2UDPA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray structure of UDP-galactose 4-epimerase complexed with UDP-phenol.
pubmed rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 131
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2udpA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2udpA01
2VUSA 2HK9A 4P4NA 3DOJA 1RWBA 3MEQA 5A04A 4MVJH 3DEYX 4FD3A 1B7GO 3GEDA 5KKCA 2HK7A 1F0YA 4II2A 3ZWBA 2RHCA 4BNFA 4TKMA 3K96A 2NVUB 2X7HA 1DHRA 4A27A 3RBVA 2NU6A 4YJFA 2A9FA 1YH3A 1H0KA 4Y6PA 5K6AC 2CDCA 4M87A 1W4ZA 4CLOA 1YQDA 1O95A 2GDZA 1YL7A 1I24A 1U3WA 2X6TA 3C85A 2WYVA 3LT0A 1JW9B 1I10A 1F14A 3DZJA 3RC2A 1GADO 3I1JA 4R5HA 2WE7A 1NASA 1P1RA 1GCUA 4PG5A 3EVNA 5EERA 3OA2A 1DJNA 4A73A 1MUUA 3E18A 3GK3A 1HTBA 5EQFA 4NU5A 2Z1MA 4DLBA 3UCFA 3GN1A 3H9EO 5KVVA 1M2WA 2Y66A 2YV1A 3SLKA 3WIEA 2CUKA 1NQOA 1Y9AA 2O4UX 2HUNA 4H15A 1IHXA 3C24A 4LMPA 4YAEA 3RC9A 4K9DA 3STHA 2HU2A 2Q1WA 3QV1A 3NX4A 4RVGA 4EZBA 1ADGA 2UDPA 3BTVA 4R1NA 4G81A 4YRDA 3GAZA 5CDTA 1XA0A 3JQCA 2QX7A 2PWZA 1XLTA 1EFKA 3FNGA 5T67A 4CR7A 1EMDA 2Q49A 1GYPA 2Y1EA 4U6SA 5JAMA 4PG6A 3KSZO 1HDCA 2G82A 3G1UA 2PZKA 4FJ2A 4MO2A 1H9BA 4FFMA 2Q1TA 3GVIA 3DOCA 3HHPA 1WAMA 4WLFA 4BNLA 2C5AA 3BHMA 3DTYA 3W8FA 2VTDA 4IJKA 4BO0A 2YYYA 9LDTA 4LRSB 1GUYA 1TA4A 1VJ1A 3OFSA 3ZI0A 2NU8A 3INGA 3Q11A 3DTTA 2GN4A 4J4TA 2Q2QA 5BQFA 2BFPA 4PRLA 4JNKA 1T2AA 4RVFA 1Y5RA 3AW9A 3UVEA 4QEDA 1Y8QB 5TC4A 4GLLA 4PLTA 3BHJA 4R9RA 3R6DA 5EINA 3AUUA 4OXYA 3B6ZA 2W90A 4GX1A 4IS3A 1UZNA 1U28A 2NNLD 2VUUA 2ZTVA 1DIAA 1E1NA 3GVCA 4XJSA 4DWVA 3UN1A 4EI2A 4J90A 1I33A 3HWRA 1MG0A 3LC7O 3NAQA 1SEPA 5HTOA 4Z0HO 3ETEA 1N2SA 3GZ4A 4QO7A 4MVJP 5TF4A 3ZWCA 1Z82A 1G0OA 4J9VA 1EVYA 1MGOA 2ZYGA 2P68A 3JQ9A 4GI2A 4YJHB 1DO8A 3VPGA 2HKIA 1VM6A 2VCYA 3QVTA 3KRTA 3PDJA 4J7XA 1ZFNA 3RFVA 2QRKA 4DYVA 1VI2A 2W2KA 3E5MA 4IDAA 1DIGA 3DMTC 4HX5A 1FDTA 3PYXA 1A9ZA 3VPFA 1VJ0A 1PL8A 3JD1A 4FFNA 4QFCA 5CPBA 1YOVA 2D4AA 3OM9A 3H65A 4TROA 4BNUA 2BKAA 5AOVA 5JC1A 4AJ2A 1JLLA 2YFHA 2D59A 1K2WA 4YBZA 4R1UA 4DBVO 4XJTA 4JN6B 4CLEA 3DZGA 1E7SA 1ZW1A 4LCJA 2I5PO 2NTVA 4W82A 2I67A 4QTZA 1MLDA 5U4QA 3RASA 1ZO8A 4LVUA 5TLSA 3ZV4A 4WUVA 1QLJA 4M55A 3U09A 4L4SA 1ADFA 4BNJA 3OA0A 5L40A 3OJEA 4AJOA 4XDYA 5I9NA 2ZB4A 5L7WA 3CH6A 2DBVO 1FXSA 2BFMA 4YCAA 1V9LA 4MJLA 1QLHA 4R69A 4CM3A 1O9BA 4OO3A 4TVOA 1FJHA 3ONEA 3TN7A 1R12A 3GFGA 1ISMA 4XQ9A 4IMPA 7MDHA 4YT4A 2IZ1A 2A94A 5TGDA 4E2YA 4TRNA 1JTVA 2D8AA 3H5AA 5I8WA 3FWNA 1P33A 4YJHA 3IDSA 1CDOA 4JX8A 3E48A 1YE3A 4IZIA 4YDRA 4ND5A 1UXJA 1E5LA 4GWKA 1R66A 3DDNA 3W4IA 3HQ4O 1A7KA 1KBZA 5MDHA 4ESOA 2NU9A 4YQYA 3BA1A 2QRJA 4J3FA 1BWSA 4CLHA 1DBVO 4O0LA 4WEQA 1O94A 2XPCA 2FR8A 4UVGA 1C1DA 1C0LA 2Q3EA 1K89A 3NJ4A 1ISIA 3L0DA 1U4OA 2V65A 3NT5A 3FTPA 3O9ZA 3ZNQA 5C37A 4KUGA 3NV9A 1ZK4A 3ICCA 1ISGA 4FBGA 1K6IA 1WVGA 2IE0A 1O8CA 2RH4A 4E5PA 3K9QO 1MXFA 3GC6A 4BNWA 3JQBC 1ENOA 5ADHA 4LK3A 4IDFA 1NVMB 4YRBA 