA 2YFNA 4Y8FA 2JBMA 5D2VA 4UTTA 2ZRZA 4FEZA 1O5XA 2OT0A 1WOBA 1I2NA 1R30A 2H8ZA 3C2VA 3W1XA 3DH7A 4FNUA 1TPB1 4JTTA 4TU1A 2Y70A 1H1ZA 1KTCA 3FFSA 1WDWA 4LOCA 3FYOA 3N73A 1P4CA 1F76A 4IOTA 2ZTKA 1C29A 1LP6A 1LRNA 4UR7A 4JN6A 1L6SA 4GUIA 3L66A 3E02A 1ZAHA 2LLEA 4LY8A 4YXGA 2YCEA 1LROA 3CTLA 3BPWA 4JTJA 2CWNA 1U83A 4POCA 3LV5A 1TPFA 1VCVA 3FKRA 1ZAIA 3EWXA 3IGUA 5AHMA 3QMTA 1EB3A 3I7SA 3HG4A 3S5ZA 3G1VA 2WSRA 1F6PA 3LB0A 4NQ1A 4ZMGA 3I7RA 3UYCA 2JKAA 3WJZA 3G1DA 3MJYA 1P5BA 1RQHA 4JGDA 2C15A 3HGSA 3C6CA 3B0UX 3NXFA 3C2OA 4DPPA 1G7UA 3TU9A 2YW3A 4NNBA 3SZ8A 3OIXA 2CW6A 2XFWA 4XKYA 2HS6A 3GYEA 5CSSA 3P62A 3HBLA 4MFDA 4WOZA 3NPUA 1YYAA 1T99A 3L0KA 3W1PA 1F74A 2DZVA 3PB2A 3G0UA 4DO5A 5G2IA 3LHZA 4AWUA 1XUUA 3TDFA 4FO4A 1VYSX 3KHJA 1PIIA 2CLFA 3WJYA 3NL2A 3QM3A 4LUIA 2E68A 3F4NA 3MW7A 2QAPA 3TW6A 1EWEA 2P0OA 3C61A 4UTIA 4UCGA 3NM1A 4OU1A 4CLMA 3W74A 2C0AA 2C1HA 1JQVA 4EF9A 1PE1A 5C6MA 1SSGA 5D2XA 1LCOA 4QM1A 2RDUA 1K8ZA 4UXDA 1VH7A 2ZZ5A 1FXQA 4JTUA 1X1ZA 2CLHA 4OT7A 1SO6A 1TO3A 1LLWA 3W6YA 4ZZ9A 4K36A 2B7OA 3SY5A 5CPOA 2J9ZA 1TQXA 3GB6A 4B5NA 3W3OA 4CQ8A 3PAJA 4NZJA 1VGAA 3LCXA 1XDMA 3S8HA 3PWAA 5DBUA 2FFCA 2ZBTA 3T40A 2A4AA 4QNEA 1TV5A 3PBVA 1L9WA 4O1AA 3LCFA 1XBZA 5KINA 4X3ZA 3UQNA 2ZA3A 1ICSA 1W8SA 1WV2A 4UR8A 1LDCA 3NG3A 1WAUA 1KV8A 4S2CA 3BG3A 3OA3A 1QPOA 3TQVA 3W85A 1M7OA 3A5VA 4FIRA 3BW2A 1JVNA 3OG3A 1DORA 3NPWA 2BTMA 2E6FA 2ZZ3A 3UWYA 4UTUA 4S2BA 1UB3A 3LRLA 1UUOA 2B7PA 2I1OA 3W7PA 3HGRA 1KM4A 4JY9A 1W5NA 2GVGA 3THAA 1JCXA 1FQ0A 1KFBA 3NDOA 1VC4A 4O10A 3W2JA 4DF0A 1YDOA 1JRCA 1G4EA 1TPVA 3NEVA 4J9JA 1VHCA 1WBHA 2E6YA 3NAVA 2QAFA 3W84A 5I3HA 5F4XA 3PBYA 4QAIA 2C3ZA 5TBOA 2YFOA 1ZENA 2TPSA 2X2GA 3G0SA 5HUPA 4O15A 2QCGA 2NUXA 1NF7A 2J9YA 2C16A 2QCFA 1H7NA 1G69A 3HPZA 3FEMA 4NX0A 3GXPA 3G1AA 3P5ZA 2Y88A 3W87A 4MUZA 2ABBA 2CZFA 3BGGA 1TPC1 2ZZ1A 3UWWA 3LDVA 2JGQA 3W2NA 2NLIA 4AMAA 1TSIA 1HO1A 5KSWA 1EP2A 4NJIA 1SZEA 1XBYA 1C8VA 3RNDA 3MUXA 4JNMA 4ORIA 2TYSA 5C5YA 3FJ6A 1SZGA 3TC7A 4ZL1A 1VJIA 3IIZA 3NQAA 4PA8A 4O28A 5DY3A 3NQ8A 3O6DA 4O0KA 4I7WA 3BW4A 1LBLA 3ZR4A 2YYTA 2C14A 1H5YA 1H7WA 1E51A 1LOSA 3OEXA 4GE8A 5AC7A 1X1OA 3GAKA 3MBFA 4LV9A 4OHQA 4NJJA 4DF1A 2B7QA 3NL3A 3ZWTA 2D73A 1TPWA 2NV2A 5D33A 3RMJA 4MY1A 1QO5A 5D09A
chains in the Genus database with same CATH superfamily
2GDUA 4IGNA 4JIHA 3WH7A 3ELFA 4B3LA 1GORA 3GXNA 1PUDA 3BLKA 1UA7A 4TOQA 5BOOA 4RZBA 5HATA 1XCFA 3MI2A 1QNQA 1ZLPA 3RM4A 5DMNA 3E5PA 3HPSA 3BC9A 3AIWA 4MB5A 1DV7A 3KCJA 7ODCA 3W0KA 4PCFA 1ZBKA 1U2YA 1QBBA 1GG0A 2ZZ7A 3WQOA 4F0HA 1Z41A 3N25A 3VU2A 2FTWA 2YA0A 1PCWA 5G4WA 1MW2A 2PLJA 3QZAA 2H90A 4ZOCA 2B81A 3SRHA 3H21A 5E9AA 3NQGA 1ZCOA 3V5OA 1B3ZA 4IXHA 4JQ3A 3GVWA 1VENA 4HNVA 1QFEA 4O13A 3GNXA 4AZ5A 3M5VA 4ML9A 3RO6A 1UROA 5CC3A 5IDIA 2YBTA 3P8IA 2GPTA 4Z17A 2C7FA 3IEBA 5HNUA 3FAXA 3HB9A 3BCDA 3W73A 3A13A 5D30A 5LKYA 4A3UA 1GZGA 2OWWA 5J5RA 4NYYA 2VC5A 1DYSA 1TKKA 3LRKA 3E49A 4C6QA 2XH0A 2XUCA 3HJEA 4OVXA 1HT6A 2RH9A 1MXGA 3VYLA 1X38A 1R7OA 4W84A 1AQ0A 1UIOA 1CGTA 3NL6A 4GHRA 2QKFA 3CWHA 2PGWA 6CGTA 1MI3A 4UOQA 2VFFA 2BASA 2GJNA 3IAPA 1KV5A 2OLHA 5FF4A 1PXGA 4B9YA 3P5YA 2PURA 2Z26A 1E4NA 1CXIA 3SN0A 1T8QA 5FF0A 3CT2A 1MEHA 1UP2A 1WDRA 4Y9NA 4UTHA 1TV2A 3APTA 3G3MA 2VEKA 3RYSA 1GVIA 1KFLA 2H3DA 1FFRA 3AYVA 3M07A 3UR2A 3N19B 2D24A 4BR1A 2XN2A 3UGRA 1EYEA 5H6HA 4V1YA 3FX4A 4QE1A 3W38A 1GOOA 4XG1A 4TX9A 5CPLA 5BRPA 1SR9A 4FB7A 4RKAA 3EXSA 3GXFA 3LLFA 2VZOA 2IQDA 2P76A 3B03A 1PKLA 3R89A 3GDTA 1N7KA 1SFJA 4FNRA 2FMOA 4QJ4B 4LVFA 3PY2A 1MFUA 4QDMA 3SB0A 4PMNA 1V02A 2REQA 3GZ3A 1VIWA 1YXYA 1JRBA 1JUKA 2R1LA 