2TYSA

Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Crystal structures of a mutant (betaK87T) tryptophan synthase alpha2beta2 complex with ligands bound to the active sites of the alpha- and beta-subunits reveal ligand-induced conformational changes.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 94
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tysA00
5J5DA 3TAOA 1TPB1 5CKSA 4M6PA 4MY1A 4ORIA 1XBXA 4KWVA 3P62A 3BLFA 3QEZA 3SJ3A 3TXVA 1S5TA 2CW6A 1EX5A 5D33A 3IRDA 3L67A 2ZCGA 1C9DA 3MBFA 3O16A 4LVGA 4O4WA 1LDCA 4GFSA 3NM1A 2DZPA 3U2OA 1QOQA 2ZA3A 1XBVA 1VCGA 1RQHA 4O10A 3M5YA 4MUZA 4ZZ9A 1FDYA 4JX5A 4FNQA 3N2XA 1TYGA 3GDLA 1A5AA 3NL6A 3GKAA 4UFIA 2DP3A 4AWSA 3RK8A 4JTSA 1OYBA 1KLZA 4JX6A 3G0SA 3PC0A 4Z0JA 5HQEA 4DO5A 3CC1A 3NGJA 1C29A 4TMCA 3B05A 1PV8A 4LU0A 1WOAA 4AH7A 1F5ZA 1KW1A 4MYXA 1G69A 1IXNA 4LRTA 1UB3A 1GVFA 3W84A 5LGZA 2DZWA 3LRKA 2ABBA 6TIMA 3SGUA 4EOUA 1VJIA 3BLEA 4A3UA 1YTEA 1AK5A 3W1QA 4JX4A 1Z48A 1ZHAA 3STEA 3QM3A 1GVSA 3W1NA 2B7PA 4CCDA 3FYOA 1LRQA 2YFOA 1T96A 1U5JA 1HO1A 4TR9A 2VFFA 3ATYA 2ZRWA 3GDKA 2BWGA 3N3MA 4WY0B 2NUXA 4RXGA 5EY5A 4NXKA 4OE7A 1DBTA 1FX6A 1QOPA 3L0KA 4ZQNA 2ZZ5A 1GJPA 3G1XA 4BI6A 1L6WA 5KMYA 4ZL1A 2Y7FA 4X22A 4O17A 1KFLA 3W1MA 3CPRA 2RKXA 4M7TA 4FNSA 5EPDA 3O8AA 2QCNA 3RNDA 3LBMA 3M6YA 2ZRVA 3WK3A 3DFTA 4AMAA 3WJXA 4MFDA 3WJSA 3W7QA 2DZTA 1TSIA 4N9EA 3QF0A 3W3OA 1OK6A 4IMGA 3LV5A 3EB2A 1MZHA 3I68A 3LXBA 4RK8A 2A7RA 2ZZ2A 2QAPA 2DJLA 5AHFA 2JKAA 3UWWA 4JS3A 1HG3A 1ZENA 3NDOA 1BKSA 1NFBA 2VFGA 3O6YX 1SSGA 3HG3A 3EX3A 5LHEA 2OT0A 4JTHA 4Y9AA 3A24A 3P67A 1GTHA 3UWZA 4FX8A 4NJKA 4K7VA 4TMBA 1B9BA 3LTPA 2V81A 2A7PA 3M5XA 2A4AA 3VI2A 2G5WA 3M0ZA 5EMUA 5CPNA 1VR6A 2CFFA 2TPSA 5KZMA 2X1UA 3N19B 3NQ6A 4IMEA 3W7CA 4UMCA 1K3UA 4MPQA 1N8FA 1I2OA 2V2DA 2Y88A 3LHYA 1SU5A 2Z6JA 4BF9A 3MP3A 3B0UX 1JR1A 2VFDA 3Q2DA 3TK7A 2QCHA 5FF0A 3LDVA 3HG5A 4BI7A 4O8RA 5EL1A 5C2XA 3THAA 3MYPA 3BLIA 2CLOA 4L4MA 4K7YA 5G1YA 1SFLA 1LP6A 1GQNA 2CZFA 1VLWA 3EWWA 3Q58A 4GRSA 3LCXA 5E0KA 2BLEA 1OX4B 4K8HA 1T0OA 2WJZA 1LROA 5KTLA 2ZDRA 1EPXA 4N4PA 3S42A 3G1SA 2JKEA 5FEWA 5IBXA 1TPDA 4UFKA 3F4WA 5HR7A 3I7SA 3JS3A 1Y0EA 3LCFA 3DENA 4DPPA 3W1UA 2BX7A 4FXRA 3P82A 3RLUA 3EWXA 1ME7A 1LYXA 1AG1O 4JEQA 3UYCA 1R2TA 5C54A 1KTCA 3D0CA 1ZAIA 3EKZA 1B4EA 1W5QA 2NX3A 4NNCA 2DJXA 2P0OA 4DO4A 1EEPA 1H60A 1T99A 2J9ZA 3UPBA 3W7HA 5K4ZA 5A8GA 2WPBA 1TRIA 3M9YA 1FCUA 2HMCA 3MI6A 3TSDA 1BEUA 1JUKA 4FHAA 3TQVA 1W3IA 4KFPA 4H6KA 2E6FA 2R91A 4ADUA 4NJGA 3BGJA 1D9EA 4O11A 3M5VA 3HPZA 1LRNA 4FNUA 3N34A 2D73A 5IBXC 2G97A 2ZYFA 5DCBA 4K8EA 3G1YA 3KRSA 3ABOA 1YPIA 4Z0SA 3FIGA 4CLMA 3LCHA 4X3ZA 4UCGA 2Y62A 1XXXA 2VEMA 4QNEA 1B3OA 4N9CA 2QCDA 1YXYA 1HUVA 4RCXA 5HUOA 1FWWA 1SSDA 2VXNA 1KLYA 3PF3A 3Q37A 2RH9A 2E77A 2ISSA 4ONVA 1K03A 5HMSA 3I65A 5K3VA 1OABA 4JIQA 5AHMA 4CQAA 1OHLA 4WZHA 1EP1A 1VPXA 2IQTA 3NQAA 3SI9A 3UPWA 1S5WA 4WD0A 2VFEA 3DFNA 5F1VA 2Q8ZA 4S2CA 1H62A 2H8ZA 3SGZA 4JTTA 4QAIA 3A9IA 1VS1A 1N55A 3KHJA 4WXYA 5D37A 5CSSA 3VCRA 2X2GA 1G6CA 3PBUA 2QJIA 1GEQA 4IX2A 3NQGA 2BXVA 2V30A 3GYEA 2AAMA 5FF3A 3GNNA 4AHQA 2ZFAA 5D04C 1XCFA 3MI2A 4LUJA 3S1XA 4UR7A 1WA3A 2EPHA 2WSRA 1KM4A 1QDSA 1JCXA 1P5BA 3U8GA 1T8XA 5BMWA 3LOTA 1TPUA 1G4SA 4Y90A 1N7KA 4NNAA 2X1SA 1OFBA 1KFKA 3UQNA 5D38A 3PSVA 3R12A 2NX9A 4DF2A 3NQ8A 3R13A 1TPFA 1KV5A 1EUNA 1GWJA 3LM7A 1TV5A 5H2ZA 1H1YA 3GXTA 4JYDA 1IXOA 4MJMA 4B5NA 3B4UA 3FJLA 1FCBA 1H51A 1D3GA 2P1FA 4NXSA 3W86A 4OV4A 5D2VA 2BSLA 2ISWA 3ZWSA 1EWEA 3HB9A 1EWDA 1KFBA 3SIZA 1TMHA 3NR0A 1JRCA 3PWAA 3E49A 1YTKA 2DZVA 4A22A 2WNQA 1GVRA 1OK4A 4O0ZA 5DLCA 4N2YA 4JTJA 3QSRA 3P61A 4EF9A 3QH2A 4NT0A 8TIMA 2FIQA 4K38A 3S6DA 1XUUA 3IIPA 3BV4A 1FY6A 3CQ0A 1DQXA 3IVUA 1ONRA 2V5LA 4QM1A 3T78A 1GVQA 1TREA 3DU0A 3NPUA 2J6XA 2FPVA 5J5RA 3NQMA 4ZQPA 2ZTJA 1OX6A 2I1OA 2ISVA 3C52A 3TIMA 1EIXA 4HHPA 2ATMA 1ZY9A 3MHGA 2GQ8A 1JVNA 4O50A 3NNTA 2W79A 4IMFA 3SZ8A 4WX2A 4DF1A 3DAQA 4HPXA 3C2VA 3QJAA 3NEVA 4MLJA 3DHFA 1VZWA 4PTNA 1K7EA 3PB2A 3C3NA 3LXCA 4M5PA 4GE8A 4JYFA 3FKKA 1UUOA 5DBUA 1IIHA 4JTIA 1SW3A 2VEKA 4DBEA 3M5ZA 3OVRA 3EWZA 4Q32A 3CWNA 1OFEA 5F2MA 4UFLA 4E2BA 5EYWA 5I3GA 1F7BA 1LOSA 1VC4A 2C13A 4IWWA 2NV1A 4JTGA 1SQ7A 3A22A 3MP4A 3W76A 2KZHA 4LT9A 1K8YA 5DN1A 1SR9A 5BMXA 4LY8A 3S5YA 1JULA 3T40A 1SO6A 1H7NA 1TTPA 2BTMA 2NUWA 2CLKA 3UD6A 1H7WA 3TV8A 3BO9A 3L0GA 2ZZ3A 2Y70A 5D03A 3W22A 3PUEA 1BWKA 3UWYA 2ZRUA 1XBZA 2ABAA 2OX1A 4LUIA 4AWTA 3UNDA 3PBWA 3UWUA 3W7RA 3E02A 5LNRA 1YDOA 1B57A 1W31A 3NYZA 4FF7A 2E6YA 1OF8A 1KA9F 2B7QA 2GPTA 4GC4A 4RR4A 2PE4A 4KFNA 4E0CA 3PY2A 2H8XA 2E09A 3T7VA 4HSNA 3W7GA 1LOQA 2UV8G 4UC5A 5CPOA 3GAKA 4FO4A 1VGAA 2E5CA 4A2RA 5A5WA 1NAL1 1KBJA 2FJKA 4FNRA 3R8RA 3HMJG 1F76A 3DBPA 3VE7A 1AL8A 3C4UA 4G1KA 3MJYA 1NSJA 1LRTA 3NPXA 4UTMA 1TQXA 2TRSA 3DFPA 1QR7A 3M47A 4AF0B 3P80A 4NJHA 4JDBA 4Y6GA 1THFD 1SPQA 1DOSA 2NLIA 1O94A 1H7XA 1QPQA 3DKLA 1AW1A 2YYUA 1Q6LA 3A21A 2C16A 3W85A 2I9EA 3W7PA 4O53A 3TA6A 3LTYA 5CZSA 4O1DA 4LNYA 4GUFA 4LRSA 1PL9A 3BG5A 3FEMA 4QJ1A 4N4QA 1E51A 3TX9A 2E5DA 3O07A 