1Z73A 1LLQA 4I9HA 3E6AA 4RPKA 1RM0A 3WNVA 5JDCA 2HRZA 2VNSA 3CE6A 2FPIA 1ISFA 1NQTA 4D3SA 4CLDA 1T2CA 2VUTA 2BD0A 3OP4A 4E4YA 3RBZA 3OBBA 4CM8B 3HDJA 1U5CA 3X2EA 3GUCA 1CF2O 1EE9A 4O1MA 4XYMA 3UUWA 4KMSA 2NVUA 3L4BC 3ANNA 5KIAA 2VTEA 3SVTA 4I9NA 4DA9A 1YRLA 3KYCA 3FCOA 5JMPA 2HRBA 3S1LA 2WJPA 2RBEA 4RZHA 4FFRA 4E33A 3RKRA 3BTOA 3PLRA 2ZKLA 2GN9A 1B14A 3AU9A 3PQFA 5I7VA 3JQ8A 4FJ1A 3OIGA 2OXIA 1ZXBA 2Q45A 3KM0A 4BO2A 2Y1CA 1D1TA 4R41A 1KY4A 2V6BA 3L4SO 4DLLA 1H6DA 5L51A 4DPMA 2C0CA 1C0PA 1G0NA 2VQ3A 1UJMA 1KVTA 2DC1A 3PYLA 2Y1GA 2FPGA 4H7PA 4BQRA 3PZRA 1A5ZA 3WOHA 5GZ1A 1I01A 1ORRA 2CFCA 2YV3A 4E32A 2O7QA 4IXTA 4NBWA 1ENPA 4O6VA 1KVRA 5TT1A 5AXAA 2PD6A 2DU8A 1DHTA 4DIFA 3UOGA 2HMVA 4HFNA 2RH8A 2AE2A 1X1EA 3ANMA 5A1TA 4YAKA 4TZTA 2X23A 3V1YA 4XYBA 1LQTA 2EV9A 1C1XB 3PWKA 2VOJA 2DM6A 2UAGA 5BNTA 5DDIP 4KQXA 2X9GA 1XKQA 2Q2WA 3GVHA 4CMCA 3VKVA 3DZKA 3MJEA 3X2FA 3V5NA 5AXBA 3FPCA 3E9NA 3IP1A 4BB5A 1ZEMA 3OEWA 3WNQA 4QO8A 1EVZA 1Q0HA 1SB9A 3JQFC 1U2GA 1R4NB 1ZJZA 4PVDA 3KYDA 2IXBA 5DF1A 1EVIA 2Q99A 1PGOA 1UZLA 3D3WB 1KVQA 1HE3A 4DYDA 1EVJA 2FN7A 3EGOA 4N54A 1GAEO 1U7TA 5HRUA 5I7FA 2YDYA 1L7EA 3C8MA 1IZ0A 1OBFO 1PS0A 4OQYA 3HFSA 5ITWA 3JQBA 2Y68A 3QWIA 4XB1A 1XYGA 1MC5A 2CDBA 2VHYA 5I7SA 4LW8A 4U0KA 2QYSA 3WSWA 1BDBA 1PSDA 3B20A 5TS3A 4PZDA 3UW3A 4EITA 4ZRMA 5AQ1A 4KTTE 2C29D 1BXGB 2DPHA 1IYZA 4Z9YA 3VPHA 3QHAA 4IIUA 3M2PA 3TFQA 3ZWOA 3U0BA 5BT9A 3WBFA 1UUFA 2GSDA 1ENZA 1SBYA 4WKGA 3SJ7A 1YQXA 1Q2XA 4W99A 1CIVA 1B8VA 1QYVA 4RPGA 1LSJA 1O6ZA 4GBJA 4D45A 1H6CA 2ZTUA 3ENKA 5KCZA 1K6XA 3C1TA 4ZICA 3WGIA 2GR9A 2EHDA 1VL6A 3BMCB 4E5KA 5DT9A 3NGXA 2Y05A 2H63A 4RVHA 4ZQFA 1A4IA 1SOVA 3FF4A 4KDFA 1HZJA 2OBNA 3ON5A 5K6AA 2Z1NA 4E5MA 2EJVA 1I3MA 2V6GA 3TWOA 4Q3NA 5KTKA 3CXRA 2GZ1A 2WEKA 4F6LA 4ALNA 4HWKA 2ZYDA 2QG4A 1NQAO 2J3IA 4KDEA 2I66A 4YRAA 1NHGA 2Z5LA 3GPDG 1DOHA 5J23A 1N7HA 4HUJA 5T64A 4DBZA 3ZV3A 4U7WA 3WYCA 1L7DA 1K6JA 4NFSA 2J3HA 4FR5A 2W4QA 2ET6A 5A03A 2B83A 2GN6A 3IUPA 5T8KC 3HNPA 3FTNA 4BNNA 4YPOA 3C7DB 4B7CA 1M6WA 2Z95A 2NLOA 1BG6A 5TSDA 4J1NA 4JP3A 4Z6KA 4IJUA 5AXDA 1E3WA 1W8DA 3H6KA 4WECA 4FJ0A 4PG7A 4OYRA 3D7LA 1LC0A 5EMHA 3G17A 3VTFA 4BS9A 4IZHA 3WJAA 4CR8A 1LXCA 1E7MA 1E6EA 1HZZA 2HMUA 3Q2KA 4IDEA 1JWBB 4NBUA 4RVDA 4EJMA 3AFNA 1DRWA 1Z74A 3BMQA 3PWZA 2QQ5A 3IJPA 1BVRA 3L6OO 5L3ZA 3RFXA 4AVYA 1UXHA 1EDOA 4BGUA 3F9IA 3Q9UA 3EK2A 1LSOA 3WS7A 1KS9A 1T25A 3K92A 4Q3BA 1P31A 1HYGA 1TVEA 1P1FA 3Q6IA 5DBGA 4FIZA 3WIDA 3VDQA 3CKYA 4A03A 4BB6A 5A9SA 4YA6A 2EP5A 4ZN6A 1PGJA 3GAFA 4BO5A 2P9EA 4BNKA 5G4LA 4EUEA 5ICSA 3HB4X 2VYND 2B4RO 4TVBA 1YONA 4YWJA 3WX0A 3IJRA 1VKOA 2J3KA 1V6AA 3BHIA 4D3DA 4CLXA 2JKVA 4MDHA 3EMKA 4PCVA 2AA3A 3N58A 2VOEA 5DBFA 4BV8A 3JV7A 5ER6A 3GDGA 3JQDA 5TJHA 4DLAA 1VE9A 1RM3A 1SZJG 5A05A 1GQ2A 3ROPA 2D2IA 4GAEA 4J49A 1GTMA 2GCGA 1HF3A 3G0OA 3JQ8B 4LGVA 4FC7A 1GQYA 2JHGA 4OSOA 2WWRA 3CUKA 3PEFA 1JA9A 2J6IA 4K28A 1ENYA 2HJSA 