2TRSA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
262
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 93
structure length 262
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2trsA00
1XBVA 1C29A 4ZZ9A 3VE9A 1YPFA 3NQDA 2WNNA 4OQVA 3W72A 2ZQ0A 1EUAA 1TPDA 3PS7A 3OVPA 1WOBA 3NL5A 3LTPA 5F2IA 1W54A 2TSYA 4O50A 1SZGA 1P0KA 1LLWA 3N14A 2CLHA 4FF7A 4WY0F 4JTUA 3B04A 2ZZ4A 1FCQA 3DFOA 1JRCA 5BW6A 3G0XA 4GWEA 2A4AA 2UV8G 4AHQA 3I7QA 3NL3A 1WOAA 2H8ZA 3N9SA 5K3VA 4MOZA 1C9DA 3W7KA 3G22A 1TPB1 3PG8A 5AHEA 3CLMA 2ZZ1A 4ZQNA 3MHGA 5DBTA 4N4PA 3H53A 3ZWTA 4D2JA 1IXPA 1RR2A 3THQA 2V0TA 2WKJA 2WNQA 3HF3A 4C1KA 4HNVA 4RX0A 3UZ5A 1B4EA 1TO3A 3CM4A 3TMLA 4PH6A 3PB2A 4IUOA 1VR6A 3OIXA 1EP3A 2YW3A 3GNNA 1WA3A 1UCWA 4OE7A 2ZA1A 1NF7A 5FEPA 4JIQA 2A7RA 1JR1A 1IXQA 1W31A 3MI6A 1PCWA 2CLKA 3EB2A 1G4SA 2V30A 1F73A 1OYCA 1VZWA 3R89A 2ZRYA 1AK5A 1UUMA 3QC3A 4NQ1A 4PCFA 3WK3A 3L2IA 1LDCA 3DHFA 1D3GA 4JTSA 3NEVA 1H7RA 1ME8A 3LTSA 4KFOA 1SW0A 2CZDA 3S5YA 3T78A 3L9CA 3G0UA 3LRKA 1WX0A 1DHPA 1TPEA 2Z6IA 1VRDA 4GRSA 1PE1A 5A8GA 1KTBA 1TRDA 1O5KA 1OX4A 3NM3A 1EPXA 5D04C 3M5ZA 1J4EA 3L0NA 1GEQA 4K38A 3HMJG 2VFGA 3GVGA 4LC8A 3LDVA 3W84A 1FCBA 3W2KA 2ISSA 3P81A 3VFLA 4R33A 3QMTA 3RU6A 3W7NA 3WK0A 4LRSA 3PG9A 4AHOA 3M7WA 4WQ6A 4FIQA 4QQ3A 4PL2A 5FF7A 1AW5A 3F4NA 4K6AA 1P4CA 5KZEA 3LRLA 2NWRA 1O60A 4DBEA 4EIVA 3CEUA 1DJQA 3MMTA 3R12A 5F1UA 3C4UA 1YDVA 4HNUA 3TC6A 3TQ0A 1SU5A 1FDYA 1PVNA 4NJKA 1KTNA 3KRZA 3CU2A 5DXXA 3V1PA 1EEPA 4AEOA 3TU9A 4UFMA 3O1NA 2YDAA 2PRHA 3I65A 4WZHA 3BGJA 1ICPA 1ZCOA 1VH7A 3NQGA 1SQ7A 4UTIA 3PUEA 4UFIA 5D02A 1T8XA 4OV9A 4JIPA 8TIMA 5HWNA 1LRNA 4DQWA 3E12A 2E5BA 4LOCA 3P5ZA 4LS1A 2Z0IA 4BWLC 5I3IA 3HB9A 4XKYB 1H62A 3C52A 5FF4A 1KA9F 4NXKA 4FEZA 1SZFA 4WXZA 1B3OA 5CSRA 1JULA 5I3KA 1R2RA 4DO4A 3OVRA 3NVTA 4OGZA 1YDNA 2GQAA 4MZ1A 5KINA 3PF3A 4R7JA 4UMBA 3EX3A 3GKFA 1OFBA 3IIOA 3M5YA 3FLUA 3P80A 5HR7A 4QJ1A 4LV9A 3TW6A 3B03A 4EWND 2C15A 2O7QA 2JKAA 2G5WA 1YADA 3IGUA 2J27A 3M41A 3B4UA 5D09A 4WOZA 1TREA 4ZQRA 1X8FA 2V2CA 3T40A 4X9SA 5DCEA 2OT0A 1OX6A 2WO5A 5HULA 3OG3A 3BG5A 1W5OA 3M44A 3INPA 5F4WA 3GX9A 3W2JA 3G3MA 3BGGA 4MYXA 3O05A 2W0UA 4N9BA 4AHPA 4HSNA 4IWWA 3W7HA 3S1XA 1KM5A 3NQ2A 3ZS4A 4AXKA 2J6XA 4CNNA 1DKWA 1FWSA 3W7OA 5T26A 1PHWA 2RDTA 4CCCA 2ISVA 5K2ZA 2H3BA 2YCEA 4X3ZA 3W75A 3MBDA 3QZEA 2NXGA 3T4CA 1OHLA 4CCDA 1HL2A 4O0ZA 3HPXA 1VHCA 2WV8A 3B06A 3W22A 3LLFA 3VNDA 3KXQA 2C6QA 4RXGA 1A53A 5G5IA 5FEZA 1H51A 3LBMA 3PBWA 1FY6A 1HFBA 1ML1A 2A5HA 1FQ0A 4E2BA 3NOEA 3G1AA 3W7RA 4N9CA 4Q32A 1LRTA 3UY8A 3PC0A 3B0UX 1TQXA 3NL6A 1KFKA 1UJPA 1FDJA 5BNKA 1SW3A 3FJLA 2B4GA 3G1VA 5J5DA 4UMAA 1H61A 3FIGA 3L0KA 1YYAA 1RV8A 4XUGA 4NJJA 1GTHA 4UR8A 3G0SA 3BLIA 4NJIA 4R53A 2C14A 5AHFA 1VYPX 4YLWA 3FYOA 4LUIA 3W2NA 4ADSA 4O54A 4LC6A 5D33A 3CHVA 4JYDA 2FQIA 1DVJA 1PL9A 5BMXA 4BI7A 4TR9A 3GLCA 2ZTJA 1XDMA 3PM6A 3BARA 2QCCA 1S3HA 2FPYA 3NDOA 3C3NA 4FNTA 3WJWA 1EWDA 4O53A 3FS2A 3A21A 2CWNA 3U2OA 5IM51 1KM1A 1VQTA 4O10A 2I1OA 2RDUA 4X22A 2F84A 3MO7A 4HPXA 1SO5A 3MYPA 2HS6A 4JX4A 4DO6A 2A2IA 3M6YA 4C1LA 2X1UA 3LX9A 2E5DA 1OABA 4LVFA 4O12A 3PAJA 3WFAA 2A6LA 1VYRA 2JGYA 4MKNA 5IBXC 1KFLA 1ZFJA 2NX9A 2B7NA 3I68A 5HJLA 3QQ0A 1VC4A 1G7VA 3O15A 3A9IA 3W1RA 2OX1A 1HO4A 2AQWA 1SFJA 1YPIA 2ZZ5A 4IMDA 5F4SA 1P5BA 5G4WA 3W1XA 4N02A 4UCGA 4H6KA 3MI3A 2EKCA 2G96A 3GDMA 4S2BA 3NQ6A 2A21A 2VFHA 2DZSA 1I2QA 2QUVA 3GR7A 4ZVJA 3FOKA 5FI8A 1CI1A 1M7PA 2QJHA 3NXFA 3KVMA 1OF8A 3ATZA 4M5PA 1VGAA 3S5NA 3MP3A 4ML9A 1GJPA 4CNPA 5HR6A 1M7OA 5EYWA 3UQNA 4I7WA 3MP4A 1LROA 1VCGA 2XN1A 4LVAA 4ZQCA 3BPWA 3NQMA 3KX6A 3S1UA 1YLVA 2Z1BA 1TMHA 3TA6A 4ADUA 3P7YA 2LLEA 3E0IA 1B57A 1I4NA 2D73A 5A5WA 1VPXA 3A24A 4IXHA 2WJZA 3IRDA 5FEWA 3W1TA 3ABOA 1G6CA 3W1QA 2GQ8A 4Z1BA 2BSLA 3C8FA 3OVQA 2Y7FA 2ABAA 2VXNA 3EX2A 2YFOA 5CZJA 5D05A 4JR5A 1N8FA 1C8VA 3W1PA 4X2RA 3VE7A 2Y88A 3GIYA 4IXXA 2GPTA 2OMAA 1TIMA 1W5MA 1F2JA 3NM1A 1EP2A 1GOXA 1SSDA 3TK7A 2TMDA 2BZNA 2ZRXA 4GUHA 1N55A 3P62A 4YL2A 3W2MA 4N4QA 1K02A 3L5AA 3S0CA 5TQLA 3W7GA 5CPOA 4AF0A 5DY2A 3NPXA 1MO0A 4HHPA 1FXPA 3P60A 5KITA 4QNWA 1SSGA 4UTMA 4A29A 3CC1A 1ME7A 1TV5A 3UWVA 4QIUA 5D2XA 1RQHA 3PULA 3HOJA 4KFNA 1KLZA 2VFEA 2W6RA 2CLIA 3DFNA 3O16A 3EKLA 3SGZA 3C2VA 1F05A 3HQ1A 3IVTA 3LB0A 2R8WA 1LM1A 1DOSA 4XBKA 4EF9A 4UTKA 4N2YA 1QR7A 4UIOA 3M0ZA 3NO5A 4UNLA 4IJBA 4LVBA 2JBMA 4KFPA 4FX6M 4FX8A 1Y0EA 1JCYA 3PBUA 1QOPA 3TKFA 1I45A 2XN0A 4DPQA 3BW3A 2YSWA 2H8XA 1JCJA 3TR2A 4G1KA 4CQ9A 4L4MA 5SWUA 1MZHA 3NNTA 4XKYA 2B0MA 3AO0A 1ZAHA 4RK8A 3SW6A 4TMBA 4OWGA 3WJXA 1EUNA 1DBTA 1WXJA 1IXNA 4YMZA 3DBPA 3GNDA 5HWJA 3W6YA 5AHIA 3JS3A 1T96A 2OCZA 2X1SA 3D0CA 4MJMA 1GWJA 1TRIA 1I2PA 1D3HA 2Z2UA 3NG3A 3CIWA 2C16A 4O4VA 4JN6A 2ZTKA 2CLLA 1FUYA 5CZTA 1GG0A 1LOQA 4MY1A 3LTYA 2YR1A 4O14A 2A1YA 3TX9A 4BFAA 1PCKA 1SZNA 4NUWA 4K7VA 3I7RA 3O6CA 2DORA 3GKAA 2ZDRA 2QCFA 4W9TA 1YXDA 4UFHA 4BK9A 4FXSA 3SGUA 1WV2A 3WK2A 3CTLA 3NAVA 1EIXA 1GYLA 1P1XA 2FJKA 3A5VA 1OFOA 1SR9A 4O18A 3LXBA 4OU1A 3G1YA 1SPQA 1NAL1 4UTWA 1VLIA 