2GQ3A 1HL2A 3WQ8A 1KRBC 3RGTA 1OD0A 3VI2A 4DO4A 3CHFA 1M68A 2V67A 3BE7A 1VFSA 1OC7A 1JDFA 4Z2KA 2VFHA 1H51A 4UNLA 2VCAA 3HM7A 3DKJA 4W85A 3EWYA 3E0IA 3VILA 3U8GA 5DXYA 4UFJA 2Z27A 1A50A 4A2SA 4Z1YA 1PPIA 4P7OA 1U5JA 4WY0F 4HSOA 2WWDA 3SCTA 1KQYA 4QCEA 2XIOA 1KNWA 4C6EA 1BG9A 1IIGA 3TFCA 5C7VA 1EP1A 3S6TA 3CQ0A 2YDSA 3AXXA 3NSXA 1Q6CA 2R82A 1E5NA 3M0XA 3D3FA 1IV8A 3ZVHB 3FYYA 4OFCA 5BROA 4ZQNA 1ADSA 1PCKA 5HMFA 3WQCA 3MMTA 1X97A 4PFMA 3HN3A 4RNIA 2ZXQA 3IANA 2CERA 3V5FA 3W7KA 4S3GA 2EKCA 2GVJA 4XTDA 2ZXDA 3B4YA 4HTBA 2YB4A 2C19A 2PWUA 4H4IA 4ES4A 4PC8A 3GDMA 4OGZA 1GPFA 4UBPC 4F3HA 3W88A 4GQGA 4JL1A 2G50A 4S3EA 2QDGA 4XVDA 4GYKA 2RDTA 4MB3A 3WQVA 2Z0IA 1DPMA 4N02A 4MIMA 4LNCA 3TJ4A 3ARYA 4M51A 3UF9A 3FA4A 5HOSA 2ZRWA 3F2DA 5D4YA 3UA3A 3RG6A 1YTDA 1SR0A 4B4HA 4PN2A 2OXNA 3AYSA 4M7SA 3W83A 4DWSA 1G7VA 2Z6JA 3TQPA 3S5NA 1W1VA 1KM1A 4YHGA 4UQAA 3EOLA 4AZGA 2QCLA 3M47A 3BZGA 5D05A 5L6UA 4RZ5A 2ON3A 1KTBA 2J9XA 3DFPA 4TMCA 3BTNA 1P6WA 3W23A 4TO8A 5I77A 4JS3A 1XGEA 3CGTA 3PAOA 4AZBA 1W3JA 2PDGA 3LMYA 2EBNA 3P6LA 5TIMA 4DWDA 1QI4A 1EZ2A 3KWSA 1TPH1 3QOKA 4LEQA 5IRPA 4LNYA 5IBXA 4H6KA 4PCSA 4NZCA 1S1RA 3EWUA 2XSXA 3DFOA 3RCYA 4A22A 1XPGA 2ACRA 3Q94A 2NSXA 4Y8EA 1BQGA 3KTSA 3CUZA 4J35A 4B5WA 2XVKA 1OT1A 2X09A 4OBTA 3IJQA 1RSCA 2ZE3A 3SW6A 1J79A 2DZTA 1BXCA 1LORA 3NQ7A 1E6XM 4FXJA 4PH6A 3RM9A 2VR5A 3P0WA 2I57A 4BEQA 4Q8TA 1GQLA 1J11A 4B2DD 2ODOA 1BVNP 3VKJA 5D8ZA 3XINA 1HKVA 2QDHA 2WVVA 4YVPA 1YPFA 3GH7A 1V7AA 3G1RA 4FF5A 3AIQA 3C86A 3VFCA 3AWOA 3ECQA 3P80A 3LGDA 3LU2A 3CC1A 3Q65A 4XZ9A 1NEYA 5CPTA 3W07A 4W8LA 1A47A 4RPQA 4FAMA 2RDWA 1TWZA 4XWUA 3PFMA 2A3LA 3P0XA 3B40A 3DBPA 4ZXLA 1A5SA 1E70M 1YXCA 2E3ZA 2NXGA 1BD0A 5E0CA 3GHSA 1NDVA 5EFDA 3AJXA 3U3HA 1JXJA 2VCCA 3QEZA 4IXXA 3E2RA 4FLOA 5I07A 1AQFA 3QV8A 4IJBA 3WNMA 3I3EA 4NG3A 1VFTA 5LA1A 2GYIA 1XIFA 4DX3A 5HNTA 1XW8A 3DU0A 1HJSA 4ZODA 2GJXA 4XAYA 1FKWA 2Y5JA 1WXJA 4AWSA 2FHFA 4IMGA 3LXAA 3D3AA 1OX4A 5HINA 4LANA 4J7RA 4K1GA 1E6PA 4N4QA 4NAEA 4NX5A 4KT2A 1QASA 1W3IA 3WUBA 4FR1A 1ONXA 2GGHA 4JQ1A 4QIUA 2DVXA 4R33A 3RMEA 3WLTA 1GKQA 1DOSA 2FZ9A 4Y9AA 1WUFA 3TZNA 4JL2A 2V81A 5CPMA 2X0SA 4M3PA 4GYFA 4NJKA 1Q6GA 2Q71A 5A8NA 4MGGA 1Q6FA 1NOWA 2QNEA 4F66A 4M6UA 2OLSA 4YPJA 2PP1A 3D0CA 2D2GA 1R6WA 2EKGA 3O3RA 1NOUA 2DZUA 4H1ZA 1EUAA 3SSJA 3K8KA 2G3IA 4H9YA 4E38A 5H8MA 4LGXA 1B9BA 1SMDA 3C2RA 1EO7A 3CNYA 1POJA 2X2YA 1DWGM 2OQHA 4ILSA 3VNIA 2C6QA 3GKFA 4KWOA 2DPEA 2GOKA 1H3GA 2QUTA 4XUGA 1R2TA 2HVMA 2YL5A 1J9YA 3MVIA 3QRHA 1EF3A 5KMYA 4UTWC 5M03A 4DO6A 3WQWA 4US6A 1JR1A 1FHDA 4YWSA 4DY1A 1C9WA 1OF6A 3DCPA 2VX5A 4IQDA 4AUBA 4JN7A 4LYRA 3S5YA 2XYLA 1VRDA 4XZHA 3DG7A 2VL4A 4DF2A 2FLIA 3FHQA 2G4JA 3JRKA 1F05A 1B30A 1GQKA 3GNOA 3E9AA 1I6NA 4KRTA 4QFUA 2QPUA 2V3GA 4E5TA 2WVTA 1WA3A 4EWND 3CHCA 4IF2A 3RR4A 1HKIA 2DSUA 3H70A 4YL2A 1E1FA 2CYGA 5XIAA 4WD0A 3WLSA 2VZSA 4Q4RA 3TC3A 1PX4A 5CAKA 1TR1A 4KRUA 1BTCA 2NQJA 1VHNA 3W6MA 1CT5A 2IPGA 1G4TA 2ACSA 2OWXA 4BQ5A 1TCDA 3U0HA 1HKJA 1Q45A 2NUWA 2EHHA 4MFEA 2PWGA 4AD2A 4A8NA 2R14A 1SPQA 4I90A 4TX8A 1OC5A 3TSMA 2DGAA 1W6TA 3PB0A 3ANUA 1XLCA 3ZT7A 5FOOA 4GACA 2PFHA 4X2RA 1V3IA 4P7QA 3CAWA 5KZDA 2PDQA 4JCMA 1ZZMA 2IMRA 4FHAA 4XAPA 4P7NA 1JFXA 1LTDA 2V9DA 2TSYA 1GNXA 4PTMA 4JHZA 3AXKA 3ZIZA 4ZO6A 4L9XA 1EHAA 4UTMA 2PWVA 5I3DA 5AZ0A 3CB3A 3M64A 1ZGDA 1D7KA 1RJRA 3EOUA 1X8CA 1GZJA 2PB1A 4HOXA 3MDUA 1KA9F 3K46A 1GZ1A 3PS7A 3CL7A 4H00A 1SJBA 4M82A 2GSJA 3LGGA 1P6BA 1K1DA 2VWTA 1GTEA 5CC7A 2ZX8A 2A7PA 4LUSB 2UY3A 3V36A 4P61A 1UH2A 3VXGA 4GUGA 3PZ9A 1NF0A 4GKLA 1YDNA 1V02E 4LSBA 1GCYA 2P88A 1PL9A 2X1TA 1IWPA 2V2DA 