3A5VA 5LNUA 2YCEA 4QITA 5AYYA 3CWOX 1OFRA 1W5PA 3RF9A 5LHFA 3L68A 1SZFA 3NL5A 3HGSA 3LX9A 3DI0A 1A50A 3IVTA 4RV8A 2NXHA 3O15A 2CZ5A 1EA0A 4CCCA 3G1HA 1SW0A 5E93A 3PBYA 2QAFA 3R5EA 3OVQA 1Q45A 4O16A 2V2CA 2ZBTA 5D05A 1TRDA 3C0JA 3O63A 2NZLA 2NWSA 3BARA 3NL2A 4MOZA 3FYPA 3L21A 4A21A 4IX0A 1K02A 1Q6QA 1AW2A 2YZRA 5BNKA 3P60A 4XBSA 1H63A 2DZUA 4AAJA 5AHEA 4LS0A 1DKWA 4FX7A 1PCKA 1QWGA 2FPYA 3T4CA 3LXAA 4NU7A 3W7DA 2ZRXA 2VENA 4YCPA 3QYQA 1YTDA 4ZVJA 4E2DA 2EF9A 4OT7A 3HQ1A 3CU2A 5C6MA 6ALDA 5K2ZA 3W1RA 1PHQA 3TMQA 1F6KA 1MEHA 1AL7A 1LORA 4UTKA 4X2RA 2Z1BA 3QMSA 2J88A 3TNOA 3USBA 1FUYA 7TIMA 2OCZA 4UTWA 2Y7EA 4NVTA 3C2RA 3STFA 1YPFA 4AHOA 3TU9A 1TCDA 3IIZA 1R30A 4ZQRA 1LBMA 2YW4A 1F74A 2ZQ0A 1A53A 3G1AA 3MO7A 3A5FA 1W37A 4OV9A 4XTIA 3QW4B 2FLIA 5KSWA 2WO5A 3GR7A 3NG3A 5L6UA 4LVAA 4NZFA 1UCWA 1X1ZA 3P5ZA 2WV8A 3O6CA 3L2IA 3CT7A 5E1QA 1H61A 3GXNA 3A23A 4WY0A 3W72A 1IIGA 3CB8A 4CCEA 1LCOA 2WNNA 1DJNA 2V82A 3WK1A 3FOKA 3TW6A 1ADOA 1X8FA 1PE1A 4UTWC 2RHGA 3N9RA 3PBVA 2Q3OA 2J27A 4WOZA 3JRKA 3G24A 1I2RA 5DELA 4ADTA 4MFEA 1ICSA 1KM6A 1W5MA 1H7RA 3PULA 5K9XA 3NL3A 3L0NA 4HNNA 5F4XA 4H4IA 1PVNA 3C8FA 4M6VA 4UMBA 3CHVA 1OFPA 5HUPA 3HPSA 4JR5A 1XDMA 1SZEA 5HWMA 4C1LA 3TFXA 2NUYA 2YPIA 3G1FA 1M6JA 4IMDA 1LBFA 5U7SA 4LVFA 4IQLA 4O57A 5CPLA 3L5MA 4PEKA 1KM0A 2WQPA 3MHUA 1MO0A 2YX0A 1EUAA 3H55A 3KXQA 2VKZG 2TMDA 1SO3A 1VRDA 3VE9A 2V5BA 1HTIA 1F73A 4NZJA 3EXSA 3B0PA 3OA3A 2FPTA 4BWLA 1IGSA 5F2LA 3GIYA 1O95A 4TX9A 4WOQA 2J24A 4ICNA 4IXHA 3STGA 2GVLA 3EXRA 3LLFA 4FNPA 1JJKA 1JRBA 3W7JA 1GOXA 1JQVA 3TC6A 3YPIA 1ZAHA 1H50A 4JY8A 1NVMA 1XC4A 1ZCOA 2AGKA 5I3JA 3W7MA 1XFBA 4CQ8A 4DELA 2CZEA 1VHNA 1H7OA 3P84A 4LOCA 1HO4A 4PFMA 3W70A 4BI5A 3S1WA 4DQWA 4GUJA 3W83A 5ABTA 3KRZA 1DQWA 3EWUA 1JUBA 4BWLC 1FCVA 3NM3A 1C8VA 1IF2A 3QMTA 4XUGA 4AB4A 5I3KA 1FCQA 2XN0A 2YXGA 3RMJA 4XTDA 2A21A 3KOFA 2FB2A 4YL2A 4JTUA 2A6NA 1XDLA 1GYLA 3QPZA 1OX4A 2XN2A 3FJ6A 3GVGA 5SWUA 1VQTA 4ALDA 3TC7A 3E9AA 4FIRA 1LLZA 5G4EA 1LZOA 5I3IA 4MVAA 1I8JA 5IM51 1RVGA 1YXDA 1F2JA 4UTIA 3ZR4A 3ABQA 1RPXA 4LC6A 1OJXA 4R7JA 1W56A 3QW3A 1YXCA 2Y85A 1RD5A 2AQWA 3I6RA 3K30A 5K9CA 3H54A 2E1DA 1D3HA 5D32A 5AHNA 2V2HA 1L6YA 1GZGA 3LGEA 1A5BA 1IXPA 5H91A 2GQ9A 4GUGA 3I7QA 3W1AA 1VYSX 2YYTA 2JKPA 1WX0A 1XBYA 2E5BA 5FEPA 5D02A 1VHCA 4LVDA 3LCLA 2ATSA 1SO5A 3W1PA 1QPNA 1ALDA 3KRUA 3M44A 4HNTA 1M7OA 3G3MA 3W7IA 4PH6A 1QPRA 5G1TA 2QUVA 3RFAA 4HSOA 4JGDA 1XI3A 4DO6A 2CLMA 3U6WA 3IGXA 5F2GA 2B7NA 4MZYA 3DHDA 2V9DA 3B06A 3PS7A 5BOOA 1ZJIA 3KVMA 2GJLA 3W74A 3W2JA 4CNOA 1TTJA 4MY9A 4LV9A 5D30A 4O14A 1WOBA 3ZWTA 4FIQA 4S2BA 3P7YA 1X6UA 4PL1A 2Q3RA 3OHIA 4UFHA 3W7KA 1A5CA 3CTLA 1TV7A 1VYRA 4UNLA 2QDGA 4HT3A 2VOMA 3IIOA 4QISA 2DU2A 1EB3A 4A2SA 1FWTA 2H90A 1U83A 1XM3A 4DF0A 2V8ZA 4RZ4A 1G4EA 3VKJA 2GOUA 2NV2A 2VFIA 1TJRA 2Y7DA 2PURA 4O18A 5F1UA 4UMAA 4NNBA 1TTQA 3T44A 4M7SA 3V1PA 2RDWA 3IEBA 1OX5A 3W1XA 1S3HA 4K36A 2EAWA 3P81A 5G5IA 3CIWA 5AOUA 3EX1A 3EWBX 3E96A 4O13A 4IGHA 3CEUA 2WSQA 4I7UA 3LHZA 3LCGA 1JCMP 1R2SA 5HWNA 5AB3A 2WNZA 3TAKA 3SSJA 3IV3A 1SFJA 5C55A 3W6YA 3W75A 2NXGA 2E68A 4M6QA 3DZ1A 3L9CA 2QUTA 3H53A 3LRLA 1FBAA 4XWUA 3ZS4A 1KTBA 5G4WA 1O5XA 4CNPA 1TPEA 4AVFA 2TSYA 3QMRA 3W1LA 4UIOA 3KAOA 4O1CA 5I3HA 3NQFA 4UNKA 2B0MA 4XKYB 3AJXA 1PS9A 4IXXA 2WKJA 4JTFA 4ML9A 1YADA 1GYNA 2W0UA 4GNJA 4YCOA 1ME9A 4P2VA 2VEIA 1WBHA 1TPC1 4HNVA 3C6CA 2LLEA 1RV8A 2GQAA 5BRBA 2A6LA 3C2EA 4AXKA 1KM5A 4JD4A 1TB3A 1SW7A 3FFSA 4Z1DA 1OFOA 5LGXA 2NX1A 1QNVA 3TQ0A 2DZSA 5FEXA 3GX9A 3KFTA 3W7OA 1JCNA 2DZXA 4GBUA 2X16A 4JTLA 3G3DA 3EKLA 3LCIA 4QNWA 4IPIA 3UXDA 2RDTA 3GDMA 4RZ6A 2Y63A 4MYAA 4WUIA 3G8RA 1K8XA 2OZ0A 3W73A 2JK2A 1ZALA 4R34A 4GJ1A 3NQEA 1X1OA 2JBMA 4WXZA 1K8ZA 4OGZA 3NQDA 3QPYA 3P5YA 3TKFA 3B04A 4P61A 3BG3A 5U4NA 3UZ5A 1SZGA 2BZNA 4Z1CA 1TQJA 4CNNA 4TIMA 5KINA 3MBDA 4EF8A 3IVSA 3NPVA 1H7PA 3LI1A 2X1TA 2ZZ6A 2TYSA 1G7VA 5G2HA 3OIXA 4JNMA 1FWSA 3QZEA 3UXAA 3HF3A 4LS2A 4IOTA 4DXVA 3DH7A 3RLVA 1MXSA 3FA5A 4LW7A 1G7UA 4NJJA 1JUEA 4Q4KA 3IIVA 2C14A 3EXTA 2G95A 3QQ1A 4CQ9A 1M7PA 3M43A 1QO5A 3GZ3A 2VEPA 1B4KA 2ZTKA 1G4PA 3S1UA 3FKRA 1M5WA 3OVPA 5FESA 4IPJA 3O1NA 2CLIA 5KZEA 4O1BA 3NXFA 2EHHA 3O06A 1TTIA 3EX2A 5AHLA 3RU6A 3TE9A 3WJYA 2V0TA 4M19A 1DJQA 4IMCA 1PHWA 3S5OA 2X1RA 3NO5A 5DXYA 1Q6RA 1Q6OA 4AF0A 3HPXA 4KFOA 4N9BA 3EEGA 1DHPA 1DL3A 1OYCA 2QUUA 4NUWA 3KVLA 2ZA1A 2QEZA 4LC8A 3DFOA 3OBKA 4JTEA 5BW6A 1ML1A 1TIMA 1FDZA 3NAVA 4J9JA 1YYAA 3SW6A 3M1ZA 3ANYA 5AC8A 5LNVA 5DY3A 3THQA 3TXZA 3HGOA 2OMAA 1GVOA 4GXMA 3FS2A 3OEXA 3CM4A 5CZ0A 4HNUA 4WJEA 5G2IA 1JCYA 2C18A 4Z08A 1VCFA 1I45A 5KITA 4Z1AA 3G1DA 4LV4A 5K7JA 5DY2A 1AW5A 1WAUA 5TQLA 3W2NA 1J5TA 5HWJA 1FDJA 1RQBA 3MW7A 3WJZA 3C61A 4O0KA 3B0VC 3W2UA 4S1FA 1EP3A 5AC7A 4N02A 3DXIA 4TO8A 4YWIA 3BW2A 4K39A 2FDSA 4EIVA 3N73A 5I3FA 1YLVA 4W9TA 3VFLA 1TO3A 3HGRA 3IIXA 3TSMA 2B7OA 2CLHA 1I2QA 3LHUA 4O1AA 1RQEA 4UTTA 2XN1A 5D2YA 1ZAJA 2CU0A 3LHVA 4JTKA 4UTHA 4PL2A 3W87A 4QSHA 1QCWA 2Y89A 3WJWA 3PSWA 5CZJA 5C5YA 4MJZA 3LB0A 1FXPA 2A7NA 1Z41A 1Z44A 1Q3NA 4HPJA 3W7EA 