3GXTA 4B5NA 2KZHA 3IGSA 3HG2A 1N7KA 3L0GA 4GUFA 2NUWA 5KMYA 5D32A 1HTIA 4IMCA 2CW6A 1AW1A 4LV4A 2NV2A 1FWRA 5F2GA 1JUKA 5G2WA 4UTJA 4OV4A 2Y7EA 3GZ3A 2E6YA 5KSWA 1FCUA 4RXFA 3LERA 1KFEA 1W5NA 3W1UA 2Y7GA 3TFXA 5TIMA 5E1QA 4L4LA 2C0AA 2R14A 4LVDA 4O1AA 3QW3A 1LOLA 2WPBA 1TPH1 4IOTA 4NU7A 3SECA 3LCGA 4QISA 3M16A 1Z42A 2VC6A 4DF2A 5LNUA 3EWXA 3UZJA 1Q6RA 3L21A 4P61A 4M19A 1OFPA 2HMCA 4E0CA 1QCWA 2FDSA 1Z44A 4CNOA 4ORMA 3MP5A 4FXRA 4H4IA 5AHMA 4AWUA 3CB8A 4YWIA 2BTMA 3QMSA 1PIIA 3TH6A 2RHGA 2E09A 1KBIA 3NQAA 2ZA3A 4LU0A 1VCFA 1ZY9A 3BLEA 1XKYA 1XXXA 3CQ0A 1QNVA 1QOQA 4AB4A 5KZMA 2VEKA 3O6DA 1L6SA 3W7QA 2BWGA 2ABBA 4HNNA 4JY9A 4AH7A 2QUUA 5AC7A 3UWWA 6TIMA 4YCOA 2ZZ6A 3QEZA 5C2XA 2GVLA 3S9YA 1ZAJA 3TJXA 3TAOA 4IMFA 5G4EA 4E38A 4O52A 5AYYA 4GXMA 3L67A 3M43A 3W74A 5E93A 5D2TA 5FESA 3N3MA 3CPRA 3KHJA 1YTDA 3WJSA 3ABSA 3P61A 3LHVA 3W86A 3UXAA 3EWZA 3C56A 1NFBA 3TMQA 2FLIA 1GVQA 3DI1A 3G1SA 4TIMA 1F74A 1W0MA 1AG1O 4MPQA 3P82A 4HPJA 1L6YA 4UUIA 3RLVA 2QDHA 4PA8A 1UUOA 2P10A 5EMUA 4RZ4A 1ZALA 2BX7A 4UMCA 4HT3A 1YDOA 4K39A 1JCNA 1WAUA 3EWUA 5CKSA 4XZ9A 4S1FA 4RJEA 4UC5A 1F6PA 5TBOA 2VFDA 3FJ6A 3AJXA 3K30A 3TCEA 5EKYA 3QYQA 4EOUA 1YTEA 2VFFA 1BTMA 4TX9A 2TYSA 1LOSA 3QF0A 4MIMA 1KV8A 2GQ9A 1TTPA 1O4UA 3HPSA 3LCFA 5AHLA 2OZ0A 4MZ8A 1TTIA 3HG4A 4UTTC 2O7SA 1BKSA 1OJXA 4YXGA 3HGOA 1KBJA 2H90A 2B7QA 3W88A 4MY8A 1I2RA 5D38A 2J88A 5HWMA 4IPJA 3M47A 4O17A 3L68A 2VFIA 3I7SA 5DCDA 4IPIA 1LTDA 4RCXA 1S5VA 3DKJA 2A7PA 1DORA 2QAFA 2DJXA 3W2LA 2JKPA 1WDWA 3LHUA 3EXSA 5DBUA 3P74A 1SO3A 3DXIA 3ABRA 3LXCA 4FHAA 4FNPA 2W79A 4NZJA 5D2WA 2E5CA 3NQ8A 1B4KA 1RD5A 4JX6A 4GFSA 3UD6A 3H55A 3KVLA 1TTJA 4TO8A 1BWKA 2QAPA 3T7VA 2EGZA 4N9EA 3QJAA 3HG5A 4FNUA 3NQVA 1DL3A 4A2RA 1JCXA 4DBDA 4PEKA 3QRHA 3OHIA 4ONVA 1EB3A 4RV8A 5ABTA 4PC8A 3SY5A 3W71A 3W7CA 1G67A 2Y63A 4BWLA 1TPWA 4O4WA 5EA9A 3B0PA 1A5AA 2DZXA 4JTKA 4FB7A 1W8SA 5G2IA 3W1NA 5AHNA 4DXVA 1XM3A 4O1DA 2YXGA 1IF2A 4NT0A 3JRKA 3SR7A 4LW7A 1AL7A 3OEXA 3HG3A 4I7VA 2V2HA 3CEPA 1V7YA 2ATMA 4O16A 2OT1A 4FNRA 2V82A 4ZQOA 3LV5A 2QCDB 4WY0B 3LLDA 2VENA 3E96A 3W83A 5LNVA 3DFQA 4MYAA 4JTFA 4MZYA 3EEGA 5DY3A 3LV6A 5K4ZA 3SI9A 4O28A 2DZPA 3LHTA 2ZRWA 1H63A 3HIJA 1R2TA 2WQPA 5C55A 5HMSA 4PL1A 3E02A 2YFNA 2PE4A 3BVJA 3EX1A 4Z08A 5D37A 3IIZA 5DXYA 4JD4A 1SO4A 2FPTA 4K7YA 1BEUA 3N34A 3STFA 3E49A 2QCLA 4O0KA 3W9ZA 4LNYA 3QPZA 1VCVA 1Q45A 3KFTA 4EVZA 1W3NA 4GBUA 4LVGA 3ZWSA 2I9EA 1H7NA 3GDTA 3S6DA 4R34A 1SW7A 1K8XA 2QR6A 3DHDA 4K8HA 4Q4KA 1QPOA 4UFLA 4HSOA 1H5YA 1ALDA 3MI2A 1GTEA 3A22A 3NR0A 5HUPA 1B9BA 3CWNA 1OYAA 5LGZA 3OA3A 3W73A 3V75A 3TQVA 1KM0A 3SFKA 3M9YA 3PBYA 5CZSA 1XDLA 3U6WA 3QSRA 3QPYA 3KVJA 3R8RA 1L9WA 3ZR4A 1EX5A 4WOQA 1ZHAA 4FIRA 4LWWA 3UY7A 3PSWA 3NPVA 3M1ZA 1LLZA 3NZ1A 4NJHA 3QM3A 3RMJA 3HO8A 4N9DA 4NJGA 3CT7A 1TPUA 4RZ6A 4IX2A 5AN7A 2YGYA 3O6YX 1KFCA 1TB3A 2Q3OA 4RR4A 5K9DA 1FX6A 4JXCA 1ONRA 4JS3A 4JDYA 3RK8A 4DO5A 4BI6A 5DELA 2FFCA 3GB6A 4ZMGA 3CWOX 1TJRA 1UBSA 3EXRA 1XBXA 2C19A 3NZRA 2EPHA 2R94A 2Y85A 3RLUA 1F7BA 2NV1A 4JYFA 5FF2A 1JCLA 1Q6LA 3QMRA 3NQEA 3UWZA 1R47A 3SSJA 1ADOA 2AAMA 3EX4A 3USBA 5HINA 3F03K 3PVFA 1QAPA 2PRLA 2VELA 5EL1A 3S42A 3VCRA 3L5MA 3LXAA 3CIXA 5I3HA 1L6WA 1X6UA 3DFTA 2DZWA 5D30A 4Z0SA 2QJIA 4LUJA 2B7OA 3IEBA 5H2ZA 3P8JA 1KV5A 2VEIA 2CZFA 2GVGA 2X30A 5K9XA 3MWAA 3LCXA 2RFGA 3PUDA 1F76A 3QFEA 4Z1DA 1KM3A 2ALDA 1FWWA 1K7FA 1L2UA 3W7LA 4A2SA 5L6UA 1LCOA 3THAA 1LBMA 3DKLA 5I3GA 1H7OA 5EBUA 5G1TA 2YW4A 2RKXA 1JVNA 3GAYA 4NNCA 3M5VA 3W85A 2EAWA 4GUJA 4CLMA 4QAIA 1G4PA 1A5BA 4IGHA 1Q6QA 1H7WA 2IQTA 3WJZA 4HNTA 4MLRA 4TMCA 2JKEA 2NX1A 4OT7A 5AOUA 5IBXA 2HSAA 3BV4A 1M5WA 1YTKA 3W7EA 1JUEA 4O19A 4QITA 1KW1A 4AMAA 5AC6A 2NWSA 2E6DA 1OF6A 1VS1A 5HNRA 4GNJA 2CFFA 1LP6A 2WSYA 1OX5A 2Y62A 5DLCA 4OBTA 2PCQA 5CPMA 4O11A 3N19B 2CLEA 3F1QA 2B7PA 2H3DA 3TW7A 2CZEA 1TPC1 1NSJA 2QCNA 1TJPA 2ZZ7A 1GVOA 2CZ5A 1QWGA 1XBYA 1AL8A 2ZA2A 3IIVA 4UXDA 5AYZA 3GDRA 4JTEA 1LORA 2CLOA 4N6FA 1X1ZA 5C5YA 1O95A 3DGRA 1KTCA 4FX7A 4FNQA 3W87A 3A23A 4UFKA 1TCDA 1JQVA 3Q37A 4XTIA 4JICA 2J9ZA 3IIXA 1VJIA 2ATSA 3NYZA 1IIGA 3SJ3A 1K3UA 4NNBA 1Q3NA 3S5OA 4CCEA 2BLEA 4U4MA 4MFDA 4NX0A 1G4EA 2CU0A 2Z6JA 5F1VA 2QJGA 3DZ1A 3H54A 4GUIA 5BMWA 1OFQA 3EKZA 1S5WA 4MFEA 3T44A 1XUZA 5I3JA 1FWTA 1V5XA 5CPLA 5U4NA 3SIZA 3UWYA 3IVSA 4NVTA 1R30A 5K7JA 1JCMP 1XFBA 4KKXA 4Z0JA 2QEZA 1PS9A 3JR2A 1T99A 1W3TA 7TIMA 2BXVA 3PY2A 1PHQA 4HN4A 3LI0A 3TQKA 3EWWA 3MBFA 2WOQA 1GQNA 3DENA 3ABQA 4WJEA 1RVGA 2PC4A 1YXYA 3Q2DA 1X7FA 3EXTA 4RZ5A 1O94A 2Q8LA 3KOFA 4JGDA 2V9DA 3PUOA 1KFBA 2FTPA 1IIHA 2CLFA 2V5BA 4S2CA 2ZRZA 2JK2A 3TXZA 2AGKA 1J2WA 1RZMA 2J9YA 5K9CA 3TIMA 5LHEA 3W7DA 1WQ5A 3DFPA 3FKKA 3L66A 1G7UA 3A5FA 4ZQPA 2Y7DA 5FF0A 1W5PA 2CLMA 1OK6A 3BLFA 5C54A 1J5TA 1MEHA 3LGEA 5CPNA 1Z48A 2ZZ3A 3PWAA 1LRQA 2C1HA 1X1OA 3ZFHA 2YYTA 3UWUA 4O1CA 2V81A 3N73A 3LHZA 1TV7A 2J24A 1QPQA 3BK0A 3IV3A 3UWQA 2DJLA 1F5ZA 1MXSA 1TPFA 4M7TA 3P67A 3M5XA 1IXOA 4WD0A 1OVDA 1KM2A 4AWSA 1PV8A 4OHQA 3W7IA 3BO9A 5D2VA 4POCA 4Y6GA 3O06A 2F7FA 1JQXA 