2TRSA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
262
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE
total genus 93
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2trsA00
2ZBTA 5BMWA 3BLFA 2ISVA 3M7WA 2Y62A 3LI1A 3W1UA 4JDBA 4O14A 3G1YA 4NU7A 5TQLA 4MZ8A 3NQEA 4WUIA 3ABOA 2Y63A 1KFLA 1WYIA 4XKYB 4AF0A 1EP3A 3RK8A 1N55A 3HBLA 3DKLA 3UZJA 4O17A 4HHPA 2DZTA 3L2IA 3N19B 1KFBA 1LTDA 3P5YA 1VZWA 2VXNA 2CW6A 4QISA 4LC6A 3C2RA 1QPNA 5LKYA 4NJGA 2ALDA 2C19A 2YFNA 4OHQA 4AEOA 4JTIA 2OX1A 1DQXA 3TQ0A 2WQPA 1JRBA 3HOJA 2V8ZA 1SO6A 2V5LA 1H50A 1SW0A 4XBSA 2J9ZA 1LBMA 3N3MA 3W1NA 4PA8A 3INPA 3M43A 3QEZA 1W8SA 5K4ZA 1K03A 2EF9A 3GKFA 2TRSA 1PS9A 3LRLA 4JX5A 5SWUA 3OA3A 3W87A 3TW6A 4BWLA 4UNLA 4UTMA 1G6CA 5D2XA 1TPH1 4UR7A 3NQ7A 1M6JA 2BXVA 3F4WA 4UTWA 4FEZA 4TMCA 4K7VA 2XN0A 3N2MA 4C1KA 3BW3A 1NAL1 2QAFA 2ZFAA 3KFTA 3FA5A 5T26A 4X3ZA 4X9SA 4WY0B 1W5PA 4DEFA 1NEYA 3TMLA 3KHJA 3OVRA 4E0CA 4CCDA 4RLIA 3QPZA 1OK6A 1FDZA 1PIIA 1T99A 4FXSA 4HNUA 4FXRA 4QSHA 3G18A 1YYAA 1EX5A 1OYBA 3W7GA 1W37A 5BRBA 3IEBA 4LRSA 5F2MA 3VNDA 4N9EA 1X6UA 2DORA 3QMTA 3IIVA 1MEHA 5CGQA 3HJZA 3KVJA 3LCWA 3I7RA 2Y61A 2GPTA 1F2JA 4NX5A 4DXVA 3C61A 1VYPX 2H8XA 3SSJA 2X30A 4IX0A 1HTIA 5KMYA 2FB2A 5D30A 2VEMA 4N6FA 2CU0A 1VPXA 4LV9A 3TJLA 3NL5A 3W84A 4R33A 3PY2A 4RXGA 3QC3A 3G3DA 4Y8FA 4O50A 1JCLA 3PC0A 2TMDA 4NJJA 2BTMA 3LDVA 3G0XA 1Z48A 3F03K 4NXSA 5F1VA 4O0ZA 4MZYA 3EX3A 5D2YA 2Z6IA 1W3TA 2C6QA 4O53A 3SR7A 1TRIA 5AC7A 4ZQMA 2CZDA 5LGXA 4LRTA 4K38A 1ZCOA 4JD4A 1SR9A 1V5XA 4PFMA 5CPMA 2DZUA 2QJGA 3BW4A 3EXTA 3NZRA 1G4EA 5D38A 3L0NA 5AYXA 5D33A 1TPDA 1WV2A 2RDTA 3GX9A 5C55A 4UTLA 3WJWA 3FKKA 1GPWA 5EPDA 1A50A 5LHEA 2H3BA 3P60A 1YDOA 5FF0A 2CFFA 4O4WA 3C2VA 2R94A 3P84A 4QNWA 2FB3A 3LV5A 5E93A 3B4UA 3L0GA 3BV4A 4A2RA 2VEIA 4W9TA 3P7YA 4MY8A 4S2CA 5D05A 2A7PA 3W7QA 5FEWA 1XDMA 1VH7A 4XTDA 4JY9A 3LGEA 5CZ0A 4NXKA 1T96A 4JTLA 2JGYA 2ZDRA 3O06A 4Z1BA 1O4UA 3GB6A 1VCFA 4M7SA 3DH7A 2FPVA 3HGRA 4JTGA 3W2NA 5LHFA 4UTTA 1W5OA 3LHTA 2QCNA 3TUUA 2QDHA 1CI1A 2PRMA 4QITA 4FX7A 4AHQA 5EY5A 1YXCA 4UMCA 3C2FA 2TPSA 3PUOA 3QSRA 4ADSA 3UD6A 3GDMA 2PRHA 3UPWA 4LNYA 4E38A 1YTKA 4BI6A 5I3FA 3LCFA 4GUFA 2QUTA 2ABAA 2CZFA 5CPLA 5LNRA 1QOPA 5AHIA 4ALDA 3SECA 3UWUA 2O7SA 5KTLA 5IBXA 4JEQA 4UUIA 3W85A 4QJ1A 3G1XA 4UMAA 1XKYA 1SZFA 3W7NA 5J5RA 1I2QA 3TX9A 3CTLA 1RPXA 4ZQRA 5DY2A 4M7TA 3GDTA 4AWSA 3B0UX 3W72A 2WPBA 3W71A 2A6NA 1KA9F 3NQ8A 1KBJA 4UTTC 1HL2A 4LUJA 3NPWA 3S42A 4QIUA 3QMSA 4E2BA 2WNNA 1OABA 1NVMA 3PUEA 1WBHA 2Y70A 3QF0A 2VENA 4FX6M 4ZQOA 3CWOX 5G4EA 3T78A 1OF8A 4UTJA 1LLWA 2NUXA 3HGSA 1OG0A 4JX6A 5EKYA 4MKNA 3C4UA 4PH6A 4YMZA 3PG8A 1FCBA 2A0NA 4NNBA 2PURA 3THAA 3UWYA 5D2VA 3WJXA 2YPIA 2R14A 4N6EA 4JYFA 4O1CA 5E0KA 3P61A 3K30A 4DPQA 1Q6QA 4M6VA 4QAIA 4J9JA 1LBFA 2E5CA 1KBIA 1AMKA 4O13A 1SFJA 2VFEA 3W76A 3TA6A 1W0MA 3HIJA 2VC6A 2CWNA 3MYOA 3FIGA 3GR7A 1C29A 1TPWA 3G1AA 4GBUA 4OU1A 1TPEA 5AYYA 3A21A 1EWEA 3NQ6A 3RLVA 1C8VA 6TIMA 2QCCA 1H7PA 1D3GA 5KSWA 2DZVA 3M5VA 1EP1A 1J2WA 3NQMA 1HUVA 4FNRA 3MUXA 4LC8A 1VLIA 1YLVA 3R13A 4TX9A 2ZRZA 5CPOA 3S9YA 3O6YX 2ZZ5A 1XUZA 4PL1A 3U6WA 2JBMA 5DCEA 4ZL1A 1TPC1 5DXXA 4O12A 3FFSA 2VFDA 5D37A 4UNKA 3A23A 3VFLA 2B7NA 4HPXA 2Y89A 2AGKA 2WSRA 3NM1A 1SU5A 2B4GA 1FWWA 2QF7A 3LHYA 5AC8A 1H5YA 3I65A 1X1ZA 4GFSA 2RDWA 3L66A 4POCA 2E1DA 4DF0A 3M5XA 1PL9A 4GE8A 5CPNA 3PR2A 4O1BA 4I7UA 1HO4A 3MO7A 1AL7A 3B03A 3NQ2A 1SO5A 4PL2A 2CLMA 3WK1A 4LOCA 3B05A 4I7VA 1F76A 2AQWA 3LTYA 4ORIA 3ATYA 5CZJA 2UV8G 3S5OA 4MJMA 4GUHA 1IIGA 2ZZ2A 1XBVA 3CT7A 5K9XA 4WJEA 1MSSA 2NXGA 1H51A 1H60A 2E6AA 3IRDA 1ZNNA 2FTPA 2WNQA 4UMBA 4AWTA 4E2DA 1LRTA 1OVDA 1I2PA 2WOQA 5DELA 4HN4A 1JULA 4H6KA 4M19A 5AOUA 2E5BA 4P61A 1JCYA 3N34A 2Z1BA 3DU0A 3JS3A 4XWUA 4IGHA 3O05A 3A22A 3W1PA 1TJRA 3L67A 1H7NA 3E96A 1EEPA 3QFEA 3NL3A 4R34A 5DLCA 2Q3RA 3ZWTA 3QZEA 3O07A 1F7BA 1LDCA 3GZ3A 3P5ZA 1OJXA 3OVPA 2Z0IA 3EX4A 1TRDA 3LCIA 1XL9A 1VRDA 1W3IA 5K3VA 2OMAA 3PSWA 3CM4A 1GYLA 1JCXA 5EA9A 2B7QA 4LS1A 1DJQA 3OIXA 1U5JA 1ZAHA 2X2GA 2AAMA 2CLOA 3A9IA 3S1VA 4OV4A 2ATMA 3TQVA 1FCUA 2CLLA 3Q37A 1H61A 1Y0EA 1VC4A 4IUOA 2W79A 3NOEA 4PODA 5BMXA 3NPXA 4LS0A 3OBKA 3G1HA 3C56A 4FHAA 3HF3A 3W83A 3PM6A 4X22A 5F4XA 1Q6OA 5CZTA 4IMFA 4FNPA 4UCGA 1GJPA 4CQ8A 3L5LA 3BG5A 1WX0A 1YPIA 3I7QA 3EB2A 3W1QA 2DU2A 5E1QA 4MUZA 1H62A 3DFQA 4UTKA 2B0MA 4MZ1A 2RH9A 3LXBA 2R91A 1YADA 2YXGA 1UUMA 4UTUA 3CU2A 3TH6A 3DAQA 4DBEA 2VFFA 3C3NA 3BVJA 3LV6A 3I68A 4O8RA 4RCXA 1WOBA 1ZY9A 3MP3A 1KV5A 4TIMA 4NT0A 4BK9A 3PBWA 5L9FA 1VYSX 1KM3A 5G2WA 2WJZA 3G8EA 4AB4A 1B57A 4TMBA 2LLEA 4AH7A 3GVGA 3NQGA 1IXQA 4WY0F 5CSSA 1TJPA 1DVJA 2GJNA 3M1ZA 2HSAA 3DBPA 1EWDA 4YXGA 1F6KA 2RKXA 4FNUA 4NNAA 1UUOA 3EKLA 4O54A 3N9SA 4RJEA 3KRSA 1PVNA 2Y88A 5TIMA 3NQCA 2ZRXA 3W9ZA 4WQ6A 4AHOA 1Z44A 4N9DA 3AJXA 1ML1A 3FS2A 4S1FA 3W7HA 3H55A 4LV4A 3STEA 4CNOA 3DKJA 3L5MA 4I9AA 4N02A 3CPRA 1T8XA 1KM1A 3VCRA 4MLJA 1H7WA 3LHZA 3P62A 4N9CA 3W7EA 1W5NA 4A2SA 3CB8A 4HKPA 5HUOA 2EPHA 3MHGA 5FF7A 4FNQA 2JGQA 3NGJA 5L6UA 