3EDEA 4GVFA 1DWIM 1LZOA 2ZUSA 1LJYA 1JCYA 1IR1A 1VPXA 4US5D 1C3FA 4GIEA 1JULA 4O19A 4M1BA 3GBEA 2ANUA 4K39A 4OUEA 3WUGA 3UCQA 3TOYA 2XWDA 3S6DA 4E2OA 5K4XA 3V5CA 2TAAA 4JTIA 1TQJA 1GVFA 5IXEA 1VYPX 2WMIB 4JAWA 2WHLA 3VDCA 3LY0A 2WNWA 3GNNA 4JTLA 1J0IA 1CPUA 3JS3A 2PUZA 2VCBA 5M2FX 4IICA 3GD6A 3N9KA 2ABAA 2DQXA 1WX0A 2GUBA 1HX0A 3W24A 1M6JA 3OVRA 5I3FA 4HK7A 4FX8A 3K8MA 7REQA 4FPSA 1UP3A 2G8ZA 3V75A 5HNRA 5LIKX 5F4SA 3IIPA 3V1HA 1EOKA 4CCDA 2J47A 2FPTA 1I0DA 3V3WA 2E09A 3SEPA 3G18A 2PWEA 5HMSA 2PZ0A 4A4AA 3PNZA 3CUFA 3PF3A 1D2KA 3WNPA 4REQB 5LHEA 4NJHA 2Y2WA 1ZBCA 3C3NA 4L1GA 4HU3A 1HKWA 5BYWA 1JZ8A 3EX2A 4ERAA 1ODZA 3GHRA 1Q85A 4EXQA 3OBKA 4NF7A 8A3HA 1XQKA 5EYWA 3S4TA 5SWUA 1K70A 3AICA 5FEXA 1FWBC 2C8NA 3G1YA 1XM3A 1XLFA 2Z1KA 5HANA 4LBRA 1W32A 3QGKC 4P8WA 1O68A 3WK1A 2P50A 1C92A 1YBQA 3DENA 4L9ZA 5A6AA 3IGSA 4Z2LA 2EPNA 4S1FA 4GFIA 1I45A 1S46A 4I9AA 1XIJA 1AMYA 1F4HA 1MSSA 4MB4A 5D38A 2UY5A 3PTMA 2QCHA 1XV8A 3JZUA 4J40A 1KFEA 2JKEA 3UPMA 1PB0A 4QAWA 1IGWA 3GH5A 2E40A 4O1FA 6ENLA 1R5YA 2OSWA 4DJEC 2D0HA 4GI4A 4L4MA 3H2OA 2WC7A 1DE6A 2D20A 4EWJA 1UR9A 2OPJA 4MY9A 4NJGA 1EGVA 5A2CA 3FSUA 3TNBA 1P0DA 1A5NC 3TLQA 2WZHA 3CZLA 2PAJA 4A29A 3UWQA 3IGHX 3KX6A 4IUGA 4PMQA 3BLDA 4LFYA 1LLZA 2BBFA 2E1DA 3SDOA 4JTKA 1LG1A 4WJEA 4O8AA 3MC5A 2E5CA 4NAFA 2XVGA 3R13A 4LF1A 4ATWA 1ICQA 4LCSA 2CPUA 4ZQOA 4MMWA 3G1SA 1FTXA 3CASA 4MWAA 5LYRA 2XZ7A 3NUKA 1ME8A 3APYA 4AF0A 3R8HA 1WXYA 1A80A 2WW5A 3K1DA 5ENLA 2E28A 2QGHA 1SMAA 1JUEA 3GTXA 2DDXA 2Y8UA 1JFHA 2ZZ2A 2ZWZA 3UZ5A 2X30A 3W1MA 9CGTA 1GHSA 4KF1A 4C6MA 5MKGB 3D6NA 1EC9A 3M0ZA 1R38A 4GH3A 5E70A 1IT7A 1P48A 3T4WA 2BOEX 2X1UA 4J2MA 4M80A 5AFDA 1D8CA 3UG8A 1XBXA 4MTVA 3R94A 4CN4A 3NGFA 3H22A 2VR2A 4WX2A 1XHGA 1QU4A 2O9OA 3LNPA 3BXWA 2PS2A 2NT0A 1SZNA 4O18A 2XH4A 3C4UA 1GW9A 4B90A 2OB3A 2E6AA 4UZUA 1JGMA 1UUQA 3LS9A 4EX4A 5FEZA 4YYFA 4BFAA 2P1FA 4PMJA 4E2DA 3DYOA 1GTHA 4JKLA 4QSFA 5CSUA 2ADAA 3W7EA 4DEFA 3QC0A 2WZTA 1G6CA 4A3YA 4D2JA 3D46A 3UU0A 2W79A 3PUDA 4TTUA 2PI6A 1RAKA 1KTNA 2PWHA 4JHOA 4FNTA 3G1XA 3ZLFA 4X61A 2QDDA 4K68A 3SRDA 1WZMA 5AVNA 3PBGA 1XGZA 3NQEA 4DO7A 4UTKA 1EBHA 1GJUA 2ZZ6A 3M6YA 3VCNA 5CBJA 2YXXA 3N29A 2XH7A 3L65A 2PSNA 1WDQA 2DV0A 3F7JA 4XO7A 4LPCA 3MANA 1S3HA 3ARUA 1X7FA 4JYEA 1KM3A 1PBGA 2C1GA 3UYIA 2RFGA 3GVRA 1KKOA 3NIYA 4O52A 4Q7IA 3KHDA 4IHCA 3NSMA 2PDFA 2C71A 3AIUA 4J3UA 3FKKA 4TVUA 4PULA 2OYMA 4WCJA 3NGJA 3SI9A 2D23A 4ZB2A 1ICPA 1J5SA 3D5HA 3U2CA 1N82A 1NJJA 1JD9A 2Y63A 2HE5A 3IJ9A 1WYIA 5K9DA 3C52A 3EPNA 1W1TA 1O60A 2J8FA 2GVEA 4D9PA 3POHA 3AIRA 1IIHA 1JIBA 2WSPA 5AN7A 3ARRA 3LV6A 5B7YA 3E5BA 4IG2B 4CKQA 1ELSA 1AW5A 1NSJA 3S9ZA 3NTYA 3WH6A 1DJQA 3TMQA 3LCHA 3N2XA 3DBNA 4NU7A 2G4FA 3OLGA 5FEWA 2O7SA 1VFLA 5HMDA 4AISA 4GNJA 3RHGA 1F07A 5JBDA 1XLHA 4IPIA 4JDYA 4GO9A 3WDRA 4QTGA 6ALDA 4PCNA 2R1PA 1RQBA 1GQIA 1KCXA 4MNLA 1W0MA 4NT0A 5JBEA 4PRWA 2DJLA 1EYWA 4CGTA 4O11A 4R34A 3T1GA 1DJIA 1LRTA 2ZUUA 5JMUA 4URIA 5IFPA 1XXXA 4P8VA 5LNVA 3ONBA 3G1FA 3PTKA 3O05A 4MYXA 4PUMA 2HRWA 4IIFA 1VFUA 3AXIA 2VFGA 1E0XA 4RNJA 3V1PA 1QR7A 4AIUA 2QZRA 2BY0A 3K13A 4C5ZA 3WJXA 2JALA 1P7TA 3PUGA 2NXHA 1Q63A 1Z6KA 4Q4KA 4C6NA 2CFFA 3WNKA 4FXFA 2JF6A 3IIVA 4K6AA 3L4UA 3S42A 1U5HA 3ITVA 1U30A 1A0CA 2BVTA 1ADOA 1CXEA 4M7TA 3THDA 4UFMA 1XC4A 4QISA 4GQBA 4XV0A 3EGJA 3GFXA 3N15A 2ATMA 4HPJA 5BZAA 4A8RA 2VX6A 1Q6OA 1MXSA 1TV8A 5EMMA 2PC4A 2EEXA 1OEPA 3QSTA 5D9MA 3N2TA 1PEZA 2GOUA 2OOFA 4IP7A 4O1CA 4KGLA 2BSLA 5BXRA 4UFHA 1VBJA 4WUIA 1E9IA 3LQGA 1A5KC 2Z00A 1F9CA 5ABTA 3O0KA 1TJ0A 1MEWA 3SN1A 1TMHA 5K3VA 4O1DA 3IJ7A 1B9ZA 2AAAA 4JTFA 3L12A 3P60A 4PCPA 