2C0AA 5HINA 4BFAA 1DORA 4MIMA 3KVKA 3W23A 3N14A 3LTSA 2QCGA 5HJLA 4XZ9A 4ZQCA 1SZNA 3F03K 3GR8A 5HNRA 2QKFA 4JXCA 3B8DA 3PG9A 2C1HA 1YDNA 3T55A 4Y96A 4UTTC 3BG9A 3HJZA 5L9FA 1UJPA 3DKJA 3BW3A 2O7SA 3IGUA 1KM2A 3NPWA 3EX6A 4L4LA 2H3DA 3P8IA 2PRLA 5AC6A 5F4WA 3S1VA 5F2IA 1KM3A 1OYAA 2QF7A 3HBLA 4FEZA 4MKNA 1KBIA 4I7WA 1W5NA 5G2WA 4I7VA 2Q8LA 3MP5A 3CLMA 1OFDA 1WBJA 4HN4A 1SUXA 1J4EA 3ATZA 1WV2A 4NQ1A 3G8EA 1GG1A 3EX4A 1O60A 2QJHA 3NQ7A 1Z42A 4R53A 3NZRA 2YDAA 1LBLA 4NX0A 3C2OA 3B03A 1KFCA 5D09A 2R14A 3M16A 3R89A 2PCQA 2YSWA 2Y61A 4EWND 3W9ZA 2YGYA 2ZRYA 1FWNA 1MEIA 3QRHA 1ZNNA 1G67A 2F7FA 5LNWA 3F1QA 3UZJA 2H6RA 5AN7A 1P4CA 2XFWA 1W3TA 2FQIA 3LRMA 4N9DA 5FF7A 3V75A 3TH6A 3M41A 3ABRA 5HR6A 5FF2A 2FTPA 3G18A 3BVJA 3IGSA 3G1VA 4K37A 1K7XA 4KKXA 4AHPA 3UWVA 3AO0A 2P10A 1JCJA 1UBSA 2QCMA 3F4NA 2WOQA 4JICA 2A5HA 1P0KA 1WDWA 2NWRA 5K4XA 2EKCA 2VFHA 1NF7A 4MZ8A 3W1TA 4BR1A 1F6PA 3GLCA 1GTEA 4LS1A 2HSAA 1LOLA 1W1ZA 2Z6IA 2ALDA 2QDHA 1UASA 4UUIA 3HG4A 3Q94A 3TUUA 3MUXA 2PRMA 1W8SA 2ZZ7A 3ELFA 5CPMA 4GUIA 3W2MA 4YMZA 3TFCA 1MEWA 4LVBA 2HS8A 2QCDB 3TDFA 2VELA 1H5YA 2A1YA 3TW7A 1TV8A 3DGRA 3NQCA 5GVJA 1SO4A 4RX0A 1ME8A 2C15A 2E6DA 3HOJA 4UTUA 1QMLA 4YLWA 1HL2A 2R94A 3LI0A 1CW2A 3WK0A 4FXSA 1BWLA 3KVJA 3TJXA 2QCEA 3TSBA 5D2WA 4XQ6A 4RXFA 1OFQA 1VCVA 1LM1A 3VNDA 2C3ZA 1OG0A 4OU1A 3S5NA 3GK0A 3W7NA 4FNTA 3HIJA 2CLEA 3P74A 4WY0F 3W07A 2OT1A 2A2IA 1VH7A 1P1XA 3CEPA 3E12A 3R2GA 3UY8A 1OVDA 3G22A 4O15A 3I7RA 1I2PA 4NX5A 3KX6A 4E38A 3N9SA 1L9WA 1NEYA 1PIIA 3GB6A 2QCCA 3PUOA 4EVZA 3FLUA 4WQ6A 5FI8A 3HG2A 5EBUA 1TPH1 3NQ2A 2I14A 3L65A 3JR2A 3PB0A 4YXGA 5LKYA 4DBDA 1WYIA 3UY7A 3O6DA 4ZMGA 3TROA 1O5KA 3UWQA 3CIXA 3C56A 2CLFA 3L5AA 1V7YA 1K7FA 2GVGA 4H3DA 2GVJA 1JQXA 3W7LA 4IJBA 4JY9A 5MHBA 3PG8A 3M7WA 5CZTA 3GKFA 3LLDA 3QC3A 4OBTA 3ZFHA 2A0NA 3G0UA 2H3BA 1QFEA 1XKYA 5EKYA 3MHFA 5FEZA 3OG3A 3QSTA 2Z0IA 1O4UA 2ZA2A 1IXQA 2GUUA 2CLLA 4PC8A 4OQVA 4DPQA 5CSRA 2JGYA 4PA8A 1UUMA 4K6AA 2GJNA 2JGQA 4RJEA 1FXQA 1OFAA 5KZDA 1QAPA 2B4GA 1LTDA 4HIBA 4PCFA 4O54A 4QQ3A 5TBOA 1KTNA 4U4MA 3LERA 4FB7A 1RR2A 4IUOA 3TCEA 2C19A 3S9YA 1X7FA 5D2XA 2X30A 3LCWA 4OWGA 1MSSA 3O05A 2R8WA 2RFGA 2NXIA 1QO2A 1R47A 3WK2A 1I4NA 2VC6A 5EA9A 3PVFA 4O19A 1W5OA 4RKAA 3L5LA 3LHTA 4OHQA 2G96A 4JIPA 1BTMA 4LTSA 4ZQOA 3C2FA 2ZZ4A 3ABSA 2ZRZA 3W71A 3BK0A 3S8HA 1PCWA 2C6QA 3S5ZA 4I9AA 4HKPA 1QPOA 2PRHA 3STCA 4JYEA 4XBKA 1V5XA 1CX9A 1KV8A 1TJPA 2Y7GA 4UFJA 5CG7A 2O7QA 4BK9A 2OJPA 2WSYA 1TPWA 3TMLA 1FQ0A 4RZ5A 1JCLA 4MLRA 1HFBA 1W3NA 1RZMA 5F4SA 3N2MA 5LNSA 4GUHA 4O12A 2F84A 3HGJA 5K9DA 3E0IA 3GNDA 1KM1A 4MY8A 1VYPX 3BW4A 3GDRA 2E6AA 5CGQA 3INPA 5AYZA 3W2LA 3DFQA 4O4VA 3QFEA 2Z2UA 4FX6M 4O52A 2ZZ1A 2J9XA 2J9YA 3DI1A 4LWWA 3QQ0A 1J2WA 1XL9A 5TIMA 4Q33A 1L6SA 3MYOA 3NQVA 2DORA 3LBCA 3HO8A 3LHWA 4TU1A 1DV7A 1ICPA 3PAJA 5DXXA 1EP2A 3TR2A 1OF6A 1GT8A 1R46A 1LLWA 5LZLA 3S0CA 1VLIA 1GPWA 5LSMA 4D2JA 5DBTA 4NJIA 4KWWA 3SFKA 4Y8FA 1KFEA 4N6EA 4ADSA 1G4TA 5DCEA 2PC4A 4R33A 2A85A 2CWNA 5HULA 4GWEA 3NA8A 2HTMA 4JN6A 3PM6A 1NF0A 4O28A 3SECA 1KFJA 2YR1A 3SR7A 2Y6ZA 1F05A 1P0NA 3PR2A 1WXJA 2CZDA 1CI1A 2HS6A 4UTLA 4Z1BA 1YDVA 4XKYA 4UR8A 4DEFA 4RLIA 1H1ZA 4X9SA 3LV6A 4UTJA 1DVJA 1S5VA 2W6RA 2QJGA 2QCLA 1R2RA 5FF4A 3TJLA 4C1KA 4A29A 4JDYA 4UFMA 3BGGA 4POCA 1L2UA 2RDUA 4AEOA 3MMTA 5AYXA 1I2NA 2YFNA 2EGZA 2QCFA 4ORMA 4N6FA 4U28A 3W88A 2YW3A 3WFAA 5AFDA 5D2TA 3DFSA 5AHIA 5DCDA 4ZQMA 1FWRA 1WQ5A 1ICQA 4PODA 2FB3A 3NZ1A 3PUDA 5T26A 1W54A 3TQKA 3BPWA 1XUZA 1ZFJA 3GDTA 1TPVA 2QR6A 4MZ1A 1AMKA 1A5SA 3MWAA 3NVTA 1W0MA 3G0XA 3MI3A 2FFCA 3NOEA 3P8JA 3W2KA 3SY5A 3L66A 4UXDA 4AWUA 3EWYA 1GG0A 4QIUA 3GAYA 3GXPA
chains in the Genus database with same CATH superfamily
3H2NA 2I5QA 1VBUA 4KWVA 3NTYA 3QEZA 4QFUA 1EX5A 5D33A 2ZCGA 1C9DA 4LVGA 4O4WA 3NOYA 2HISA 4H7ZA 1T40A 2QNEA 3U2OA 1FWIC 1QOQA 4QR6A 5GJPA 1D2KA 4QCFA 1QNPA 3L12A 3OTRA 3WNPA 4FNQA 2Y0FA 3GDLA 1ZBWA 1H0GA 4UFIA 2OKTA 3LS9A 4KEZA 4WKAA 4ZO9A 4C90A 2D23A 3G0SA 4Z0JA 4Q8PA 5HQEA 4RUBA 3S9ZA 3B05A 3N25A 4D1JA 2R9RA 1WOAA 3WUGA 2CPUA 4MYXA 3S2JA 1GVFA 6TIMA 1XYAA 1DWGM 3NCOA 5HA7A 4W4QA 2NQLA 5AYBA 3OZYA 4IJCA 4XO7A 1FKWA 1LRQA 4PBEA 1ONEA 3CUIA 1U5JA 3N17A 3GUGA 2GSHA 3B0YA 3GDKA 2BWGA 1UROA 4WY0B 3T2QA 1DBTA 4G2DA 4GJIA 2PC8A 3BUVA 2YDRA 4D6IA 3G1XA 4BI6A 5J8LA 3IJ8A 4GIEA 3DGBA 1KFLA 2RKXA 3FCPA 3QQWA 2F2HA 4NKCA 1MNZA 3RNDA 2ZRVA 1HKWA 3WK3A 3DFTA 1Q63A 1TSIA 4PRTA 4DAFA 4KWUA 3VNKA 5C7VA 4XV0A 4HMDA 3TNBA 4B15A 1JL8A 2ZZ2A 4DY1A 5AHFA 4FMVA 4HHHA 4EKJA 1E0TA 2J75A 1BPLB 1TVPA 1M01A 3RG6A 4AW7A 4PZVA 1BKSA 2DH3A 1EJXC 3O6YX 1SSGA 5D8WA 3EX3A 5LHEA 4WKFA 2OT0A 5XIMA 2ZUWA 1OWQA 4S3FA 2XH0A 4Y9AA 2AKZA 5E09A 1DXFA 2V81A 2A4AA 3VI2A 4MHBA 3U7VA 3GU1A 3WQGA 4WRHA 4X63A 3GE7A 3CZ8A 1TJ0A 2GYIA 3N19B 3W7CA 4UMCA 1K3UA 4EACA 3I10A 1N8FA 4B92A 2Z6JA 4BF9A 4U2YA 3B0UX 4XG1A 2B31A 3O0FA 4AZ7A 2HVMA 3BICA 3LDVA 3ARYA 3NUKA 4WLCA 1KQZA 3S4TA 4GNKB 2CLOA 3FSUA 1IWBA 3F2DA 2RJHA 2CZFA 3Q58A 2QQ6A 3S2LA 2BLEA 1TMQA 4QJ3B 2Z28A 4P7OA 5D4YA 1LROA 2ZDRA 3ARSA 3RJXA 