3E9AA 1RPXA 3QQ1A 1W1ZA 4AF0B 2GVJA 1QPRA 2NZLA 1OFRA 3PR2A 3C2OA 2ZCGA 4JTLA 2QCDA 4WY0A 4ADTA 1GVRA 5H91A 3DH7A 4K8EA 1XBZA 3NA8A 3S5ZA 2XFWA 1G4TA 3RNDA 2NLIA 3HJZA 2GJLA 1TV8A 2Y89A 4MLJA 3DAQA 5AFDA 2NXHA 3I6RA 4JTGA 5F2LA 1VYSX 4UTUA 3QSTA 3PBVA 1DQWA 2R91A 3R2GA 4AWTA 5LGXA 1TYGA 3C61A 3EWBX 1TPVA 4HKPA 1QFEA 3LRMA 1OFAA 2G97A 1A50A 2QCEA 5DCBA 2C13A 1QDSA 3HGJA 1LBLA 2P1FA 3KRSA 3FKRA 4CQ8A 4M6VA 1FWNA 1ICQA 4DELA 3NPWA 3IGXA 3VI2A 1H1YA 4CQAA 4JTTA 1WBHA 3QH2A 1W56A 4JEQA 3C2FA 1MEWA 2RH9A 2E77A 3LM7A 4O1BA 3MYOA 4LS0A 4JTJA 1W37A 5DN1A 1OYBA 1H50A 1K03A 2PURA 1FBAA 1SUXA 3N9RA 1A5CA 4EF8A 5G1YA 3W2UA 1MSSA 1VHNA 1HO1A 3Q94A 4JTHA 4WUIA 2ZRUA 2H6RA 2ZFAA 4UFJA 3W1MA 3W7MA 1H1ZA 2EHHA 1A5SA 3UPWA 5BOOA 4FNSA 5EY5A 3STCA 4GE8A 4NX5A 2NUYA 4M7SA 1UB3A 3C2EA 3O63A 2E68A 4XWUA 3UPBA 1Q6OA 3LHWA 5FEXA 4JY8A 3RFAA 3BG9A 2A0NA 2JGQA 1SFLA 3BG3A 2A85A 1R2SA 2DZTA 1GT8A 3C0JA 1JUBA 3GXNA 4UTHA 1ZJIA 1EWEA 5GVJA 3FA5A 1F6KA 4GUGA 2A6NA 1LYXA 2P0OA 3FEMA 2NX3A 3NQFA 3GR8A 3HPZA 3UYCA 3NGJA 4AVFA 3L5LA 3LHYA 3TE9A 3ELFA 5MHBA 1LBFA 4I9AA 4H3DA 2X2GA 4O8RA 4GC4A 3DU0A 5CGQA 1NF0A 2DZUA 3LCLA 1U83A 4WXYA 2V8ZA 3RF9A 3G8EA 1K7XA 2A7NA 3OBKA 3TSMA 3TC7A 4LTSA 3VKJA 3P84A 1AW2A 4DF1A 3LI1A 4J9JA 3W07A 3FFSA 1H7PA 4WX2A 4JNMA 2VEPA 4KWVA 3TSDA 2V5LA 4JDBA 4QSHA 1UASA 3LCWA 5CZ0A 3C2RA 4Z1CA 1GG1A 4QNEA 5HUOA 1U5JA 2FIQA 2GOUA 5LNSA 4M6QA 2WSQA 4XQ6A 5L9FA 1D9EA 4NXSA 3BW2A 4QM1A 1QMLA 2NXIA 2QUTA 5EPDA 3STEA 3W1AA 4A21A 4U28A 3W7JA 1OX4B 2HS8A 1H7XA 5CG7A 1XCFA 1ME9A 3MJYA 1KLYA 2GUUA 3NL2A 3MW7A 2Y61A 4LS2A 1TQJA 3G8RA 1EP1A 1ZENA 3EWYA 1SO6A 3GDLA 1XC4A 3B05A 3FYPA 1W5QA 4BI5A 3GK0A 1P0NA 1GVFA 1QPNA 4ZQMA 3F4WA 4E2DA 1JRBA 1TTQA 3G3DA 4ORIA 5LNWA 3R13A 1ZNNA 2YZRA 4N6EA 3W1LA 1XI3A 2I14A 1FDZA 5HQEA 2X1TA 4ALDA 4YCPA 3LOTA 3MHUA 3ANYA 2ZYFA 1Z41A 4RLIA 5J5RA 4FO4A 4XTDA 3SZ8A 2RDWA 2G95A 3TROA 2Q8ZA 3G1DA 1K7EA 5G2HA 3GYEA 3GXPA 5F4XA 2FB3A 4BF9A 1XL9A 1KM4A 2QKFA 2E1DA 4IX0A 1TSIA 4ICNA 5LHFA 3B8DA 1OG0A 2Q3RA 1CX9A 3STGA 1QO5A 1SZEA 2PRMA 3IVUA 4UTTA 4LY8A 2ISWA 4DF0A 3KAOA 1O5XA 1RQEA 1K8YA 4Y8FA 3S1VA 4UTLA 1IGSA 3B0VC 3TAKA 4DEFA 4LRTA 4Z1AA 5KZDA 3PB0A 2OJPA 4MUZA 3T55A 1KFJA 4K37A 3HGSA 5FF3A 3MHFA 3BW4A 1H60A 1R46A 1GPWA 1XUUA 3W23A 2QCGA 4UNKA 3TV8A 1K8ZA 2NUXA 4KWWA 5KTLA 4LT9A 4JX5A 2YPIA 1CW2A 1LZOA 5D03A 5F2MA 5C6MA 2DU2A 2ZZ2A 3S8HA 4PFMA 3LCHA 4Y96A 3NQCA 3YPIA 1S5TA 3G1XA 4P2VA 3U8GA 3UXDA 1DV7A 3GAKA 1E51A 3C6CA 2QCHA 5D2YA 3KRUA 5AC8A 4IMGA 5I3FA 3TUUA 2DZVA 4TU1A 2J9XA 4O15A 2QCMA 1OFDA 2WNZA 1MEIA 2XN2A 2YX0A 1ZAIA 4O13A 3KVKA 4O57A 4A22A 1OK4A 2E6AA 1VLWA 1KM6A 2DP3A 4UR7A 1GYNA 1HG3A 3WJYA 4BR1A 5CSSA 3DFSA 4GJ1A 1I2NA 4XBSA 3DI0A 3GDKA 3LCIA 1HUVA 4MVAA 3UNDA 1WYIA 3ATYA 3Q58A 1BWLA 3N2XA 1M6JA 3TSBA 1QO2A 3WK1A 2VEMA 3G24A 3G1HA 4M6PA 2VKZG 3P8IA 3TFCA 3G1FA 3PSVA 3TJLA 3HGRA 5LZLA 5BRBA 1GVSA 5AB3A 4JTIA 4AAJA 4HIBA 4Q33A 5AYXA 4JYEA 1GZGA 6ALDA 4NZFA 2TRSA 2HTMA 2FB2A 3O07A 2FPVA 4IMEA 3G18A 3S1WA 3HBLA 3NQ7A 2QF7A 4A3UA 2C18A 3EX6A 3W7PA 4K36A 1WBJA 3O8AA 3TDFA 3QW4B 4RKAA 1RQBA 3W76A 1THFD 1JJKA 1NEYA 3IIPA 3MUXA 3N2MA 4Y90A 4UTWC 5LNRA 2YYUA 1ICSA 2Y70A 2C3ZA 4I7UA 3LBCA 1OFEA 4MJZA 4ZL1A 1T0OA 3NPUA 5U7SA 4DPPA 2VOMA 1AMKA 3TXVA 4PODA 2TPSA 2V2DA 1DJNA 1FCVA 1YXCA 3TNOA 3P5YA 3R5EA 1FXQA 4IQLA 2E6FA 2X16A 2ZRVA 2EF9A 1W3IA 3W3OA 4MY9A 1DQXA 1NVMA 4Y9AA 2GJNA 2Y6ZA 5LSMA 3W70A 5K4XA 2ZBTA 1EA0A 2QDGA 1I2OA 3L65A 5LKYA 5E0KA 1G69A 4PTNA 4NNAA 2WSRA 1I8JA 2X1RA
chains in the Genus database with same CATH superfamily
1XBVA 1KKOA 3TYCA 3ZVIA 4ZZ9A 4TX8A 3E2VA 3VE9A 3N11A 3NQDA 3BLPX 4TX6A 1G1YA 3MMDA 4MNKA 1E4IA 5IHRA 3W72A 4W93A 3PS7A 4BY3A 1WOBA 3NL5A 3FJ4A 4O50A 2JEPA 1SZGA 7TAAA 4F9JA 3CUGA 1FCQA 2NQZA 1JRCA 4BQ4A 1UWIA 4GWEA 4ZOBA 3I7QA 3JZUA 4F0LA 3CZ8A 1WPCA 4MOZA 3W7KA 4FPSA 3CLMA 3NDYA 3COTA 3MHGA 4NYYA 1P43A 4N4PA 1A3HA 3H53A 1IXPA 1XIEA 2J6VA 3THQA 1BVZA 4D72A 2V0TA 2WNQA 3VZYA 3HF3A 4C1KA 3OB8A 1FKWA 1VEPA 3N25A 5M03A 3TMLA 3PB2A 3IWPA 2WKLA 3RMEA 2YW3A 1WA3A 1JDCA 5F7UA 2ZA1A 1A5OC 1IXQA 3MI6A 3LN3A 1PCWA 4HU3A 2CLKA 3EB2A 3APYA 2WNWA 2GSHA 4Z1YA 1A5KC 1VZWA 4UBPC 1OG6A 3U7VA 1UUMA 3QC3A 1GOQA 2OZ3A 5CH9A 1XW8A 1LDCA 3DHFA 4JTSA 2YCIX 1H7RA 3ARRA 1DWJM 4KFOA 2ACSA 2YA0A 1CZ1A 1JPDX 4H8UA 1F3TA 3GNXA 3E3HA 3G0UA 5C2CA 3LRKA 3GY1A 3KTXA 1J0IA 3QGVA 4UCFA 1TWIA 2R1PA 2OELA 4GRSA 1PE1A 3T07A 1KTBA 2WQDA 2C1IA 2GLKA 1NDZA 1EPXA 2J79A 4QR6A 1EJ7L 5T8GA 1XIBA 4ENLA 1NIUA 4K38A 2VFGA 3EB4A 4P8XA 1WCGA 3OOQA 3CZJA 1P1MA 4Q8UA 4V1XA 3VFLA 3WQFA 4DYEA 5HANA 2ASHA 1EBHA 1AQHA 1QOXA 3W37A 3BE7A 4WQ6A 1AW5A 2NWRA 4EIVA 2NQ5A 1PEZA 3QVQA 3UNTA 1U5VA 3KRZA 4MB1A 4W84A 5DXXA 3LBOA 5FOOA 4NG3A 5A2BA 1PX4A 3MT1A 3GFXA 3TU9A 1HVQA 3O1NA 2YDAA 3AYTA 3RG6A 3B9AA 4IGNA 1UPMB 3PUEA 1O66A 4OV9A 4AU0A 4FOJA 2E5BA 3R0UA 2DVUA 4LOCA 2AL1A 4BWLC 4UQCA 3LPFA 1UZ1A 2XWDA 2VVNA 2X1IA 1EHNA 3C52A 1DXIA 3EOUA 4YS1A 3BOLA 2NQLA 4PEEA 2X40A 4WSJA 1LQ2A 5I3KA 1CDGA 2GQAA 3IGHX 3L2MA 2GSJA 