5J5DA 3WLNA 2YFNA 4H7ZA 1OIFA 2JBMA 3P93A 1PIFA 4BHYA 3GVVA 2VRKA 3ALGA 2H8ZA 5GNYA 4FNUA 4JTTA 4TU1A 2ZUNA 2Y70A 1OCQA 4HMEA 1EJVC 2VNCA 4LYQA 3MB9A 3VNKA 3T2OA 3KP0A 1LP6A 1L6SA 2VM8A 2V38A 2YCEA 2HEJA 4E8GA 3N12A 2CWNA 4IIHA 2CHNA 2YJQA 4POCA 1TPFA 4JQ2A 3FKRA 5AY7A 5AHMA 1EB3A 3S5ZA 3G1VA 4HA3A 2WMHA 2X8RA 3LB0A 2XH2A 3WJZA 3G1DA 4C6KA 4GBDA 3HGSA 2WCSA 3NXFA 1DJHA 4DI9A 2ZUWA 5T91A 2CW6A 2KAUC 4XKYA 2BHYA 3S2MA 2R1MA 3GYEA 2X7VA 4HA1A 4EAYA 4HNCA 3A9BA 4MFDA 4FOKA 3QTGA 3TYAA 3PHAA 3BQ5A 2DZVA 4DO5A 5G2IA 4U2ZA 3LHZA 4AWUA 4I9TA 3CUIA 4FO4A 3KHJA 1YQ2A 3NL2A 2X41A 3QM3A 3LSBA 4H9TA 2P0OA 1FHVA 3SFWA 3CJPA 2C0AA 2C1HA 1PE1A 3WLJA 3LD5A 2I56A 5B7ZA 4UXDA 1FXQA 4JTUA 5C2CA 2HVNA 3DERA 4UZSA 1LLWA 4ERIA 3W6YA 3SY5A 1G9HA 3U2ZA 2TODA 1DWJM 5CPOA 3RDKA 4AX7A 2OEMA 4D8LA 3PAJA 4NZJA 4Z2HA 3LCXA 1XDMA 4DNMA 2ZBTA 3REQB 5FSEC 4FOJA 3T40A 2A4AA 4G56A 1TV5A 2WK2A 5KINA 1GOMA 3F5JA 2FH8A 5DMLA 4GCXA 1UKSA 1W8SA 1WV2A 3LN3A 3G6MA 2VTFA 3N2OA 3TQVA 1M7OA 4FIRA 2Z1WA 1O5QA 3BW2A 1JVNA 3OG3A 1DIDA 1DORA 2DVUA 3WF1A 1XLIA 4ZR8A 3UWYA 3FV9A 1UB3A 3LRLA 4JY9A 1TA3A 1R85A 4LH8A 7PTDA 3NDOA 1RH9A 1VC4A 3ARXA 4O10A 4WGHA 3MA8A 3NEVA 2IW0A 1VHCA 3NAVA 4KQNA 3ZR6A 5I3HA 3AI0A 3PBYA 2C3ZA 1ZENA 2TPSA 2X2GA 5HUPA 4AZCA 2NUXA 1NFPA 3R7MA 1D8WA 1ECEA 3SRKA 3LK6A 3HPZA 1KBKA 1FH8A 2CCRA 3DIPA 1NWSA 4W7UA 3N1AA 1TPC1 2ZZ1A 3UWWA 2JGQA 2NLIA 4AMAA 3BAYA 5EMKA 4E6MA 4D1IA 1EP2A 2UZ9A 1SZEA 1T5AA 1XBYA 3ID7A 3CZKA 4JNMA 4ORIA 3GBDA 3B8WA 1ITCA 4PSRA 3UJSA 2RJHA 2HPMA 3IIZA 4D6IA 4B2DA 2PTWA 1LL7A 2EPKX 4MWAE 4I7WA 3BW4A 5EU9A 2YYTA 3VCCA 3F2BA 1H7WA 1E51A 1WKDA 1LOSA 3HQNA 5AC7A 3EB3A 2J6VA 3B9OA 1B3WA 9XIAA 4LV9A 3IAQA 2B7QA 1JPHA 4DUWA 4LUIA 4RDYA 4PEEA 3RMJA 1E0VA 1A49A 1KB3A 2HVOA 4A21A 5CPQA 3RX2A 2FKPA 3BV7A 3SCWA 2QJHA 1KRCC 4EVZA 1S38A 4GO8A 1GOIA 1DIKA 2FHCA 3BSGA 1FOBA 3C8NA 4EOUA 4MKVA 2PODA 1MO0A 2BXYA 4NVTA 1BF6A 3LTSA 3I7QA 5DEZA 3NDYA 3GU2A 3H4XA 2XPKA 5FJJA 3Q58A 4HT3A 1SJAA 1US3A 3LPOA 1W5QA 1WUEA 4JTRA 2UV8G 2XVPA 4EACA 2DVTA 4HKPA 3RJYA 3GW0A 3IV3A 3W86A 2BDQA 2VFIA 2R1KA 3STGA 1XD0A 3UFYA 4O8RA 1C91A 1W1YA 1EL3A 1IEVA 1MDLA 2OTDA 5CSYA 5DBTA 3UXIA 5E9XA 1JI1A 1S5WA 1NAL1 1YTEA 2XIMA 2VP8A 4LAZA 1TRDA 2KX9A 1W5MA 2OQLA 4C1NA 4LVDA 2ZC8A 4MYAA 1JYWA 3MCOA 1ZUAX 1J4EA 3FK4A 4PUKA 1I4NA 2WZEA 3B04A 2V3EA 1YW1A 3AUOA 3TCEA 3JVAA 3W1UA 2BFGA 4AQLA 4HSNA 5REQA 3VZZA 3VNJA 2W67A 5HUOA 4QS5A 3SFKA 5DN1A 1V79A 3BLOA 3VGGA 3TN4A 1RD6A 3DGRA 1S3TC 3FIGA 3KL0A 3LYEA 4U3AA 3BUVA 4YYCA 3DYMA 3W02A 3L5MA 1K3UA 1SO4A 3W2KA 1RALA 3C2FA 3NYZA 2E9BA 3MYPA 5JBFA 2VFDA 4XX6A 2PDWA 6REQB 3PPFA 4IP5A 4C6DA 3IARA 1XCXA 3VCRA 3KRZA 2QLYA 3S1GA 4H8NA 5HQLA 4Y9OA 5AHEA 4LAKA 3SECA 1W9XA 4Q4MA 2ZVRA 6TAAA 3XISA 2HXTA 1UQYA 3VIHA 4XZIA 3FDGA 1ZS2A 3TSDA 2YA1A 2PDJA 3IJIA 2NX9A 1A5UA 1AG1O 4AHQA 1EJXC 2O0TA 3QMSA 2XG9A 2JGYA 4Q4PA 1H09A 3TEVA 1GG1A 4H19A 5XIMA 2I17A 1CLXA 1C8YA 3UJEA 2NT1A 1RPKA 3HMCA 4DUVA 4IFRA 4M19A 1TWDA 1T6MA 3R1ZA 2EPOA 3C2YA 4LAOA 1ECQA 5AYBA 1AFSA 1TV7A 3ZJKA 4JIPA 1GOWA 5CJNA 2GWNA 1CECA 3LX9A 1N55A 3HGOA 3U7BA 4KGJA 4O4VA 1TPUA 3R5EA 4GQRA 3SCSA 1VB9A 3NJ3A 1IXNA 3SCQA 3AWNA 1UH3A 2E7FA 2HMCA 4N0RA 3NZGA 1W1B1 4D6JA 3BAJA 1NP2A 2XVLA 2YX0A 3M1ZA 2YCLA 3VVGA 5G4EA 1QCWA 4CN1A 2QR6A 5LNUA 2OCZA 4ADTA 3SY8A 1LOLA 2PDLA 2QF7A 4A35A 3SJ3A 1W9PA 4N7QA 1JCTA 1FWEC 4FK9A 1YNQA 2QCMA 4LVGA 4U28A 2YCIX 3WL1A 2GDVA 3WDHA 3SCOA 1XJBA 1Z7AA 4KRZA 1E5JA 4AD0A 3OZPA 4LS2A 2YDRA 5I5RA 3W28A 1UC5A 2YL6A 3ABXA 4R85A 1ZY9A 4RDVA 5CZ0A 5HXMA 3OGSA 1ISXA 1TTQA 3GIQA 3KZSA 3GR8A 3W7QA 4QG9A 3NO3A 4LTSA 