5A69A 2XUCA 3QTPA 5DQPA 3VIJA 3F5LA 3GH7A 3LSCA 1Y0EA 3DENA 4DPPA 3W1UA 4J3WA 2BX7A 3AXMA 5FSDC 1ME7A 1AG1O 3LMYA 1KTCA 3CH9A 1ZAIA 3EKZA 4ZOEA 1B4EA 2NX3A 5HDRA 1CXEA 1H60A 3UPBA 4AZGA 5A8GA 1TRIA 1FCUA 4MJ4A 2NLYA 2F6KA 3VOJA 3TN4A 1JUKA 3UXLA 1MW1A 1W3IA 4H6KA 4DLFA 3TA9A 4DUXA 4O11A 3HPZA 3N34A 4GC3A 3E3HA 3WD1A 3G1YA 1PZ0A 4Z0SA 1EH9A 3N9KA 4RW5A 1UA7A 4MSSA 1B3OA 5BU6A 4QEEA 1YXYA 1WUEA 4NAEA 3B8UA 5JBEA 1KLYA 3LM3A 3WMLA 1E1EA 1E0UA 5HJXA 2FGLA 4ONVA 3I65A 2VCAA 1OABA 5AHMA 1EP1A 2X7VA 3NQAA 1S5WA 3IRSA 2Q8ZA 3CHDA 1OZQA 1Q7MA 3N4FA 2CXGA 1VS1A 3PPCA 3B9EA 1BVNP 1GEQA 3KBSA 4JNYA 3THDA 4CD6A 4AX6A 5A2BA 1SYTA 2V30A 4C1NA 6XIMA 4UQDA 2AOSA 2JF6A 3THCA 3PZNA 3KWXA 2ZFAA 1XCFA 4UR7A 2IXVA 4Q4SA 1V0LA 1WA3A 3MVIA 2WSRA 1E72M 1QDSA 3DG3A 3U8GA 3VD5A 5F7UA 1XLLA 2D0FA 1JDEA 1B90A 1IEIA 4D6EA 2ZC8A 4D6HA 2JEPA 4RW3A 1M65A 1TV5A 1XYLA 1RCQA 3BLLA 4DWDA 4US5D 1IXOA 2W92A 2XJ7A 3B4UA 1FCBA 4CD5A 3W86A 4OV4A 5D2VA 1W9VA 4ZENA 4V2XA 1DJHA 5M5DA 4DJDA 1JRCA 1E6XM 3E49A 3H4GA 1E0WA 2R82A 4RE4A 5C9UA 2DZVA 2P5NA 3M0IA 4N2YA 2VRKA 4J7RA 4YN5A 8TIMA 4D8ZA 2WZMA 3IVUA 1ONRA 1O12A 3NPUA 2J6XA 4BJHA 2VO5A 1Z3NA 1AD1A 4MGGA 4HHPA 3KP0A 2FVMA 1JVNA 3NNTA 1E3ZA 3DAQA 4HPXA 2D0HA 1H09A 4PB3A 3KEHA 3MUIA 3CYJA 1CECA 3AJ7A 1M9HA 4ES4A 2RAGA 1QT1A 3LXCA 1IT7A 3AHYA 3JZEA 1NWUA 2G37A 2OZ3A 1SW3A 2TAAA 1ZB5A 4LEQA 3A3HA 4YHEA 1OFEA 1F4HA 5EYWA 1TA3B 1F7BA 4IWWA 4GI8A 4JTGA 3WD4A 3LBOA 4LT9A 1EF2A 1E3XA 2A3CA 5DN1A 1SR9A 4GYJA 1YNYA 1OB0A 4LY8A 4IF2A 1PO9A 1CXFA 2Z7GA 3CV2A 3RGTA 3UD6A 5DF0A 5DMLA 1J93A 3WEOA 1Q8JA 4GXWA 2V63A 4H6EA 5C8BB 2PB1A 3PBWA 3UWUA 3E02A 1YDOA 2VT0A 3AZRA 3AWNA 2GPTA 1W1TA 2X41A 4KFNA 3H4XA 2H8XA 4U31A 2E09A 4HSNA 4B5WA 3CLWA 2UV8G 4CU6A 1KQYA 1VGAA 3FVDA 2FJKA 3H2OA 2FTWA 1K6WA 3DBPA 3SCPA 3MJYA 1NSJA 3K46A 2ZUUA 5EBAA 3GC2A 1TQXA 4YIWA 2TRSA 3DFPA 4XAFA 1QR7A 1NARA 4JDBA 4GFIA 1THFD 2Y8UA 2NLIA 1RY0A 4LXFA 1O94A 1H7XA 2P0IA 3QVQA 1O6IA 3A21A 2C16A 2X09A 3WQPA 3TA6A 1C3FA 3LTYA 5ABFA 4QBXA 1YPXA 1F07A 1B30A 4LNYA 4JN8A 3WBYA 3FEMA 3LQLA 4CD4A 3ZVHB 2E5DA 3O07A 3EDKA 2BXYA 3L68A 1JPDX 3UA3A 4EWJA 3QHNA 3OZOA 3WEZA 4RV8A 2W66A 1WUFA 4S23A 4CCCA 2GFTA 1SW0A 3WF3A 3D46A 5CQ1A 3SRFA 2V2CA 5D05A 1XYCA 2ZXBA 3F7JA 4HA3A 4QJ4B 4GO9A 1OZMA 3NL2A 3GG0A 2VQTA 3FVMA 1AODA 2YZRA 3P60A 3N15A 2ZWZA 1DQUA 3VM7A 2CESA 2DZUA 5AHEA 4LS0A 1PCKA 1IEVA 5JIWA 3RPDA 4H01A 3CWHA 3LXAA 2WBGA 1NDYA 1I75A 4XKMA 4YCPA 2SFPA 4ZVJA 3GSMA 4E2DA 3UVIA 4OT7A 2CXEA 1RA0A 3HMCA 1MEHA 1AL7A 1LORA 5D9PA 2Z1BA 2WVVB 1HZYA 4J3UA 1GZJA 5A6AA 3TNOA 2OQLA 3UGVA 3USBA 4XAZA 1NTHA 3BQ5A 1IEXA 1BVWA 4KMQA 1BXCA 2RGLA 1GOOA 3C2RA 1IEWA 1P6WA 4ERGA 1YPFA 4AHOA 3TU9A 1R30A 2V38A 4K68A 3D6NA 3TOPA 2YW4A 2R24A 1V0NA 3A5FA 4EK7A 1GNXA 1P48A 2F6XA 2O9PA 4I5XA 4LVAA 1UCWA 4PUWA 3QGAC 1S2AA 3L2IA 1TWDA 3GXNA 3E38A 3CB8A 4CCEA 1DJNA 1UR4A 2E9LA 3K13A 3WK1A 2CITA 2ZADA 4AEEA 3OIHA 3TW6A 3LLXA 1JXJA 1PE1A 4LQ1A 2D3LA 2Q3OA 2J27A 2NQJA 2VDIA 3FAWA 4J2MA 1ICSA 1KM6A 1S3TC 1W5MA 2GWGA 1AH3A 3CMFA 4HNNA 3UYIA 3WQWA 3V36A 1HJVA 4DJFD 4M6VA 3CUZA 1VIZA 2G4FA 3WDQA 2JEQA 4JTRA 3VPLA 3N1AA 1XG4A 3DECA 1EC8A 2V5CA 3QR1A 3L5MA 2AGTA 1EO7A 1QWKA 1R3QA 2EPKX 2PDGA 4C5YA 2VKZG 2TMDA 3UG5A 2WBKA 2X40A 2VURA 3VE9A 3UA4A 1HTIA 4HZ6A 3EXSA 3MSGA 4CQCA 1UHVA 1GKQA 1WDRA 4WOQA 1M7XA 4HK7A 4B5VA 4CVWA 5D9OA 4IP7A 1J0JA 3LLFA 4QCEA 4H9TA 1P0DA 4Q4MA 1DWIM 4U33A 1P1MA 1JQVA 1PZ2A 1AQFA 2Z2BA 1RLDA 4Z2LA 2FHCA 4M82A 2D0GA 1YE4A 4XAPA 2XVGA 2HXUA 2IQDA 2CZEA 4LOCA 4BI5A 1DIDA 3LU2A 4DBWA 4MNKA 1V6UA 4RE3A 3EWUA 2IPJA 4BWLC 3B3DA 3HV9A 3NM3A 2OODA 3QMTA 5I3KA 2OEJA 4JNZA 3RMJA 2JF7A 3UF9A 4DB7A 4S3KA 4C7GA 4JTUA 2EJ1A 3QPZA 1OX4A 1RJQA 2HROA 4ALDA 3UZXA 3E9AA 5G4EA 2VI0A 2OELA 4MVAA 2BGSA 3MMDA 2NQ5A 4E4UA 1RPXA 4AIOA 1O5QA 1MRAA 3VU2A 2XSXA 3UZZA 3I6RA 2AL1A 2HQAA 3WDHA 1D3HA 5D32A 3RX3A 3IACA 1CGXA 2BG5A 3LY0A 1IXPA 3AHXA 5H91A 5DX7A 3HM7A 3TR9A 1W1YA 3U2ZA 3UXKA 4QLLA 4V27A 2J8FA 3OLDA 3H2CA 1S38A 4PE8A 3KRUA 2XH2A 4R3UA 3NGFA 1V02A 3G3MA 4GHRA 5G1TA 3SO7A 3RFAA 1TFVA 2VZSA 4Z2IA 5F2GA 2B7NA 3DHDA 3B06A 1WDDA 1US2A 4S3DA 1ONWA 2YJQA 1CTNA 1WZAA 4C6CA 2GGJA 2GJLA 2UY4A 4C6QA 3RX2A 4FOKA 4IL0A 2QV4A 1ZL1A 3ZWTA 2G0WA 4FIQA 7REQB 4HOWA 1A3XA 3M0LA 3QR3A 3OHIA 3SRKA 3CTLA 4BQ2A 1TV7A 1VYRA 4UNLA 2VOMA 3IIOA 5IDZA 3T2PA 4GI9A 2H90A 1XM3A 4DF0A 1V3LA 2PTWA 3W02A 1M7JA 2GOUA 4O18A 2PURA 3PZMA 1M68A 3D3AA 3PNZA 1TTQA 3TN3A 4QX4A 3T44A 3RITA 3VNLA 1S3HA 4C5ZA 4K36A 2EAWA 1Q7ZA 1JDAA 5AOUA 4KCWA 4ZXOA 1QBAA 3BH4A 3RJYA 3CEUA 2WSQA 1I60A 2WMIA 1G1YA 2Q71A 2NT0A 2OXNA 3IJQA 4KRTA 3IV3A 1SFJA 5C55A 3W75A 2E68A 5IFPA 2PDPA 3LPGA 4ICMA 1F3XA 3LRLA 3VM5A 1EBGA 1N2VA 3WO8A 5EFDA 4B4HA 3RUBL 5G4WA 4Q4OA 4DJDD 4KEUA 3VD9A 1O5XA 4D9PA 4U5IA 2DQWA 1GOIA 3QMRA 5BWFA 1S1PA 1L8PA 2VR4A 2W63A 1CDGA 1Q13A 4IXXA 1VENA 1HKVA 4Q8NA 1ZRQA 2ZE3A 4GNJA 4YCOA 1J9YA 2POTA 1TJ2A 1UQYA 2IKHA 4X2PA 3U5UA 2O56A 3BE7A 3W82A 2JE8A 4HNVA 4L6DA 4JHZA 3C6CA 4F2TA 1RV8A 2PDWA 3OZMA 3L4TA 3PZGA 4IPPA 4PMZA 2A6LA 2PDMA 4JD4A 