5AHEA 3NZ1A 1XBYA 2XN2A 1B4KA 3P67A 4EWND 1BWLA 5DY3A 3E02A 3CC1A 5FEXA 3C2OA 4KKXA 1KTNA 2F7FA 2PRLA 1OYAA 3GXPA 1A5CA 3T55A 1F73A 5A8GA 3UZ5A 2EKCA 4NJKA 1KFCA 3R89A 1KLZA 3UXDA 3W7CA 2RHGA 3BO9A 4IX2A 1NSJA 3TIMA 4S2BA 3STFA 3OEXA 3WFAA 4OGZA 5F1UA 1LCOA 1EPXA 2QCDA 3LXAA 2ZZ4A 1OK4A 5D2TA 2E68A 1O5XA 2ZZ1A 1TTJA 1IF2A 2J24A 5AHNA 4K8HA 3TSMA 3W75A 3NPVA 1YXYA 3W7DA 3A5VA 3A5FA 4ZQCA 2WSYA 3TE9A 3W1XA 3F1QA 3IV3A 1QPOA 3GLCA 3NXFA 3RNDA 1R30A 1I8JA 4L4MA 2A7RA 1QWGA 4TU1A 4GRSA 1DORA 1W1ZA 4IMEA 1K7XA 3TNOA 2BLEA 2V2CA 1QMLA 3FJLA 3IGSA 3PBUA 2HS8A 3WK2A 3N73A 4U4MA 2FPYA 4K7YA 3TR2A 4BWLC 2NX9A 3W2MA 1TPVA 1MEIA 1W56A 4MJZA 2FJKA 3OG3A 1I2RA 4Y90A 1NF0A 1ZJIA 2H6RA 3CHVA 4ZQPA 2V30A 5LSMA 1UJPA 3BLIA 1R47A 1SQ7A 3CQ0A 4JR5A 3SIZA 1KM2A 5CSRA 3NL2A 3PBYA 3EXSA 1K7EA 3WK3A 4RV8A 3QH2A 1A5SA 3GK0A 2GUUA 1IGSA 5GVJA 4ADTA 2DZWA 1DBTA 3HGJA 1L9WA 3KVKA 2YGYA 5LNUA 3P8JA 2E6FA 1LM1A 3TFXA 4BFAA 3S1XA 2Q3OA 3BGGA 4O10A 5DCBA 1QO5A 2J27A 3TMQA 3W23A 3M44A 4K36A 3NA8A 1UASA 3W73A 1PE1A 4BR1A 2WNZA 3DFNA 2OZ0A 3UXAA 2FQIA 4FX8A 1GVFA 2F84A 3IIXA 3LBCA 2FDSA 1YDNA 2GQ8A 2E09A 3LI0A 4UTHA 2VFHA 1KTCA 4LVAA 1AW1A 1S5WA 4LUIA 1THFD 3BW2A 4OT7A 3FKRA 1TV7A 4AF0B 2BSLA 1PCWA 3W7LA 1XBXA 4KFOA 1IXPA 3FYPA 3TCEA 2H3DA 3TXVA 4IXXA 3R5EA 1TPUA 2VFGA 1Q6RA 1Q6LA 1GZGA 1DQWA 1I2OA 3O15A 4JTJA 4UFMA 3ABQA 3LLDA 3W2UA 4NJIA 3H54A 1JUEA 4HNTA 1ME7A 1FXPA 1O60A 1J4EA 1KFJA 2CLFA 3Q94A 2HMCA 2JKPA 5DBTA 3O8AA 1WA3A 2ZZ6A 4NQ1A 1LOQA 2VELA 1OFRA 3NG3A 5HWJA 1SFLA 1LP6A 4HPJA 2ATSA 2P0OA 5D04C 3PWAA 3B0VC 3LCLA 3LCHA 3PB2A 1JCNA 3M0ZA 1OX4B 2OT0A 3DENA 3E12A 4AVFA 1N8FA 4GNJA 4UC5A 1D9EA 1WDWA 6ALDA 1HG3A 1FX6A 4JIQA 2NZLA 4ORMA 1BEUA 3W74A 4RX0A 1VHNA 1VS1A 1HFBA 1EA0A 4JDYA 1LORA 4AAJA 2C13A 3G3MA 1FWNA 4JYDA 2ZRVA 1FBAA 3LOTA 4WXZA 1GVOA 1R46A 3LXCA 1R2RA 4Q33A 3EKZA 2QJIA 4WY0A 5FEPA 3L0KA 1EIXA 5FF2A 5HULA 2NX3A 1DV7A 2O7QA 2YCEA 1TMHA 1G4SA 3NDOA 2V81A 3TFCA 1NF7A 1QOQA 5D03A 3UYCA 1XXXA 4MY1A 3FJ6A 2RFGA 1M5WA 2YR1A 3FYOA 3THQA 3SY5A 3NQDA 5LNSA 4ZMGA 3G1VA 5F4WA 1JUKA 4M6PA 3TSBA 4GXMA 3NAVA 5HR7A 5HR6A 2ZRUA 2BWGA 2DZPA 1JRCA 2X1RA 4GJ1A 3KOFA 4DO4A 2A6LA 2DP3A 4YWIA 4Y9AA 2CLHA 3MP5A 1RV8A 1AK5A 1F05A 5CG7A 1MXSA 4O4VA 4X2RA 4JXCA 3HG4A 3Q2DA 5I3GA 1GG0A 1JQXA 1GTEA 1UCWA 4A21A 4CQ9A 3BPWA 1FWSA 3NQAA 4GUJA 4CNNA 3TXZA 3D0CA 2X1UA 3V1PA 5I3HA 4EF9A 3B8DA 4OQVA 5AB3A 3LERA 5HNRA 2QUVA 4Z1AA 5K7JA 3L65A 2YZRA 4PC8A 1GT8A 2X16A 1RZMA 3CLMA 4RZ5A 1OFPA 2QAPA 4O16A 2NV2A 4DBDA 3KRZA 4IOTA 3W7OA 4UFJA 3E49A 1KM0A 7TIMA 4RZ6A 1XDLA 3L68A 1XM3A 1EUNA 4HSOA 1R2TA 4UFIA 3NQVA 1OFOA 3P8IA 4WOZA 2IQTA 5HJLA 3QMRA 4DF2A 5LNWA 2QCLA 1PHQA 3ABSA 4Z1DA 4K37A 4JICA 1IXOA 5FEZA 1I45A 1R2SA 1GG1A 1P0NA 4Y96A 3LBMA 3DHFA 3DFOA 2D73A 2J9XA 4EOUA 1LZOA 4JTUA 3IIPA 3P74A 3VI2A 4IMGA 1ZHAA 3IVSA 3GNNA 4EIVA 3LCGA 5C2XA 5AYZA 4NZFA 2E5DA 3PB0A 2TYSA 5K9DA 3WJZA 3HB9A 5EBUA 2NWSA 2A2IA 2ZZ7A 3JR2A 3SW6A 1H7OA 3M5ZA 2WSQA 2WV8A 1P5BA 3LRMA 4MYXA 4H3DA 3W7MA 4DF1A 2ZTKA 5I3KA 3MHUA 1GQNA 1B4EA 1G69A 3S1WA 3R12A 2GVJA 3LHVA 3KAOA 4LTSA 3N14A 1TTQA 1SPQA 3EWYA 2ZTJA 4OE7A 4Z1CA 2QCDB 5I3JA 2TSYA 3STCA 4K8EA 2H8ZA 3BLEA 3R8RA 1QO2A 2YFOA 4NX0A 4LVDA 4BI5A 1VJIA 1FUYA 2Y7EA 2V9DA 3LTPA 2X1TA 4NNCA 4YLWA 2KZHA 1HO1A 1ADOA 1JCJA 1K3UA 1VCGA 2ABBA 4HNNA 5BOOA 1QAPA 2W0UA 2FIQA 4D2JA 3W7JA 4JTFA 3W7IA 3OVQA 3DXIA 4UTIA 5EYWA 3T4CA 4L4LA 1QCWA 2GQ9A 2JK2A 1OX6A 1GVRA 3QPYA 2B7PA 4O1DA 3ZWSA 2HTMA 3GKAA 1FDJA 4HSNA 2A7NA 4FF7A 5AHLA 4A22A 3QJAA 2FPTA 4ADUA 3TAOA 1C9DA 3W7KA 3L21A 2E6DA 3NM3A 1DL3A 2ZRYA 1OFDA 4CLMA 4XQ6A 3ZR4A 1Z42A 3HPSA 5EL1A 2CLKA 5U4NA 4WXYA 2C15A 3EEGA 4R53A 1Q3NA 4LVGA 4MPQA 1QFEA 4UFLA 3S6DA 4DELA 5CKSA 1OFBA 1UB3A 2FFCA 2VOMA 1J5TA 2YW3A 3UWQA 2EAWA 3EWBX 5F2LA 1P0KA 1PV8A 3TQKA 1S3HA 1UBSA 3B0PA 3G1DA 3IVUA 4WOQA 5D32A 5K9CA 1K8ZA 3CIXA 5AHFA 4PEKA 1KM5A 1RQBA 1T0OA 2WKJA 1O95A 3MI3A 4JTEA 3DI0A 3W86A 1YXDA 4AMAA 1G7UA 3L9CA 1YTEA 2XN1A 1OX5A 1WAUA 4O57A 3W1LA 3S1UA 4RZ4A 2C1HA 1WXJA 1O5KA 3TDFA 1P1XA 5G2IA 1ME8A 1TO3A 1AG1O 1W31A 2QR6A 4WZHA 4MYAA 2E77A 1K7FA 3SZ8A 5C5YA 1LOLA 5LZLA 1CW2A 4JY8A 3W7PA 3MMTA 3WK0A 5HQEA 3V75A 3MW7A 3YPIA 4UIOA 3RF9A 4ONVA 1YPFA 4LU0A 2Q8ZA 4I7WA 1DJNA 3NQFA 1H7XA 1K8YA 3NR0A 5A5WA 3BG9A 3HPXA 4MFDA 4RK8A 4AXKA 4N4QA 3ABRA 3HO8A 3O63A 2V0TA 3GNDA 4GUGA 3DGRA 3BK0A 3Q58A 2G96A 1XI3A 3PF3A 3E9AA 1YTDA 4IQLA 3G0SA 1ICSA 2VKZG 4CCEA 1OYCA 3NEVA 1LOSA 1VHCA 5HWNA 2J6XA 3QQ1A 3LTSA 5FF3A 4QNEA 2C14A 3SFKA 1A5AA 3GYEA 1JUBA 3EX6A 3QM3A 4WX2A 4P2VA 1S5TA 4LWWA 2C3ZA 4JTTA 2E6YA 2J9YA 4Q4KA 3NPUA 3KRUA 4K39A 5D02A 4DO6A 3T40A 3G8RA 2JKEA 2ZA1A 1WBJA 3H53A 3MJYA 4EVZA 1OX4A 3SI9A 1MEWA 1B3OA 4M6QA 1VGAA 2A85A 2YDAA 1ZALA 3LHUA 4LVBA 4AHPA 4JYEA 2G95A 2DZSA 1N7KA 5CZSA 3O6DA 1X7FA 4N4PA 3U8GA 1TTPA 4K6AA 1DOSA 4MIMA 4NVTA 5C6MA 4JGDA 2I14A 4YCOA 1VCVA 2X1SA 1QPRA 1KW1A 3NL6A 3M9YA 4O18A 4XZ9A 2PC4A 1G4PA 2OCZA 5F2IA 1TB3A 5KZDA 3MP4A 4YL2A 1B9BA 3DHDA 3TROA 1H1YA 2Y85A 4QM1A 1ALDA 3PAJA 5AC6A 