1IYXA 3MZNA 2A1YA 3GM8A 1JEZA 2XIIA 3BG9A 3U7VA 1F6YA 1IE7C 1HN1A 2XIJA 3EWWA 1IZKA 3S6OA 2AKMA 4WXYA 2C79A 4ML4A 4UTWA 2W63A 1XDJA 4V28A 3PANA 5EB8A 3CL8A 5C9UA 1J2WA 3HIJA 4JTCA 3I6TA 4LEFA 5CCZA 2EG8A 4RR4A 2HTMA 2Y7DA 1QAPA 4W93A 2XDFA 4JIRA 1VBGA 3TN6A 1ITUA 3GTFA 3TROA 5DF0A 1UWTA 3I6RA 1RQEA 3MUCA 2VRJA 3H7VA 4ZE5A 3IV8A 3UY8A 3VKCA 4J1OA 1PVNA 2QCEA 4US5A 1R9YA 3QSRA 4DLMA 1SYTA 5LGXA 4AIBA 4S38A 1C8XA 1ZBWA 1LRQA 2YW4A 3CEUA 1OABA 4A3HA 2FGLA 4Q4SA 3WDPP 3S3GA 4JCLA 5PTDA 4BQ3A 3F5LA 4GNKB 4RZ6A 2Q3OA 3OVGA 1F3EA 3L2IA 3UY7A 5IFTA 2WHMA 2Y7EA 3B0VC 3O6CA 3UETA 5MHBA 4EPEC 4YTTA 3S0CA 4AX6A 3W4RA 2WHJA 4B92A 1XH1A 4IGSA 2DT2A 4PZVA 1R9XA 3CQJA 4LT9A 1B90A 1AK5A 4ADUA 1PSCA 1TJPA 3GTIA 5H2ZA 2OWCA 3IPWA 3IGXA 2V3FA 1UQZA 4K1WA 1L6YA 1N8IA 4H8VA 1XDLA 1OG6A 2PD5A 1JDDA 1IT8A 1XFBA 2Y89A 4BI5A 3KRBA 1G4PA 1IXQA 3GU1A 4N4PA 4X0VA 3DHDA 1QWKA 2Z1XA 1QBAA 2C18A 4XK2A 3TYCA 3KFTA 1DQXA 4E8DA 3TW7A 1GOKA 4AB4A 5AOUA 3HMJG 4WZHA 4HOWA 1XPYA 2A3AA 3SQSA 1GHRA 4BI6A 2AOSA 1DIOA 2WMKA 4JTHA 1VPQA 1E6SM 5AYIA 4ZGYA 3V18A 2W4XA 3PSWA 3FVMA 3RM8A 4IWWA 4Q8UA 2WM1A 2J88A 1PDZA 5JUVA 3CWOX 4PMZA 2XSAA 3M41A 3MUY1 2EXOA 1BGGA 4NSBA 1EFZA 3ISIX 4FLRA 4R5EA 5ECVA 2ZKMX 4IL0A 3I10A 1XGDA 1OJXA 1UOZA 4ZFMA 3WY1A 3AHXA 1TREA 1SW3A 1EO5A 3I3DA 3URQA 4GVGA 4P5UA 3OZYA 4UUIA 5EA9A 1E9ZB 2F8QA 2EQDA 4LWWA 3SQLA 1LYXA 5AHLA 3QY6A 4LC8A 3DI1A 1FWJC 1DJNA 2DZPA 1RY8A 3CIWA 3PPGA 7XIMA 1YDYA 5T8GA 4RE4A 5LZLA 1Q6LA 1LOQA 2F9RA 3THQA 1QPNA 1KXVA 4PBEA 4ZE4A 4GGBA 1CBGA 3DFTA 4KH2A 1YTKA 3S5SA 2WVSA 2XTKA 3M6DA 3N11A 4ZBCA 2VX4A 1JYVA 4Y9MA 5IM51 2WPGA 4L65A 1E6NA 1ZB5A 3DFNA 4IX0A 5DXXA 3ABZA 4MDPA 1DQUA 1YIXA 1FVPA 5FF7A 3WQPA 2E25A 2IQTA 3M9YA 4LUYA 3TH6A 1CTNA 3ATYA 3PZMA 1YKWA 2X0HA 3VIGA 4D6HA 4UFIA 1GYMA 3MO4A 4GYJA 3MV01 4MNMA 4GINA 2DH2A 4CU8A 5DCBA 3FCPA 2PRLA 3MP3A 3ATZA 4XISA 1VFHA 2JF7A 4N9CA 3NQVA 4IZGA 1MW1A 2ZFAA 4YWIA 5H1WA 6TIMA 1EXPA 2ZRVA 4ALDA 1T0OA 4MJ2A 3N14A 4DZ5A 1J96A 2VI0A 1PTGA 3TN5A 4JNYA 1XLBA 2Z29A 3GVGA 1XICA 4U3CA 3W75A 4JKMA 4W4QA 5C9ZA 4GX9A 3PZVA 1OSEA 4V1XA 4GUFA 4DXVA 5BRBA 4HNLA 1IZJA 1X96A 3CBWA 3MVTA 1UIPA 3B0XA 4PTNA 4GKTA 1U1JA 2NVDA 2W92A 3MHUA 2DZAA 2GGGA 3QQ0A 1S5MA 1Q2RA 1NARA 3GDKA 3L4XA 1NH6A 3IVTA 5A6JA 1UBPC 4C60A 5GJPA 3HPAA 4Y2WA 4GY0A 3W29A 3NOYA 3PK7A 4K7VA 2PDIA 4AD3A 2J7CA 1UKPA 1DBTA 2H6RA 3HG3A 4U4MA 1ESWA 4QX4A 5E0FA 1RUSA 5BXPA 4J5NA 2FVLA 4GY7A 3GYCA 1FWIC 1QO2A 4B3ZA 3N3TA 4MDOA 5F2GA 1J93A 1N2VA 3O2LA 4ZQRA 2YR1A 5F2MA 4DBUA 4FNPA 4KEMA 1ZNNA 3VUSA 2L5HA 3GY1A 3IIOA 3F5KA 2PLCA 3MKVA 2J8TA 4S3FA 1BRLB 2OGJA 3QQ1A 3OYXA 3W7IA 2QGYA 3XIMA 3BCFA 2XSBA 1W9VA 4PUNA 3WCZA 3U4AA 1Q8JA 3NCOA 2OZ3A 3W1LA 4WDWA 2QUNA 2ZZ4A 1HVXA 3LENA 4U5KA 3W2LA 4QITA 5G1YA 3VZYA 1OGSA 2CBUA 3RFAA 3W76A 1AW2A 2Y61A 3ZS4A 5HMEA 4GX8A 3DYPA 2ISSA 4JIEA 4CCZA 4ZO7A 2PU1A 3H2AA 1G0CA 3IJDA 1BF2A 1Q4WA 4QDPA 1GVEA 1UWQA 3BLPX 3EB4A 2Q8XA 4K7YA 2E5DA 3CT7A 1Z9AA 3VE7A 4JTDA 3N2BA 4AXKA 2HROA 4IPPA 1A5BA 3W7CA 3KDNA 2WKLA 1AJ0A 4J3VA 3TXVA 3E0FA 1KD0A 2BGQA 3CTTA 1BWKA 4W89A 4IT1A 3S2CA 4ONVA 3TMLA 2E77A 4JFUA 3M4HA 3LZ5A 1P0BA 4D1JA 4RZ4A 4B5UA 4H04A 5LHFA 2QUVA 1G01A 1OGBA 3B0PA 2DUZA 3RX3A 2GK1B 2A3HA 3S46A 1FCVA 3BWWA 4LCRA 1YLVA 1ZFJA 4GYPA 3GNPA 4QS6A 3L9CA 4CU7A 1UR0A 1VEPA 2JEPA 1V03A 3SBFA 1LQAA 1REQB 4X22A 1SGJA 5C54A 2EAWA 1ZJAA 1OC6A 3N9RA 2YGYA 1UH4A 2BLEA 1F7BA 2P53A 2TMDA 3AROA 4IJRA 1E72M 3LLDA 3HGJA 2ZQ0A 4GFSA 1NDWA 3IJ6A 4HYRA 2BS9A 3HU7A 1SZFA 4GZEA 1WKFA 1TV4A 3GTNA 3ZMRA 3LBOA 4KMQA 2UBPC 1H63A 3UNDA 5EBAA 1XLMA 5EMLA 3U6WA 3HZ3A 2VEIA 1A5MC 