4XUYA 1PIGA 2VR5A 2DZSA 5FEXA 3GX9A 2O0TA 3W7OA 2DZXA 1IQ8A 1XD1A 3EKLA 1V3HA 3CGTA 4IPIA 2AQVA 4H9XA 2RDTA 2PD5A 3E5BA 1UH3A 4EXBA 3VGGA 3RHGA 4GD0A 5G1MA 5E0FA 4PTDA 4B5XA 4S38A 4L9XA 1FFQA 1TELA 3W73A 3VGEA 2JK2A 4GJ1A 4AUBA 4EE9A 1K8ZA 1QI3A 4OGZA 3P5YA 3OOQA 2XSBA 5U4NA 3UJ2A 3LPOA 1SZGA 4Z1CA 4XBJA 3OLGA 5CAHA 3LQGA 4EF8A 4ZCWA 1R7AA 4B9YA 1RJRA 1H7PA 2X1TA 2ZZ6A 1XC6A 1G7VA 1V51A 2X0SA 1R3VA 1F8IA 1FWSA 3QZEA 5A8NA 4JHOA 2YKKA 4IOTA 1JZ5A 3DH7A 1MXSA 3SUTA 3W53A 4AIBA 4MNJA 1G7UA 4NJJA 3Q4DA 2REQA 3AOFA 5JUVA 3IIVA 1BGGA 1QTWA 4CQ9A 1M7PA 2VEPA 4TTUA 1NJJA 1G4PA 2IS7A 1M5WA 1PKNA 2CLIA 2C8NA 2HE5A 2XFYA 3SAZA 2Y5EA 3WJYA 4IMCA 1L8NA 4PMJA 3REQA 1U1JA 1PXGA 3S5OA 1JEZA 1Q6OA 4BQ5A 4CN6A 2QUUA 2ZA1A 3ZSSA 4QE4A 4J3XA 4JTEA 5PTDA 4C6MA 1FDZA 5IRPA 3M1ZA 1UR9A 2EQDA 2HBXA 3THQA 1EYWA 2OMAA 1GVOA 2GSJA 4DWSC 1Q6CA 4XISA 5G2IA 2VMFA 1O7AA 4N0RA 4PTMA 5H6HA 5KITA 4LV4A 5K7JA 4LCSA 5A95A 4F0MA 3W2NA 1ISWA 4J3TA 3MW7A 3WJZA 1SJBA 3B0VC 4S1FA 4R85A 4K2SA 2DZBA 4TO8A 3F2CA 4YWIA 1R0MA 3CYVA 3BW2A 4YS1A 4EIVA 1DXIA 3WELA 4PUKA 1L6GA 1LWHA 3IIXA 3TSMA 2B7OA 3WUEA 4C6IA 1L2QA 2PMQA 1WDQA 2HK0A 5D2YA 3CV7A 1ZAJA 4UTHA 5JH2A 4PL2A 1PKMA 1I0DA 4QSHA 4M0XA 4NI3A 1GKRA 3WJWA 1XRFA 4MJZA 1V6TA 1YHTA 4HTYA 1AH0A 2A7NA 3WD0A 3WMCA 2IQ0A 1T5AA 3ABXA 1DORA 1MW2A 3M46A 4KH2A 3MZ2A 2VWTA 1D7FA 1XLDA 4ZQCA 3F03K 5HNRA 3AHZA 3B8DA 1EL3A 2WCAA 2YA1A 3TWAA 4F66A 4HK6A 5HMEA 4H8UA 5L9FA 4NASA 3IGUA 4RNJA 3ITLA 1GPFA 5F4WA 1KM3A 1R3RA 2QF7A 4FEZA 1W5NA 5HPOA 2WXDM 4I7VA 1PBGA 1OFDA 2E9BA 1GG1A 3NZRA 5HAOA 4K8GA 3TZFA 4NX0A 3C2OA 2GK1A 3M16A 2XTKA 2Y61A 5DRIA 2ZRYA 1L0PA 1FVPA 4KS0A 3AROA 1XIDA 5LNWA 5LA2A 1W9UA 2H6RA 3CV6A 3LRMA 3PZTA 2VC7A 3ABRA 2CBJA 5FF2A 3WQCA 1KBLA 3LPFA 3IGSA 4KKXA 4XZHA 3GU2A 3CQKA 3ITOA 1NOFA 1PTDA 3W27A 4Z17A 3IJLA 4I9MA 2QCMA 3S1GA 3ENLA 2PI6A 2QVNA 5K4XA 4DM2A 2GWNA 2EKCA 4MNLA 4BR1A 3QZAA 1GTEA 4LS1A 4GIRA 4UOQA 2QDHA 1MDRA 1UASA 4UUIA 5KZ6A 3TUUA 3MUXA 1NOUA 2ZZ7A 1KO0A 3RRAA 3ZSTA 1DHKA 1EGZA 3W2MA 1XP3A 3FJ4A 4LVBA 2O9RA 5CBBA 2HS8A 2VELA 1XLEA 4NAEB 4DNMA 1R85A 3DGRA 1DTNA 2C15A 3MKKA 1A5OC 2E6DA 3HOJA 4UTUA 2JIEA 1KNWA 4U5KA 1BWLA 3KVJA 3N29A 1QHPA 2WC4A 1J6OA 3GFZA 7XIMA 1B1YA 1NQ6A 5A6KA 3GK0A 4WJXA 4FNTA 3HIJA 2VR2A 4U10A 2CLEA 2YBUA 4C1NB 4WY0F 3W07A 1S2TA 2A2IA 1WDPA 1BG9A 3BXWA 4G1NA 2OZTA 1P1XA 4TV6A 3E12A 3MSRA 1BYBA 3P93A 3C0QA 2CHNA 3ICJA 2VCBA 1L9WA 3BCJA 3SY1A 2W27A 5TF0A 2Z1SA 1E73M 2PDXA 1I0BA 1J0KA 4GXPA 3JR2A 3PB0A 1OC7A 4PUMA 5A6MA 4XZBA 2X1IA 4OBRA 3CZKA 1KCLA 3W29A 3SCOA 3AMGA 3CIXA 4JL2A 2CLFA 1V7YA 4KRUA 1U5VA 5T9CE 4H3DA 3RCNA 4PTXA 3WLHA 4IJBA 2ON3A 1JG9A 4JIHA 1XW8A 3LLDA 3QC3A 3TQPA 2A0NA 3G0UA 2WANA 5HNUA 1VFUA 3SEPA 1XDJA 1V4YA 3BLPX 1LF1A 3QSTA 2EPMX 2Z0IA 3RPTA 1NWTA 1BYCA 2ZA2A 5I23A 1IXQA 3GG8A 2GUUA 4F2UA 2WVUA 4GZ7A 1K1DA 5C9XA 2ISFA 5A2AA 4PA8A 1TWWA 1W3HA 5KZDA 2ZDSA 1QAPA 3QYSA 2J8TA 4PCFA 1KTNA 4U4MA 4BEQA 3S2NA 1RR2A 3TCEA 4D6CA 3S9YA 3VD3A 3R10A 5D2XA 3LCWA 4OWGA 1VFLA 4QROA 3R0DA 2R8WA 2RFGA 4KGJA 1UH4A 3WK2A 3PPGA 1BRLA 3OW1A 4RKAA 3L5LA 4AVOA 4OHQA 2G96A 3HPAA 2YXXA 1MZRA 3T2OA 3KWSA 2PP0A 4AD2A 4LAMA 2GOKA 3W71A 3AMKA 3BK0A 2C6QA 3S5ZA 3DEQA 4HKPA 2P88A 3SADA 3STCA 1BTCA 1V5XA 3AIRA 4XD5A 3ZMRA 1IV8A 1QJWA 1E6ZA 5A8QA 2Y7GA 4CD7A 4US6A 4AX7A 5CG7A 3FEQA 4H04A 2YLAA 4MLRA 3HQOA 1HFBA 1AJZA 1W3NA 2QIIA 3VC6A 1O66A 4ZGYA 4IG2A 8A3HA 2F84A 1EHNA 3AYTA 5JIPA 4MY8A 1X97A 4RPPA 3BW4A 3OVGA 2E6AA 3HQNA 3INPA 2WMGA 3KOXA 4ZO7A 2R1PA 4YVXA 3QFEA 3RU8X 3EA2A 4O52A 2ZZ1A 3QQ0A 1XL9A 3KBJA 1SZRA 3HO8A 3LHWA 4MWAD 1EP2A 4UTFA 1R46A 5HNNA 2G50A 2GVEA 1Q8AA 1LLWA 4LBSA 2OWCA 1PIFA 1OQFA 4KWWA 4Y8FA 1KFEA 4N6EA 5CZKA 5BXRA 5DCEA 2PC4A 2WZEA 3QV7A 4CNSA 3NA8A 4JN6A 1NM9A 1EA9C 1WXJA 1CI1A 4UTLA 4NILA 5LYRA 4ZB2A 1O1ZA 1H1ZA 3L4WA 4UTJA 4BQ3A 2W6RA 3ORWA 3TJLA 1HKIA 4A29A 4J40A 3AU6A 5ABFB 3BGAA 3BGGA 3GXIA 1RP9A 1X8CA 3MMTA 1I2NA 1XINA 2YFNA 4LB4A 3RMEA 3C86A 5EMKA 4N6FA 4U28A 1G01A 4GIAA 3PNUA 1LQ0A 2QGYA 4M80A 1C91A 4XZIA 5I06A 2ACSA 3TQKA 4CCZA 1XUZA 4F0HA 1TPVA 3GXMA 1A5SA 4BY3A 4G8TA 2VUYA 4UXDA 3EWYA 1GG0A 5I7GA 2R1NA 2VZUA 4UOJA 5J5DA 1TPB1 3T8QA 4ORIA 4TQTA 2J4GA 3P62A 3AMLA 1GHRA 5HNTA 4DRSA 1GZ1A 5AKQA 3O16A 2FMOA 1UKSA 4Y8EA 4GFSA 3NM1A 2ZA3A 3CUXA 1XBVA 5LIWX 3UEQA 2O92A 4JKKA 1FDYA 1QVBA 2J77A 4YVPA 1HIZA 1A5AA 3EDEA 1AMYA 3RK8A 1OYBA 1EC7A 1KLZA 1X96A 4PCNA 1XCWA 3PC0A 4DO5A 3CC1A 4L56A 3VMPA 3CL7A 1PV8A 4LU0A 4LAUA 4DYKA 5B80A 5T91A 2J7CA 3MSDA 3WH9A 3V0UA 2IPWA 3LGDA 2F61A 3LRKA 2ABBA 3PPFA 5CAKA 3DC0A 4V1YA 1VJIA 2Z29A 3P14A 1YTEA 3PJXA 4EXAA 3W1QA 1Z48A 1ZHAA 3NDZA 3QM3A 1GVSA 3NDYA 1YEYA 3FYOA 1Z6KA 2OQYA 3N18A 3ATYA 3N3MA 3UXIA 4O1EA 3GQYA 4RXGA 4L7ZA 5EY5A 4B9ZA 4OE7A 2D2OA 1S2WA 1GJPA 2XVKA 4FP1A 4GK8A 4C6BA 1L6WA 4P8UA 3V7PA 5KMYA 1RHCA 1H1NA 3D47A 4X22A 4O17A 2TODA 2V5KA 3W1MA 3A9BA 2IXUA 3LBMA 4WKHA 3WJXA 4MFDA 3WJSA 3ISIX 2DZTA 2ZX9A 3VZYA 4IMAA 4QG6A 4IMGA 5TAOA 3PFMA 3LV5A 2QF8A 4MUPA 2A7RA 1RPKA 4Q4QA 2BS9A 5GJNA 5A94A 3MCNA 5C9WA 1QI5A 4D71A 4DM1A 