5F2GA 2NXIA 3A24A 3MWAA 3W2JA 1LLZA 4FNTA 5J5DA 4PTNA 4BF9A 3VKJA 3LB0A 5HMSA 4LS2A 4IJBA 5ABTA 1MZHA 1KFEA 2V82A 5EMUA 1YDVA 2V2HA 1H7RA 1TQXA 3DZ1A 4O1AA 4TR9A 2VFIA 2G5WA 2NXHA 3UWVA 1GVQA 4XKYA 1P4CA 3W1TA 1L2UA 1SUXA 1F6PA 1O94A 3NO5A 4DQWA 5C54A 3M16A 5LGZA 1NFBA 4MLRA 2CLIA 1FCVA 3M47A 4UFHA 1EUAA 3NVTA 3TAKA 1VQTA 2QCFA 2QJHA 4B5NA 1PCKA 4ZZ9A 2QCHA 3HG2A 3EWWA 5DBUA 3UNDA 2V2DA 1D3HA 4CQAA 2EGZA 2A5HA 1KTBA 3VE9A 4G1KA 3W88A 5DCDA 1I2NA 3ZFHA 3PUDA 1LBLA 2FLIA 3STGA 3S0CA 1XBZA 3W2LA 3NNTA 3KXQA 3S5ZA 3M5YA 3BG3A 1Q45A 2ZQ0A 4CNPA 1LROA 4RR4A 1W3NA 5BW6A 4XUGA 3JRKA 3AO0A 1SZGA 2YYTA 1SSDA 1AL8A 4ICNA 4HT3A 4OWGA 3HPZA 1BTMA 1G67A 3P81A 4OV9A 5BNKA 3I7SA 3LHWA 3KX6A 2XFWA 3IVTA 1IIHA 4KFNA 4IPIA 3PSVA 3I6RA 3KVLA 3R2GA 3C2EA 4NUWA 3G0UA 4O52A 1JR1A 3C8FA 1DHPA 1WQ5A 2Z2UA 2QCEA 1L6SA 4O0KA 2QKFA 5KINA 1L6WA 2PCQA 2RDUA 1GOXA 1L6YA 3EWZA 3TKFA 2CZ5A 4FNSA 3UWWA 4FB7A 3W2KA 1EP2A 1ZENA 1AW2A 1W5MA 1X8FA 3C6CA 1CX9A 3GIYA 5U7SA 3PG9A 2QEZA 4MFEA 5FESA 3QYQA 1SO3A 5G5IA 3GAKA 5LNVA 2G97A 1TQJA 3PS7A 3W22A 1FWRA 2HS6A 3DFTA 1TCDA 4XTIA 1SO4A 2C16A 5H2ZA 3PVFA 3FOKA 1FY6A 3MI6A 4AWUA 1FWTA 5D2WA 1VYRA 1GVSA 3LLFA 3L5AA 3EX1A 4GWEA 4UFKA 2Y7DA 4O15A 5TBOA 1G7VA 1RQEA 3DFPA 4JTHA 1EB3A 1FCQA 5MHBA 1ICPA 3GXTA 1H63A 1TV8A 1ZFJA 5KITA 4A29A 3MBFA 4RKAA 2JKAA 1BKSA 3MHFA 3UY8A 2Y7FA 3IGUA 3CEPA 3W1AA 2VEPA 2Q8LA 3ZS4A 2CLEA 4Z0SA 1QPQA 4UTWC 3M6YA 4KWVA 4N9BA 1FQ0A 1SZNA 4ML9A 3USBA 4WD0A 1LYXA 1KV8A 2NV1A 1I4NA 5DXYA 1DKWA 2WO5A 3FLUA 1KM4A 3G1FA 5AFDA 5I3IA 1V7YA 3MI2A 1S5VA 2Z6JA 3N9RA 4IWWA 1OHLA 2PE4A 3UWZA 4M5PA 4EF8A 4Q32A 2NWRA 3DFSA 1SW7A 3W70A 3TK7A 4FIQA 4GUIA 1QNVA 1JCMP 3E0IA 1GWJA 3DI1A 1TTIA 3EWXA 3W07A 1K8XA 4JTKA 3EWUA 2A4AA 3GXNA 1QR7A 5IM51 1OFQA 4U28A 1XC4A 3GR8A 4N2YA 1W5QA 5D09A 4A3UA 3LCXA 5FI8A 2Y6ZA 2ZA2A 3FEMA 3G1SA 3ELFA 3GDKA 1OF6A 3HG3A 3QW3A 2EHHA 3TC6A 4XBKA 4O11A 5AN7A 3SGZA 4JTSA 1QDSA 2ZRWA 4LY8A 3GAYA 2BX7A 4NZJA 2DZXA 2ISWA 4UXDA 1TV5A 1TIMA 1U83A 2DJXA 2ISSA 3SGUA 1TSIA 3SJ3A 1SZEA 3WJSA 2ZA3A 4JNMA 2YX0A 1W54A 4R7JA 2VEKA 3HGOA 3ATZA 3QW4B 4DPPA 3HG5A 2GVGA 5HUPA 2DJLA 1SW3A 4FIRA 5KZEA 2NUWA 2J88A 1IXNA 3NYZA 4Y6GA 5G2HA 3HMJG 2H90A 4ZVJA 2QCMA 4HNVA 3MBDA 1RQHA 1FXQA 2C0AA 3MYPA 5FF4A 5HINA 1RR2A 3PULA 4FO4A 1ZAIA 4JIPA 2V5BA 4TO8A 4IMDA 4CCCA 4GC4A 3IGXA 1ZAJA 1ONRA 8TIMA 3IIOA 3F4NA 3RMJA 3O16A 3P80A 4NJHA 2ZYFA 1ICQA 4JS3A 1GEQA 2I9EA 3O1NA 1WOAA 4Z0JA 3B04A 2I1OA 3WJYA 3S8HA 1JQVA 1GTHA 3B06A 4ZQNA 5G1TA 4H4IA 2YYUA 3VE7A 2QUUA 3BGJA 3W3OA 3CWNA 4LT9A 1K02A 1SSGA 4KWWA 1TREA 3W1MA 1XCFA 3TJXA 3G22A 3W7RA 1JJKA 4YCPA 2OJPA 2ZCGA 1TPFA 4LVFA 1MO0A 1OFEA 1AW5A 1A5BA 5G4WA 1Z41A 2BZNA 3N2XA 1A53A 1XUUA 1GYNA 3T44A 2A21A 2GOUA 1F5ZA 3GDLA 5K2ZA 1VLWA 3UQNA 1BWKA 3QRHA 1ME9A 3TW7A 5HWMA 5DN1A 4HIBA 5H91A 3QSTA 5K4XA 4IPJA 2GQAA 1M7PA 1LRNA 3S5NA 2GJLA 3W1RA 2Y7GA 3QQ0A 3CIWA 1KFKA 3UY7A 4MVAA 3C0JA 3UPBA 5G1YA 4MY9A 2YW4A 2YSWA 3OHIA 4JX4A 2C18A 3KVMA 3ANYA 2NLIA 3RU6A 3TV8A 2NUYA 4LW7A 1FDYA 4PCFA 4IMCA 3IIZA 4RXFA 2B7OA 2QDGA 3P82A 5AHMA 2CZEA 4MOZA 1M7OA 4O28A 1RD5A 4DO5A 1H1ZA 3PBVA 2P1FA 2W6RA 5F4SA 1XFBA 1VR6A 3T7VA 1E51A 4O19A 1X1OA 3RFAA 3BARA 3O6CA 1JVNA 1TPB1 3EXRA 1KM6A 1LRQA 1TYGA 4C1LA 1KLYA 4QQ3A 1RVGA 3W6YA 2R8WA 2A1YA 3LM7A 1OFAA 4KFPA 3TSDA 4UR8A 1G4TA 3G24A 4Z08A 5KZMA 2OT1A 2GVLA 4BI7A 3EX2A 3LRKA 3S5YA 3TC7A 2ZZ3A 1F74A 4IXHA 3TU9A 2QCGA 1PHWA 5IBXC 2NX1A 3U2OA 3GDRA 4JN6A 4OBTA 3RLUA 3CEUA 3HQ1A 3M41A 2P10A 3LX9A 3C52A
chains in the Genus database with same CATH superfamily
1QI0A 3RJYA 2IUZA 5JQ9A 3BLFA 3M7WA 2IPGA 3WNMA 2UWFA 2WMIB 1UKSA 4MZ8A 2VZTA 2WBGA 3MKCA 4GVHA 1OGSA 4IZGA 1E0VA 1KR0A 3F5KA 4XAFA 3SCOA 4K2SA 4XKYB 1V8EA 3RK8A 1PJ9A 3DKLA 3UZJA 2PWDA 3ARVA 3CB3A 3IUIA 4Z2LA 2NQHA 2BOEX 3CV1A 4AYSA 4XZWA 1P6CA 2DZTA 3N19B 1HVXA 1LTDA 2ISFA 5A8PA 1V02E 3DC0A 5F7UA 4NJGA 4FA3A 4PN2A 2CEQA 2VDIA 3VIIA 3KBMA 2YFNA 2EJ1A 1JRBA 3HOJA 4EXBA 2V8ZA 2V5LA 3RILA 4YVVA 3H2MA 2J9ZA 1LBMA 1H2JA 3IJDA 1U1UA 5HMEA 1A5UA 3M43A 1OT1A 3QEZA 3WBAA 5B80A 2O9OA 5AECA 3PZVA 4PZVA 2A3AA 4YN5A 3GKFA 1TWWA 4GKLA 3VIOA 2Z24A 3N4AA 4BWLA 1TPH1 1M6JA 2BXVA 5C2CA 4CD4A 3LQLA 3S6TA 4PSPA 4K7VA 2VEGA 2XN0A 3ICJA 4LAKA 1S2AA 3V0SA 2V69A 4C1KA 1NAL1 4QG6A 1XIFA 4DB7A 2ZFAA 2PWGA 4CQCA 3BICA 2GUBA 2CERA 1W5PA 2HVOA 3LNMA 3OVRA 2Y5EA 4CCDA 4D6FA 4AZCA 4B5WA 1V3MA 3UPMA 2R1NA 2GVEA 3BCFA 1IT0A 4M24A 1YYAA 1EX5A 1OYBA 3IEBA 4I5RA 4LRSA 2YDRA 3RUBL 3FYYA 1UKQA 2EO7A 3LMZA 1TWSA 4QTGA 3KTSA 5CGQA 5I06A 1EJVC 3LCWA 2I9UA 1PZ3A 2GPTA 1F2JA 4MJ2A 3C61A 4C6EA 3TZNA 1HL8A 2FB2A 5DT5A 4R33A 4DJEA 1IEIA 5A6TC 4EACA 2QGYA 3PY2A 3QC3A 3NTYA 2BTMA 3LDVA 4DUVA 4O0ZA 3WDIA 3DG6A 1HF6A 4Z2KA 1ZB5A 1SFTA 1LQ2A 5AC7A 4ZQMA 3BCJA 1VFHA 1SR9A 3T6CA 3RCYA 4PMDA 3BW4A 1DJXA 1MW2A 1S1RA 3HJEA 5D33A 3SN1A 2XH4A 1WV2A 3FKKA 4AZCB 5EPDA 5LHEA 3WBWA 3VAVA 2H3BA 2BHZA 5FF0A 4O4WA 4L6OA 3THUA 4UQDA 4QNWA 5E93A 3FXYA 3IS4A 2FYMA 2Q6ZA 2RDXA 4MY8A 2D24A 4NRRA 5FEWA 2A3CA 3TTQA 4DUWA 2WSPA 3PZQA 