2QCDA 4HYVA 3T0TA 4H9XA 1J01A 3GK0A 2CZVA 4KIEA 4IMAA 3OVQA 1W37A 4MWAC 1SFTA 2FQIA 4NYUA 4RLIA 3EWCA 2Z1BA 1CZ1A 1HJXA 3EX6A 1TMLA 2R9RA 4JX4A 1HTIA 3OB8A 3LSCA 4A8IA 3ABOA 4PB3A 4G5DA 2ZRXA 1UZDA 2O9TA 1U1HA 3EX4A 1H5VA 4ZO9A 2GUYA 2NUYA 5JH1A 4AY8A 4OWGA 4HA0A 4GG9A 7CGTA 4BK9A 3MHGA 1ZP3A 3DGBA 4HN8A 4B5XA 3DHFA 3NEHA 4OUIA 2Z6IA 1IHIA 4RNFA 2JIWA 3LZ3A 2FGBA 1OFRA 3G2GA 1J10A 4HHLA 3FOKA 3SIZA 1NFGA 1E55A 3FGCB 4JTAA 3AMDA 4GNVA 4F0SA 2W5FA 4GRSA 2X16A 1EGMA 4RJEA 3MMWA 4HIBA 3IIXA 4HSHA 3K4AA 1ONWA 3KVJA 2XWEA 2BVYA 4AIEA 4F0MA 2GQ9A 4PTVA 4RE0A 3L2LA 4JXCA 2YZ5A 1R87A 1A3HA 1UR8A 4WK9A 1OYCA 3WJSA 5JH2A 2HV5A 1QWGA 4HHHA 4LV4A 3OQ8A 4LB4A 2ATSA 4OKDA 2J7FA 4WSKA 4O50A 2VJXA 3QXBA 2AMGA 1ZRQA 4INFA 1EC7A 4M6QA 2VZTA 3GC4A 1FY6A 2J66A 1HZYA 2WBGA 2Y5EA 4G1KA 3E2VA 3BGJA 4EANA 3PTQA 4FX6M 2O4MA 4LQ1A 2Z7KA 1TIWA 1G5AA 1S2UA 1K03A 3IJ8A 2CXEA 3AU6A 3IRSA 2Y62A 3DAQA 3R11A 1C9DA 4H6RA 3BLEA 5DMMA 4QEHA 4P2VA 4UB9A 2FJKA 3TKFA 3V4BA 3BMXA 1J0HA 5HJXA 1EQCA 2ONEA 4H6QA 3MP4A 1VCFA 3TJIA 1SVDA 5HNNA 1Q7ZA 4C6IA 3VD9A 3CAQA 2OELA 4LY4A 4L9YA 3VTRA 3Q45A 3I4EA 4MPKA 3WF4A 2CLEA 1JI2A 1KFJA 3IVUA 4J4KA 2RGMA 2YDAA 3DXIA 4RXGA 2F6UA 4Q32A 2QHAA 4QQUA 3ZLHA 1FWGC 5D9OA 3DN5A 3TCSA 4MG4A 4B5SA 3LI0A 4I7UA 3CHEA 4FR6A 3T0DA 1FH7A 4QXIA 3UZYA 4CD7A 1HUVA 4IMCA 3BAKA 1QNRA 2ZE0A 1UYQA 3LGEA 5FIPA 4ACZA 3DI0A 2Y7FA 4KCWA 4WSHA 3AHZA 3LHVA 5FEPA 2WMGA 1H41A 3P74A 1XH0A 3GHUA 3KWXA 3C0SA 5DT5A 1ZQ5A 1QPRA 1BTMA 4A3RA 2WNQA 2DZSA 1I9CB 3CAKA 5I3IA 3C3UA 4XZLX 1UD3A 3S9YA 3N34A 3PPCA 4HHPA 5M1TA 3S2JA 1UZ4A 4JKKA 3B8UA 3DX5A 3DG6A 4QJ5B 1GT8A 1W9DM 3A47A 1RD5A 4RUBA 1HJVA 4D72A 2RUSA 2D2HA 3USZA 3W7JA 2GVYA 1YRRA 3GIYA 2QUMA 1K8XA 4Q8MA 4ZTXA 2E6DA 2CBIA 2W0UA 1JYNA 2G3MA 4HZ7A 4Q6JA 2V2CA 1LM1A 3NQFA 2B0MA 4FNQA 4DBDA 2J7HA 2ISWA 1PYFA 3VNDA 4GUHA 3NQ6A 4PMVA 2VC9A 1CIUA 3PTDA 2Y8KA 1C7TA 4FNSA 1B4KA 3IWPA 1VLWA 4MAZA 4HQVA 1TIMA 4Q4QA 3LEPA 3AIBA 3A12A 3P81A 5G5IA 2H9AA 2VD8A 2VMFA 4L6OA 1ZBVA 4Y90A 4EKJA 3CPGA 3CQKA 2R1NA 3G0XA 1H60A 1FCQA 4XO6A 3NO5A 2F6XA 5HJLA 1J6OA 4V15A 5JVLA 3LERA 5M3WA 4DJFD 4UMBA 5AYXA 4AH7A 1X1NA 4LUTB 3IRDA 3V0SA 3CAVA 2HCVA 5HPCA 3FA5A 1B3OA 3KTXA 1EF2A 3M0MA 1LUCB 1XYLA 3O63A 1OF8A 1UOKA 2I14A 2INZA 4IPJA 3BW3A 3NWRA 2VQUA 3STEA 2RGLA 2ZCGA 1PJ9A 2HNEA 4ZO8A 3DDMA 1KQZA 1DXFA 2O92A 1KRMA 4YMZA 4MJ4A 2CZEA 3QV6A 1AH3A 1H7RA 1UWUA 1WQ5A 3QOMA 4H3DA 3GG8A 2Z25A 2FYMA 4B9ZA 3EMZA 3EEZA 2P8BA 4L5ZA 3DEQA 4PMUA 5KZEA 3W1AA 4QE4A 1OCBA 5I0DA 2C91A 1XLAA 3KVMA 4MLJA 4Z1AA 3PR2A 4NHVA 4W7WA 2VEPA 4MKNA 4ZQPA 4B91A 1Q65A 3T0AA 1RR2A 3E3HA 2ASHA 4XZMX 3BOXA 1MZHA 3CU2A 5K7JA 2WV8A 1BXBA 3VKBA 2PGFA 2X1SA 5BMWA 1SM9A 2RAGA 4Z2IA 3RLUA 4FZIA 3CO8A 3AU2A 5FSDC 4MLRA 3LRMA 3R0KA 3HURA 5U4NA 4OJYA 4O17A 4WJXA 2D1ZA 3UR5A 1C90A 1EUNA 4Y6GA 3GWQA 4YU1A 3KS5A 4HJFA 1WAWA 3TTEA 2X0YA 3GQYA 2DSWA 2CEQA 5A8QA 3MS8A 1G1YA 2BHUA 3WBXA 3N4AA 3B06A 2HJPA 3UW6A 1Y8BA 1J18A 4DXXA 2BOGX 2F61A 2IXVA 5XINA 2VVNA 1RK6A 1E71M 4BF9A 4NRSA 3KRUA 4CNSA 4IM4A 3PPHA 3N13A 1ML1A 1FWTA 2D0FA 4L4PA 1R3WA 1KCZA 4G8TA 1SU5A 4G1NA 4L1XA 2G97A 3QC3A 1DWAM 4Q8WA 2DT1A 3STCA 3GG0A 4HMNA 1XKJA 4Q3MA 4M6PA 4GXPA 1UR2A 1FHUA 1VS1A 3ABQA 3FXGA 4RV3A 4CD5A 4IP4A 3AQUA 5GNXA 1D3HA 4DN1A 5EMJA 1JZ3A 2XJ7A 3M0JA 3WF2A 4ZSUA 5I3KA 1DQWA 3GNRA 2IUZA 3F4VA 2QDEA 4FA3A 4X63A 4DJDD 3QYQA 3S83A 4U31A 4AWTA 2OO6A 3QH2A 3HOJA 3A9IA 4LBSA 3RIKA 4DNHA 1XG3A 3PZIA 3CUJA 1FDYA 2PDCA 1HJUA 3MUIA 1E43A 3C0LA 2OG9A 3T2QA 4GOAA 1IZCA 4C6JA 3GO2A 4GC3A 1XRFA 2QIIA 3WO8A 3DC0A 2QJIA 1RP8A 2AMXA 1IF2A 4I7VA 1ISYA 4XBSA 4KKXA 