3EX3A 3ALGA 4DLMA 3B8SA 3FLUA 3VGDA 2PDUA 2O9TA 3TW6A 2C15A 2C8NA 1OC5A 3GG1A 1MQPA 1GEHA 3WQ5A 2BVWA 3M41A 4E8DA 4QE5A 2W92A 3B4UA 4D8ZA 3UFYA 4ZQRA 2WVTA 3ONCA 4IFRA 1GQLA 5GNZA 4EP8C 3M44A 3N04A 5GQBA 3INPA 3GX9A 4D9PA 4C6MA 4OKDA 2OG9A 3E1F1 1A80A 2VCAA 1KM5A 3C2YA 4AXKA 3EZ4A 2HZGA 4CNNA 1GJUA 1E43A 4PUWA 4M0XA 1PHWA 2FFIA 2H3BA 4UOJA 2C7FA 3W75A 4IL0A 1KQYA 1XRTA 3QZEA 3T4CA 3DCPA 1YBQB 1K6AA 4WGXA 1HL2A 4NILA 4O0ZA 1KXHA 4AZCA 3B06A 2Q6ZA 3RYSA 3W22A 3LLFA 1IR2A 3H2MA 2UY3A 2HCVA 2C6QA 3ORWA 3MV11 3AU6A 1UWQA 1B1YA 3LBMA 4US6A 4GQRA 3W00A 3WD2A 2Y1HA 1HFBA 4J3XA 1ML1A 4UZUA 4E2BA 4IIBA 3DEQA 3WLQA 1P7TB 4HCHA 1UWAA 3OA5A 2OO0A 2AQVA 1UW9A 1E72M 4MWAC 2XM1A 3WNKA 1V7AA 1FDJA 5BNKA 2WZTA 1XYFA 3BAYA 4D6DA 7A3HA 3VILA 1YYAA 1GQIA 3GNRA 2XIOA 2QF8A 3G0SA 4UR8A 4UOZA 5BWFA 4NJIA 4CN1A 3APGA 3NUKA 3FYOA 4BQ3A 3O2LA 2DSZA 2XVNA 4XV0A 3WBAA 1QNOA 3GW3A 4PMQA 3IAPA 4B5UA 3CHVA 2ZX8A 4OBSA 5A6LA 1DVJA 1CXKA 4LSBA 2Y4SA 4TR9A 3SM0A 2PU1A 3NDOA 1VFOA 3LM3A 2X7WA 1E0WA 3U9IA 1WNOA 5XINA 6REQB 4IFKA 3ARQA 1VJSA 2CWNA 2DIKA 1KM1A 3T0AA 1VQTA 4X22A 3MO7A 1ITCA 3WF1A 3H12A 1VEMA 2HS6A 3KZPA 2E5DA 2DUZA 4LVFA 3XISA 2A6LA 4MKNA 3QHMA 3WF4A 4DN1A 5IBXC 4D6EA 1XLGA 3I68A 3QQ0A 1VC4A 1UD8A 3A9IA 1W1VA 3STPA 5F4SA 4IMDA 1P5BA 4N02A 3MI3A 3GDMA 2X0HA 2DZSA 1DWFM 4YWSA 2D2OA 1TR1A 1GGOA 3LU2A 3KOZA 3HFYA 3FOKA 5FI8A 2QJHA 3B8VA 3BSGA 2GJRA 4JFUA 3AXHA 4PMRA 4YN5A 3WNOA 3DESA 3H2FA 3QKZA 3UYIA 4CNPA 3SUWA 4DJDA 2JEQA 1P6WA 2GUBA 4L1WA 1LROA 1VCGA 4GVIA 1IWBA 4UNIA 5A6AA 4X0VA 4LVAA 5DX7A 4DJFC 1EF2A 1YLVA 1MVYA 3BLOA 5A5WA 1VPXA 5TAOA 4JEJA 3W1TA 3ABOA 4YNGA 4Z1BA 2PDBA 3OVQA 1OWQA 3SRDA 4PUEA 4JR5A 1QI4A 1RUSA 4MPKA 3GIYA 3TYDA 4A8NA 1F2JA 3VO0A 2RJHA 3TK7A 4B91A 4ZOAA 1EDGA 2C0HA 4YL2A 4GUHA 1N55A 3GC5A 5DT5A 3L5AA 4H04A 3UA4A 4AF0A 5DY2A 1Q6FA 1MO0A 1QUMA 4QNWA 4HMDA 2PSNA 4UTMA 2E25A 1ME7A 1TV5A 2VO5A 3UWVA 3SAZA 5D2XA 1E73M 3PULA 3HOJA 4KFNA 4GI8A 2W6RA 3DFNA 3EKLA 4PMJA 4P8VA 1ZU8A 4XBKA 3MSYA 4UTKA 1MRAA 4AD3A 3CMGA 3M0ZA 3G6MA 4UNLA 1V0NA 3T0CA 1E1CB 1AUSL 1CENA 4IJBA 4LVBA 2JBMA 5EGRA 1K9DA 1Y0EA 1JCYA 2Z2AA 3B0YA 3PBUA 3TKFA 3ZMRA 5H1WA 2H8XA 2Q8XA 2VC9A 1AQ0A 5SWUA 4HSHA 1AJZA 1ZAHA 4RK8A 4AQLA 1ZBVA 2RAGA 2WKGA 4OWGA 2FKPA 1FWDC 1XLBA 1DBTA 1WXJA 2J7HA 4YMZA 3DBPA 4JCLA 4MNJA 3H4WA 1T96A 1MFUA 4MJMA 1FWJC 1GWJA 1B9ZA 2DUXA 4AWEA 2VZTA 4NSBA 4O4VA 4F40A 5CZTA 4HA3A 3UZYA 1LOQA 3AI0A 4XZLX 1TZ7A 2J4GA 3TX9A 3H8AA 1W1YA 1KCKA 3V0TA 3VIPA 4PRRA 1EGVA 4HU8A 4XZNX 1XLEA 1YXDA 4UFHA 2GYIA 2QV4A 1K4GA 3SGUA 3TJ4A 4IHCA 1EIXA 3GHUA 2FJKA 1LQAA 3N9KA 2HDJA 4IIGA 1S46A 3K8MA 4GUFA 2NUWA 3UZXA 1HTIA 4E2VA 1TA3A 3MSGA 4K8GA 4OTKA 4G56A 4M1BA 3OLGA 1W9VA 5KSWA 1KFEA 2IKHA 3DC0A 4K1WA 1TE6A 2Y7GA 3QV7A 4KF1A 4RNFA 3S5SA 3CUFA 2R14A 3QW3A 2GK1B 2INFA 2P5NA 4GZ7A 3OYXA 2VC6A 3TONA 4GX9A 3TN5A 3PUGA 5CZKA 1LQ0A 3W29A 1OFPA 4CN6A 1AVAA 2VR2A 1E71M 4ORMA 4ZENA 3THUA 5AHMA 4YWIA 2BTMA 9RUBA 2WZMA 1QXLA 1OGGA 3PZIA 4XK2A 3E0FA 1TJ0A 5EMJA 3OLDA 1EZWA 3EPOA 5CSYA 3U2ZA 4I8DA 3CJPA 5KZMA 3O6DA 1L6SA 3CPUA 2E4TA 4QE4A 2ABBA 4JY9A 2QUUA 6TIMA 4YCOA 1WZAA 4CD5A 2ZZ6A 3QEZA 1HT6A 2XFYA 5LXXA 1PDZA 3WD4A 4S39A 3C5QA 2UWFA 3IUHA 4IMFA 1XRFA 2Y0FA 1IT8A 3WNPA 4O52A 3M43A 2QS8A 2HBVA 5D2TA 2C79A 2HRWA 3CXOA 3AIWA 4S3KA 1F3WA 1K77A 1HF6A 2I5GA 3W86A 1C92A 3C56A 3H6OA 3WX7A 2ISFA 2EO7A 3GIQA 4IQJA 2FLIA 4JKKA 4D6FA 1GVQA 1WP6A 3DI1A 3G1SA 1XV8A 3E0VA 1F8IA 3GXIA 1UUOA 4HOXA 2VDHA 4X63A 2Z1WA 5CC6A 3FXYA 4BA0A 1C7TA 4IMAA 1ZZMA 2CESA 3SCNA 4K39A 1WAUA 5CKSA 4CVUA 4MSSA 3FJ6A 3K30A 3N1AA 3AS1A 5J04A 5LIWX 3H7UA 1YTEA 1V3KA 1UOKA 1LOSA 3QF0A 5FSEC 4AYGA 1TTPA 3HPSA 3MZNA 3OZPA 1NH6A 2OZ0A 2J8TA 1TTIA 1VBJA 3HG4A 1DEDA 3DERA 2O7SA 3F4DA 1UWSA 1RLDA 2EQDA 1KBJA 3GTHA 2B7QA 3W88A 4MY8A 2D0FA 5D38A 1PB0A 3CAVA 3PJTA 4GIEA 4IPJA 1W3HA 3SQLA 1IZKA 4RCXA 4UR9A 1S5VA 1MXDA 2W61A 3W2LA 3S47A 4DNMA 2E9BA 5DBUA 1UA3A 1R3VA 5BXPA 3NO1A 4D71A 2W79A 2GVYA 4HP5A 3HPFA 3NQ8A 3SUVA 2DEPA 3ZZ1A 4GY0A 2QQ6A 4GFSA 3UD6A 5AZ1A 2FZDA 1OC7A 2OFJA 3RM9A 2PDLA 3M7SA 1PBGA 5DMYA 2P0IA 3HG5A 2BOGX 2J78A 1OINA 1XQKA 3QRHA 4L9YA 1EB3A 1K8CA 4WLCA 3ARSA 3W7CA 3SY5A 2NSOA 3ALFA 4BWLA 4E6MA 3T81A 4RE2A 2ZXQA 4JCMA 1E6NA 2PWDA 4O4WA 5EA9A 1W8SA 4L5ZA 1VFSA 3W1NA 5M3WA 5A8QA 1BD0A 1GOOA 4XD3A 3BLDA 3SR7A 1V02A 3NCOA 3HG3A 2V2HA 1VJZA 5FACA 1V7YA 4E5TA 4O16A 2BV9A 4FNRA 4RV3A 2IPFA 1VKFA 4HOWA 3NIYA 4MYAA 4JTFA 3VOIA 5BZAA 2DW7A 5HATA 4MZYA 1XD0A 4PBGA 4LANA 3SI9A 2DZPA 3LHTA 2ZRWA 4B5WA 1A3WA 1R2TA 3WZ0E 4CD6A 4ZO6A 3WD3A 5HMSA 1BFNA 5HNTA 2PE4A 3EX1A 4JD4A 5FKYA 5FJPA 1ELSA 2HK1A 3DIPA 1SYTA 3VX0A 2VZSA 3N34A 3E49A 3H22A 3BMXA 1E0XA 5AC4A 1UUQA 3QPZA 1V6UA 1VCVA 1AH3A 3LS9A 3GD6A 4GIAA 1US0A 4IUGA 3U2EA 1EJRC 3APTA 1SJDA 1XRVA 3EBVA 4K8HA 1YNQA 1QPOA 1W2PA 4HSOA 1ALDA 5HUPA 1B9BA 3CWNA 3PTKA 3TQVA 1KM0A 4YTTA 3F2CA 1QHOA 2QMJA 3PBYA 3NOYA 1XDLA 2WWCA 4QQUA 3SQMA 3ZJ7A 1UHVA 4WOQA 3VK5A 5FL0A 3NSMA 1XH0A 3UY7A 3PSWA 4D1JA 4IG2A 4FF5A 3QM3A 4IX2A 3O6YX 5IDIA 4P8WA 