3EPOA 3F4CA 3TYBA 1NDZA 1E43A 3NDOA 4QG9A 2VJXA 2GJPA 1EYEA 1MNSA 1ZCCA 3W28A 3DG7A 3KLKA 3OLEA 1V79A 2V3EA 1F6YA 2G5WA 3TYZA 1RA5A 2YDSA 4J4KA 3EOEA 2PTXA 5CPNA 2VX7A 3URAA 5BYWA 1MVYA 4JKMA 2CFFA 2TPSA 2X1UA 3U57A 2FVKA 4TTGA 3RLHA 3TYUA 1ITUA 2PDKA 3OG2A 3LHYA 1WCGA 3MP3A 1JR1A 1A80A 3TK7A 2VZVA 2INEA 4BI7A 1HL9A 4O8RA 5JH1A 4DLMA 5EL1A 4PTWA 4PMUA 5C2XA 3VOCA 2ACRA 4CNTA 3Q65A 3L4XA 2WHMA 1GQNA 3MSYA 4KRZA 4QRNA 3HV8A 5E9XA 2OWXA 2YL9A 2X05A 1ZU8A 3U2CA 4GISA 1OX4B 4K8HA 4EAMA 1T0OA 2WJZA 4N4PA 3G1SA 1XHGA 2QJMA 1TPDA 1MFVA 5HBFA 2BVWA 1TV2A 4A3QA 3FW6A 3LCFA 4QJ5B 3P82A 1FHUA 3MO4A 1LYXA 1ZS2A 3UYCA 2PODA 4C6KA 3D0CA 1W5QA 1AFSA 3STPA 2DJXA 1GHSA 2DSZA 4DO4A 1M41A 4KEMA 4XK2A 1T99A 2WPBA 3M9YA 1PPIA 2HMCA 3MI6A 1BEUA 2QJNA 5CEWA 3GVQA 4NJGA 2WYSA 2V68A 3DYPA 2PBGA 4AY1A 3M5VA 4FNUA 2D73A 3WLNA 3KP1A 5DCBA 1CXKA 4B5TA 2WSKA 1YPIA 2E8YA 4CLMA 4X3ZA 1F3WA 2NSOA 2BFGA 2Y62A 2PDJA 3VDHA 4JN7A 3LG3A 1EDQA 1SSDA 5D9NA 3AIQA 2VXNA 3Q37A 1J10A 2ISSA 2PDHA 3VA8A 5K3VA 5A6BA 2Z24A 3SI9A 4J3VA 4WD0A 5F1VA 1H62A 2H8ZA 3SGZA 3GRIA 4QAIA 5CSYA 1SJAA 4WXYA 1P43A 3I3EA 3OLIA 4IX2A 4KW2A 2P53A 4AZHA 2YA2A 4ZFCA 2VM8A 2BXVA 2AAMA 2ZKMX 2J8GA 4AZ6A 5JBFA 2J6VA 3MI2A 2BY1A 3APGA 3QHMA 4W5ZA 2EPHA 1KM4A 1P5BA 1JCXA 1B0IA 2G3NA 4HOZA 3IUHA 5BMWA 1Q66A 1TPUA 1W8GA 4L9ZA 4Y90A 4NNAA 1A5KC 4DNHA 1OFBA 1XS2A 2W5FA 3PSVA 3NQ8A 4JBRA 1KV5A 1UR8A 3N6JA 2OYKA 1GWJA 5H2ZA 4JYDA 2HVNA 2WMIB 2XGZA 3EDJA 4MJMA 4B5NA 2ODOA 4DHGA 1H51A 2G8ZA 4IUGA 3RO6A 2P1FA 2J79A 4NXSA 3QXBA 2PDNA 1EWDA 1KFBA 3SIZA 1TMHA 1OD0A 1E0XA 3CS2A 3PWAA 5BRQA 2YIHA 4YTRA 1OK4A 5DLCA 3QSRA 3H8AA 4JAWA 2OVLA 1H49A 3QH2A 5FJJA 1BKHA 4PUDA 1AZ1A 4JZ5A 1JF6A 4RDWA 3CQ0A 1DE5A 1DQXA 1J18A 1JDDA 4IIEA 1ZP3A 5J5RA 3WLSA 3NQMA 4Q7IA 3CT2A 3EKGA 2WMHA 4H6RA 3MPGA 3MHGA 4O50A 4IMFA 2W79A 1I1WA 3C2VA 1L6FA 1YQ2A 4LUTA 3NEVA 2FJUB 3DHFA 4PTNA 4B16A 1S5NA 1K7EA 4C6OA 3C3NA 4M5PA 4JYFA 3FKKA 1UUOA 2BP1A 1IIHA 4JTIA 2FHBA 1A5LC 2VEKA 1J12A 4DBEA 3EGJA 4Z2JA 2ESCA 3EWZA 3T0DA 1LOSA 1HJSA 2NV1A 3SURA 3ZM8A 1DE6A 4W8BA 1OT1A 3S5YA 1HW6A 3SUVA 1TZ7A 1JULA 4IIHA 1TTPA 3G6LA 2KAUC 1GCYA 2NUWA 2XIQA 2VC9A 3RO8A 2ZZ3A 1QI4A 5TNVA 4J3SA 3CPUA 5D03A 7ENLA 3PUEA 3RIKA 3VIPA 1HGWA 4LCQA 2YBVA 3UWYA 1XBZA 3WD3A 4AWTA 2WM1A 5E0CA 3UNDA 2OTDA 3FHAA 3BMXA 3CXOA 4GQGA 3HJEA 5LNRA 1B57A 5B7ZA 3NYZA 2E6YA 1KA9F 1UA3A 4GC4A 1Z8AA 4GACA 2P3ZA 2REQB 3PY2A 2XVLA 2O9TA 3T7VA 3UP8A 1ECQA 4UC5A 2GDQA 3GAKA 3T0TA 4YWSA 4FO4A 4A2RA 5A5WA 1NAL1 1KBJA 5GJMA 4FNRA 5I6SA 1JZ3A 1PSCA 3CBWA 1F76A 3VE7A 1GK8A 1J0ZA 1NFPA 3NPXA 4B3KA 3REQB 3OODA 4PB5A 1GOMA 4EAYA 4Y6GA 1FHDA 2PU1A 3VIHA 1XRSA 4W89A 1QPQA 4JTAA 3DKLA 3BV7A 3W85A 2INFA 2I9EA 4HCLA 3WF1A 4AYSA 3R1ZA 3ZJ7A 2FZMA 4O1DA 4GUFA 1MUWA 3NSNA 4QJ1A 1D8WA 2ZX8A 3A5VA 7A3HA 4QHRA 1H3GA 3CZLA 5LHFA 1XKJA 4FOUA 1SZFA 1ZQ5A 3NZPA 5EMMA 4DJEC 3NL5A 3HGSA 4DAIA 5FSEC 1ISVA 4P7RA 4GMEA 1A50A 2DSVA 4E4PA 2QPXA 4NG3A 3PBYA 1POKA 5FD0A 2I17A 4QTGA 1XLHA 3ITTA 1TRDA 3O63A 1T8QA 4MOZA 3FYPA 3L21A 4ZB5A 1K02A 3V3WA 1H63A 4F9JA 3ARRA 4DIAA 3RM9A 1DKWA 2FPYA 4G56A 3N11A 4C7FA 1CGTA 1YTDA 1E1CA 2EF9A 4ZTYA 2BVDA 2YDQA 1DIOA 2DZAA 3BAWA 6ALDA 1C9WA 4Q8WA 4F40A 3H2AA 2WK2A 2FZBA 4ROPA 1DTUA 3CB3A 3K4WA 3WH8A 5XIAA 2G3MA 2FDMA 2OCZA 1LG1A 4MG4A 3STFA 1OCNA 5I0DA 3IIZA 4PTVA 1JPMA 1F74A 2ZQ0A 3ONBA 2CERA 3PZUA 4TUFA 3MO7A 1GORA 3LK6A 1W37A 4HYWA 3QW4B 4LAZA 2FLIA 5KSWA 1GW9A 4KBXA 1PDYA 4ZO6A 1EXPA 4FF5A 4NZFA 4W7UA 1Y5WA 4MAZA 4GG9A 4WVXA 3P5ZA 1QI0A 2CETA 2WV8A 3CT7A 5E1QA 3B8IA 3DFHA 1H61A 3E2VA 3A23A 3MC5A 1IIGA 2ISDA 1W3KA 3VCCA 4XSLA 3VGHA 4B2DA 4AD0A 3U0HA 1HJQA 2GK1B 4V28A 1M53A 3AHTA 4UTWC 4MDOA 3ARVA 2RHGA 3N9RA 3PBVA 2E40A 4WOZA 1GQLA 3QN3A 2EBNA 2ZXAA 2QDEA 3B8SA 4ADTA 1QPKA 1MQPA 4Q4RA 4UR9A 3I3DA 5K9XA 4ZOCA 5FJTA 4Q7BA 2D2GA 3CUJA 1PVNA 3CZEA 3H2MA 2X0YA 3NQBA 4GGHA 1E0VA 5HUPA 1GQKA 9CGTA 4HD5A 1SZEA 3LSBA 4C1LA 2YPIA 3AS3A 2PLJA 4IMDA 4HU4A 1LBFA 4EXQA 5U7SA 1QATA 3GS6A 4PEKA 3ARTA 2PDFA 4BF7A 5ECVA 4KETA 2YX0A 1EUAA 1B3YA 3KXQA 1OSEA 1FWDC 2PEVA 1SO3A 3T1GA 3SB0A 1F73A 2E1WA 2PSNA 3CMJA 1HX0A 2CCRA 4BWLA 3PJTA 1VFTA 2J74A 1FFRA 4WGXA 4IXHA 1K9EA 1E1FA 2DVTA 4FNPA 2PFHA 1R3YA 3NURA 2ZUMA 3TC6A 3TYDA 4LANA 4BKNA 3L2MA 1NVMA 1XC4A 3R43A 4LNCA 1XIBA 4CQ8A 2OOGA 1ZBCA 3W26A 4ZTXA 4A8IA 1CB7B 1H7OA 5A6TC 4PFMA 3S1WA 4DQWA 4GUJA 4MTVA 2WCGA 2VYOA 1JUBA 3EMCA 3PFRA 4W84A 4D1IA 4PUUA 2Z1KA 2YXGA 2PGEA 4QS6A 3VZXA 2A6NA 3W38A 1LWJA 2XGIA 4RDYA 1IYXA 4UB9A 3PTDA 1W1PA 3FJ6A 3B9AA 3TC7A 1VFSA 4WK9A 4JQ1A 4V33A 2J7FA 4WSJA 5DT7A 4NYYA 3U3HA 3H21A 1WNOA 5HXMA 4LC6A 3CL6A 1J8VA 3E5PA 5CBJA 1YXCA 3FDGA 2Y85A 4IGNA 5FJRA 2AQWA 2FH8A 3K30A 3H54A 3BDKA 2NVAA 2BVYA 2PDUA 3B9NA 1GZGA 1GOWA 3EDDA 2GQ9A 4GUGA 3I7QA 3W1AA 4HJFA 4P7LA 2E5BA 5FEPA 3UR8A 1RBLA 5JXQA 2WHJA 2NVDA 4TXEA 1E6RA 3PZQA 3WF2A 1NFGA 1W3JA 3M44A 1QPRA 3FNDA 2QUVA 4HSOA 4DBSA 1BRLB 1XI3A 1WKEA 5CPQA 3U6WA 2JQXA 4JFUA 2V9DA 4NI8A 4OVXA 2F38A 1RALA 2PGFA 4DO7A 4E8GA 2XM2A 1MQRA 5CG0A 1P7TA 4RNIA 3CH0A 3H22A 1EC9A 