4F40A 1MUWA 3L5LA 2XINA 4H9VA 4KERA 3HQPA 3FAWA 1DXIA 2GQAA 5I06A 1PZ0A 3W7NA 2W61A 1EX1A 2PWDA 1FWHC 2E8YA 4YS1A 1KO0A 3MZ2A 3EOSA 3TWAA 4O0ZA 1L2QA 1M41A 2WAGA 4FEZA 4GY1A 4I5UA 1XIIA 4RE3A 1RVKA 2OT0A 1V6TA 1R30A 4XD3A 3E6EA 3DH7A 1SJDA 3THCA 4IFKA 3M46A 3RRAA 3NXLA 3ZM8A 3MV11 3TOPA 4ZEPA 1LRNA 4UR7A 4GUIA 4EP8C 5IOBA 1ZAHA 4S3CA 5LXEA 4UQBA 1QHOA 3BGAA 4CVWA 3LV5A 2GGJA 3CZGA 1VCVA 4QG6A 1L8NA 4BQ2A 5LIYX 3CZJA 3WLMA 1QPKA 4OOUA 5GJMA 4EK7A 5BWFA 3RRXA 2ISFA 3GC5A 1K8CA 1RQHA 1A5LC 5DQPA 1JYXA 2PCEA 1E15A 1HP4A 3CUHA 3C2OA 3S2LA 1VEOA 3VIIA 3N6QA 3OIXA 1KCLA 3QHOA 3LM3A 1JNDA 1W2PA 1E4LA 1UPMB 4R88A 2IKIA 3HBLA 3SSZA 3QZ6A 2E1WA 3NPUA 2REQB 1T99A 4EAMA 1XSIA 3ES7A 4E3VA 1CGYA 1XUUA 1VYSX 2CLFA 3APGA 7TAAA 2QAPA 3MCMA 2R24A 1V51A 2YLLA 1V6UA 4UCGA 3W74A 2Z1SA 5C6MA 5C7HA 5D2XA 3UWEA 2RDUA 4YVVA 3WQ5A 2ZZ5A 1UHVA 2VUYA 3W53A 1J12A 3VDBA 5BOFA 4OT7A 3VDAA 1TQXA 5A69A 4PTWA 1LLOA 1C8QA 3C5QA 2CIPA 3PWAA 3TTOA 5I09A 4O1AA 3LCFA 1XBZA 3TLLA 4NKCA 4LX4A 3UQNA 4BY3A 1HKMA 3T6CA 3LUTA 1EJTC 1KV8A 3VIMA 4OIFA 3BG3A 4M1RA 3VGBA 1E1CA 1QK2A 3L4VA 4AC7C 2O55A 1QUMA 1O1ZA 4Q22A 3AJ7A 1TUXA 2ZZ3A 1UD8A 5A2BA 1ODUA 3HGRA 1KM4A 4S3BA 1W5NA 3THAA 2BHZA 1BYDA 4ACYA 4E4UA 5C9RA 3PP7A 2ZIDA 1RA5A 1TPVA 3OZOA 2VO5A 4J9JA 4NP7A 1DJXA 1XIBA 4RDZA 3UG5A 3W84A 4XZBA 5J04A 3ONCA 5TBOA 4NZ5A 3EYPA 2J9YA 3FA3A 3WLOA 2QCFA 3UVIA 1C93A 3CPUA 1R9ZA 3P5ZA 4NZ3A 2PPGA 1AUSL 1RCXB 2ABBA 2CZFA 2WCAA 2GJRA 4GVHA 5FD0A 3LDVA 3W2NA 4WHBA 2IS7A 2OODA 4AZ7A 3ITTA 4NZ1A 4TV5A 4DWSB 3SUWA 1MW0A 5A8OA 4GIYA 5G1MA 3FJ6A 4ZL1A 3OBAA 4XSMA 1S2VA 4F0KA 2HZGA 2VOTA 1TVNA 1WNOA 1YE4A 4OOZA 4Q8PA 3TYEA 4R7WA 1QW9A 3GAKA 2WJEA 4C91A 1AZ2A 3ZWTA 2Q02A 1TPWA 3TVAA 4UQ9A 4MY1A 1Z69A 3PJWA 2Z24A 2ALDA 1NELA 1OX5A 4GQ0A 1KXTA 4ATDA 1FCUA 2OQYA 3UT0A 3PWGA 1S5VA 1Z8AA 3FJLA 3P14A 4F48A 5DMYA 2G3FA 5ECUA 1H1YA 4JEQA 2GLKA 4BF5A 5I6SA 2YZRA 2AL2A 3EWBX 4M81A 5DRCA 5BNKA 1RCOB 2A79A 3N2CA 4QBXA 3L0NA 3PULA 4JR5A 1FP8A 1WZLA 3DFSA 4AAJA 2VGBA 4X9SA 3TQKA 4G2DA 4OBSA 1H61A 1PIGA 2J74A 1FX6A 4UTTC 5CZJA 4ENLA 3AFBA 2GVLA 3B9DA 4I9MA 2WMJA 3VA8A 1TCMA 2F6KA 1V6YA 1P0NA 5GQBA 3STFA 2WVVB 3A64A 3W27A 4AZIA 1GGOA 4IIDA 4V2XA 4L56A 4JYDA 4QG8A 2EJAA 4UOJA 2BVWA 1BLIA 4EPDC 5RUBA 4G7FA 3WJWA 4GUJA 4HMCA 2BNJA 2A6NA 1EOMA 2FZ8A 2ICSA 2I5IA 2BMBA 1OFDA 1GEQA 5H8UA 3EDFA 3WF3A 2BY1A 3VGDA 3AMGA 3NA8A 3NQDA 3HQOA 4AG0A 2FB2A 2QT3A 4O57A 1H0GA 3H7RA 1NU5A 1F3WA 1UZHA 3M5XA 3WKZA 3WEZA 1M1BA 3UWVA 6PTDA 1JD7A 1UWRA 1F6KA 2GJXB 4PMOA 3T44A 4C7DA 5LXXA 3L7RA 2NQ5A 4CD4A 3RPMA 2ISVA 2NWRA 1K6WA 4ZENA 4HNUA 2A85A 2DZBA 4Z2JA 1OX4B 3AS0A 5FJPA 4EE9A 5KZ6A 4W8AA 3UD6A 3VOHA 4QCFA 4NAEB 1BPLB 3G22A 3A4WA 2V82A 4AD5A 3MCNA 1BWVA 4GZIA 2A2IA 1IXOA 3MKKA 2I9EA 5I2UA 2FJUB 4OZOA 4O4WA 4NNCA 4K8EA 4N42A 1JCMP 2DQWA 1VIZA 2HNHA 3WFZA 5CJMA 2VZUA 4I8DA 2XGZA 4Z0JA 1EA9C 3WUFA 3KCLA 4QHRA 3VE9A 2PA6A 2PD9A 4NIRA 5KETA 2H8XA 3TFXA 5FJOA 5I3GA 4BCEA 2XFRA 4GMEA 1YNYA 2RDXA 4CCEA 3H8AA 4WXZA 3KBVA 3OHIA 5EGRA 1UUMA 3M0HA 2JE8A 1TR9A 3LNMA 1D3CA 1HVQA 3KBMA 3TTYA 4B15A 2AGKA 1OFAA 1X6LA 2AQOA 1TJ2A 4DAFA 3I3BA 2PZNA 1P1MA 1XLGA 1Q7MA 4JTGA 4F79A 1V3MA 1W5PA 2WHKA 4TX6A 3TYZA 5ABFA 2Y7GA 3TV8A 3NVTA 3FS2A 1EJWC 1W91A 3NQCA 5M17A 2OKOA 4UQDA 4GI6A 1NWUA 4HCHA 4TTGA 1UD2A 3FYPA 3DECA 1P0KA 4I6KA 2RJGA 9XIMA 2NLYA 1KM6A 3H6OA 1G94A 1M3UA 1O7AA 1R2SA 6XIMA 4C90A 4JD4A 1OZQA 1TYGA 1NQ6A 4MPQA 3HTWA 4G7EA 3WELA 3GTHA 1UMLA 3CH9A 4LVBA 3RF9A 3O6AA 2ZRUA 5DO8A 3R0DA 3DOPA 4OBRA 3DUGA 3Q37A 3P3BA 3ABSA 3EXRA 2Y1HA 1EIXA 1TWIA 2P3ZA 4PR4A 5AHFA 3OODA 3NFUA 2PBGA 4IPNB 