3TTQA 2RGMA 3RK8A 1XKJA 4DJDD 2PDPA 5DELA 4Q4PA 2VX7A 1H11A 1PX3A 2DT1A 1OGBA 5HPCA 3V18A 1ZGDA 4AZ5A 3NZRA 2EPHA 4C6LA 1KXVA 5DRIA 4GNKB 4M51A 5FF2A 1JCLA 3QMRA 3WH9A 1Z3NA 1DJGA 1H0GA 1W32A 2AAMA 2OSYA 2DSVA 3F03K 3TYEA 3PTDA 2VELA 5EL1A 1SJAA 3QR0A 4L6OA 3CIXA 1X6UA 4Z0SA 2VHLA 1HGYA 1Q13A 2Q71A 4LAOA 1NFPA 4ROPA 1UQYA 1I1XA 2CZFA 4JTDA 2Y8VA 2FHFA 4QEHA 1ITXA 3LCXA 2UY2A 2ACQA 4QLKA 1KM3A 3AIBA 3W7LA 1EDTA 1GK8A 5L6UA 2X42A 5I3GA 2WMHA 2QDEA 3M5VA 1QI3A 3W26A 2EAWA 3QXBA 1J2BA 4IGHA 1Q6QA 1H7WA 1U2YA 3VIMA 4D6GA 2A3CA 3VDCA 1Y7VA 5IBXA 1M5WA 4LBUA 3W7EA 1JUEA 1UR4A 2ZWZA 4AMAA 1AZ2A 5E0CA 1UROA 1Q4NX 2NWSA 1VS1A 2QPSA 2CFFA 4DWSC 3VZZA 2W9MA 1DJZA 2Y62A 5DLCA 1FTXA 2OSXA 4C6NA 2J25A 4ACYA 4KCUA 1OCQA 3FEQA 1UG6A 2YIHA 3AICA 2CZEA 2HPMA 4S3AA 1BXNA 2IPGA 2VC5A 2QCNA 1TJPA 1XBYA 2ZA2A 3H7RA 3GDRA 4JTEA 3KHDA 3OIHA 3BAIA 1E3XA 2CLOA 4PUKA 3A23A 2W63A 4UFKA 4DJFA 3E5BA 1TCDA 1JQVA 3LSCA 4GNVA 3IIXA 1VJIA 2ATSA 3GM8A 3SJ3A 1Q3NA 4NX0A 1G4EA 3WBWA 1FWFC 4DM1A 5BMWA 3T1GA 3CBWA 1S5WA 1XUZA 3BL3A 2ZDSA 5HMDA 3GG8A 2FZ8A 2GOKA 5CPLA 3GNOA 2J8GA 4NZ1A 5K7JA 1GPFA 1PS9A 3JR2A 1OT2A 1QI2A 4UQDA 5A8PA 3B8WA 2HROA 3WUFA 7TIMA 3WNNA 2BXVA 3PY2A 4WDWA 3CPGA 3LI0A 2BHYA 3N15A 3E2RA 3MBFA 2WOQA 3DENA 1Z69A 3CLWA 2QIWA 2HNEA 2V68A 1YXYA 3Q2DA 3P0XA 1O94A 2PUZA 4JGDA 4R3UA 4IICA 1IIHA 2CLFA 1C7SA 1DE5A 2V5BA 4DM2A 3B9NA 3EA3A 4LXFA 1XIMA 4LUTA 5DT7A 1A5LC 2J9YA 1VIWA 4GO9A 3U4FA 5K9CA 3FY1A 5LHEA 3W7DA 1G7UA 3A5FA 3VDHA 2Y7DA 3A6OA 2FYMA 3AALA 5C54A 1JEZA 4H9ZA 4Q7IA 5D9NA 3RCMA 1TJ2A 3RDKA 4EX4A 2YB1A 4O1CA 2V81A 1WUEA 3K8KA 3N73A 3LHZA 4AZGA 1E4NA 1TV7A 3UESA 1QPQA 4HZ8A 2VDIA 4OUEA 3DYMA 3A47A 3VIFA 3MUAA 3W7IA 1XLKA 5D2VA 1LT8A 3MKKA 3QQ1A 2EPNA 1TWDA 1JZ8A 4AF0B 2GVJA 3LY0A 3HV8A 4QLJA 4KGJA 2E9LA 4X0NA 1XBZA 4R7WA 1LG2A 3NA8A 3WKZA 3LNPA 1TG7A 2CXEA 1XWYA 2XDFA 3EA2A 4MLJA 3FK4A 4KGLA 4J3VA 2DVTA 3QSTA 3PBVA 4PCNA 3EWBX 1TPVA 2I5QA 2OU4A 1UH3A 2IXUA 3HGJA 1ICQA 4DELA 1H1YA 3AZSA 1P0BA 1E1EA 1MEWA 2PTYA 3HPAA 2E77A 1XR2A 3MUY1 4PB5A 2ZOXA 4NAFA 3WMLA 4AG0A 3MYOA 4DVOA 4HPNA 1TIWA 5G1YA 3MWCA 1MSSA 1O7AA 3DN5A 4H6QA 1G9HA 1HO1A 3GC2A 3Q94A 4LBSA 4WUIA 2H6RA 4Y9PA 5DO8A 3URBA 3ZLGA 3W1MA 1PYFA 3AHTA 1H1ZA 2EHHA 5BOOA 2FZNA 4FNSA 4NX5A 3UPMA 4XISA 4H8VA 4M7SA 3MCOA 3O63A 3WUGA 3LHWA 4KW2A 4JY8A 5HJYA 3RFAA 3BG9A 3SY8A 1J0KA 3FX4A 3D6NA 4JFTA 1GT8A 4UTHA 2OLSA 3SY1A 2A6NA 1LYXA 5FAJA 1RJQA 1ZJAA 3UZZA 3NGJA 4HNOA 3QHNA 3LHYA 1CGVA 4JIRA 1LBFA 2Z25A 4I9AA 2X2GA 3DU0A 1NF0A 1WE5A 2VEGA 1R86A 3LCLA 1MNSA 2Z27A 3GU9A 2NQ9A 1U83A 2V8ZA 2PGFA 3G8EA 2A7NA 2BFGA 1VEOA 4CNUA 4LUSA 2W67A 4DHGA 3AC0A 3G6LA 4FP1A 2PTZA 4KWVA 1OCNA 2V5LA 4P7QA 1EA9C 4M56A 1NM9A 4X2PA 3VNIA 4GACA 1O12A 1TJ1A 1UWTA 2INZA 3GG7A 1V6VA 1GG1A 3KBVA 5LNSA 2ZADA 2BNJA 2WSQA 4ZFCA 1JFXA 3STEA 5E0FA 3AQUA 5A8OA 1G0CA 4GX8A 4LS2A 3G8RA 4KEZA 5BRQA 3GDLA 1JZ3A 3S4TA 4BF5A 1ZP4A 3U5UA 3BJFA 3GK0A 3DBNA 1DJWA 1K4HA 4B9YA 3LUTA 4TV5A 1TTQA 3R13A 1ZNNA 4N6EA 3NZQA 2BVDA 1XI3A 3Q65A 4GI9A 4ALDA 2X1TA 2CLPA 1HL8A 3EWCA 4RLIA 2E40A 2EG7A 3EB3A 3EWDA 3SZ8A 5REQA 2Q8ZA 2DZBA 1JZ2A 1YRRA 5G2HA 3ARWA 3QN3A 1KM4A 1Q4WA 4IX0A 1FOBA 4W89A 3T08A 5LHFA 3B8DA 1OG0A 1ZQ5A 4IQDA 2PRMA 4FOUA 2ISWA 3GUWA 3KAOA 1RQEA 1K8YA 3S1VA 4P7OA 4UTLA 2XH7A 3OHMB 1MYRA 2PF8A 3L4UA 1C9WA 2DH3A 4MUZA 5FF3A 3BW4A 1H60A 2WMFA 1K8ZA 2XSAA 3A12A 1TWWA 2CC0A 1LZOA 3KOYA 4XB3A 4RL3A 5F2MA 4WSKA 2MNRA 1GKPA 1KBKA 4H41A 4NZ4A 3VTRA 4R85A 2OEJA 3MSRA 2OVLA 3GAKA 1E51A 2QCHA 2CEQA 2D23A 1TV3A 1BYBA 1IEXA 4BCEA 3BTNA 5I3FA 2DZVA 4TU1A 1JNDA 1OFDA 2WNZA 1ZAIA 4O13A 3WCZA 1OK4A 1H4PA 1SJBA 2E6AA 1VLWA 3BAXA 4LNCA 4GKLA 1TVNA 3DI0A 3LCIA 3MA8A 3NDZA 3W6LA 5ABFA 4HZMA 3LQLA 4L65A 3KDOA 3WLNA 3RO6A 4DB7A 3N2XA 1M6JA 1KCLA 2E8YA 2Y2WA 3G24A 3WDQA 3G1HA 4M6PA 2VKZG 3LZ3A 3G1FA 3M0LA 1PIGA 2PCEA 3VIOA 3IJQA 1GVSA 3NO3A 2JF6A 1ECQA 5D9PA 2QULA 3IJ6A 1NJJA 3NQ7A 4A3UA 2V63A 3EX6A 3TDFA 4NAEB 1Q2RA 1JJKA 3BJTA 5LNRA 3LNMA 2C3ZA 3LBCA 1T0OA 4S3DA 2YXXA 1AMKA 3TXVA 2V2DA 2P50A 4QSFA 3GVQA 1YXCA 2PBGA 4ICCX 2VNCA 3WLPA 2EF9A 1Y5WA 1TE1A 3R1ZA 4MY9A 1DQXA 5K4XA 3UR5A 2CXGA 3B8TA 1I2OA 3L65A 1RA0A 1XYCA 1N82A 3A4AA 2PDQA 3PFRA 3SCRA 3ARVA 2X1RA 3QV9A 4PTXA 3UJ2A 1C29A 1NWTA 3BANA 2CHOA 4TXEA 6XIMA 2WNNA 4AC1X 1NDWA 2BOFX 4F0RA 4NF7A 1V6YA 5MKGA 2WMIB 3WL1A 3WQCA 2TSYA 1X39A 4D6CA 3DG7A 1P0KA 1LLWA 2ICSA 3T8LA 2CLHA 2VWTA 2YZ5A 3DFOA 2DIJA 3DECA 2UV8G 4AHQA 4G5DA 5CPQA 5HA7A 1WOAA 2Z29A 3GFYA 3N9SA 4GHRA 1TVLA 1Z32X 5FL1A 4NL1A 1QATA 4GXWA 2OTDA 4A8LA 5DBTA 2HISA 4C6KA 2VZOA 3VMNA 2WKJA 1XD1A 3UJSA 4HNVA 3UZ5A 1B4EA 1F3EA 1Q7ZA 1TO3A 3CM4A 3PZGA 4PH6A 5B80A 4W87A 4MAVA 3GNNA 1P6CA 3M0JA 1FKXA 1EEXA 1NF7A 2A7RA 4IG2B 2D2JA 4HA0A 2HVMA 3HV9A 1XCWA 4MTVA 4GCAA 5CJ5A 3A4JA 2PLCA 3R89A 3E0WA 2V6AA 4RE4A 1TFVA 1M3UA 2XG9A 4NQ1A 3WK3A 4MWAB 4WGHA 3CL8A 1O5QA 3BAJA 4I6KA 3MS8A 3NEVA 4JTAA 4AD0A 3LTSA 4XAFA 4ASTA 3CUIA 4LX4A 3FXGA 4UWMA 3S2LA 2GJXB 1RP9A 4DWSA 2A3BA 1BWVA 4JNYA 4ZFMA 1DHPA 2A3LA 1VBUA 2Z6IA 7CGTA 