2X0JA 1A9YA 4UEKA 4IBOA 4O59O 2WSBA 3FSRA 3S2IA 3QWFA 1LNQA 3ZV5A 3I52A 3ICPA 3HDYA 4WLNA 1LI4A 1TXGA 2Q1SA 5AYVA 3OSUA 5F21A 5ILOA 4N7RA 4CMAA 5A5FA 4RCVA 1XGKA 1X13A 3DAGA 1UP7A 4R4JA 1UXKA 1M66A 4WOKA 4CLOB 2DKNA 2EKPA 2NQ8A 3GEGA 2PZJA 3DBLB 5BSGA 2O3TA 4URFA 4GLOA 4CMJA 4E13A 3PFWO 3BXXA 3GEMA 3LVFO 3NEPX 1DXYA 3RIHA 4AJ1A 1ADBA 1I5RA 1V0JA 2OGUA 4WCDA 1ZVMA 2YHIA 4JJIA 2JJYA 4AICA 1U2DA 3ZU3A 4W4TA 2VRCA 4RLSA 4BO3A 4GWGA 4PLWA 1Z6ZA 3OJOA 4ZQHA 5FF9A 4UVEA 3JYQA 2QRLA 4F3YA 1GUZA 1HYEA 3P2OA 3UF0A 3WGHA 2OP1A 3WICA 2EXXA 2D1YA 3NDJA 2UUOA 1XQ6A 3DL2A 3PXXA 3JTMA 3CMMA 2V6FA 2PY6A 2IZZA 1OC2A 2B37A 1NR1A 1EZ4A 2EP7A 4CQMB 4WLEA 1NPYA 3F4BA 3V2GA 1ONPA 3U5TA 2P5UA 3WGOA 3TOZA 2HAEA 1HDGO 3V2UA 4QUKA 1DAPA 1MFPA 2P2SA 3RUAA 3S2FA 4XQGA 3F47A 3OICA 4XGKA 4EUFA 1NAHA 2ZK7A 3SLGA 4E30A 2HK8A 3I5MA 2BGKA 3D5TA 4E5YA 1DC5A 1ZEJA 5I8ZA 5JCJD 2LDBA 3GG2A 1GDHA 3ZWAA 3PYMA 1VSUA 1N8KA 4GSLA 2O4CA 1E7YA 3HSKA 3EW7A 4ZD6A 3U9LA 2PNFA 2VYNA 2AG5A 4B3HA 4BV9A 1CWUA 1I8TA 1AGNA 1BGVA 2WM3A 5FYDA 3TZ6A 1C1DB 3KB6A 4DC0A 1IZ9A 1HKUA 3DAPA 3BMOA 3W1VA 1B8UA 1F06A 4U5QA 1NP3A 3RUFA 1E3WB 4IDGA 3TJRA 4BNGA 2Q50A 1H6AA 3Q2IA 1Z7EA 3TZQA 2NTJA 3H2SA 3JQAA 4D7AA 5HS4A 3ABIA 5KVCA 3D4NA 4XD2A 3QA9A 2ZB8A 3D64A 1ID1A 3SC6A 4OGWA 2X0NA 2AQHA 2WD7A 5IZCC 1GD1O 1C14A 1J6UA 5H83A 4PG4A 3U4CA 4DIBA 3WLEA 3RUHA 1F12A 4CUZA 4NU6A 3TQHA 3ZU2A 4NK4A 4YJDA 2I99A 4WCFA 4NJMA 4DL9A 2RCYA 5CDUA 4LCEA 2D5CA 2VHZA 5L53A 1VJTA 2DTDA 3ZNNA 3W8EA 5JNLA 3H9JA 1CQJA 2IRWA 5JAQA 5F5NA 4BKRA 2YV2A 4Y98A 7ADHA 5JO9A 2EIHA 2PK3A 2J8ZA 4HY3A 2JHFA 2ZQYA 4W7IA 4NJMB 3PHLA 4OOFA 4YT2A 4XEHA 4L4XA 5JYEA 1HDOA 1I0ZA 1W0CA 2EG9A 3OIFA 1ZK2A 4WOJA 1E92A 3F46A 4DMMA 5JO0A 4ZVVA 4PLFA 4LVCA 4L75A 4RQTA 3ZWMA 4RL6A 4Y9DA 4IINA 4OL9A 2BH9A 1GZ4A 4E6PA 5I9MA 2Q4BA 2R2GA 3VPSA 2FOIA 3SX2A 4BKOA 4U0JA 1GEEA 1H2HA 4YJGB 5CDYA 3KLMX 3WGZA 4BO4A 5DOZA 2QW8A 1PZEA 1MG5A 1NFRA 2I3AA 3DXFA 3CTMA 1Q0QA 4II3A 3ZWXA 3A28A 3PHIA 4GX2A 3DR3A 4MKXA 2LDXA 5LDHA 5GZ6A 4DQUA 3DZHA 4L76A 4XQCA 1LDBA 2X86A 3QRWA 4GMFA 1JVBA 4R1TA 1BXGA 2R00C 3HDHA 3E5RA 1GU7A 3ASUA 4CV1A 1GY8A 4M49A 4EDFA 5IJZA 3FRJA 1PGPA 3OJFA 4OQZA 5IDXA 3Q9NA 2O23A 2GLXA 3EZYA 2X5KO 3C7AA 3QLJA 3H9UA 4DUPA 4ND4A 3BAZA 3FN4A 3DBHB 4XYEA 3I4CA 3GOHA 2CD9A 1BXZA 3WLFA 2WYUA 3KYBA 1YKFA 2AQ8A 2WYWA 1H94A 1BW9A 1A71A 5KVQA 4B7XA 1WLYA 4CQMA 1GQQA 2VWHA 1GCOA 1DLJA 4ILKA 4KUHA 2DUWA 1UXGA 1I36A 3B1KA 4J1SA 3ZHYA 4NH4A 1TB4A 1YJ8A 2EW8A 4BO9A 2TMDA 2VZ0A 4E12A 4MVJD 1OFGA 2C82A 3NTRA 1RM4A 2OL4A 4OM8A 4R9SA 2EGHA 4O5OA 5EQDA 3NDIA 4ROSA 3I9NA 1HDRA 5G0TA 5MGBA 3L6EA 3S2EA 1R0LA 3QWBA 4MPDA 3RJ9A 3AOEC 3EC7A 3DMYA 4NG5A 4JIGA 3M2TA 5JAIA 4I5FA 1WDMA 4PZCA 3DOOA 1YBMA 3VZRA 3QVWA 1Q7CA 3JD2A 3G49A 1X15A 4CMEA 3S8MA 3UXYA 1E3JA 1E6UA 4LMRA 3AOGA 4WASA 5EN4A 4PZEA 4B4WA 2EW2A 3RD5A 4OJNA 3UGKA 4AG3A 3B1JA 1NVTA 5A9TA 2YY7A 2QIOA 2F00A 3E8XA 