1B54A 4OOUA 4A6GA 4JY9A 3LGEA 2J74A 4JTLA 3OBEA 3I3BA 2G4JA 3R25A 4S3FA 5E5CA 4Z1BA 4EAMA 4TTUA 3M0XA 1PWLA 4L6DA 4M7SA 3DH7A 2XIIA 1JAEA 5TAOA 1EZWA 2QCNA 3TUUA 2IXVA 1F61A 4Q8OA 2DIJA 4QITA 3WLMA 1Q4WA 4P8VA 4UMCA 4QXIA 1T5AA 4H9YA 4GNVA 1JDCA 1OEPA 4JQAA 3UD6A 5BOFA 3UPWA 3M0LA 2ZE3A 2QDDA 4IUGA 1S2UA 3CQJA 4FLRA 4J3TA 4ZFCA 2ABAA 5AVHA 5CPLA 5LNRA 4PTMA 1M01A 3KCJA 1UPPA 3SECA 1QHZA 1F8IA 4QJ1A 4UMAA 3GQYA 5E9AA 3A47A 4O1FA 1WCGA 1Z3NA 3ME3A 4G9PA 3TX9A 4OFCA 3KL3A 3CTLA 4ZQRA 3GC5A 4B9ZA 2HVMA 4WK9A 5DY2A 3PP7A 4M7TA 3B0UX 3TYUA 3ABZA 3W71A 3SM0A 2YL9A 1XRSA 2W61A 4ZB0A 3SCQA 4LUJA 5LIKX 3VNJA 1GNXA 3PUEA 2Y70A 3ES8A 3QF0A 2XZ7A 2VENA 1DJGA 4FX6M 4ZQOA 3T78A 2PDNA 2FKPA 2NUXA 1U1HA 3TNBA 1TG7A 5GJMA 4MKNA 4GY7A 2A0NA 3VM5A 2GDQA 3N3TA 5D4YA 3RR4A 2BV9A 1EDQA 1GQKA 3N4FA 2YPIA 4J2PA 4N6EA 3MKVA 3O6AA 3DX5A 2O4MA 4J9JA 3SN4A 3WQWA 2E5CA 1KBIA 1AMKA 3FA3A 1SFJA 4E8CA 3F5LA 3SCWA 1XSIA 2ZUSA 2QNEA 1W0MA 2EQDA 1H3GA 2VC6A 2CWNA 1KGUA 3L4ZA 3F4DA 3R0KA 3G1AA 4GBUA 1TPEA 6TIMA 1V7AA 2DZVA 3RHGA 1T6MA 4NYYA 3NQMA 4PCPA 4S3JA 1YLVA 3R13A 3MCMA 2R9RA 3AS2A 1XUZA 4PL1A 1VFTA 2JBMA 4F0KA 1UUQA 4J2MA 2C1GA 1GKQA 3FFSA 2IMRA 3A23A 2J7FA 1PB0A 1QRQA 2FTWA 2AGKA 3NM1A 2J8FA 1XHGA 2DGAA 3LHYA 5AZ1A 1X1ZA 4HBKA 1KGXA 2VT0A 3L66A 3G2GA 3H7UA 4DF0A 3WF4A 3MPGA 1FH7A 2YL5A 3D5HA 5AVNA 3TVAA 3E6EA 3OU8A 1E73M 1SO5A 4ERGA 4I7VA 2ACRA 4UQEA 2P76A 2AQWA 4CD5A 3R4IA 2ZZ2A 1XBVA 2J77A 4KCVA 5K9XA 3USZA 1H51A 1VBUA 1ZNNA 2WNQA 3V36A 5D8WA 1OVDA 1I2PA 2WVVB 4H6KA 3R58A 4GBDA 3QFWA 1RLCL 3N17A 1TR1A 3JS3A 1R3QA 3N15A 1H7NA 3E96A 2G8ZA 1Y5VA 1E6PA 2PTDA 2XU2A 1KQZA 2FMNA 2Q3RA 3ZWTA 1F7BA 2I16A 1LDCA 1P7TA 3GZ3A 5HQLA 1OJXA 3N13A 3E0WA 3JZUA 2O9PA 3F2DA 3LCIA 3MCNA 4I5XA 1W3IA 3KS6A 1GYLA 1R3TA 2B7QA 4LS1A 1Q8AA 1OT2A 3CBWA 3RMEA 3GXFA 1U5JA 1ZAHA 3URQA 1NU5A 2ATMA 4AD0A 5CBBA 4JZ5A 1B0IA 3W6LA 1Y0EA 1PDZA 4IUOA 1W1YA 4PODA 1MW3A 3OBKA 3TN3A 1KR1A 3HF3A 4GJJA 5CQ1A 5F4XA 1Q6OA 3ZOAA 3VMPA 1W17A 4IMFA 5ECUA 5DT7A 4C91A 3BG5A 1LG2A 4ZCWA 1O12A 4GH3A 3EB2A 1IR1A 1Z89A 1OD0A 2DU2A 4MUZA 1H62A 4A8IA 2HISA 3A3WA 2RH9A 3LXBA 1YADA 1C8YA 1DE6A 1RVKA 4UTUA 3I6TA 3CU2A 5CG0A 4O0QA 1WOBA 3MP3A 4BK9A 3AS0A 1VYSX 3FY1A 4Y2WA 5G2WA 3R11A 1V0NA 4TMBA 3PZNA 2LLEA 3NQGA 1IXQA 5CSSA 3VD4A 2C0HA 3ALGA 2VL4A 3M1ZA 1EHNA 3WDQA 5C7HA 1EWDA 3UA3A 1F6KA 4XG1A 4FNUA 4NNAA 1UUOA 1V6XA 3EKLA 3ZMRA 5AY7A 1HP5A 1WNOA 4S3CA 2ZRXA 3A4WA 4F2BA 4AHOA 3TYCA 3FS2A 5JH1A 2HPIA 3DKJA 5HK4A 1H7WA 3LHZA 3P62A 4N9CA 4PUKA 4Q22A 4A2SA 3GVWA 1JZ4A 1OSEA 2YCKX 1S46A 1ZJBA 3QY6A 3GVQA 3SCSA 5DY3A 1OC6A 1XIDA 5FEXA 3BOXA 4KKXA 1A5MC 4B3LA 1A5CA 1NDZA 3T55A 3UZ5A 2VGIA 1WDPA 1KFCA 2GJXB 3GR4A 1KLZA 3NYDA 3E38A 3UXDA 2XHYA 3EPOA 3BO9A 1NSJA 1Q85A 4S2BA 3TIMA 4BJHA 3STFA 3FSUA 5F1UA 4ICMA 4S3DA 2EPKX 4MNJA 2ON3A 1K4GA 3RPMA 4Q8PA 1TTJA 2YCLA 2QGHA 4K8HA 2QMJA 2CKRA 3NPVA 4DXKA 4MGGA 3A5VA 4JTCA 2WC4A 3PTDA 4ZQCA 2WSYA 3H70A 4RDYA 3DYMA 1I8JA 3A12A 1QNOA 1YIXA 1UKTA 1BVZA 3BOLA 1QPKA 5IHSA 3TNOA 1QMLA 1RBOB 3AI0A 1LF1A 2HS8A 3WK2A 1UD6A 4BWLC 1TPVA 1WDRA 1NF0A 2H6RA 3CHVA 3RX3A 5LSMA 4Y9MA 3BLIA 4WJXA 1VENA 3KBSA 1RALA 2BB0A 1KM2A 3NL2A 2Z7GA 1GKRA 3FDGA 4XVEA 3ITVA 3I4KA 4RV8A 1A5SA 1IGSA 4EPBC 3KVKA 1KB3A 4OBRA 2QUNA 2XSXA 5CSYA 3DECA 2J27A 4K36A 3NA8A 1UASA 3RCNA 1PE1A 1DPMA 1NDYA 4BR1A 3N12A 2OZ0A 1KFWA 3UXAA 4F3HA 4MB4A 1AMYA 1XDJA 3CPUA 3H12A 4LB4A 1XWYA 3I3DA 4JHZA 1CENA 5H8UA 3MMUA 2GJPA 3EB3A 1PCWA 1XP3A 1G01A 1FP8A 3R5EA 1Q6RA 2J62A 2ZC8A 1GZGA 4TVDA 1I2OA 4JTJA 3ZXWA 4UFMA 3ABQA 4NJIA 4U2ZA 1JUEA 2YCLB 1E1EA 4HNTA 1ME7A 3CZ8A 3Q94A 5DRCA 2AGTA 1CNVA 3O8AA 3NWRA 4NQ1A 4AEEA 1LOQA 1OFRA 3WF2A 3WF1A 5HWJA 3CMGA 1Z8AA 3LCLA 3B0VC 1X7IA 4GNJA 3IJ8A 1DIEA 6ALDA 2YB4A 2RGMA 3TW9A 2RUSA 1BEUA 3REQB 3W74A 1Q7MA 1PKYA 4RX0A 1EA0A 4JDYA 3L4YA 1LORA 3WQCA 3G3MA 3CPGA 2FVMA 4WXZA 2HJPA 3OO2A 2VI0A 1GVOA 1R46A 4Q33A 1E4NA 1FP9A 5FEPA 3L0KA 1EIXA 5FF2A 1DV7A 2O7QA 1TMHA 1G4SA 2R24A 4NKCA 4WCJA 4Q4PA 3APTA 4PMVA 1EOMA 1XXXA 4MY1A 3FJ6A 4QS5A 2AL2B 1CXHA 3FYOA 3G1VA 1VAHA 1JUKA 3CQHA 2ZUUA 3SCPA 1W9XA 3NAVA 4QJ3B 2SFPA 1QNPA 4DVOA 2DZPA 2HEJA 1RK6A 4GJ1A 3HPAA 2OEJA 3WDPP 4HD5A 3WX7A 1HKVA 4ZOAA 1F05A 3E3HA 3SUVA 4JXCA 3Q2DA 4RDZA 2JEPA 1DIDA 1TCMA 3T07A 3EOUA 1K4HA 3BPWA 3VC5A 2VC7A 4FK9A 4GUJA 2BGQA 2GWNA 3TXZA 1WDDA 3UR5A 3V1PA 4E8DA 4G2DA 4KCUA 3QGVA 3AOFA 1C9WA 2VR2A 4Z1AA 1GGOA 3L65A 1JPIA 3JVAA 4D6GA 1X98A 2BGSA 1NFPA 4IOTA 2OQHA 3VFCA 1SJBA 4E4FA 3K1DA 2OU4A 7TIMA 1MYRA 4FLSA 2IPFA 2GL5A 3W38A 1FFRA 3ITXA 3U5YA 1EUNA 4XX6A 3R94A 3NQVA 3VIPA 1OFOA 4WDTA 3P8IA 3LSCA 3WLOA 3QMRA 5EFFA 3ABSA 4YNGA 1VIZA 5A1AA 1IXOA 3M64A 4Q4QA 1GG1A 4ZO9A 4YIWA 4DWSA 3EOLA 3UWEA 2I7GA 2VZVA 1QI4A 4JHMA 1ZHAA 3IVSA 1C93A 3T0AA 4EIVA 4D6EA 1QWKA 3ITTA 2DIEA 2PPGA 3U2EA 2CETA 2XYLA 5I79A 3CL8A 1VJSA 3N2CA 3EEZA 3ZJ7A 5FKYA 2TYSA 1O7AA 1GK8A 4LBRA 4IL0A 3S2CA 2WWDA 3PPCA 2WPGA 4MYXA 5HANA 4DF1A 4GACA 3MHUA 1B4EA 1G69A 1BVNP 5A3HA 3S1WA 3N9KA 3LHVA 3LGDA 4LTSA 4AD2A 2ZUMA 3STCA 