1VRDA 2Y24A 1A4MA 3URNA 1J4EA 3L0NA 1XYLA 3N6QA 1HL9A 3GVGA 4E3TA 4KQNA 2B81A 2ISSA 1UKTA 1FVPA 3EMQA 3ZVHB 2O92A 3QMTA 3RU6A 5I23A 3AUOA 3T2PA 3W01A 4AHOA 4DJEC 4PL2A 5FF7A 2F38A 1H3GA 3F4NA 1TWSA 5C9RA 1S2VA 2EJ1A 1VPQA 3LRLA 2R24A 3KZSA 4AUBA 3CEUA 2QPXA 3PAOA 4XX6A 4UB9A 3REQB 2D24A 1YDVA 4HNUA 3TC6A 1SU5A 4QS6A 1C93A 3D3AA 1KTNA 5CXPA 3UZWA 3V1PA 1QASA 1OZQA 4UFMA 3I65A 1Q63A 4WZHA 1EIBA 4GQGA 4H8NA 1ZCOA 1VH7A 3NQGA 1SQ7A 2OWXA 3I3DA 5AVHA 1VD6A 4UFIA 4JIPA 4R9OA 4MKSA 2FGBA 4F4RA 3P3BA 2I16A 4XKYB 3VZXA 4MDPA 3KRBA 4A4AA 1I1WA 1RY8A 4K1GA 1RK6A 4AY7A 4WXZA 1B3OA 2XYLA 1F4HA 2CERA 3AROA 3H2AA 3OVRA 2R82A 3NVTA 1YDNA 5LIYX 4GCXA 1KWGA 4R7JA 4UMBA 1OFBA 3P80A 3VM7A 1LJYA 3AMDA 1HGWA 3CZGA 1E70M 2O7QA 2G5WA 1YADA 3IGUA 3AAMA 1XIIA 2XZ7A 1TREA 2ZE3A 2WYSA 1X8FA 2FVLA 2V2CA 3T40A 5DCEA 1DJYA 5HULA 4U3CA 3CAQA 3PWGA 1W5OA 4G7FA 2VT0A 1YW1A 1A0EA 3MKCA 3UBPC 2SFPA 1RBLA 3NQ2A 2XGBA 2J6XA 1FWSA 3IK4A 3W7OA 4CCCA 4ILSA 1P0EA 2OLAA 4B9ZA 5K2ZA 3VNYA 4B4HA 3VKAA 4X3ZA 3MBDA 1US3A 2IKGA 3SIMA 3WQWA 2R1MA 1VHCA 2WV8A 1DTUA 3QR1A 2REQB 4AZIA 3ES8A 1EHAA 3UETA 4XD5A 4YHEA 3R6IA 1A53A 3WMBA 1QNQA 2EJAA 4X60A 5G5IA 1IEIA 3CUJA 4FA3A 1FY6A 4J2PA 1Q5MA 3OQ8A 1IYXA 4QG9A 4JPGA 1SFTA 1U30A 1UP2A 1LRTA 3UY8A 3PC0A 2HVNA 4J3WA 1TQXA 3NL6A 3LPGA 4XO6A 3FJLA 3KOXA 3TN6A 3G1VA 4UMAA 1H61A 3IS4A 1BRLA 3L0KA 2WHKA 3BOXA 1R9YA 4QTGA 1L6GA 4GI6A 3LMZA 1OCBA 3AFBA 4JKMA 4C7DA 2ESCA 1PJ9A 2IPWA 3W2NA 4O54A 4XIMA 4LH8A 5D33A 3IUDA 4JYDA 5C9ZA 4Q7NA 3ITYA 3SSZA 1PL9A 1WUFA 3KCJA 1R3YA 3BARA 2QCCA 4ZXOA 3S2NA 4FNTA 5EBAA 1EWDA 2FZBA 2J13A 3I6TA 4AVOA 3V5OA 3QYSA 5AKQA 2F84A 4HPXA 3CZEA 3N29A 3NURA 4KRUA 4XBJA 1MWOA 3M6YA 3B0XA 3LX9A 3E6EA 1OABA 1XLMA 1KFLA 2B7NA 3T09A 3WLOA 3BOFA 3W1RA 1HO4A 2AQWA 2P76A 1SFJA 3W1XA 5G4WA 4W5ZA 1QPKA 4TTGA 3ICJA 4H6KA 1DIKA 3K8LA 5M1TA 4KESA 1S3TC 2EKCA 2G96A 3D46A 4S2BA 1Q2SA 4Y9OA 1V4YA 2ZUWA 2XIIA 4ZVJA 4XD6A 3WL0A 1M7XA 3BC9A 3WBYA 5H8MA 3KBNA 3CASA 3KVMA 1H5VA 4M5PA 3SCSA 2ODOA 3MP3A 1GJPA 3W28A 1M7OA 1PYMA 3KX6A 3S1UA 4Q4QA 4XZIA 3TA6A 1YNPA 3OVGA 2YBUA 1V3JA 2D73A 3A24A 4IXHA 3TC3A 5JIWA 1B90A 3N17A 3GVRA 3WFZA 3BZGA 2ABAA 2PWVA 4ZSTA 1O6IA 2YFOA 4L7ZA 4KIEA 5CZJA 3DG6A 3C3UA 1N8FA 3EAUA 1NU5A 4NHVA 4RW5A 2Y88A 4C1NB 3LPPA 3TJIA 4IXXA 5A3HA 5FJRA 4ATWA 2D3NA 3M0KA 5I03A 4KT2A 3CO8A 4QFUA 3NM1A 1GOXA 3WG6A 4ZTYA 2PDXA 2BZNA 3P62A 5ECVA 4N4QA 3S0CA 3W7GA 2XUCA 3AYRA 3NPXA 3HQPA 5CBJA 4LAMA 3GQYA 3BCFA 7REQB 1XLIA 4C6PA 3TTEA 4QIUA 1VRXA 3O16A 1F05A 3HQ1A 1PKLA 1LM1A 1DOSA 4PMNA 3OYZA 1MQRA 4EF9A 3I6EA 2DW6A 5BXRA 4NYUA 1DTNA 4W88A 2F61A 4EXBA 1ZS2A 4U5KA 3UG5A 2V5KA 2WHLA 2D0GA 1I60A 5BOEA 1AQMA 2Q02A 4JBRA 2XN0A 2I56A 4DPQA 1BGGA 2XIJA 3FJNA 4A3RA 1JCJA 1WDDA 3MZ2A 1JGMA 3HQNA 3NNTA 1V08A 2B0MA 3AO0A 3RHGA 3SW6A 3M0XA 1LG1A 4TMBA 2VGFA 3M0VA 3WF2A 3WJXA 1JPIA 1DXEA 1IXNA 4JL1A 4AW7A 8CGTA 3CQHA 2OQLA 3JS3A 2OCZA 2X1SA 4C6QA 1BHGA 5CC3A 1CECA 1TRIA 1I2PA 1YMYA 2Z2UA 3NG3A 4ZODA 1PTGA 4B2DA 2ZTKA 2CLLA 1FUYA 4DBUA 4B5VA 2QVNA 1E40A 3TLLA 2YR1A 4O14A 3IARA 3GNPA 4ZO8A 4BFAA 1TZZA 3GVWA 1WDQA 3BH4A 3GKAA 3VDBA 4PCPA 4GO8A 3WIJA 4FXSA 4BK9A 1GOIA 3HTWA 3CTLA 1ECEA 4GQ0A 1P1XA 4DZAA 1CNVA 1OFOA 3WLMA 2UZ9A 4OU1A 1R6WA 1PZ2A 1SPQA 1NAL1 3GH7A 3VGFA 3AOFA 1VLIA 4O1FA 2QLYA 3QZAA 4C6OA 3DYOA 2YCJA 3HG2A 1N7KA 2PDHA 5FJTA 4QDPA 5G2WA 4NY2A 1AZ1A 4YYFA 3MSDA 1YBQA 3RO8A 7ODCA 1ISYA 4LYPA 3R25A 4QS5A 4FR1A 3TFXA 5TIMA 5E1QA 4LQ1A 2C0AA 4P7NA 3CHDA 4US5D 4O1AA 2WPBA 2F2HA 1TPH1 2IS7A 4NU7A 3SECA 3SJNA 2FGZA 1Z42A 5CC5A 5IFPA 2W3ZA 5LNUA 2QYGA 2VD8A 3EWXA 1E15A 1CLVA 3UZJA 4IISA 2QGYA 2HMCA 4RDVA 1P7TA 1HQTA 4LALA 4CNOA 1XINA 3QMSA 1PIIA 1MUCA 2RHGA 3ITTA 2AGTA 2E09A 1B3YA 1FWAC 1KBIA 3NQAA 4LU0A 3FVDA 1VCFA 1ZY9A 1RCXB 1XXXA 2YDQA 3AHXA 1C8XA 1P0DA 1QNVA 2FGLA 3N3TA 4Q8PA 3W7QA 5CG0A 3S2JA 4AH7A 4IPLA 5JH2A 5C2XA 1QI0A 4JTCA 2E1WA 1A5UA 5LA1A 1ZAJA 2PAJA 3IACA 5G4EA 4W7UA 1Z6KA 4LCQA 4LY4A 3L67A 3EOLA 4Z2HA 2BXYA 3N3MA 3CPRA 1E6XM 1YTDA 4L1GA 3WJSA 4HOZA 3ABSA 3LHVA 1UD5A 6REQA 2HXTA 3VYLA 1AD4A 1W1B1 1IWPA 4PMDA 2R1NA 3NWRA 1CBGA 3F2DA 3TMQA 1UR0A 3CL7A 1F74A 1AG1O 2ZX5A 4MPQA 2ADAA 4FALA 3BGAA 1T7LA 5A6BA 1EJWC 2QDHA 4PA8A 2P10A 2Z7KA 1EC9A 3WEOA 5EMUA 1UC4A 4RZ4A 2XVPA 2BX7A 4A3YA 3LSBA 4UMCA 3V35A 3L4VA 4D1IA 1CYGA 1JI1A 4HT3A 4HQVA 2VX4A 3EWUA 3PZNA 5GJMA 4RJEA 2ZUNA 4B3LA 3AJXA 5CGTA 3V5CA 4U33A 1LT7A 3BQ6A 3H23A 1BTMA 1ZSXA 2Z4GA 2BY0A 2NV9A 2GQ9A 1WKYA 2OSWA 5D9OA 3LCFA 4UQ9A 3L7RA 1QW9A 1OJXA 4YXGA 3HGOA 4G2DA 4F66A 2YDSA 5BOFA 1I2RA 1PO9A 4ZO7A 3M47A 4PMZA 3FA4A 3L68A 1VFUA 2VFIA 3I7SA 5DCDA 1QNRA 3GR4A 3TYUA 4DJEA 2QAFA 2PEVA 3HA1A 3WQEA 6ENLA 4ACZB 4ZCWA 3LHUA 3KBJA 4WHBA 3DXIA 2PGEA 4S3GA 4DAIA 4MNLA 1YPXA 2E5CA 1V6WA 1B4KA 2DT2A 5A6JA 3VIJA 3RCYA 4F79A 1UD4A 1RD5A 4JX6A 3GWQA 4TO8A 1BWKA 1GKQA 2OEKA 5AZ0A 2BY2A 2EGZA 1ISVA 4EPEC 4DBDA 4PEKA 3QTGA 4ONVA 4PC8A 3CV7A 1J0HA 1G67A 3FNDA 5CC7A 2PTWA 1TPWA 3GU1A 3V0SA 4FB7A 5G2IA 1XF0A 1XM3A 4O1DA 1VP5A 2YXGA 1SVDA 2VZUA 4D6HA 