3AJRA 3RQSA 3RUDA 1BW9B 4RLHA 2CY0A 2DT5A 5IN4A 4YXFA 5IF3A 4YJFB 3H5NA 4GVLA 5B4UA 5B12A 4DPLA 2FSSA 5KJ6A 1AXGA 1NPTO 3LF2A 1KETA 3VZSA 4KWIA 4GX0A 3KVOA 4TRJA 1DPGA 4OSPA 4Q9NA 3A4VA 4BNZA 3LU1A 3NGLA 3KYCB 4NBRA 5DCYA 5KJ1A 4GPD1 5IAAA 1QYXA 4IIVA 1SNYA 2VZ9A 4Y8VA 3K6JA 1GPDG 4TQGA 1U8XX 4UEJA 3DBLA 3LLSA 1VC2A 3ROKA 4O63O 2IYPA 3H7AA 1IPEA 1HDYA 1DIHA 4D79A 2QZZA 4RGBA 3T4EA 1PJ3A 1P45A 2JCVA 2YFQA 3BTUA 3I23A 3ITDA 4FW8A 5H81A 2ZIZA 1LU9A 3W8DA 3CMCO 5COAA 4BO8A 1U8FO 4IJWA 2IEDA 3FWZA 3BTSA 1V3UA 4CM9D 1KEPA 3AUAA 3FR8A 5G0SA 2PGDA 2O48X 4ALLA 4CJXA 3U4IA 1NBOA 1GEGA 4RPJA 3RSHA 3NT4A 3O4RA 3WYBA 4YYZA 3LC1O 2SCUA 3JD4A 2WE8A 1PJ4A 4HXYA 1MA0A 1H9AA 4MVJM 1ZSVA 4HFJA 5JDIA 1KC3A 1Y8QA 1X0XA 4IY1A 3ADOA 4B79A 1GV1A 1YDWA 4E0BA 2ZQZA 3OQ6A 2Y0EA 3A9WA 4IGEA 3OF2A 3GT0A 4MKRA 3M1LA 2H1SA 1U3UA 4PLVA 2HQ1A 4PLPA 3RFTA 2E48A 1V8BA 5CHEA 2G1UA 3WFIA 4CUKA 5IXSA 1JKFA 2PV7A 1K5HA 1BDMA 1ISHA 3RI3A 1VKNA 1YS4A 2NADA 4D46A 4MKZA 1QRRA 2O3QA 4UVHA 4FGSA 4TMFA 3QWHA 4E3ZA 3U4HA 2AW5A 1D1SA 5I9LA 1FMCA 2E49A 3FD8A 3AY7A 3DBVO 1U3VA 2O2SA 3ZWNA 4C7JA 2YUTA 4GKVA 4PLZA 4ZQBA 3SJUA 4E21A 4C4OA 4IDBA 1JAYA 1ZK3A 3U62A 2VN8A 1JQBA 3HUDA 1QMGA 1T24A 3GZNB 4Q3DA 4CV3A 5ILGA 2J3JA 4J0FA 3K2BA 3ZDFA 2OFPA 4K6FA 3RAJA 1SCUA 3IMFA 2GF2A 2J5KA 3U4DA 1P0FA 1RKXA 3P7MA 4EEZA 1B16A 3ZU5A 3WXBA 5IZ4A 1T26A 4XR4A 3AI3A 1PL7A 2NQTA 2DBRA 4CMIA 3LYLA 1NM5A 2IYOA 4PLHA 1K3TA 3EHEA 2VRBA 1CJCA 3B1FA 3ONFA 5LC1A 4UAGA 4DRYA 1KVUA 4PIVA 1IB6A 5T8KA 3PJDA 2UYYA 2ZJ1A 2OBYA 5TX7A 2EWMA 3IOYA 4RF5A 3RUEA 1J0XO 4MVJG 3IQDB 4CLRB 1MC4A 3GY0A 4LRTB 3VKUA 2Y0DA 2ZYAA 4LN1A 5L4LA 3ASVA 3MOIA 4BNHA 1XDWA 3JQAD 1M6HA 2PH5A 3PTZA 2X8LA 5CG2A 4CM7A 4I5EA 4XGNA 3RUIA 1E1MA 5B1YA 2E6UX 3JYNA 4BO6A 1B26A 4RF2A 2OHXA 1EUCA 5LDGA 2NM0A 3COSA 1DJQA 4DIOA 5CEJA 1XHLA 1MB4A 3LLVA 3OETA 4NIMA 2ZTMA 4QT0A 3KEQA 3RUCA 1QV7A 4IQ8A 4BKPA 4UUPA 4AJLA 3LK7A 2CF6A 5JXWA 3JQ7A 3KTDA 3OMLA 4HNHA 4PFJA 3PJFA 1RM5A 1PZHA 2O3SA 4A2CA 4ALMA 1B0AA 4GKBA 4MP8A 5EL0A 4YVFA 1V35A 3H4VA 4GX5A 1SMKA 1I3KA 3EUWA 4NDNE 1M75A 1WNTA 3HADA 4NK5A 1EK5A 1AHIA 5CAEA 3EYWA 3W6ZA 4DVJA 1LQUA 2PTGA 3WR5A 3RVDA 3WBBA 5FEUA 1X7DA 1EUZA 5IG2A 1D7OA 1E1KA 3JQAB 5THQA 1A7AA 1R16A 4RJTA 3ADPA 3PK0A 4K6CA 4PLYA 2PFGA 2Y1FA 4BGEA 3RC7A 1DSSG 4WK6A 3HN2A 2Y1OA 4H16A 4FFPA 1I3LA 4XB2A 1DIRA 5GZ3A 3WB9A 5DULA 1N5DA 5JSFA 4QSMA 1X7HA 3VPXA 4L0QA 4OAQA 5ENVA 2BFOA 1LSSA 1HDZA 1XU9A 2BELA 5C7IO 2YQ5A 3I4FA 4XIYA 2W2LD 2NTNA 2Q1UA 3ZHZA 4BGIA 1HE5A 4CMHA 3G79A 3ETDA 3S2GA 1G6KA 5ENDA 1QXSA 1VRWA 4UEOA 3UKOA 4ZU3A 2X0RA 3K8ZA 3ZW9A 3P5SA 3QW2A 1YB1A 1JVSA 4JK3A 2HMTA 2PGJA 3AU8A 3DFUA 4BNIA 2B36A 2FY8A 1HEUA 2AEFA 1P44A 3U49A 4WPGA 1GZ6A 2FRDA 1P9LA 1NYTA 2JCYA 3IIEA 3K31A 1W73A 5G2OA 3KETA 2WDZA 5JCJA 4D42A 4YACA 5F5LA 5LCXA 4JQCA 2VHXA 4DC1A 2V6MA 1HXHA 3PZBA 4XR9A 5TT0A 3BMOB 4XZ3A 1O0SA 4ZJUA 4NJOA 4BMVA 1E0DA 4YAJA 2EEZA 