3EGJA 3CUGA 1JI2A 3R8RA 1UH2A 5EGRA 2YFOA 5CLWA 1VFMA 4IF2A 2X1TA 2G41A 4R5EA 4YLWA 1HO1A 2EPLX 2ABBA 3ANUA 2IPWA 4HNNA 2FIQA 1I75A 4AD5A 1UIOA 2DVTA 3QZAA 3JU2A 4GI9A 1Q66A 3W7IA 3OVQA 4HNLA 1UA3A 3T4CA 1CWYA 4U5IA 2X1IA 4HNCA 1V08A 4JFTA 4C6PA 2HTMA 1ITXA 3GKAA 3QXBA 4FOUA 3ID7A 2WCAA 4HSNA 4FF7A 4PMYA 1NDVA 9XIMA 4ADUA 4JIHA 1SVDA 2QDEA 2GK1B 1BD0A 3MT1A 3L21A 1CIUA 1DL3A 2XPKA 2ZRYA 1UKOA 4KWOA 2XH7A 5EBAA 3D3FA 3S9IA 4JIIX 3G5EA 1UJQA 1XW8A 1QFEA 3T0CA 1OZQA 1UB3A 2YA1A 4L4PA 3Q4DA 4PCSA 3EWBX 2FZ9A 3GTXA 1AQFA 1OC7A 3TQKA 2J7EA 3UG8A 5A95A 1E15A 4NZ5A 4WOQA 5K9CA 5FJUA 5FSDC 4PEKA 1CB7B 1T0OA 3R7MA 3MI3A 3DI0A 3W86A 9XIAA 1EYWA 1NQKA 2DH2A 4K68A 4GNKB 1AD4A 4BCEA 3UGVA 1DYSA 2AKMA 4RZ4A 4X63A 3WMSA 2Z2AA 1P1XA 2E7FA 4URIA 3GH4A 2E77A 3SZ8A 4QCFA 1XC6A 1SJCA 1ODUA 5LZLA 3MMDA 1NOWA 5HQEA 3WNNA 1RXOB 1TV3A 3SUWA 4KGLA 3AROA 5A5WA 3VDCA 4REQA 2XM2A 4MFDA 3GTIA 2PD9A 3ARTA 4GUGA 4D1IA 3BK0A 2G96A 1UPMB 3VD9A 1DXFA 3PF3A 3E9AA 1W1IE 1YEYA 2DEPA 3BAIA 3UNTA 4GYFA 3G0SA 3AXHA 1XLGA 5E6YA 3IARA 1LOSA 4M51A 4TX8A 2C14A 3SFKA 1A5AA 3PHAA 5BU9A 3QM3A 4QLJA 3VOIA 4BQ3A 1S5TA 4QLKA 4C5ZA 4CQBA 3MWCA 6CGTA 2IKHA 3LG3A 4K39A 1FHVA 3VD3A 4QE1A 3LGGA 1JG9A 2PGFA 3G8RA 3T40A 5JIPA 3DESA 3WKZA 3TOPA 3MJYA 3WDHA 2BASA 1B3OA 2J75A 4M6QA 4PTWA 4LVBA 4JYEA 5HNTA 3RITA 1XLFA 3CHFA 2VVNA 1IWBA 2YXXA 2GGEA 1X7FA 3U8GA 4R7WA 1E1CA 4MIMA 4NVTA 1YBQA 4JGDA 4MWAB 4CD6A 1VCVA 1KW1A 3NL6A 3CHDA 3IRSA 3POCA 3ITLA 3EPMA 3N6JA 5KZDA 2OO6A 1E6RA 2WB5A 4PYSA 3U5UA 4EWJA 1QUMA 1ALDA 1XLMA 1F8MA 3CTTA 3CZKA 2UY4A 4GQGA 1LLZA 5J5DA 4PTNA 3VKJA 3H2CA 5HMSA 4AZHA 4W85A 5BRPA 3GG7A 2V82A 1TQXA 1RPKA 4EXAA 3DZ1A 2XH2A 4EAYA 3EMQA 2WMHA 3UWVA 2XH0A 1GVQA 4LXFA 2IW0A 1P4CA 5C54A 4MLRA 2E8ZA 2R6OA 1RBLA 4UFHA 4G5DA 2QCFA 3T8QA 4ZZ9A 2DVXA 3SCUA 3UNDA 2V2DA 3S83A 4CQAA 2A5HA 4JN8A 5BXPA 4G1KA 3W88A 5BWAA 3QR1A 1I2NA 5DCDA 2A3BA 4E2VA 1PWMA 4AWEA 4ZBCA 3KXQA 2OSWA 3M5YA 3BG3A 3RN6A 3U48A 4DM2A 3CL6A 5EMLA 3JRKA 3N2TA 3T81A 1SSDA 3UR7A 4HT3A 2WC3A 4E8GA 4OV9A 4AVNA 5HAOA 1DWGM 1XG3A 3NOYA 3BJTA 3KX6A 1QI3A 1A3WA 3I6RA 1W9PA 3R2GA 3WUGA 4QLLA 1DHPA 1BQCA 1HVQA 2EG6A 1IR2A 1GOXA 1HKKA 9RUBA 1R7OA 1WKEA 2PDLA 1J01A 4YTUA 3W2KA 1KWGA 1RAKA 4MFEA 1R9XA 4UQBA 1SO3A 1YNPA 4JFSA 5G5IA 5LNVA 1J12A 3BDKA 2P50A 3WBXA 2G97A 4Q4OA 3PS7A 1DJYA 1E4MM 4CN4A 2VRJA 1TR9A 3WO8A 5H2ZA 3FOKA 3MI6A 2ZIDA 4MKVA 3P6LA 2YBVA 3MANA 3ZSSA 3QHOA 2OLSA 3LLFA 2POTA 5TBOA 4O15A 4J35A 3DFPA 1FCQA 4IPNB 2DPEA 3GXTA 2Z00A 2A79A 2JF6A 1H0GA 3BC9A 4IGMA 3EYPA 1YKWA 2OWCA 3WELA 2JKAA 3U2CA 3OBAA 3S47A 3CEPA 3W1AA 4N42A 1LL6A 3VOFA 2Q8LA 4LANA 1W6TA 1CLXA 1W91A 2W4XA 4ML9A 3USBA 1KV8A 7A3HA 3LPOA 3FLUA 5AFDA 3SBFA 1J0KA 1V7YA 1W1TA 3GSMA 1ITQA 3LK6A 4S39A 1OHLA 3GH7A 1A5KC 3MJMA 3GFXA 3WBYA 2AL1A 2IQDA 4PUEA 1US2A 3HU7A 3EWXA 2Y8KA 1K8XA 3E2SA 4IH3A 3SN0A 2D2HA 4IICA 1WXZA 3BOFA 1OFQA 4ZSTA 1W5QA 2AMXA 4G6CA 3VNKA 3ITCA 4LGXA 2Y6ZA 3G1SA 2HK1A 3W24A 3QW3A 2ZUTA 1GHRA 1R3WA 3SQSA 5AN7A 3EA1A 4FXJA 5DX7A 1OCNA 4JTSA 4AY7A 4RDWA 1QDSA 4GX8A 4LY8A 3GAYA 5HBFA 4NZJA 1BGAA 1WKDA 2C7FA 3KLKA 4UXDA 1TV5A 4GIAA 4BZYA 3T42A 1SZEA 3WQ8A 2YZ5A 1FVPA 3WJSA 1WAWA 4C6CA 4JNMA 3GM8A 1MQQA 4ERIA 3ATZA 4PUDA 4B2DA 4DPPA 5IHRA 1REQA 4PUMA 2EPNA 5KZEA 4RNHA 2J88A 3NYZA 5G2HA 3F7JA 4H8VA 1JIBA 2QCMA 4KBXA 1RQHA 2C0AA 2D22A 3U7BA 3AMCA 4JTQA 2PWVA 3KBJA 5AYBA 2AQVA 3UT0A 3WUBA 4IIBA 2BG5A 3AXKA 8TIMA 3WF0A 1Q6GA 3O16A 5C8BB 1B5TA 4X9YA 4QBXA 4NJHA 2X8RA 3CUJA 4JS3A 2VGBA 4Z0JA 3BUVA 3CMJA 3B04A 5I24A 4L61A 3WJYA 4NG3A 1GTHA 4DJFD 1AQ0A 5G1TA 4US5A 2QUUA 3UZZA 3W3OA 2QPUA 3W1MA 1ELSA 1JJKA 1TPFA 1MO0A 4EPDC 3QC0A 2BMBA 2BZNA 1GYNA 4IG2A 3E2RA 4DXXA 2GOUA 5K2ZA 3FGCA 1BWKA 4DY1A 3M0IA 2DUAA 3RPTA 3VDBA 4AVOA 4IPJA 4RUBA 2GJLA 2EPOA 2O4QA 2VURA 3W1RA 1RA5A 2J7HA 3VMNA 3UY7A 3DN5A 3UPBA 1M41A 2VWSA 1XLAA 1QVBA 3KVMA 2BVWA 1QBAA 4WLCA 2NUYA 5CC7A 2ZE0A 2D2OA 4PCFA 4PUJA 1L0PA 2QDGA 4AFYA 1K9DA 4MOZA 1R8LA 3PNZA 5CJMA 5F4SA 4LF2A 3BMVA 2G50A 4O19A 4V15A 4Z2JA 3GNXA 3EXRA 1TPB1 1V3LA 3KWXA 5FAJA 1R9ZA 4C1LA 4A3HA 2V3EA 1SMDA 4QQ3A 5DANA 2VZOA 2R8WA 4OOZA 3W6MA 4AMCA 3CH9A 3LM7A 1OFAA 7REQA 2D0FA 4IQJA 4UR8A 3TOYA 3UBPC 2BVTA 4U3AA 3G24A 4XZLX 5KZMA 4GYPC 1BXNA 5A6KA 4BI7A 3F2BA 3EX2A 5DRIA 2PGEA 3TC7A 3WLPA 2ZZ3A 3OLGA 2ISDA 3DBNA 1KXHA 2NX1A 4DZHA 3OZPA 4OBTA 3RLUA 2PLJA 3FJNA 1E40A 4WIWA 2I56A 2O55A 4C6LA 5GNYA 2NVCA 4F0MA 4RPPA 3TJ4A 2W5FA 1XGZA 3W1UA 1F6YA 3EBVA 3DYOA 4NU7A 1DHKA 1R5YA 3HMCA 5TQLA 3UZXA 3BLOA 3NQEA 5TNVA 4XVDA 1S3TC 3ABOA 3OLIA 5LA1A 1U5VA 3WMLA 1E56A 1EP3A 3HBLA 4K8GA 1J93A 2XFFA 4HHPA 4JFUA 5E0FA 3L2IA 2D0GA 4ACZB 4H8UA 3D3AA 1VZWA 1HP4A 1HN1A 2CW6A 4I9MA 3CZLA 5LKYA 3GXIA 3KOWA 3AAMA 2OFJA 4E2OA 2VMFA 4MNLA 4I8YA 4CEUC 4KERA 5A2AA 1ISWA 3OZMA 1M3UA 1H50A 4HOXA 3N3MA 4PA8A 2Q02A 1B3ZA 1EEXA 5K4ZA 3G6LA 2F9RA 4H7CA 4R3UA 1UH4A 3WBEA 3WD1A 2F8QA 3T1GA 5SWUA 3OA3A 2XIOA 3W87A 3UJRA 4UTMA 1G6CA 3F4WA 3WMBA 4LUTA 3NSMA 4TV5A 4UTWA 4GIYA 1TMQA 1JZ3A 3N2MA 1TWZA 1E1CB 2OLAA 1UBPC 