3MWCA 1E6QM 1WOBA 4S2BA 1E9IA 4Z2KA 3VKAA 1X6UA 2Q3RA 3CQHA 4Q22A 4UFHA 4LUSA 4HHLA 5BOFA 5CGMA 3UFYA 3SCUA 4IG2B 4ZODA 5CJ5A 2CZVA 4DXXA 4JTDA 2UWFA 2OSXA 3GIQA 3BCDA 3VKJA 2NV2A 1TJRA 2Y7DA 5F1UA 1KB3A 4IPNB 4NNBA 4UQEA 1CYGA 1W9PA 3IEBA 4JL1A 4ICCX 3E96A 4N7QA 1QHOA 1NU5A 2PDIA 3IK4A 4LAOA 3FA3A 1IR2A 4JFSA 1JCMP 4YTQA 2PWVA 5AB3A 3A4WA 3A6OA 2NXGA 3DZ1A 3EA1A 2QUTA 4IP5A 2DIJA 3ZS4A 3ZJ8A 1YX1A 3V18A 1TPEA 1K9TA 3P0XA 2PDLA 3GG7A 1OBAA 3KAOA 2DH2A 4GO8A 3AJXA 3A64A 1FOBA 1C8QA 3GO2A 4F9DA 3SJNA 1RAKA 1YADA 3NXLA 1GYNA 4HB7A 3TTYA 3BOFA 4FR6A 1US0A 3OJGA 3AIBA 3GM8A 4YVVA 1AD4A 2HWGA 4PN2A 4RNHA 2VEIA 4XZNX 1WB0A 2ZX6A 3LN3A 2LLEA 2GQAA 3VDCA 2PS2A 4NF7A 4AXKA 4Y9MA 3FFSA 3PUGA 2OQHA 5BXTA 4Z1DA 3BMWA 1TVNA 3TQ0A 4E3TA 4XB3A 3KFTA 2X16A 1XSJA 2Z2AA 3EWCA 3LCIA 1D8CA 4QNWA 4M81A 6A3HA 3CAVA 4RZ6A 2Y63A 4RZBA 4DZIA 2ANUA 1ZLPA 2FYMA 5IOBA 3QFWA 2WW5A 4NL1A 3PANA 3NQEA 2YL8A 1JPIA 2PF0A 4LYRA 2O4QA 1UD4A 3F4VA 3QPYA 1UP2A 2WLYA 4MB3A 2B81A 4F4RA 3F5KA 3KBWA 4P61A 2O55A 3QKZA 5BXPA 3E0LA 4CNNA 4XAGA 5KINA 1CXIA 2YCKX 3H24A 1VFFA 4UOZA 4HZ7A 4P8VA 3I4KA 1U22A 1ELSA 2TYSA 4FXJA 2DUXA 5LXXA 4PMVA 3HF3A 3MCOA 4LS2A 2OSWA 1XFCA 1DIKA 4ATWA 1JUEA 5EMJA 2NT1A 5REQA 3FY1A 3EXTA 1VPYA 4AC1X 4DWSA 3QQ1A 4YNGA 1IWAA 1QO5A 2ZTKA 4AY8A 1XH1A 4ROQA 3S1UA 3ZOAA 1EQCA 3L23A 4E2OA 1EJRC 2YCLA 3FGCA 6XIAA 1UQZA 1DP0A 4B5SA 4I5UA 3ZJKA 5D8ZA 3O06A 4WIWA 4XVDA 1Q65A 3RU6A 5IFTA 1Q6GA 3NO5A 1Q6RA 2R1KA 3E0FA 1GONA 4AF0A 1A5MC 4NUWA 1OYCA 4IGSA 3DFOA 4NZ5A 5HATA 3OBKA 3EB4A 5BW6A 3AICA 1TCMA 4GYFA 3NAVA 4J9JA 1F61A 1YYAA 1P6BA 3ANYA 5AC8A 5DY3A 3AI0A 3QY7A 4GXMA 3ONCA 3OEXA 2ZVIA 4KWSA 1JFXA 3KZSA 4L4PA 3VABA 4Z08A 5CC7A 2V69A 4Q4PA 5I77A 4NSBA 1WAUA 5TQLA 1J5TA 4BHYA 1FDJA 1A5NC 2DW6A 4DZAA 4LGXA 1CNVA 5AC7A 2A3AA 4N02A 4QE1A 3WY1A 3TYAA 4DUOA 1DWHM 5AC4A 2FDSA 5I79A 3DIPA 1GVYA 4E4FA 5I3FA 1YLVA 5FAJA 4BA0A 3HGRA 2CLHA 1I2QA 2YLLA 3LHUA 1RQEA 2XN1A 4S3CA 1KFWA 1B3VA 4GX8A 4HMCA 1MRQA 2IPFA 3UJRA 4W5UA 3PSWA 5CZJA 5C5YA 2CEQA 4PEEA 3LB0A 4PBFA 4CU7A 1Z41A 1Q3NA 1E4LA 4HPJA 3S6OA 1IT0A 3BURA 4BQ4A 5AECA 1CIUA 4BFAA 2WMJA 2EPNA 3VOFA 4IFRA 2QCGA 3OA5A 1ECEA 3K5XA 4JXCA 3WH5A 4PSRA 2J7GA 2C1HA 3ITGA 2V5DA 5LXEA 1YDNA 3VIMA 3WL1A 1TZ9A 4UTTC 1Y5XA 3BG9A 1TG7A 5ABGA 2ZXQA 3E74A 5M03A 3NPWA 8XIAA 3QLDA 1UWAA 1TV3A 3HBLA 4IFKA 1E6NA 5G2WA 3GDBA 2PDYA 3MP5A 4UNIA 2FZNA 3CLMA 1ENUA 4IFOA 3LZ5A 1SUXA 1WV2A 4NQ1A 4HVXA 1XLBA 3M0KA 3EX4A 1O60A 2FTYA 5AVHA 3NQ7A 4HN8A 4YTSA 1LBLA 3B03A 1XLIA 2R14A 2Z1VA 4C6DA 3JVAA 3MKVA 3QV6A 1X39A 4PYSA 1J0IA 1MUMA 4LAKA 4EWND 3VIFA 1FWNA 1W9BM 3B9OA 1Q2SA 1OG6A 1ZGDA 3SRDA 2WKLA 3UZJA 5A2CA 2XFWA 4PMXA 3WZ0E 4P7QA 3M41A 3S6TA 3Q67A 2NSXA 4FLSA 4IQJA 2FTPA 3G18A 4MPKA 5EGRA 1RCXB 4K37A 1K7XA 3K4AA 3WBEA 3K8LA 4ZOBA 3AO0A 5I24A 1JCJA 1RVKA 1UBSA 2A5HA 3DN5A 1CXLA 1NWSA 5I3DA 1HVXA 2VFHA 1F6PA 4WSHA 3HQPA 2HSAA 3UW6A 3BLDA 3DESA 2Z6IA 1OINA 2P8CA 1CZ1A 1UYQA 1WZMA 3RILA 3WYZA 4MAVA 3B8WA 2VHLA 3OYXA 3NZGA 2A1YA 3P2VA 3GC5A 1TV8A 3KTCA 3N2TA 1XLMA 3BTNA 2OGYA 3IJ6A 2GUBA 1AZ2A 2VL4A 4BS0A 1B3WA 3AMCA 2QCEA 3TSBA 1OFQA 1PDZA 3VNDA 4C6JA 3GG1A 2FZ9A 3ARPA 2C3ZA 1J96A 7TAAA 3P74A 1FWAC 2OT1A 1YDYA 1VAHA 5C9RA 3CEPA 3R2GA 3UY8A 3G22A 1TWZA 4O15A 1I2PA 1HQTA 3H12A 4E38A 3MUZ1 2VGBA 4KEVA 1NEYA 3PUOA 3SQSA 5FI8A 3HG2A 1TPH1 2XVNA 3NQ2A 1NP2A 3UY7A 4AIUA 1PWMA 3A47A 4ZMGA 5DT5A 3TROA 2WVTA 1O5KA 3UGRA 1U5HA 2MANA 3N2OA 3L5AA 1H4PA 3RLGA 1K7FA 1QW9A 3W7LA 4JY9A 5MHBA 3PG8A 5CZTA 1PKYA 3GKFA 4QXIA 2W91A 4ERIA 1XQLA 2FVLA 2F9RA 2I56A 3OG3A 1CGYA 1V7AA 3NO3A 4XD4A 3GNRA 5CXPA 2WZIA 4H6QA 1QK0A 3O0KA 3SBFA 2HPIA 1OM0A 4OQVA 4DPQA 4P8WA 2JGYA 3A4XA 3DUGA 1JXKA 3B97A 2B4GA 2F6UA 1P0EA 4HIBA 4O54A 4QQ3A 3GH5A 4FB7A 2W9MA 2C19A 3DX5A 1X7FA 1XLGA 4IZGA 1PJ9A 1EJ7L 3O05A 3AWOA 1VD6A 1QO2A 1R47A 2VC6A 3PVFA 4PRWA 3PHAA 5JVLA 4Y9OA 1XLJA 4TV5A 4LUTB 3LHTA 2DT0A 4JKLA 4JIPA 1BTMA 3ZR5A 1GQIA 4M56A 4NIRA 4I8YA 5FL1A 3ABSA 4KCUA 1C90A 3QBUA 2WLZA 3NZQA 1C92A 2PRHA 1UG6A 4XBKA 1OCJA 3WMBA 1KV8A 1TJPA 3VOGA 3PTKA 2O7QA 2EJAA 2J66A 3ZLHA 2WSYA 4L1WA 3V0SA 1LT7A 4RZ5A 4AD4A 5DMMA 3M4HA 2VVNA 5LNSA 1IZKA 4GUHA 4O12A 5K9DA 3E0IA 1VYPX 2GVYA 3UR2A 4I6VA 3VC5A 5AYZA 3G1RA 1T7LA 3DFQA 1BSIA 2CC0A 1C8XA 2UY3A 4FX6M 3TN6A 4LWWA 3GTIA 4Q33A 3VNYA 4MWAC 2WNWA 3NQVA 2DORA 3LBCA 3QLLA 4TU1A 4MWAE 1X98A 1CPUA 4S3GA 4CQDA 3TR2A 3W0KA 1JD7A 1KCKA 1J2BA 4A6GA 3AZTA 1UOZA 3P3BA 3I4EA 3VIIA 3MY9A 4YPJA 5DBTA 3ZO9A 4AEFA 4ADSA 1XYBA 3DG6A 3KLLA 2CWNA 4LF2A 5HULA 4AZCA 3VD7A 5C2GA 1P0NA 1FWBC 4PSPA 3DHPA 2CZDA 2HS6A 2E0PA 4Z1BA 2DIKA 4IGMA 4W7WA 2GGIA 2Q01A 4DEFA 1OD8A 1G9HA 3NFUA 3LV6A 3CTTA 4MB5A 2GSEA 4QG8A 4C1KA 5DMNA 1UZHA 4JDYA 4UFMA 3DC8A 4OFCA 4POCA 1L2UA 2RDUA 4ORMA 4G7EA 3PAOA 2YW3A 3WFAA 1A4MA 3EWDA 5AFDA 2AMGA 5D2TA 5AHIA 4TX8A 1WQ5A 4JPGA 3NZ1A 5T26A 1U30A 2RDXA 4XVEA 3HPFA 3N04A 3VCNA 1E4IA 2XIIA 2QR6A 3KW3A 4MZ1A 3R8HA 4GKLA 1AMKA 7ODCA 1W0MA 2FMNA 3MI3A 2FFCA 3P8JA 6REQA 4GYPC 3SN1A 2WZHA 3GAYA 3SCTA 3GNXA 3TAOA 3T05A 4PFHA 4M6PA 3HA1A 