4LYPA 2BVDA 2GWGA 4O1BA 1XD1A 1K9FA 2WYSA 3E12A 4BI7A 2BXVA 4M8UA 4MVAA 4RXFA 4W7VA 1O1HA 1QK0A 3OP2A 4Y9PA 3OBEA 3ZJ7A 3CMJA 4L6DA 5G2HA 4PTXA 2EO7A 3EX1A 3MWAA 4PODA 4D6DA 4W87A 5F4WA 2ZUTA 3UERA 3WG6A 4HHMA 1DJZA 1YHTA 3ZJ6A 4RK8A 4YLWA 5FAJA 2VEGA 4KFOA 5AHIA 4TVCA 1KXQA 3B4UA 1P1XA 4Q4OA 2QULA 4AVOA 1DTNA 2DFAA 5CSRA 1F4AA 3UPBA 1NQKA 2GUUA 1V5XA 3KOXA 3ZT6A 3FHAA 5C8BB 3V7PA 4IPLA 3GKAA 4AYGA 4R7OA 1O4UA 1HFBA 3COTA 4F4RA 4WGXA 1OADA 1XL9A 3GR4A 1EX5A 1H7XA 4UOZA 3MBDA 2V69A 4IFOA 3A21A 3W1TA 3WN6A 4KEVA 4EIVA 4CNOA 4Q6XA 1TB3A 1Q3NA 4QDWA 4M0XA 3E2SA 4IISA 3UR8A 2I16A 1FFQA 1V3HA 2VHLA 4UTLA 4OV4A 2V6AA 1JZ7A 2NSOA 3V35A 5FI8A 1FHLA 1K7FA 3CQHA 4CN6A 4MZYA 1E73M 5EL1A 1TMQA 1E6ZA 1FP9A 1XYBA 2QCNA 3N18A 4XB3A 1DVJA 5DY2A 1OIMA 3QN3A 2BOFX 4JICA 3WD4A 1H11A 5D9PA 3T78A 3CHVA 1G4SA 3LQLA 4R7JA 2PRMA 1OVDA 2A3EA 1V6VA 2PLKA 5CQ1A 3D47A 2QV4A 2J7EA 4AEFA 1J5TA 3CV6A 1HL8A 3SUSA 4J3TA 5H91A 3VFLA 5JXQA 5EMUA 4NXKA 3S1XA 3ZT5A 1QNVA 2YB1A 4O12A 3W71A 4NUWA 5C55A 3UA4A 4J2PA 3DFHA 4CVUA 2CKRA 1H0IA 4UR9A 2X7WA 4N6FA 2J7GA 2NV1A 2WSKA 3WNNA 8TIMA 4WOQA 4WKHA 5C9XA 3EPMA 3SAZA 2PRHA 2CLOA 4UQEA 2BGSA 5A6BA 7REQB 5AKQA 4H9UA 2GSEA 2Y5SA 2F2KA 1K6AA 3QKZA 4HYWA 2HBVA 2XFYA 1M65A 2PDMA 2Y4SA 1EA0A 1OZMA 1PWMA 4GC4A 4DIAA 4XAFA 2YXGA 1KM5A 1JCLA 2WSYA 4HTYA 4RE2A 1JJKA 4I5XA 3VC5A 3L23A 3PVFA 1PS9A 4LAUA 4DQWA 2WANA 3ITOA 1H50A 2PF0A 4W9TA 3RK8A 2YCJA 2HK1A 3CM4A 3NZRA 5CLWA 1KWKA 4KETA 3GH4A 4AHPA 1TTJA 4GXWA 1PV8A 3M5YA 1UPPA 2W6RA 3OVPA 3ARSA 2Z7GA 5AC8A 4M5PA 1KKRA 3BAXA 2AAMA 1AJ2A 3UVAA 4J3ZA 3W7GA 5DCEA 1G67A 1YBQB 1HL9A 5TAOA 4ZOEA 4WJ8A 1JGIA 1QMLA 1EEPA 2QF8A 4GYPC 2OLAA 3URAA 3WK2A 3SGUA 4GISA 1R2RA 3WMSA 4ZQCA 3AISA 2FB3A 2CXGA 1V8EA 5CLTA 1QHZA 3W00A 1GVYA 4W5UA 1GKPA 1FBAA 2GGEA 1T40A 1PX3A 2JQXA 1ZPTA 2P10A 4PL1A 6XIAA 1UWAA 3PZOA 1ITQA 3T7VA 2ZX6A 4GI8A 5FKYA 1I8JA 4FSAA 5K2ZA 1FDJA 1AH4A 5LNSA 3NL5A 1B31A 4F9JA 3SM0A 3VM7A 1WOAA 4BWLA 5AC4A 4JN8A 3EMCA 1KM2A 1I1XA 2WZMA 4PCTA 2PDYA 1A3WA 2WJZA 3LXCA 1UC4A 1U33A 2C1IA 2PBOA 4GH1A 4U33A 3O07A 3LOTA 3EA2A 2MUCA 3FLUA 1PTAA 1RBOB 5EKYA 1JG9A 3TYUA 1WBJA 4NI8A 5CH9A 1V6XA 3B8TA 3DKLA 3BJSA 2HQAA 3R6IA 1UBSA 1O5KA 1H49A 4I5RA 1O6IA 1VF8A 3B8SA 4HNOA 2MNRA 5FJTA 1IWBA 4GXMA 4NAFB 3VD4A 2CITA 3NZPA 4ERGA 1HJWA 4R9OA 3M43A 3R8RA 4IIBA 1Y65A 3U57A 4DI8A 5HA7A 4AMCA 1ZSXA 5HDRA 1FUYA 2J7BA 1ISWA 1T8XA 4LJ3A 4QLLA 4MWAB 1RZMA 3LBCA 3HG2A 3VINA 4C6FA 2VURA 2WWCA 3AZRA 3GC2A 3P82A 4AF0B 3WD0A 4C6CA 4AFYA 3BLIA 3RAOA 4I8YA 3PUOA 1JAEA 4AW7A 4A8LA 3TAOA 4GIAA 4DJFA 3ZVHA 4C6OA 4C5YA 2PDBA 3WEMA 1QOPA 2JFEX 3RU6A 1OGGA 5FL0A 4XD5A 1K9EA 4FIQA 3T0BA 1DWFM 2G96A 3KE0A 3W7MA 3LM7A 4Q8QA 2SFPA 4UMCA 4GQQA 3VNZA 4XBJA 3HFTA 3Q67A 2CWXA 3B8VA 1JCNA 5D32A 2J25A 1CXFA 3KAOA 1VBRA 3R10A 2YDQA 4O1EA 1R3SA 4WDUA 1OG0A 4UCFA 3AMCA 4FS9A 5E0KA 1PWLA 1VJSA 2BXZA 3SCUA 3BJFA 2PF8A 3VKKA 2OFJA 3GVQA 2Y6ZA 4J27A 2E8ZA 3BOLA 1OT2A 5CZKA 3K30A 3MSGA 2D2JA 3WL0A 2VQTA 3TJXA 4HMDA 1K02A 3UZXA 1T96A 1T7LA 3SO7A 4L7ZA 4I6VA 3OA5A 3LHUA 5F2IA 3QGVA 2QQ6A 2O56A 1YNPA 4TUFA 1EWDA 3ZO9A 1KXHA 3R2GA 4OTKA 4HZ8A 2FTYA 4PUJA 3PZQA 3O16A 3ARPA 1JXKA 2HSAA 3V0TA 3LHTA 3TX9A 1GVSA 2Q3RA 3PZGA 5TNVA 1GVOA 3H53A 3A23A 3QBUA 1F2JA 2ZWYA 2EGZA 1W1ZA 2WQPA 2WMFA 3ANYA 5EMYA 1R3QA 3WBAA 4K8HA 3WX7A 1YMYA 4D6CA 3PZTA 1UD6A 3URBA 1SZRA 1E4MM 2WO5A 4ORMA 3WH5A 4N2YA 2VZVA 3WLQA 4EF8A 3GFYA 1LWHA 4NILA 3G3DA 4BQ4A 5A2AA 4B16A 4C1KA 3WLIA 4N9DA 4HD5A 1JAKA 4DJDA 1XLJA 5C0QA 3UG3A 1OK6A 2J79A 3IACA 4LCQA 3NOEA 1O94A 3RLVA 4UC5A 4DBWA 3B3DA 4QQ3A 3RITA 1NWRA 1XUZA 4CQBA