3NQBA 1GOQA 1V6TA 1EO5A 1GQIA 3FA5A 3HA1A 5TF0A 2XFYA 4DEFA 1NEYA 1U22A 2DY3A 2WMJA 4E0CA 3IAPA 3LMYA 3SB0A 1B1YA 4FOKA 4KWUA 1OK6A 1POKA 4IJRA 1JYVA 1PIIA 1BSLA 1JAKA 4FXSA 2GGHA 1N8IA 3HFYA 4A8NA 5A6BA 3V5FA 1BRLA 1W37A 5BRBA 2PC8A 1V3HA 3K5XA 7REQB 4N9EA 1X6UA 1TIWA 3IIVA 3KVJA 3ZJ8A 5CBJA 3I7RA 3HN3A 4C6QA 1EGVA 4NX5A 3P2VA 4P7RA 2HDJA 5GQBA 3SSJA 1Y8BA 4LYQA 1HTIA 5KMYA 2QJJA 4IPPA 2VEMA 4N6FA 1GHSA 4REQB 1VPXA 4LV9A 2KX9A 4ZOCA 4J40A 3B9DA 4RXGA 3G3DA 4LPCA 4Y8FA 2L5HA 2OLHA 1JCLA 2TMDA 4NJJA 3VCNA 1JZ6A 4ZE5A 3G0XA 3F03K 1CYGA 4NXSA 4MZYA 5D9NA 1K6AA 5D2YA 4BA0A 2Z6IA 2C6QA 1ONEA 3QV7A 1D7FA 2CZDA 3CLWA 4J28A 1ZCOA 2G37A 4ZB5A 3EXTA 3MUZ1 1G4EA 4D72A 1V3JA 5D38A 2RDTA 1V93A 3TTOA 3WJWA 3B8TA 1J0YA 1MNZA 4QJ5B 3SRKA 2CFFA 3ANVA 3B40A 4PRTA 1NWTA 4DI8A 2R94A 3P84A 2HROA 2FB3A 4HZ8A 3LV5A 4W9TA 4S2CA 2A7PA 3W7QA 3WH9A 4LUYA 2QMKA 4NXKA 1T96A 3H4GA 4FLQA 3FN9A 1O4UA 3GB6A 1Z9AA 4AC1X 4JTAA 5LHFA 4GQQA 1DTNA 3M0JA 3LHTA 2QDHA 1EH9A 4TUFA 2PRMA 1TE1A 2QF8A 4AHQA 3KEHA 5EY5A 4YS1A 3QSRA 1J0ZA 3N1AA 4LNYA 2G3FA 3BZJA 1YTKA 3WLKX 1A4MA 3LCFA 4GUFA 4L7ZA 2W3ZA 2CZFA 3HQNA 4ALDA 5A6SA 2WHKA 5KTLA 5LYRA 4UR9A 5IBXA 3P0XA 4JEQA 4UUIA 1XCWA 3W85A 3TLQA 3TTYA 4UOZA 3AIVA 1SZFA 4QGCA 1X39A 1BPLB 4NAEA 1MXGA 3DHPA 1US0A 3VOCA 3UJ2A 4AWSA 1R0MA 2QV4A 2HWGA 4AZIA 3ITGA 1HL2A 3IK2A 4LNCA 1K77A 2MNRA 3NPWA 3S42A 3DIPA 4LBUA 1BWVA 4DWSB 3CWOX 1UWSA 1OF8A 1HJWA 3BV7A 3A9BA 4JX6A 4UZUA 4YMZA 3ZJ6A 1FCBA 5GNXA 1E4IA 2HVNA 2NQ9A 3WJXA 1F3TA 4I9JA 3B9AA 1CT5A 4O1CA 5E0KA 5LA0A 3K30A 1XYAA 1XSJA 4QAIA 1LBFA 1JI1A 4LUSA 4C6DA 2NQJA 3HIJA 4FR1A 1JF6A 3IGHX 1ITUA 3H7VA 3B9NA 4OU1A 3GG8A 1S2WA 3A21A 3EMCA 1C8VA 1I0BA 1D3GA 1J2WA 2VC9A 4HMCA 1HUVA 4FNRA 3RAOA 2PDGA 4LC8A 4TX9A 3S9YA 3T0BA 3O6YX 3U6WA 4RZBA 3ZT5A 3WL1A 1QOXA 4R85A 4O12A 3UXLA 2YXOA 3BWWA 4UNKA 1LG1A 3VFLA 1FWEC 4ZTXA 2Y89A 1PTGA 3G6MA 1MXDA 1J8VA 2QF7A 1H5YA 3I65A 1OCQA 2XUCA 2AAAA 4POCA 2DQXA 2NSXA 2E1DA 2PZNA 1LJYA 4EPEC 4GE8A 1N8WA 4JIEA 1KCKA 4O1BA 3BMWA 3JZEA 5CXPA 3UZWA 2CLMA 5CGTA 3TYDA 2FJUB 2GSEA 1AODA 4ORIA 3GWQA 4EANA 2UV8G 4GUHA 1IIGA 2ZVIA 4PMNA 2Y1HA 4QX4A 1EGZA 3VNZA 3PPGA 2OZ3A 4US5D 1LRTA 3WDRA 2Y5SA 1JULA 4FPSA 2W67A 2WZTA 4YYCA 2E5BA 4V1XA 1JCYA 5LIWX 4XWUA 4IGHA 1JL8A 2QW5A 1F4HA 1Z7AA 3W1PA 3L67A 3SGGA 3N18A 3CAVA 3VX0A 1EEPA 1PAMA 4LUSB 3NL3A 3QGKC 2FDMA 2WM1A 1LUCB 3VZXA 4FAMA 3OVPA 3O2LA 2BS9A 3WYZA 2QV5A 2OMAA 1FWGC 3NZGA 4HNOA 3PSWA 1WB0A 3CM4A 2NVAA 5EA9A 4MG4A 2Z1XA 4DZAA 3IWPA 3VK5A 3TYEA 3S1VA 4PCTA 1D8CA 4GMEA 3NSNA 3NOEA 1LWJA 5BMXA 2Z28A 1PYFA 5IDIA 3C56A 3EWCA 4HA3A 3PM6A 3DDMA 4DYEA 1CB2A 3MSDA 1YPIA 3W1QA 2E40A 2YOCA 4ACZA 3DFQA 1NWUA 2AQOA 3EAUA 5CPQA 1UWRA 4DBEA 2VFFA 4O8RA 3VCCA 1XYZA 1KM3A 1B57A 1HT6A 2REQB 3CNYA 4WY0F 1TA3B 4DJEC 1DVJA 4GKTA 2HSAA 3MUCA 2RKXA 3UCQA 1C91A 3DUGA 3AHYA 3GRIA 1UKPA 4ZGYA 3N9SA 4RJEA 4UZSA 1TZZA 1YBQB 2Y88A 1J0JA 3VDGA 3AJXA 3L5MA 4N02A 1KM1A 3VCRA 2WKGA 1PO9A 3AIUA 1FWBC 4MLJA 3CB8A 5HUOA 2EPHA 1K70A 1NARA 4ZB2A 1XH1A 5FF7A 4FNQA 2CC0A 5AHEA 1XBYA 2XN2A 3NFUA 1RHCA 3WN6A 3E02A 3CC1A 1E3XA 3C2OA 3DC8A 1W8GA 4BY3A 2FGBA 7XIMA 1F73A 3OODA 2EKCA 4NJKA 1YE4A 4D8ZA 3UCCA 4IX2A 3GO2A 1OADA 2PU0A 4U2YA 2R1PA 1W9UA 1EPXA 2QCDA 4Q4RA 1OK4A 1J2BA 5AHNA 2ZZ1A 4PTXA 2J24A 3VVGA 4I90A 1RLDA 3F4VA 1YXYA 3A5FA 3W1XA 1CGXA 3IV3A 3MV01 1QPOA 3NXFA 3RNDA 3K1GA 1QWGA 4TU1A 1DORA 4I3GA 1W1ZA 4IMEA 1K7XA 4GVFA 4GI6A 3IGSA 2INEA 3FV9A 3N73A 4AZ5A 4K7YA 1MUCA 4JCLA 4L9ZA 1Z6KA 1KCLA 4PMOA 1XLLA 1I2RA 4D8AA 4ZQPA 4D8LA 2V30A 1UJPA 4EP8C 4L1GA 9CGTA 3B0XA 3PBYA 1K7EA 5HMDA 3TA9A 3WK3A 4BQ4A 4H01A 3QH2A 4IFOA 7ENLA 2GUUA 3UG5A 3PPFA 2VYOA 4H9TA 4ADTA 1KWKA 2DZWA 4LFYA 3HGJA 4J3VA 5LNUA 3P8JA 2E6FA 4BFAA 1TV2A 3TFXA 3VGEA 3BGGA 1UD8A 1QO5A 3W23A 2PDUA 2Y8VA 4M29A 2FQIA 3AWOA 1GVFA 2F84A 3IIXA 2FDSA 2OEMA 3ZT6A 5CSUA 2E09A 4WSJA 2CESA 2VQUA 1S5WA 4A05A 4LUIA 2YLAA 4OT7A 2EKGA 3POHA 1MW0A 1XBXA 4H04A 1IXPA 4AYGA 2H3DA 5BROA 4IXXA 1TPUA 1Q6LA 3ARXA 3AISA 2OOGA 3O15A 3LLDA 3H54A 4XZMX 4XK2A 1XRFA 1HJQA 1KFJA 3QKEA 3AHTA 3KM8A 1OC5A 2IKJA 5LIYX 4C6KA 4AG0A 1H4PA 3NG3A 4MHBA 1LP6A 4A3RA 2PF8A 5D04C 3PWAA 4QRNA 3LCHA 1VFSA 4L1WA 1JCNA 3RXZA 1UYQA 4IIFA 1N8FA 4UC5A 2WM0A 2ZKMX 4P7QA 3WQVA 1XKJA 3ZVHA 1O5RA 3MSGA 2HBXA 4XZIA 5XINA 1VS1A 1HFBA 3M6DA 1W1A1 1FWNA 1YPXA 3LUTA 4F4RA 3CS2A 2D1ZA 3LOTA 3OGRA 3PN8A 4JFWA 3LXCA 4N7QA 3GU2A 2QJIA 4WY0A 3WQOA 2NX3A 2E9MA 2AMGA 4QAWA 3K8MA 3OW1A 1CDGA 1XYLA 2V81A 1NWSA 4KEZA 4H9UA 1NF7A 1QOQA 5D03A 2I57A 2HBVA 3W29A 1UD4A 1M5WA 3THQA 1E0XA 1D3CA 3A4XA 3TSBA 1DWJM 5HR6A 2BWGA 1JRCA 3GTNA 4B91A 8CGTA 2CXEA 1OY0A 3WY1A 3I10A 1ZSXA 1GQLA 1AK5A 3T2PA 5FACA 3PZOA 3HG4A 1YRRA 3KE0A 5I3GA 1GG0A 2HZGA 1GTEA 4A21A 4ERAA 2J8TA 2Q8XA 1FWSA 1GOWA 3NIYA 1TA3A 4IIGA 4WKAA 1IZKA 1NIUA 1V6YA 1ISXA 3N04A 3WENA 5E6ZA 3WD0A 4BF5A 3P3BA 3DCPA 4PR4A 1W3JA 2OR2A 1RUSA 4JL1A 4RZ5A 4ZFMA 5LIXX 1OFPA 2NV2A 1JPMA 4H1ZA 4JN7A 4UFJA 3P0WA 4L80A 2HNHA 2H9AA 3R1ZA 1XDLA 4V33A 1XM3A 4B16A 3NSXA 4F48A 5IFTA 