2BHLA 3VHRA 1GV0A 1PJCA 4RPLA 4J1QA 3AY6A 4I1IA 2YHUA 3WSVA 1OAAA 1X1TA 3FR7A 4J7CA 1MV8A 3ZNOA 1P1KA 3H3FA 8LDHA 4ND1A 4RDHA 4BO1A 1EDZA 2JFHA 3HJAA 3KEOA 4DQVA 5FFFA 5A9RA 3F5SA 4RV9A 1TT7A 4EEXA 2XXBA 1N92A 3BMNA 4JJGA 2E4AA 1O5IA 3CZMA 2HO5A 3NT2A 1PZFA 4DXHA 4WLOA 4ND3A 4BMNA 4HFRA 4L74A 1LDMA 4KOAA 3AM5A 5KJEA 4GL4A 4EBFA 2G0TA 2OOSA 3KSDO 3PHJA 4G5HA 4J2OA 2NUAA 5JS6A 3H3JA 2VHVA 2GZ3A 2P91A 1UDCA 3VH4A 4JP2A 3TL3A 2VRCD 3PRJA 2P4QA 4B7UA 2RHRA 1IULA 5CFZA 3RC1A 2O3JA 2OP0A 2PKQO 3RKUA 1EFLA 1UH5A 1N7GA 4Z9XA 1QYCA 3PLNA 4H3VA 3KLPX 1TT5B 1WP4A 4R5MA 2QHXA 3QQPA 4EYEA 3UICA 4ALJA 1I2BA 3ST7A 3AM4A 3DONA 1HDXA 1N9GB 2ZCUA 3INTA 2JCXA 2D5AA 1VSVA 4JJFA 2BFAA 4P4GA 2X5JO 4ZQGA 5BSFA 3KHUA 1WDLA 1ZXLA 4WNCA 5C3MA 5BSEA 1ZMTA 5B4TA 1OI7A 2W98A 5ICMA 2O3UA 3UCEA 2AEJA 1GUFA 2PH3A 4RVSA 4MINA 5FI3A 5U9CA 3EY4A 4EJ6A 3NUGA 3E82A 3RWBA 1FDWA 3GGPA 4L9RA 5C5IA 3VVCA 4CM8A 4OMUA 3JQFA 4J9UE 1TLTA 1U7HA 4N5NA 1LA2A 2E37A 4E31A 3KO8A 3GR6A 5JPIA 4E5NA 3L9XA 1F17A 4GH5A 4ZRNA 4AFNA 2WD8A 3R1IA 3PDUA 4NFHA 1I30A 4NFYA 3WFJA 3GF4A 5L4SA 4ZHSA 2FR0A 5JE8A 3WWZA 4IJVA 2Y99A 1C0KA 2HDHA 4EW6A 2CDAA 3MWEB 4NZ9A 1TI7A 5BSHA 3ROQA 5HBRA 1MFZA 3MJTA 4A7PA 1B3RA 1ZSYA 2GO1A 3V2HA 4BMSA 4CQLB 1E3EA 1ZBQA 2FHSA 1N9GA 4M89A 4QECA 2Y67A 4ZGWA 1NFQA 4YT5A 5KJCA 4PGFA 1A4UA 4RVUA 5K0ZA 3O38A 1LDYA 3HZZA 3CPSA 1FF9A 2EERA 3V1TC 4F45A 3LC2O 1DIBA 1UAYA 1PR9A 2Q2VA 2BGLA 1OC4A 2VT2A 3VZPA 4IDDA 3R3SA 2C07A 4NI5A 4MIYA 1ISJA 1EQUA 1NR7A 5KKAA 1Y81A 4GSKA 3G3EA 4QFDA 3I9LA 3LF1A 4Q3CA 4WCFB 1ZK0A 1E6WA 2HLPA 2FWMX 4BQPA 4YT8A 3IUSA 3PI7A 2RIRA 4UUNA 5ES3A 1WMAA 4F46A 4JROA 2PR2A 3GH3A 2WD7B 3AUTA 6LDHA 3A06A 4PRKA 1ZKMA 1HLPA 2BLLA 5JDIC 2W2KB 3JQ6A 5COBA 3VAZA 4CM4A 3IL2A 1U3TA 3EDMA 5L7YA 2C54A 1YBVA 1KIFA 4N5LA 5AVOA 4LISA 3OQ1A 3ZV6A 1LRKA 1KVSA 2EGGA 4IUYA 3D3EA 2DPGA 1R4NA 2H9IA 4N5MA 3E03A 3LT1A 1CEQA 1KY5A 3DFZA 5KWEA 3AFMA 3I83A 1H2BA 1QP8A 2DTEA 1XWFA 4IGFA 4ONEA 1RYDA 1EBUA 1KC1A 4FC6A 1R37A 5DCWA 3DHEA 3GUYA 3PQEA 5DN9A 2B69A 5JDCC 4MVJE 1LC3A 1SO8A 5EIOA 2CVOA 3W4KA 2XOXA 1HYHA 1Z45A 1Y5MA 3G1TA 1PQUA 2DQ4A 3EVTA 1DRVA 1WW8A 3RCBA 3UH1A 1ZJYA 1XCBA 1XIVA 3LZ6A 3ZWYA 1O89A 2VWGA 5DZSA 1CETA 3PGJA 1EEHA 4XRGA 4B8WA 2FPPA 1S6YA 2QZ9A 3V1UA 1ZUD1 3QIVA 3TF5A 3OQBA 2NU7A 3K30A 1WXDA 1NWCA 4YB8A 2ZCVA 2FZWA 3SXPA 4JLWA 1U5AA 2GERA 1LUAA 1PQWA 2NVBA 2PGLA 3LQFA 4I5GA 5A3VA 4D3FA 5KVSA 4IMRA 2F1KA 1P0CA 1U9JA 5TJ9A 2H6EA 3AOEA 1YB4A 1G1AA 4P8RA 2NV6A 3DC2A 1B3BA 2VZ8A 2PZMA 3GPIA 4HNGA 3D0OA 4KWHA 9LDBA 3L77A 4I5DA 4Q3EA 3ZWPA 1EUDA 1PJSA 3WQRA 1OOEA 4RQUA 4ND2A 1DRUA 5CP8A 3K2EA 3VVBA 2HMWA 4NNJA 1OZAA 1LSUA 1WZIA 2VNAA 1LBEA 1ZCJA 4FCCA 3PPIA 4YTEA 2JD0A 1U1IA 3MZ0A 3IP3A 3OJ0A 4MVJA 1M76A 2R6JA 2PLAA 4M86A 4CM6A 5L7TA 1S7CA 2VYVA 1W6UA 4E2WA 2C2YA 4FSHA 2EF1A 4FQ8A 4I08A 3FI9A 4TWRA 4Y6SA 5BNIA 2AEMA 4HKTA 4R54A 5IZCA 4WEOA 2CVQA 1TEHA 2IZ0A 1VLLA 1T1RA 