3QV9A 1MW3A 3AU2A 3LA4A 1I1XA 3SJ3A 1A0DA 1S5TA 3IJIA 2CW6A 1NIUA 1OGBA 1VKFA 2HCVA 4J35A 4I8DA 6TAAA 1E1CB 1LDCA 2ZVRA 3OP2A 2OG9A 1E71M 1RBAA 2DZPA 3G6MA 4H9ZA 4B3ZA 3H2FA 1VCGA 4CGTA 1U33A 1C7SA 8CGTA 4MUZA 1UR2A 3MKCA 2OLSA 3UCQA 1TYGA 4B91A 3VKKA 3GKAA 4R7OA 3ZVHA 4JX6A 2DW7A 3POHA 1HNYA 4IISA 3RX4A 3NGJA 1C29A 5E6ZA 3WIJA 4M51A 5GPRA 3UR7A 2HZGA 4HOXA 1IXNA 1UB3A 3W84A 5LGZA 1XIHA 2WHKA 4Q8TA 4WDUA 3BLEA 4A3UA 3OGVA 1RH9A 1AK5A 1EDTA 4JX4A 3C0LA 4UQCA 2JFEX 3STEA 4HMEA 4YTUA 4B5UA 5CC5A 2B7PA 1W9DM 1D7KA 1T96A 1BYDA 2OO6A 1HO1A 5BU9A 1X7IA 2VFFA 4L6OA 3CNYA 2NUXA 4QQUA 1WKDA 3OGRA 4RDZA 1FRBA 2ZZ5A 3R7MA 2OPJA 1IZJA 2E3ZA 3EB3A 7CGTA 4HBKA 4IIGA 2Y7FA 1MFUA 2DDXA 3CPRA 4M7TA 3TTEA 2VX4A 2ALRA 2P76A 3O8AA 2QCNA 1Z69A 3M6YA 5BZAA 4X0NA 5M17A 3AISA 2BY2A 4JIRA 2NVCA 3QGKC 4WDTA 3QF0A 1UR1A 3EB2A 4RK8A 1AA1B 4H7VA 3SN0A 5M2FX 2QAPA 1NDVA 3KS5A 2UBPC 1XJBA 1EHAA 3SCNA 2BB0A 1NFBA 4M1RA 2C91A 2D69A 4IIFA 5G4HC 4AZIA 4HZMA 3FYYA 3P67A 1SMDA 1GTHA 1AVAA 2BDQA 1U1UA 4FX8A 4NJKA 1F9CA 3VD4A 4K7VA 3V4BA 4LSBA 4TMBA 3R4IA 3LTPA 3RDKA 2ONEA 3ZT6A 1W32A 1VR6A 3SQLA 1W2PA 4L1XA 5KZMA 3R11A 2EO7A 4DVOA 1AQ0A 2V2DA 4Z2GA 3BLKA 1OGSA 3CIVA 2XZ7A 1SVDA 2X8RA 4FLOA 2EEXA 3Q2DA 5FF0A 3ES7A 4CN4A 2UY5A 4URIA 3TYEA 3THAA 4ENLA 3MYPA 3BLIA 3RYSA 2WJFA 4L4MA 1BXBA 5G1YA 3GW0A 3QZ6A 5M3WA 1SFLA 3TWBA 3ZZ1A 2A3BA 1RSCA 1E4NA 1M1BA 3EWWA 3LCXA 2QUNA 3FDKA 2C1GA 5KTLA 3FK4A 4J28A 2JKEA 5FEWA 3C2YA 2ZUNA 4UFKA 4GOAA 5HR7A 1GVEA 3L4ZA 2VD9A 1RK5A 3I7SA 3RPMA 1BF2A 3JS3A 2Y5JA 4IPLA 4JQ4A 1NH6A 2QHAA 3RLUA 3EWXA 2XM1A 4JEQA 5A6LA 1VF8A 5JBDA 4NNCA 2P0OA 4N42A 1EEPA 1UWSA 3W7HA 5H8MA 5K4ZA 2PLCA 3P6LA 4I5RA 1Q7QA 1FP8A 3TQVA 2ZUTA 2E6FA 2R91A 1TUXA 4ADUA 4B3LA 1D9EA 1UIPA 3ZVIA 1CLXA 4UBPC 3KCLA 3AYVA 5IBXC 2ZYFA 4KIRA 2YB4A 3KRSA 3ABOA 1F4AA 3LCHA 5I2UA 1I6NA 2VEMA 5LIUX 1FWWA 3PF3A 2E77A 4HTBA 4HJWA 2I57A 5HMSA 5CCZA 4JIQA 4CQAA 9RUBA 1VPXA 1P6CA 4UQAA 2PF8A 1P7TB 4S2CA 1VBGA 3I6EA 4U2ZA 3TJIA 4JTTA 1YBQA 3KHJA 5CSSA 2DT1A 1XG3A 2GJXA 1J5SA 2ZUVA 1W1B1 3WQEA 3NQGA 5FF3A 1FH9A 4JIEA 4YYFA 2ZX7A 4LUSB 4F0LA 5D04C 3NYDA 4LUJA 1US3A 3WQ5A 3PJUA 3S1XA 3H4WA 2VD8A 3T8LA 4Q8UA 2BXZA 2RGMA 1T8XA 3LOTA 4KPLA 1G4SA 4DZ5A 1N7KA 2X1SA 1KFKA 1OCBA 3UQNA 4GVIA 4AU0A 3R12A 2NX9A 4D6DA 1JZ2A 2XYLA 1TPFA 2ACUA 4Q6XA 1EUNA 2J7DA 2O9OA 3EPMA 2CHOA 1WXYA 4LYQA 4GNVA 1UH2A 1WP6A 2BSLA 3U7BA 4JFTA 4L5ZA 3HB9A 3A4JA 2QDDA 3CQJA 3ME3A 4GY1A 4A22A 2WNQA 1GVRA 4ERAA 4O0ZA 1LQ2A 4JTJA 3T42A 4WDWA 2Y2WA 3OYZA 1A3HA 1XUUA 3IIPA 2V5LA 3T78A 3SQMA 4ACZA 2FPVA 3VOIA 4ZQPA 1KC7A 2KX9A 2ZTJA 3MZNA 2I1OA 2ISVA 3C52A 1SFSA 1VP5A 3TIMA 2ATMA 1TE6A 3GC4A 3V0TA 3SZ8A 4WX2A 1W1IE 3WQ6A 4DF1A 3C5QA 4KESA 1K6AA 4H83A 2BY3A 3WLRA 3QJAA 1YE6A 5A3HA 1OIFA 9XIMA 1Y65A 4GQ0A 3EA3A 5ECUA 4GE8A 1LWIA 3II1A 2G3JA 5DBUA 3M5ZA 3OVRA 4Q32A 3CWNA 3KBNA 2I7GA 5I3GA 4UFLA 4Q7NA 2C13A 1VC4A 2CBIA 1KGUA 2DVUA 3A22A 3WF4A 3MP4A 3W76A 1TV4A 4RV3A 2FGZA 1HVQA 3VGFA 4Q8OA 3WCZA 1VBHA 4IH3A 5BMXA 1R38A 1V0KA 3E0VA 3T40A 3GU9A 3BZGA 1OT2A 1HL8A 2BTMA 3CZGA 1XCXA 4WJ8A 2CLKA 3WDJA 3BO9A 2XINA 3BANA 3WNMA 3BSHA 5XINA 1BWKA 4MJ2A 3ZLFA 1HKKA 1VEPA 4LUIA 3T0CA 3EPNA 1EPVA 4M3PA 3AYSA 3CQIA 4JHMA 1WO2A 3CJPA 3IJ9A 1OF8A 2B7QA 4X9YA 4RR4A 2WC7A 4E0CA 3O2LA 1LOQA 5REQB 3WD2A 4DWSB 1E6SM 2UY2A 5DMYA 3IANA 2E5CA 2D22A 4HU3A 2BASA 2YCLB 3FGCB 3R8RA 4S3BA 4KCTA 4G1KA 3AS1A 1LRTA 4S3AA 4DJEA 4UTMA 5HMDA 3MUCA 5I09A 4AF0B 4NJHA 2QUMA 4XZWA 1DOSA 3L4YA 1UPMB 4C65A 1JI1A 5I78A 4DZHA 1B9ZA 3H6OA 2YYUA 1Q6LA 3F4DA 3W7PA 1DIEA 4O53A 1XYFA 4ZEPA 3MMWA 3WQ8A 4IICA 3EYPA 2E25A 1PL9A 3BG5A 4N4QA 3TX9A 1PAMA 5LNUA 4K3ZA 1KXQA 1LL6A 5AYYA 1W5PA 3T09A 1RLCL 5I03A 1NWRA 3LX9A 3PBGA 4J1OA 2E7FA 1QBBA 2CZ5A 1TMLA 3UERA 2QAFA 3Q45A 3OVQA 4F48A 4QGCA 1PTGA 1Q45A 4O16A 2GDVA 2ZBTA 1QHZA 2NZLA 4A8NA 6ENLA 3BARA 4Y7EA 4A21A 3VIKA 1Q6QA 2GDUA 2V67A 3O6AA 1AW2A 1OCQA 5BNKA 2WHLA 4FX7A 3AXHA 3R6IA 4QAWA 1QWGA 3T4CA 4WCJA 4NU7A 3W7DA 2ZRXA 2VENA 4HA4A 1J79A 4MB4A 2V3FA 1CENA 3BAYA 5K2ZA 3N4EA 3W1RA 1PHQA 4HNOA 4RPQA 5LIKX 3S47A 1F6KA 1MWOA 1XIFA 1FWEC 3KDNA 4JEJA 5EB8A 4UTKA 3PTQA 4X2RA 1WPCA 5E70A 1PX8A 2J88A 5FJPA 1KGXA 1FUYA 7TIMA 1BAGA 3AIEA 4UTWA 2Y7EA 4NVTA 5AZ1A 1MI3A 1TCDA 3RR1A 3VUPA 1VBJA 1LBMA 2QVHA 2QULA 1A0EA 3WQ4A 3G1AA 4DJFA 4OV9A 4XTIA 1KGWA 3EEZA 2WO5A 1E9YB 2BHYA 4IFKB 3AS0A 3SRHA 3WMSA 3XINA 1X1ZA 3MS8A 1Q85A 3NO1A 5DRCA 3KZPA 7PTDA 1CWYA 3W72A 1LCOA 3O7UA 2Y8VA 5JU6A 2CKSA 3FOKA 1V3KA 3TTOA 1X8FA 3JRKA 2J47A 3WLOA 1Q6EA 3G24A 2EG8A 3E2SA 5LA1A 3MMUA 3VK5A 3PULA 3H23A 1VFMA 3NL3A 3N2CA 1DPMA 3URBA 3ZYZA 5DFAA 5HMFA 2C71A 4NZ3A 4BCEA 3C8FA 3W37A 1K4HA 3CHVA 4JR5A 4PMYA 4G7FA 5HWMA 3NEHA 2NUYA 3FV9A 3G1FA 1M6JA 3G2GA 3VGDA 4LVFA 4XZLX 4IQLA 5CPLA 3FJNA 4R88A 4REQA 1KM0A 2WQPA 1MO0A 1FWCC 1KCXA 2IKJA 3QV8A 5HOSA 2V5BA 3TCSA 1N82A 4NZJA 3B0PA 2FPTA 2DT2A 1IGSA 1O95A 4Y2WA 3EOOA 2J24A 2HDJA 4AZBA 3STGA 1SR0A 4IHCA 2QW5A 3ERPA 4GX9A 2DV0A 2G3IA 2X42A 3MDWA 2FKPA 3WBXA 3TONA 4MKSA 1ZAHA 1RXOB 4Q8QA 2NV9A 3OZPA 4JY8A 4L4OA