5HJLA 4DF2A 2X42A 5LNWA 4Z1DA 4JICA 2PDMA 1R3RA 1P0NA 3E5PA 3LBMA 1OINA 2Y24A 2O0TA 4PRWA 4JTUA 1GONA 3IIPA 1EC7A 5LIUX 3VI2A 3PJWA 3GNNA 2QS8A 3KRBA 1AH4A 1EGMA 3LEPA 3WQPA 1DIKA 3PB0A 5DO8A 5K9DA 3HB9A 4AW7A 3C3UA 3RO8A 4PBEA 1A5LC 1GCYA 2WV8A 4C5YA 4RNJA 3VC6A 1I0DA 1M7XA 1QI2A 1A5NC 2FHFA 3R12A 5T91A 2B31A 3VKDA 1TTQA 1SPQA 3QR3A 1FOBA 4OE7A 1YHTA 2I5IA 2QCDB 2TSYA 3GFYA 2H8ZA 6PTDA 1KRAC 1OB0A 3IJLA 2PF0A 3CQIA 3BLEA 3ITYA 3N6HA 4CEXC 3MZ2A 3OP2A 4AY1A 1HW6A 1EJRC 1VJIA 4Q8TA 2PGWA 4W93A 3EMZA 3LTPA 3SJNA 3U57A 4Q7IA 5B7ZA 1WE5A 1XYBA 4NAEB 2KZHA 3T2QA 3QLDA 3MDWA 1QAPA 3QVQA 2BXZA 1J79A 3B8WA 1HJVA 3W7JA 3CV6A 4JTFA 3GG1A 4U3CA 4UTIA 4L4LA 3V0TA 1QCWA 2WLYA 2JK2A 1OX6A 3VU2A 1Q5MA 3U4AA 2B7PA 2B81A 2HE5A 1RY0A 3E0LA 3L4WA 4XAYA 3MS8A 1TVPA 3D47A 1XLDA 2HNEA 5AHLA 1ISYA 4A22A 3QJAA 2FPTA 5BYWA 3PZGA 3LPFA 1C9DA 4DJDA 3NM3A 3WQ5A 1OFDA 4CLMA 4YVPA 3ZR4A 3ZLHA 4C6BA 3S4TA 3HPSA 2CLKA 3GIQA 5U4NA 4WXYA 4IL2A 3EEGA 4PB5A 2IS7A 1SMAA 4MPQA 3S6DA 2FFCA 2VOMA 4P8WA 4BQ2A 1J5TA 4NASA 2OZTA 2NVDA 1P0KA 1XCXA 3QOMA 4ZSUA 1UBSA 1IWAA 3UESA 1XPYA 5D32A 1K8ZA 2ONEA 1PX4A 2PDFA 2CZVA 4L64A 5HPCA 1RQBA 3CYVA 2WKJA 1HJXA 3L9CA 1YTEA 3LY0A 1H41A 1OX5A 1WAUA 2GSHA 3W1LA 2I17A 1UQYA 1JZ5A 3H4WA 1O5KA 3TDFA 1F9CA 2PUZA 1GJWA 4E6MA 2QR6A 1E70M 1V6VA 1K7FA 1XFCA 5C5YA 1LOLA 5J8LA 1CGWA 1CW2A 3W7PA 4QDWA 5E0CA 3RPDA 3WK0A 3MW7A 3YPIA 1D7KA 2Q01A 1DJNA 3VILA 4F40A 1H7XA 1MI3A 3CGTA 3VZZA 1K8YA 1Q6CA 2NQ5A 3HPXA 1JXKA 1XGDA 1LUCA 1LL7A 3ABRA 5GPRA 3SQLA 1XJBA 2DSUA 3SUSA 3O63A 4MUPA 4NZ4A 4NI8A 2WCGA 1V4YA 3MB9A 3Q58A 2XG9A 3OZOA 3C0SA 2F6XA 1XI3A 1EJUC 2VD9A 5I2UA 1ICSA 1J96A 1PKLA 5HWNA 5FF3A 4LAOA 3SDOA 3GYEA 1JUBA 1NJJA 2FH8A 3APGA 2QT3A 2C3ZA 2QIIA 2E6YA 2PDKA 2WJEA 1B3XA 5D02A 1VFFA 3QLLA 4DO6A 4QEHA 2ZA1A 1BYCA 1WBJA 3UJEA 4A8LA 4TX6A 1OX4A 3SI9A 4I8DA 4UWMA 2A85A 1TZ9A 3LHUA 2DZSA 5CZSA 3WD2A 2QQ6A 4N4PA 1TTPA 4PUUA 1S5NA 1U1JA 6XIMA 2I14A 4YCOA 4IP5A 3K13A 1JNDA 3M9YA 3A4AA 4W7WA 5I07A 5E70A 1V0LA 2PDHA 3RO6A 3B9EA 2OCZA 1EQCA 4U10A 1S2CA 1UIPA 3MP4A 4DBSA 3DHDA 3HV8A 1Y7VA 2VHLA 3FW6A 5AC6A 3V1HA 3MWAA 3N4EA 1U30A 5JU6A 5DMYA 3GDBA 5KZ6A 1KFEA 3GVVA 2G0WA 2V2HA 1XISA 1P0EA 4TR9A 4PCNA 2G5WA 3QGAC 1A80A 1XQKA 1L2UA 3NO5A 1F6PA 1O94A 3M16A 4Z2IA 2QVNA 2RJGA 3UERA 3M47A 3ZJKA 2PDCA 1EUAA 3NVTA 4DX3A 3TAKA 3LU2A 3E2VA 5CZKA 2OODA 4E4PA 3URAA 4Q8MA 2EPMX 2EGZA 1KTBA 5HNNA 5FA5A 5I5RA 3PUDA 4LF1A 5HDRA 1LBLA 3RX2A 4CGTA 3S5ZA 1Q45A 1XH0A 4MKSA 5HNUA 4A3YA 4RR4A 5BW6A 3QN3A 1S2TA 4XUGA 4LAMA 3AO0A 2YYTA 4MWAD 1AL8A 4OWGA 4AIEA 1MFUA 1C8QA 1G67A 5MKGB 3P81A 3I7SA 3KL5A 2WLZA 3LHWA 1IIHA 4IPIA 1NWRA 2Y4SA 3RYSA 3G0UA 3C8FA 2Z2UA 1V3IA 1ZL1A 5AC4A 2XGIA 1CGVA 1N82A 4W7UA 3EWZA 5D9OA 1Z32X 3B8IA 4EE9A 4FB7A 1EP2A 1BF2A 1ZENA 1OQFA 4JEJA 3GIYA 1CX9A 3GG0A 3PTMA 4ZA0A 3QYQA 4DYJA 1NELA 3UZYA 2A3EA 1TQJA 1FWRA 2Z1VA 2HS6A 4Z42C 1MDLA 1TCDA 2WZMA 3DFTA 3HM7A 3PVFA 3U7VA 4J3SA 1VYRA 4AIOA 2J7BA 4GQBA 3UA4A 2PCEA 3PZUA 3L7RA 1VF8A 4Y7EA 2WMGA 3NZQA 5REQA 1O5QA 2X41A 1ZFJA 3KHDA 3SO7A 3MBFA 2WVSA 3ZLFA 3NVDA 1BKSA 1OCBA 3CAQA 3MHFA 3UY8A 1VFOA 3IGUA 1SM9A 3LENA 4KWVA 3KLLA 1XG4A 1SZNA 4ROPA 1DKWA 2DT0A 3G1FA 3N6QA 2Z6JA 3BLKA 3UWZA 1EC9A 2YBTA 2VX6A 3NO3A 1PZ1A 4M5PA 4B9YA 2NWRA 1PX8A 1SW7A 1JD9A 1UD2A 3W70A 3TK7A 4I6VA 1YDYA 2Z26A 1XD0A 3THCA 3W07A 1FTXA 4XB3A 3PJTA 3V5CA 4EPKA 1J0HA 3GXNA 1QR7A 2YIHA 3KUMA 4NI3A 3NDZA 3QYSA 4U28A 3WZ0E 3WLSA 4H6RA 3FEMA 1OF6A 2D3NA 2ZICA 1EO7A 3UW6A 5M5DA 3FNDA 3AUJA 4O11A 2WSKA 4PEEA 2IXUA 3OA5A 3GW3A 2JIWA 2ISWA 4W7VA 2G3MA 4MDPA 3WH7A 1TIMA 4JTDA 4JKKA 1QNRA 2DJXA 3SGUA 1TSIA 1JPKA 4B4HA 4D9PA 1W54A 1RA0A 2VEKA 4GABA 4KEVA 5A8NA 3L4TA 2Z1KA 1E0WA 3HG5A 1JGMA 2ZWYA 5BU6A 2DJLA 4V2XA 4GGHA 1REQB 4I9TA 2P3EA 1AZ2A 3IUDA 3CT2A 4ZVJA 7TAAA 4XAZA 4HNVA 4J4KA 3GHSA 3MYPA 1FXQA 1EYEA 2VCCA 3TWBA 3M0MA 1UHVA 4FO4A 1ZAIA 3GYCA 4CCCA 3IGXA 1ZAJA 3V4BA 4AD3A 1FWIC 4JNYA 1UZHA 2FVKA 3WLNA 2Y2WA 4RNIA 2DSWA 1GEQA 4BKNA 6TAAA 5JUVA 2I1OA 1Q6DA 3HPFA 5C9WA 3O3RA 4GXPA 1VP5A 4H4IA 1DWAM 2V5JA 1AUSL 2RJHA 3CWNA 3SUTA 1SSGA 3GUGA 2PDPA 2ACSA 4IPLA 3MU7A 3OLEA 3TJXA 3SAZA 3S6OA 3FCPA 4LVFA 4B90A 5G4WA 1XLBA 4DZ5A 1XUUA 2NLYA 2A21A 2W27A 1FH8A 3ALFA 3KCLA 1VLWA 4S3EA 2Y5JA 4WSKA 5FAGA 1ME9A 4JKLA 4KWSA 4R27A 4IIDA 2PZ0A 3WH6A 3AXIA 1EJTC 1EX1A 2J25A 5K4XA 1M7PA 3S5NA 1HIZA 3GW0A 4RE3A 3CZGA 3QQ0A 1W9BM 3AS3A 4MVAA 4OIFA 4ZEPA 1KRMA 4HA1A 1FWDC 3CWHA 4MY9A 4JX4A 1UP3A 2BOFX 3Q45A 3AIEA 4C6MA 1ZJHA 3N11A 3ZM8A 1FDYA 4IMCA 3CZJA 3EDEA 2V5CA 1AFSA 5KETA 2B7OA 3P82A 2IPJA 3R6IA 1TVNA 1RD5A 2W9MA 3PBVA 2XSBA 1RCQA 2OGYA 1P0BA 2WAGA 2ZUWA 3BARA 1X1NA 2QJMA 3O6CA 2GJXA 1JVNA 4J3XA 1TYGA 1UR1A 3VIHA 2BODX 3K4DA 1KD0A 3PBGA 3KP0A 4WGXA 2PSNA 4XUYA 3PZIA 3W6YA 2OWXA 2ICSA 3H2NA 2CPUA 2YL8A 1UD5A 4F0LA 4R88A 3TSDA 5ABHA 4M8UA 2VJXA 4Z08A 3PAOA 4IHCA 5I09A 2IKIA 4L56A 4RV3A 3U2OA 5A8OA 3GDRA 4JN6A 4FZIA 3LS9A 3AALA 4NILA 3HQ1A 2P10A 3LX9A 2OSXA 3F4CA 2D2GA 5BMWA 2ISVA 4HHLA 3ARPA 3FHAA 2Y62A 3LI1A 4FR6A 