4K1LA 2B4TO 2YW9A 3HG7A 3WGGA 3GGGA 3ONDA 4HBGA 3QWAA 4A10A 2AQKA 1D8AA 4Y67A 1P1HA 4BNMA 3F1KA 1JAXA 2GYYA 2IEBA 2GZ2A 2WTBA 1VPDA 5KNLA 2OUIA 3OJLA 3DAFA 2X58A 3PIDA 3PHGA 3Q0EA 2I6TA 2JFFA 1JU9A 1IY8A 3H9QA 2DTXA 3GVXA 4UVIA 1BVUA 1QSGA 2FMUA 1SC6A 2HCTA 3KXDA 1YO6A 5JLAA 1HSOA 5JFOA 1BRMA 3MJSA 3BZUA 4IXWA 1PS8A 3H5RA 1GYRA 3WDSA 4W9NA 2TMGA 5AXCA 3MCVA 1R15A 3L4BA 1XU7A 2PKQP 2GGSA 4XQEA 4RZIA 4CM1A 5A9SB 1DC4A 1P3DA 3PJGA 2P4HX 5L9AA 1B8PA 4WJZA 4J16A 4OXKA 4B3IA 2YHIB 3NJ8A 3R3JA 4B8ZA 4CQLA 3GG9A 5IXYA 1NNUA 2AE1A 1NXQA 4DPKA 4FB5A 3F5QA 5DBIA 6ADHA 1C3VA 3I6QA 3LT2A 1NQ5A 1PQPA 1R4MA 1YOVB 4BGVA 5ITVA 4ALIA 1ZZEA 2AQIA 4WNIA 1Z75A 3AUSA 4PLGA 2GNAA 4FOOA 4CMGA 3TZKA 3S55A 2WMDA 3KSUA 1DLIA 1HWYA 5CEFA 3GLQA 1ML3A 3ZHXA 4OXNA 3I9KA 1N1GA 3CZRA 1E77A 3VZQA 3ZWVA 1PZGA 3SC4A 4OHUA 4XDZA 2HJRA 4IDCA 1IOLA 3JSAA 1H5QA 1E3LA 3AM3A 2G5CA 2O3RA 1LTHR 4CM9A 4FS3A 3ZNPA 1B2LA 1UP4A 3CINA 1HE4A 3D1LA 4WGGA 2P9GA 4EJ0A 4TRRA 2IXAA 4JCOA 4M1QA 5JW6A 1WMBA 3GNTA 3VH1A 1P1IA 1XQ1A 3UHAA 4CMKA 3BMCA 2DLDA 1AUPA 4J2HA 1LRLA 1HE2A 2PZLA 3KBOA 1H6BA 3GNQA 1P77A 3SEFA 1WPQA 1WWKA 3NKLA 4BNVA 4AJPA 1UZMA 1PGQA 4CMEC 3GDOA 4CPDA 4YEDA 2DBQA 4PVCA 3TSCA 3ZGYA 4DTIA 3LT4A 3SBOA 3O8QA 2AMFA 2CVZA 4TKLA 4WCFC 1B15A 4Z3KA 2P9CA 1T1SA 1IUKA 4BNYA 4DREA 1Q1NA 4KQWA 3Q1LA 3EAGA 2JAPA 3OEYA 3DBRA 3H8VA 5FI5A 4IQ0A 5CEEA 3MJVA 4WLVA 4X54A 3ORFA 2H5LA 4RDIA 4AJKA 4BUCA 4BNXA 3QVSA 2PKRA 2D0IA 5IDWA 4HV4A 5L4NA 5G4KB 3BMNB 4FOSA 1GL3A 4W6ZA 3K73O 3JD3A 3I3OA 4A5OA 4YR9A 3O26A 1PJBA 1PWZA 1T4DA 3WGYA 2C59A 3F6YA 3GNSA 2BRUA 1BSVA 4WLUA 3ULKA 4CMIB 3VOSA 1LDEA 3GGOA 4L73A 3ZW8A 2C7GA 4CR6A 1K0UA 3PFFA 5FWNA 3TRIA 4J0EA 3KYDB 5F1OA 5B37A 3W4JA 4BL5A 4B3JA 3RROA 1FDSA 1E1LA 2GUGA 2O50A 3IS3A 4UULA 3ZWWA 4Z9FA 4QQRA 5DP2A 3ZZNA 1NX6A 3ANLA 3A1NA 2XXJA 2J5RA 2PD4A 4XA8A 1SOWA 1IE3A 1I32A 5L45A 1RPNA 2B35A 4FN4A 4PLCA 4BVAA 3P2YA 2CF5A 3D4OA 4CQMD 1I3NA 1GPJA 5C7LO 4MIOA 1CERA 5HA5A 2J5QA 2X0IA 4CV2A 5EJ2A 4B4VA 3E1KA 5A3JA 3C1AA 4R01A 1NHWA 1Y9EA 2V7PA 5DOVA 1AE1A 4RPHA 3HB5X 1SPXA 1XG5A 4YAIA 2I65A 5CDGA 2FZEA 2OORA 4M8SA 4W7HA 1LLDA 1QORA 4CLRA 2FP4A 3AK4A 1Y8RA 4J91A 1KOLA 3RU9A 4E2XA 4HFMA 4Z0TA 3WTCA 3KZVA 3RU7A 4TSKA 4XCVA 2DVMA 1YBAA 3JCZA 3WYEA 2VWPA 2I9PA 2EKQA 1D3AA 2ZTLA 4NR0A 1Y7TA 4M54A 1HETA 3ENNA 4C7KA 1PJTA 1WZEA 3FNFA 3OH8A 1HL3A 3HE3A 3L6DA 3KUXA 2RAFA 2Q4EA 3CIFA 3QJ5A 1PJQA 2C2XA 4F6CA 4R16A 5CG1A 3M1AA 5JC8A 4HADA 3ZCXA 3PIIA 4BIIA 5F3RA 3ROMA 1NTOA 3AI1A 2DFVA 4EUHA 5A06A 3ETGA 2GASA 1ZNQO 2GPTA 2X5OA 1NPDA 3DZIA 3GZNA 5JY1A 1V3TA 1OMOA 4JBIA 3UFXA 5BNFA 2CSUA 3VTZA 4QXMA 4MOWA 1F8GA 5G0UA 3ZHBA 2XAAA 4CMBA 2CMDA 2ZB7A 1ULSA 4JBGA 4Z3DA 3GN2A 4XWYA 4KZPA 2Y93A 3FNHA 4BOYA 3EZLA 1T2EA 2NVWA 2O7SA 3L07A 2GD1O 2VWQA 3JQ9C 1HLDA 3GHYA 3P19A 1LLCA 3DZBA 2UVDA 3Q3CA 4XX0A 5JAZA 1ONOA 4P4LA 3FHLA 1HT0A 1RJWA 3C7CB 5G0VA 3ZH2A 3WMXA 4XIJA 3A14A 