1AL7A 5AYBA 3F4VA 3TZNA 5BXSA 3T2QA 2V82A 2NLYA 3FSTA 1E1CA 1J9YA 3E96A 5LNVA 3DFQA 1U33A 3EEGA 4QG6A 5K4ZA 4IFOA 4O28A 4H9YA 1RALA 3HIJA 3MANA 1JZ7A 5C55A 2OZTA 1ZJBA 4PMUA 4Z08A 5D37A 2IUZA 2DDXA 5DXYA 1DPMA 3G77A 3CAWA 1RHCA 2YL8A 4O0KA 3P2VA 4LNYA 4L9XA 3Q67A 1Q45A 4L64A 3ZWSA 1FWHC 1SW7A 1K8XA 2QR6A 3DHDA 4R7OA 3R8HA 4Q4KA 1JYWA 3A22A 1E4MM 2EEXA 2O56A 3V75A 4LB4A 3D3FA 3RJXA 1QI5A 1A5MC 4LAKA 4BJHA 3L4ZA 5CZSA 5M5DA 3QR3A 1OM0A 1NDYA 3EOEA 3KVJA 1IE7C 1IT7A 3ZR4A 1PPIA 1B3WA 1ZCCA 3OODA 4HA1A 1UJQA 2QIIA 3AIUA 4N9DA 4NJGA 1LWIA 3FHQA 1WKFA 1KFCA 2Q3OA 1EDQA 4Q6XA 4L9ZA 2YL9A 3HU7A 4JDYA 4S3JA 3AYVA 2FFCA 3GB6A 2WHJA 2VYOA 2WMKA 1E55A 3CTTA 1W8GA 1ADSA 2Y85A 2Z28A 3CWHA 4QDWA 3UGVA 2NV1A 1Q6LA 3NQEA 3SSJA 3KL3A 3RXZA 1ADOA 4I8YA 1V3LA 3SQSA 1NQ6A 2GK1A 3K46A 3M46A 4PBEA 5HINA 1EYWA 3L5MA 5I3HA 1L6WA 4U5IA 1T41A 2DZWA 3IEBA 5H2ZA 1FP9A 1KV5A 1YQ2A 1VBHA 3WD1A 2VEIA 3ARUA 2GVGA 5HK4A 3RLHA 3GC4A 2X30A 3MWAA 3PUDA 1F76A 3SCOA 4KPLA 4A2SA 1LCOA 3JW7A 1LBMA 3DKLA 3MTWA 3DG3A 5G1TA 3F4CA 4NNCA 3W85A 3LLXA 5I00A 4KWUA 4CLMA 4ERAA 1G4PA 5E6ZA 1EJXC 1M9HA 1A5BA 3W38A 2IQTA 3WJZA 4HNTA 4MLRA 2HV5A 3DX5A 5CJNA 2FVMA 3VKDA 2ZIDA 4OT7A 2HSAA 1R8LA 4O19A 1KW1A 1CLKA 2E6DA 4GNJA 2DIEA 2ALRA 4NI8A 2QJJA 1XP3A 5E09A 1OX5A 2P8CA 5TD4A 4PBFA 5IOBA 2PCQA 4F8XA 6TAAA 4O11A 1DP0A 4F9DA 3MV01 2CLEA 2B7PA 3TW7A 2ACUA 2ONEA 5E9XA 4KERA 2ZZ7A 1GVOA 2VRKA 1QWGA 2H9AB 1AL8A 5AYZA 4CVWA 3H2EA 1X1ZA 2POZA 2PODA 1KTCA 4FNQA 4LPCA 4JICA 3VAVA 1WDSA 3AHYA 3A13A 4B92A 1IIGA 1Q6GA 1K3UA 2BLEA 4MFDA 4WCJA 4XUYA 1XYBA 2QJGA 4GUIA 4MFEA 4DBSA 5I3JA 4AY8A 4WEVX 4YPJA 1FWTA 1PZ1A 1V5XA 5EFDA 3A4WA 3SIZA 1I6NA 3T2OA 3UWYA 3IVSA 4Z2IA 1R30A 3VOGA 1CGWA 1XFBA 2PP1A 4Z0JA 1FRBA 4CU8A 2E28A 1EFZA 4PCSA 3GE7A 1W3TA 1UMYA 4W85A 1PHQA 2J77A 4HN4A 1XPYA 2I7GA 3SCWA 1XIHA 1XG3A 4MKVA 3TA9A 3TQKA 1JG9A 4JNZA 1RVGA 1W1PA 2PC4A 4Q6JA 1NFGA 4PFHA 2GQ3A 2V9DA 1D8CA 3AIVA 2WM0A 3MPGA 2JK2A 3TXZA 4JAWA 1JIBA 1J2WA 1R7OA 4R5EA 1ITUA 3R0DA 3UJRA 3T0DA 1RZMA 3B4YA 3U57A 1E9ZB 1L6FA 1REQB 3DFPA 2G3NA 3OGRA 2ZC1A 1S39A 1W5PA 4QP0A 2GWNA 3N13A 1OK6A 4P7RA 4G8TA 3LGEA 5CPNA 3M0YA 5FJIA 1FA2A 2C1HA 2A3AA 2W5FA 1X1OA 5FA5A 2YA2A 4AY1A 3CHCA 3ZFHA 5ABEA 3NXLA 3TTOA 2J7CA 3BK0A 4LAZA 3UWQA 4CU7A 1F5ZA 1MXSA 3WDJA 1GOMA 3H4GA 3WQ8A 3ZLFA 2Z24A 1CCWB 4WD0A 1OVDA 1KM2A 2ZUMA 4AWSA 2GGJA 1BSLA 4POCA 4Y6GA 3O06A 3EMZA 2F7FA 1ZPTA 2WPGA 4WK9A 3E9AA 1RPXA 4N0RA 1OT1A 1W1ZA 3HZ3A 4AZ7A 1GONA 1EJTC 4XZWA 6XIAA 1UWRA 4GYPC 2ZCGA 2PS2A 4JTLA 4GJJA 3SUUA 1UYQA 3PBGA 4NZ5A 2PDGA 3DH7A 4K8EA 5CPTA 1G4TA 3RNDA 3HJZA 1TV8A 5I02A 2Y89A 1HJWA 4HNLA 3VUSA 3DOPA 1DWAM 2NXHA 1V02E 4A8IA 5HBFA 2CNCA 4TVUA 4HKPA 2G97A 1GW1A 2QCEA 3BZJA 1ISXA 2C13A 4M6VA 3IGXA 3VCNA 5CBIA 3TWAA 3F5LA 5C70A 3QH2A 2ZX7A 3FCPA 4JEQA 3WBXA 4XAZA 3SUTA 2EKGA 5EMKA 3GDBA 3WSUA 4MJ2A 1RCOB 4O1BA 1Z7AA 4LS0A 4JTJA 1W37A 2XH0A 1OYBA 1XYAA 5A8MA 1K03A 1FBAA 3N9RA 5A6BD 2ZRUA 3AZRA 4OIFA 4X9YA 1FWBC 1E3ZA 2ZFAA 3W7MA 1A5SA 2ZX6A 5EMLA 5EY5A 3KEHA 3KLKA 1EOKA 1EXBA 4L61A 3C2EA 2E68A 1KBLA 1RBAA 3MCNA 1HJQA 1Q6EA 2JGQA 1SFLA 3KTSA 3MKVA 4M8UA 1W3JA 3F7JA 4XAYA 1FWEC 5GVJA 1J96A 1F6KA 4GUGA 2P0OA 3FEMA 3ZR5A 4AD1A 2W62A 3UYCA 3VX1A 2DQXA 2X41A 2R6OA 2YXOA 3KL0A 3BDKA 3OBKA 2DVXA 4AIUA 4BEQA 1ISZA 3P84A 5HNUA 1AW2A 3FFSA 1H7PA 2V69A 1MRQA 1Q7QA 4JDBA 3QY6A 1UASA 3BSMA 3LCWA 5CZ0A 4K68A 3C2RA 1AODA 4QNEA 3ONBA 5HUOA 4B3ZA 4LCRA 2QJMA 3M0HA 2GOUA 4M6QA 1UR1A 1V0KA 4XQ6A 1D9EA 1E0UA 4A21A 1E56A 1A3XA 4I9JA 3U7BA 3W7JA 4YU1A 1OX4B 1H7XA 2CBVA 4GYKA 5CG7A 2XPKA 1XCFA 1ME9A 3MJYA 5C9WA 1KLYA 4AIEA 3NL2A 2Y61A 1ZENA 3FW6A 3TN3A 5DFAA 4BI5A 2C91A 3ARXA 1P0NA 1B0IA 1K1DA 1QPNA 5FJOA 1RJPA 3A4XA 2AMXA 1IWAA 2YZRA 2I14A 4KCVA 2I5IA 4CQCA 2ZYFA 3SRHA 3PJWA 3UJEA 2G95A 3BJSA 4C7GA 2ZE0A 3G1DA 1UKPA 3FVMA 5EB8A 3GYEA 2FB3A 4BF9A 4ERGA 8RUCA 1XL9A 2FJUB 1OSEA 1K9FA 1TSIA 4JIHA 2Q3RA 3STGA 3MJMA 5I06A 4F0HA 4TTUA 3ANUA 3V7PA 3FV9A 3B0VC 4PMYA 4DEFA 4LRTA 2OJPA 4K37A 3WF0A 3S9IA 5A6MA 2PP0A 3OBEA 2QCGA 2Q09A 3TV8A 3CB3A 2V67A 4H2CA 3U3HA 1JDDA 5KZ6A 4QG8A 1RXOB 4JX5A 1X1NA 1CW2A 2VOTA 4V15A 3CQKA 5D9MA 3BV7A 4TOQA 2WANA 3II1A 4HK7A 4Y96A 4H6RA 1O1HA 3U8GA 3UXDA 2JFEX 3IRSA 3TTSA 1DV7A 5D2YA 4JFVA 4IMGA 2V5DA 1CXFA 3IPWA 4H19A 3TUUA 1WZLA 4I5UA 1LF1A 4JN7A 1OC6A 3S9ZA 2J9XA 3PN8A 4O15A 3VNKA 4AYSA 2XN2A 2YX0A 2VC7A 4A22A 1JDFA 1KM6A 1JCTA 3WJYA 5CSSA 3DFSA 4GJ1A 3GDKA 3WDIA 1BYDA 3U4AA 2POTA 2BGNE 3VIGA 3ATYA 4WKFA 1K9EA 3Q58A 3TW9A 4Z42C 4FXFA 1QO2A 3E2QA 2XIBA 1AJ0A 3PSVA 3TQPA 3HGRA 5BRBA 1ZRQA 4JTIA 4JYEA 1XGDA 2PDFA 2W4XA 3DDMA 2WJFA 4NZFA 5KETA 3POHA 2HTMA 3VNMA 2QPUA 3I4KA 3O07A 3G18A 1XLAA 3WLLA 3S1WA 3W24A 2BG5A 2DSWA 2IKIA 4RKAA 3K1DA 3W76A 4EKJA 1NEYA 3IIPA 4Y90A 3W81A 3WLRA 2GJPA 4UTWC 2YYUA 4WRHA 1ICSA 8XIAA 1L2QA 5BYWA 1L0PA 4MJZA 1S1PA 3NPUA 3UT0A 5A8NA 2VOMA 3RPDA 3KP0A 2Y8KA 2VDGA 4OOZA 1S5NA 3R5EA 1FXQA 2YCKX 4IQLA 2E6FA 2BGSA 2X16A 1NVMA 3QBUA 4CQDA 1AFSA 1KRBC 2ZBTA 1EA0A 2P3EA 1DXFA 3IV8A 3FSUA 4PTNA 