4JDBA 4O14A 3G1YA 1AD1A 4DUXA 4CU7A 4KS0A 3B0YA 3UVAA 4WUIA 2YB1A 1K9TA 1VRXA 3L12A 1ENUA 4GHRA 2CXGA 3LSBA 4AF0A 1N55A 4O1EA 3DOPA 1UR0A 1EOKA 1V0MA 3QV8A 2GQ3A 4IFKA 4XAGA 1KFBA 2VXNA 3PBMA 4QISA 1EC8A 4LC6A 2OSYA 4GIRA 4YTRA 2ALDA 1P6WA 2CBIA 3R8GA 4OHQA 4E3TA 2FGLA 4AEOA 2OX1A 1DQXA 3TQ0A 2WQPA 3H4XA 4TQTA 2JALA 4DAFA 2OPJA 1W8SA 1L6FA 1DE5A 3VD7A 4D6HA 1L2QA 3A4JA 2PLKA 2TRSA 4Q4SA 3BAJA 4JX5A 2OELA 3UXIA 2J66A 1B2YA 1Q6FA 4UNLA 5FJRA 3TW6A 5D2XA 4UR7A 1S2VA 3RX4A 4FEZA 2DZBA 3VX1A 3BURA 3BW3A 2QAFA 5C2GA 3VKCA 4ZTYA 4KRZA 4NP7A 2WMIA 2A3LA 3KFTA 1T40A 5T26A 4X3ZA 1XV8A 4PSRA 3W01A 2WJDA 4GXWA 2HRWA 5I7GA 3TMLA 2WHJA 3XISA 4NIRA 2ZC1A 3WH8A 5JBFA 3GIPA 1XICA 5M2FX 1M1BA 3H22A 1XIMA 4ZO7A 1PSCA 4QDMA 4FXRA 3ERPA 4QSHA 4YPJA 3UG3A 3Q67A 1K9FA 3W7GA 1VKFA 3CXOA 3S46A 4KCTA 2WQDA 4IIEA 5F2MA 2ZXBA 3VNDA 4KF1A 5EU9A 2PAJA 1MEHA 4PB4A 3WLLA 1A0EA 1H49A 3WMCA 1VYPX 4HK7A 1W1PA 3ZVHB 2X30A 1LT8A 5B7YA 5H8MA 5D30A 4NZCA 4OVXA 2CU0A 3KWSA 3NL5A 1JDDA 4J7RA 4R7OA 1OIMA 4XISA 2GVYA 5F1VA 2PDQA 4TV6A 3EX3A 1W3TA 1RCOB 4NAFB 4O53A 3CK5A 3W82A 4HU8A 5E9XA 4K38A 4JD4A 1V5XA 4PFMA 2DZUA 2CCRA 3NZRA 1BTCA 2PTWA 2ESCA 5AYXA 1TPDA 4UTLA 4BEQA 1GVEA 1A50A 1SJAA 3OZYA 4GY1A 3WFLA 1YDOA 1D2KA 4A3QA 2Z27A 3L4XA 1ZUAX 3B4YA 4UQCA 1OD8A 3L0GA 2WKLA 4A2RA 3ARRA 4W8LA 4HB7A 3CYJA 4C6JA 2OX4A 5CZ0A 8RUCA 4DNMA 4YTSA 4WKFA 4HTBA 1WPCA 2X05A 3O06A 2XJ7A 1V02A 1BYAA 2ZX6A 1VCFA 3M0VA 1BSIA 2XINA 2FPVA 2PWFA 3KOXA 1CI1A 5EFDA 1L6GA 3TTSA 3KZPA 3EWDA 1YXCA 2E9LA 2OYKA 2TPSA 1K6WA 3PUOA 1XINA 3UYIA 4E38A 4BI6A 5I3FA 4AQLA 2QUTA 2PMQA 1FHDA 1LQAA 1Q65A 1UROA 5AHIA 1E9LA 2CYGA 2O7SA 1UC5A 2GDUA 3GTFA 3F5JA 4A35A 1BRLB 3G1XA 4Q4MA 1XKYA 5J5RA 1RPXA 3LD5A 3S5SA 1HKJA 4WDXA 3W72A 2ALRA 2A6NA 3FXGA 5DQPA 1KA9F 4G56A 1XIGA 3WNOA 3NQ8A 5DMMA 1QW8A 3ISIX 4BQ5A 2TAAA 6XIAA 4QIUA 4E2BA 4IQDA 3MO4A 1OABA 4W87A 1WBHA 3NCOA 5G4EA 1DIOA 1LLWA 1F3XA 3HGSA 4M56A 3Q65A 1UR4A 2VGGA 3UG4A 4PH6A 1XQLA 2PURA 3PWIA 2O56A 3THAA 3UWYA 4M1RA 3HZ3A 5HXMA 2R14A 4JTRA 3GHTA 3FDKA 3ZR6A 4WJ8A 4JYFA 2WK2A 3P61A 1VEMA 1J5SA 4DPQA 1Q6QA 4M6VA 2F38A 1M68A 2BNJA 2PWEA 4O13A 2VFEA 3CASA 1BAGA 3W76A 5AYIA 1CLVA 2UZ9A 1FWCC 3MYOA 1TV4A 3FIGA 4RW5A 3WLIA 2QJNA 4W8BA 3WUEA 1NOUA 1UZ1A 4ROQA 1FWHC 2F2KA 5DMLA 5AYYA 1ZP3A 1RBAA 1EWEA 3BZGA 3EA2A 3NQ6A 2CITA 2WVVA 2QCCA 1XD1A 3ARSA 3M5VA 5H6HA 3MUXA 4Q6XA 5CEWA 4ZR8A 5C0QA 5HATA 5DCEA 3VXGA 3RRXA 4LJ3A 5D37A 5DF0A 4M82A 2B7NA 1MRQA 2QPXA 1SU5A 2J6VA 5AC8A 4GFSA 5D8ZA 3WF3A 5A2BA 4LY4A 5BWFA 5FJTA 3M5XA 4W4QA 3TCSA 4MWAA 2JFEX 5CPNA 1B31A 4DZIA 4I7UA 2EEXA 3MO7A 3NQ2A 4G7EA 4JQ2A 2PDBA 4LOCA 1KXQA 4AEFA 6REQB 5FSEC 1F76A 3M0KA 3LTYA 4MSSA 2FZNA 3ATYA 5CZJA 3S5OA 5BCAA 4MJMA 1CTNA 5M1TA 4HVXA 3CT7A 2NT1A 1QHOA 4FMVA 2FTPA 4H00A 4UMBA 4E2DA 4D1JA 4A4AA 1SZRA 5DELA 3FX4A 3ZLGA 3ARYA 4ML4A 3KOYA 5AOUA 4P61A 1WKFA 2AL2A 3A22A 1TJRA 2I5QA 4TOQA 3N25A 3VUSA 4GQRA 3ABXA 2PLMA 3DEQA 4GISA 2Y8UA 4R34A 3ARQA 5DLCA 3AZTA 3AU6A 4GO9A 3VGBA 3O07A 2V38A 3BAYA 3EX4A 2PFHA 3AHXA 1VRDA 1V03A 5K3VA 4DNHA 6REQA 1JCXA 3BMXA 4H7ZA 1EHAA 1J6OA 1DJQA 3OIXA 3E0VA 1E43A 2X2GA 2AAMA 1IWPA 1AJ0A 3S2MA 5XIAA 4OV4A 3TQVA 1FCUA 3Q37A 2PDYA 4L6HA 1JPDX 1QK2A 1VC4A 2W79A 2VD8A 1MDRA 4LS0A 4FHAA 1CXFA 3AYTA 4DWSD 1Y5XA 5CZTA 2JIEA 2YA0A 4FNPA 4MNKA 1GJPA 3IACA 4UCGA 1VD6A 4CQ8A 3L5LA 1K9EA 1YNYA 3HQOA 1YMYA 1ECQA 3KBNA 3GH5A 3I7QA 4HYRA 1ZRQA 2B0MA 2ACQA 4MZ1A 2R91A 4DN1A 1UUMA 2VNCA 3JUGA 3BVJA 3ITOA 5I3DA 4C1NB 5L9FA 1ZY9A 4TIMA 4AISA 4ZODA 4QG8A 3WQ6A 2WJZA 2WHMA 1CGTA 4AB4A 4AH7A 4QP0A 3UR2A 5A6JA 2E28A 3N29A 3WDJA 2PP1A 1TJPA 4FSAA 3DBPA 4YXGA 4JFVA 2PP3A 3KRSA 5HJXA 5LXEA 3NQCA 3RDKA 2V3GA 4IG2B 1DEDA 4S1FA 5BXSA 4ZXOA 4I9AA 1XX1A 1U5HA 1T8XA 2VDGA 1HL9A 1UMYA 4IFKB 3W7EA 4L4OA 1W5NA 4HKPA 4Q3MA 1KNWA 4WEVX 3AICA 1E9IA 2OGJA 3S1GA 3NGJA 3TLLA 5ECVA 1B4KA 4EWND 4MWAE 1TFVA 2F7FA 1K1DA 1OYAA 3GXPA 4HZ6A 3TN6A 4DBUA 1DP0A 3MUIA 4XZHA 5A8GA 2W66A 3M4HA 1J10A 3CO4A 1NP2A 1EXBA 3K4WA 4RE0A 5CAHA 4OGZA 4XZBA 3VIMA 3MZNA 1FKWA 2E68A 1O5XA 1IF2A 2X40A 1SYTA 3WEZA 4WKHA 3KTXA 4WDWA 4WR3A 3TE9A 3HV9A 2XGBA 8A3HA 3F1QA 3GZAA 3GLCA 1WZAA 3PNUA 4GCAA 4L4MA 2A7RA 4TVUA 4GRSA 5IOBA 4OKDA 4AX6A 2ZX9A 4QQUA 2GJRA 2BLEA 2V2CA 2P5NA 2AOSA 3FJLA 2J78A 1UWAA 3FA4A 4XD6A 5CH9A 1FWFC 4JOMA 4U4MA 3TR2A 3W2MA 1W56A 1MEIA 4MJZA 2FJKA 4Y90A 1BGGA 3W53A 1ZJIA 2P8CA 2DDXA 4HYWA 5GJPA 2XVPA 3CQ0A 4JR5A 3SIZA 4YYFA 5CSRA 2VOTA 1UOKA 2V3DA 1TUXA 3FHQA 3QTGA 1Q4NX 3ONCA 4Y9NA 4NZ3A 3GK0A 1U33A 3PK7A 3EKGA 1DBTA 1L9WA 1KRBC 4DJFA 3K8LA 2CHOA 3C2YA 1LM1A 4O10A 2ZX8A 3TMQA 3URNA 3W73A 4AX7A 2DZAA 2WNZA 3LM3A 1GUVA 3KBWA 3E2QA 3NEHA 4J3ZA 4CNTA 4FX8A 3ZSTA 3R79A 3LBCA 2GQ8A 3LI0A 4UTHA 2VFHA 4CKQA 3M46A 1THFD 3BW2A 1J6PA 3AYVA 1TV7A 4GVGA 4C7GA 2FFIA 1DJHA 2BSLA 2UY2A 4GC3A 4KFOA 1Q63A 1BFNA 2DQWA 3TCEA 2W63A 1YX1A 2EBNA 4L9XA 3TXVA 2HXTA 2FHCA 3TC3A 2FVLA 1DQWA 2P3ZA 3W2UA 4M81A 5RUBA 1J4EA 3GC4A 4J5NA 2CLFA 2HMCA 3S2LA 1UG6A 2XTKA 1WA3A 2ZZ6A 5A2CA 1S5MA 5BXRA 1RD6A 1BYDA</