5CDSA 1KERA 3MWDB 2C5EA 4P38A 1GYQA 1IPFA 4DGSA 4BKQA 3D3WA 2X22A 4OOEA 1SEVA 3OECA 2W2LA 3ZU4A 3QSGA 1LRJA 1ADCA 3HN7A 4CUJA 2E82A 4YQZA 1GR0A 1UDBA 1R6DA 4GGPA 1GFSA 5A4DA 3PWSA 3LSYA 2FSVA 4BHTA 5EPOA 3WJ7A 1J5PA 3WQSB 4CL8A 5KJFA 2Y1DA 1FK8A 5JBIA 1T2FA 1YL6A 1DC6A 4NBVA 5B4VA 2JD2A 3PVZA 4CM5A 5C7OO 1HSZA 3DB2A 3IKTA 3TZHA 1MX3A 3LDHA 4K26A 1YQGA 8ADHA 1E7WA 5H82A 3GVPA 5TNXA 4CM4B 4MVJI 4R51A 2B4QA 4PG8A 1MP0A 4YAGA 1YL5A 1PTJA 2DBZA 2DUUA 4I9UA 3WMWA 5IDYA 3ZN2A 3N74A 4GVXA 1KYQA 2BMAA 2AXQA 2OMEA 1DB3A 1CYDA 1P74A 1E5QA 3RJ5A 1A27A 3WGTA 3VDRA 3JYPA 2X9VA 3JQGB 2HSDA 3DO5A 4MVJF 3UCXA 4BKUA 1CQIA 2G17A 4BNTA 3ITKA 4OIMA 3VH3A 3BIOA 4J1TA 3M6IA 3DWFA 4J6FA 2VHWA 2BF7A 4FDAA 3AI2A 4DQXA 1YDEA 2ZJ0A 1VL8A 2DFDA 4AL4A 3B70A 3QVXA 1ZSNA 3MJ4A 1GZ3A 1JWAB 4AJ4A 2UV8A 1RYEA 2POQX 3INRA 3D5QA 3JQGA 1E7RA 3W6UA 4XKJA 5I7EA 3VH2A 5DP1A 1L1FA 1SAYA 1JKIA 1Y8RB 3T7EA 1DDOA 2P5YA 1I2CA 4OKIA 2HMSA 4J43A 4D44A 1R4MB 3V8BA 2AG8A 4G2NA 4S1VA 1PJLA 5A02A 3MTGA 1EE2A 3FBTA 1UP6A 4R1SA 1X14A 4A0SA 1X0VA 2OZPA 1CRWG 1Q7BA 2PA3A 2JAHA 2BGMA 3E9MA 4OH1A 3UAGA 1EQ2A 3DMTA 2UUPA 3GMSA 1NWHA 5F1KA 3GRKA 2C20A 4Q3AA 4ZA2A 4J4HA 5T5QA 1Q7GA 4J4BA 3NTQA 1JKJA 2Q46A 3D4PA 3DHYA 3I9OA 3R0IA 5T6BA 5TRTA 5A5EA 2IDZA 1DC3A 1T2DA 5L95A 5IN5A 4NQZA 2A4KA 1UR5A 3E9QA 3NYWA 1BHSA 3MOGA 4D43A 1QYWA 4IS2A 2NACA 1Y1PA 3JYLA 4KP7A 2YJZA 1LJ8A 3GHHA 4B4UA 1AHHA 3BMQB 4FFOA 1FDVA 4E2ZA 3NDRA 3QP9A 4D0SA 1BTOA 4ZQEA 4JGBA 3DHNA 3GQVA 2GRAA 3HDQA 5HS6A 1UAGA 2CNBA 2IODA 1N1EA 2GN8A 1PJ2A 1M67A 5F1PA 1EK6A 3GRPA 4GGOA 1QYDA 5THKA 3C1OA 3TL2A 4ALKA 1V3VA 1WDKA 1XR3A 4LSWA 3CSDA 3IC5A 5GMOA 4I8XA 3DBRB 4Q39A 1A72A 2Y0CA 3QY9A 1LDGA 4FPXA 2EJWA 3F4LA 1D4FA 1YWGO 5KOIA 3PGXA 4NMHA 1LLUA 3TOXA 1DEHA 1UXIA 3H2ZA 5K9ZA 2JFGA 3JQEA 5T57A 5IDQA 1ZIDA 3JQ7B 1Y6JA 1DFGA 1C0IA 3O03A 4DMLA 3GFBA 2CZCA 2ZB3A 3H9GA 4GQAA 4N18A 5HM8A 1ZH8A 3T4XA 4AJIA 3TFOA 1MXHA 4KUEA 1XEAA 1SB8A 4QX6A 4S3MA 4FFLA 1H93A 1UDAA 1ZMOA 3AWDA 3N7UA 2VYVD 1QV6A 1R0SA 4L8VA 3NRCA 2X1HA 3JD0A 5COQA 4MP3A 3WTBA 1XSEA 1E7QA 1KEVA 2G76A 2JL1A 2XF8A 3I9MA 3OHSX 4R3WA 3GA0A 4J7UA 4UREA 2AHRA 2X9NA 3F1LA 3TZCA 1LX6A 3GDFA 3QVOA 3I6IA 2I76A 3DQPA 2NSDA 1E3IA 4NBTA 1TT5A 4OKNA 1NAIA 3VC7A 4PN3A 5HWSA 1R0KA 4UUOA 4UUMA 4AJNA 1JDJA 1DAOA 1PGNA 3OIDA 5GY7A 4FGWA 2NWQA 5IFLA 5CPFA 3F3SA 1PIWA 5TQVA 4AJJA 1XELA 3I9JA 4UVDA 2A35A 2C7VA 1JN0A 3DBHA 2YDXA 4IPTA 1C1XA 4Y6RA 1YVEI 3CEAA 2EKLA 4L4RA 4MIEA 4XRRA 1FDUA 3TDKA 4JXKA 1QR6A 1P1JA 3KOUA 4XGIA 1QKIA 1ZK1A 3WGQA 3PQDA 4JBHA 4R68A 4GMGA 4TRMA 5ER9A 3IKVA 1PR3A 2X4GA 3KV3O 2ZATA 1KEUA 2ILTA 4G65A 1PWXA 1YB5A 1Z7BA 2BI8A 1LDNA 2VT3A 1IHYA 1AN9A 4W9NC 4D41A 4D0RA 3WQQA 2QYTA 4AJEA 1PL6A 1ULUA 1KEWA 1QG6A 3IAHA 2B5VA 2B0JA 5JCXA 1ARZA 2YQ4A 3WWYA 4XYLA 3U3XA 4U8GA 5JY6A 4EGFA 1LEHA 1PS9A 1HRDA 4CODB 1DFIA 2O2YA 4U6QA 3DZFA 3K5PA 2FR1A 3T7CA 4MP6A 3PJEA 2OO5A 1AXEA 2A92A 5U1PA 