5A95A 4RNIA 2WSRA 3POCA 1KB3A 2GGIA 2ZX9A 2G4FA 3A3HA 1FHDA 4OQVA 3GVVA 5FJJA 4W8AA 5I78A 2J8FA 3LTPA 4LYQA 3MDWA 4KS0A 1EJVC 4FF7A 4WY0F 1BTCA 2F6XA 3ZQ9A 5BW6A 2A4AA 2OGJA 1DQUA 5JBEA 4LGXA 3AMKA 2GVEA 3NL3A 2H8ZA 5M2FX 3LGDA 3T0BA 2YOCA 4Q8OA 1EPVA 3G22A 2VUYA 5HNNA 3S3GA 4ZQNA 1HP5A 4OJYA 1GOKA 5JIPA 4I6VA 2PDMA 4D2JA 1RR2A 2B31A 3L23A 4JHOA 1UBPC 4RX0A 1WKDA 4A8RA 4E8GA 2ZXDA 3GXDA 2QJNA 4OE7A 5FEPA 4B16A 1NOUA 1JR1A 1W31A 3W0KA 1NWSA 1G4SA 4DZHA 2V30A 2ZRYA 4PRTA 1X96A 4PCFA 4GMEA 3L2IA 1FFRA 4BHYA 1ME8A 3TYBA 2OKTA 1SW0A 2CZDA 2KAUC 3URAA 3SUSA 4PYSA 3NSNA 3MMUA 1DJIA 4HCDA 2UBPC 4CGTA 3OZMA 1H2JA 1DHKA 2FDMA 1TRDA 3NM3A 1J11A 3VU2A 4OBRA 1GEQA 1LUCB 2PWUA 3L4WA 4QJ5B 1R3SA 3HMJG 4LC8A 1S2CA 4OZOA 3W84A 3LD5A 1OY0A 2PD9A 3W2KA 3R4IA 3P81A 2VJXA 1XIGA 2WZHA 3ARZA 3V3WA 4R33A 4CD7A 4WDUA 4FLOA 4GZJA 1UR9A 4GXPA 3N2TA 1JF6A 4QQ3A 3GU2A 1R0MA 3WLKX 4RNHA 4DBEA 1DJQA 3MMTA 1CLXA 3EOOA 3TQ0A 3KM8A 1PVNA 1VBGA 2NVAA 3U48A 2EPMX 5TF0A 1BXBA 4AEOA 3W82A 3PTMA 1HKVA 2BMBA 1TKKA 3V36A 3GH4A 3GO2A 1ICPA 4UTIA 2WMJA 1EOMA 8TIMA 5HWNA 5LA2A 3LPOA 3E12A 3P5ZA 2Z0IA 5I3IA 3HB9A 1BXCA 5FF4A 1QBBA 4WJXA 1HKKA 3TP4A 4LCSA 5CSRA 1JULA 2AOSA 2G3JA 1GZJA 1R2RA 2DUAA 3K4WA 4OGZA 4JQ3A 3R79A 3PF3A 1S5MA 1BVWA 3BXWA 4ECLA 4NP7A 3M5YA 4INFA 4PUNA 4QLLA 5HR7A 4QJ1A 3B9DA 4LV9A 4EWND 3BLLA 4MDOA 2AL2B 3TN4A 1B31A 2VRJA 5HQLA 2J27A 4B5XA 3BAKA 4PSRA 3ITCA 2WO5A 1OX6A 3WQDA 1BAGA 2J66A 2DY3A 3BG5A 3MQTA 1JZ6A 1CXEA 4P7LA 5F4WA 2A79A 3W2JA 1AA1B 1ZBKA 3BGGA 4MYXA 2DQWA 1RSCA 2W0UA 3SB0A 3KBSA 4AHPA 1W9XA 4H2HA 4IWWA 3W7HA 3S1XA 4PMOA 2ZICA 4GYPA 4AISA 2NSXA 2XFRA 1DKWA 4GK8A 3PJUA 4S3BA 5T26A 2RDTA 4AZBA 2ISVA 3VD7A 4EPDC 4L6DA 2YCEA 2G41A 1VB9A 1XSJA 2NXGA 4V28A 1UP0A 2GWGA 1V3HA 3RPTA 4B5SA 1OHLA 4CCDA 2PDCA 4UQBA 5DRCA 1W17A 2D69A 4PGLA 1UD3A 1T6MA 3AIRA 4RXGA 1K70A 3PBWA 4MGGA 4CD8A 4NAEA 4DJDC 2A5HA 3O0KA 1FQ0A 5JMUA 3W7RA 4Q32A 1FHLA 4HYRA 3RITA 2NW0A 2I17A 1EC7A 3B0UX 2OEMA 4IQEA 1UJPA 4FLRA 2HPIA 4YTQA 1XS2A 1SW3A 4GFIA 4H7VA 4RW3A 3FIGA 5T9BG 4UTFA 4S38A 3EOSA 4JIIX 4KEMA 3KS6A 1US2A 3BLIA 2C14A 5AHFA 4YLWA 3ISIX 3N6JA 2HQAA 1PUDA 1CWYA 5BMXA 3TR9A 4BI7A 4GISA 7PTDA 3GLCA 3DHUA 3ITXA 1S3HA 3UVAA 3C3NA 3GXFA 1XIFA 4PUJA 1UP3A 1AJ2A 1I75A 3U2OA 4AX6A 2WMIA 3EDJA 2RDUA 3WN6A 1Q8AA 1M01A 2CZVA 2GDVA 1SO5A 4FS9A 3ZT6A 4GGHA 4QHRA 4JX4A 2A2IA 4C1LA 2VL4A 1OGSA 2VCCA 3LEPA 4O12A 3PAJA 3CL6A 4H00A 3OZYA 4C6DA 1ZFJA 2JQXA 4J3ZA 5HJLA 5FD0A 1G7VA 3O15A 1W3LA 2ZZ5A 1LLOA 9XIAA 1X97A 3PNZA 3NQ6A 2A21A 2VFHA 1I2QA 1JFHA 3SCQA 1GYMA 1CI1A 1M7PA 1W9DM 1W1IE 1KD0A 3ATZA 3E0LA 3NZPA 1VGAA 3S5NA 4ML9A 5HR6A 5BWAA 3CHEA 2XGIA 3UQNA 1SJCA 3MP4A 2XN1A 4ZQCA 5I09A 1NOWA 1N8IA 2PGWA 2Z1BA 4RDYA 4MWAA 2J7FA 3E0IA 1PKNA 2FZ9A 5I07A 2WJZA 3K4AA 5FEWA 4AXNA 1G6CA 4EK7A 2GJXA 4H7ZA 3W1QA 2GQ8A 3C8FA 1U1HA 1R3WA 4ZB5A 3PTQA 2VXNA 5LIKX 2WZIA 1BPLB 1S1RA 1C8VA 4J40A 3VE7A 3NFUA 3PZMA 1WZMA 2GPTA 2OMAA 2PTDA 4YHGA 4A05A 1YIXA 1W5MA 4WKAA 4X61A 1UR2A 1EP2A 1R87A 1R3QA 1RAKA 1SSDA 2VP8A 4JFWA 2TMDA 1D7FA 3W2MA 1K02A 3GXMA 2XH2A 2ZVRA 4TVDA 4HHPA 1FXPA 3ZVHA 3P60A 5JVLA 2E7FA 4ZO9A 1SSGA 5DMLA 4J4KA 1CIUA 3QV6A 1RQHA 1KLZA 5GNYA 4Z2LA 5DEZA 8A3HA 2CLIA 2IKJA 3SGZA 2EXOA 2VRQA 3IVTA 1CGTA 2R8WA 2VGIA 3B97A 3REQA 1QR7A 4UIOA 2XINA 1F9CA 2X0SA 3KUMA 4HZ7A 4KFPA 1E9YB 3PNUA 4FX6M 4FX8A 4L1XA 2P8BA 3BW3A 2YSWA 3KE0A 4J7RA 3WEMA 5I6SA 4G1KA 4CQ9A 2DT3A 1JAEA 4DUVA 4XKYA 4J2MA 2BDQA 3LQGA 4Y9NA 2WC3A 3WH6A 2UY4A 2XGZA 3VDAA 3GNDA 5HWJA 3S2MA 1E5NA 3D0CA 1W2VA 3L4XA 2VTFA 4PSPA 2YKKA 3CIWA 2C16A 3F5JA 4JQ1A 5CGMA 4JN6A 1D2KA 4FOKA 5HJXA 1E6ZA 3LTYA 4L80A 1U5HA 2A1YA 4DAFA 2AKZA 3FDKA 1SZNA 4NUWA 3QLLA 1JD9A 4AFYA 1KFWA 3A64A 3O6CA 1XIJA 1YNYA 2VWSA 3WK2A 6CGTA 2WVSA 3NAVA 3BAWA 1GYLA 4IZGA 2E3ZA 1SR9A 1VFMA 4O18A 3RLGA 1ODUA 4KETA 3G1YA 1PZ0A 4UTWA 5CAHA 3GXTA 1S2AA 4JIEA 3TLQA 4NKCA 3VOHA 1BKHA 3AHVA 3F5KA 1QTWA 1GQKA 4GYFA 2W91A 2GSEA 3AXXA 5IDZA 1YKWA 1JUKA 4UTJA 3AIEA 4EAMA 2Y7EA 4C6CA 4FLSA 1FCUA 4RXFA 3RR1A 1XICA 3LERA 1W5NA 3W1UA 2REQA 4A35A 4L4LA 1ZTVA 2CHNA 4LVDA 1LOLA 3LCGA 4JHZA 4DF2A 2GZXA 4IIDA 2WC7A 3GYCA 3WQOA 4B90A 4M19A 3VVGA 1CB7B 5GNXA 4E0CA 3GIPA 1HJVA 1Z44A 2OGYA 4H4IA 1KR1A 4AWUA 3CB8A 1U22A 3ES7A 3BWWA 1XISA 3OU8A 2HE8A 4K3ZA 5CSUA 1XKYA 2PTXA 3SO7A 2P3ZA 5FAGA 4DYKA 4AB4A 2VEKA 3C8NA 2BWGA 1R7AA 5FCZA 2DPEA 4HNCA 3UWWA 3AJ7A 1PWMA 2D0HA 3ME3A 3G5EA 3PPGA 3S9YA 1BSIA 2CHRA 4HPGA 1KBBA 1I0BA 4E38A 2X0YA 4GXMA 1KWKA 4PB3A 5FESA 1JXJA 2YL5A 3KHJA 1CEOA 4EE9A 3M6DA 4JQAA 3EDDA 3UXAA 4XD4A 1UA7A 1Q6DA 3E38A 1GJWA 1QNPA 4TIMA 1GOWA 2BY3A 2NVDA 1ZL1A 1L6YA 2CCRA 4UUIA 3RLVA 5M17A 3WYZA 3RN6A 1ZALA 3W4RA 2WM1A 3GZAA 5DMMA 2WWDA 1YDOA 4XZ9A 2AMGA 3TCSA 5CPSA 1M03A 2VFDA 1HKIA 2RUSA 3TCEA 5EKYA 3IK2A 2PI6A 1CT5A 3DC8A 2BVTA 3WO8A 4EOUA 2VFFA 4PULA 1XLLA 4TX9A 3UG4A 4G1NA 3KLLA 1KV8A 4C5ZA 3G1RA 3PZQA 4DRSA 2VVSA 1E5JA 3VKCA 1EYEA 2HEJA 2W66A 3N4EA 4XAPA 1EGZA 5I0DA 4DIAA 1CTNA 1RK5A 2J88A 5HWMA 1UWUA 4IM4A 4O17A 1JAKA 2A7PA 3R58A