3JYOA 3NTOA 1IL0A 5G4KA 4RORA 3GMDA 5TIIA 4XYGA 5EESA 1Q0LA 4LSMA 3PHHA 5G0WA 3WG9A 4KTVE 2W8ZA 4HP8A 2R00A 1BMDA 4WE3A 2YZ7A 3MJCA 2JD1A 1VL0A 1U4SA 3PP8A 1T4BA 3RBXA 3BYZA 4R3NA 1YJQA 1E3SA 4RF3A 5JYDA 4CL3A 1PU2A 5JMWA 4IM7A 5BR7A 2I3GA 3FBGA 4RF4A 4YJGA 2PD3A 3O8QB 1X7GA 4P22A 2BI7A 1YGYA 3TPCA 1J4AA 1J49A 4Z0PA 3L9WA 1PX0A 4NPCA 4NHEA 3C3XA 3FPLA 1PEDA 2B5WA 4RO0A 4IQGA 1DFHA 3TNLA 4AJHA 5DNAA 3MTJA 1ONNA 4ID9A 4INAA 5DCUA 1I2ZA 3HFGA 1EBFA 2DAPA 1YXMA 3FNEA 2D3TA 4B4OA 1F8FA 1NVGA 3QE3A 4ITUA 4BO7A 4CV0A 4A26A 3AY3A 1BXKA 4TZKA 1NFFA
chains in the Genus database with same CATH superfamily
2VUSA 3AIIA 2HK9A 2BR4A 1U7XA 3GJQA 5A04A 4W5JA 2XKAA 3HA2A 4KIFA 1W5BA 4ZKEA 2HK7A 5FNVB 2H92A 4II2A 4WBXC 3P9IA 3C1UA 3UAVA 3ZWBA 4YMTA 4TKMA 1KK1A 4YAUA 4X20A 3ABQB 4ZT6A 5DSTA 3H2KA 4GNKA 4HWPA 4HH3C 5JHGB 4Z8YA 5K6AC 2CDCA 2EZUA 5IT0A 2VNHA 1W4ZA 1W36C 3KYIB 1YQDA 1Y7LA 5HSGA 1O95A 2WIGA 2GDZA 3MCTA 1WB6A 2D74A 3C85A 2XB9A 3L0IB 3LXMA 1JW9B 4FMDF 4G97A 1CCWA 5AM1A 2WG1A 4BMDA 1F14A 3RC2A 5AFSA 5B2EA 1R2QA 1AV7A 2RB5A 3ZD8A 3WFZA 1QVWA 2Q5CA 4U3JB 3K1AA 1XZJA 1DQZA 3EVNA 1Y6ZA 4V1CI 1NBEA 1DJNA 3OA2A 4FHGA 5IM5A 4JNGA 5FBKA 3E18A 3IQXA 1C7JA 3ILYA 4N5HX 3DWGA 3O84A 4MRPA 1TD9A 1AO0A 4D1YA 1W2HA 4FOPA 1I0IA 4UASA 3UCFA 2XCTB 4WV3A 3F6BX 3H9EO 2CUNA 3EIUA 3S7ZA 4RNDB 3UC9A 3A3KA 2YV1A 2WVHA 2FK7A 2Y77A 3OLQA 1I6LA 1NQOA 3FRIA 3PE4A 1M1NA 3STVA 3K70C 4QL3A 3OQOA 1IHXA 2Q6OA 2QLJA 3C24A 4LMPA 3KKKA 1UFRA 4FMPA 1FP4B 1RPTA 1JRLA 1Z37A 3ZQJA 1XXHA 2JI6A 3VDMA 4EY4A 2WHYA 1OE0A 2C4KA 4DMCA 4KWTA 4DJJA 1SQ6A 1SA0B 2OV3A 3LHFA 3L7AA 3L43A 4JX9A 4RVGA 4YRCA 5IWAB 1IHPA 4MULA 3PXUA 4DSZA 3EFBA 3ESCA 3O92A 4YRDA 1P7CA 2QTAA 1QGAA 1SK9A 1B1CA 1L5VA 4Q5IA 1U63A 1XV5A 2HQBA 1XTIA 1GGMA 3R7FA 3KKPA 3TGWA 1NVAA 1XLTA 5E6RB 4U63A 3O4JA 3Q7RA 1YS6A 3PD1A 2WKRA 3L8HA 1ZR4A 2H4JA 2Y1EA 1RHMA 2ETVA 4M0UA 3LHIA 4C4TA 3I30X 4OHYA 3U16A 5LXTA 2W48A 4MO2A 1DTSA 4JNCA 2XECA 3R3UA 4I36A 3H0CA 3GVIA 1YA6A 3BK7A 3GJ3A 4CG3A 3BHMA 1SRRA 1L5YA 4TYPA 1DQRA 4EYSA 2VTDA 1WZUA 1J5EB 4IJKA 4ZCLA 2OMKA 4RV4A 3VNQA 3FXAA 2P5TB 3NEJA 4LRSB 3ANYB 2JFVA 3OFSA 3NETA 1DTWA 2ZJ7A 5KSPA 1TFUA 3FYSA 2NU8A 3R6TA 5B7PA 2XB2A 4KO1S 3T9EA 3UGTA 2GN4A 5I7AA 4RVFA 1B6SA 2JJ2D 4LWQA 4OGGA 2O20A 3RWOA 2IELA 5A5GA 2H48A 2XCOA 3NAZA 1Q0UA 4XARA 3ZH9B 1E2NA 2P4SA 2YNMA 5EINA 4N03A 4QIHA 3AUUA 4KLCA 3B6ZA 1X7WA 3A6DA 3DP9A 4IS3A 3ZE6A 1Z6XA 2PS0A 4DWVA 3UN1A 3KOZA 4H59A 5LKRA 4NVRA 4MR7B 4XSHA 5FJJA 4BZZA 2ABWA 4HWOA 2HX1A 4KKXB 2CLLB 3PENA 3V1NA 3HWRA 1V7PC 4P93A 1SEPA 2YMPA 3E7PA 3I3SR 3H8JA 4B3RB 5FLEX 1P72A 4K05A 3UJBA 2WFMA 4UBKA 2JLYA 4LF7B 5HDBB 3ZWCA 1G0OA 2Q1XA 3CLSD 2OV1A 4PM4A 5FUYA 3DFFA 2ZYGA 1MGOA 1VJDA 3N2IA 3PT5A 3VPGA 4I19A 3P9CA 5HEKA 1U6KA 4P53A 3GLSA 1E0AA 1VM6A 2EHJA 4B6JA 2VCYA 3QVTA 1JHOA 3HO1A 2IL1A 4RYDA 5ANRB 3ZBUA 2BBWA 3PDJA 1DNPA 4LSZA 4QVGA 3MTQA 4N3GA 2Z6QA 2QRKA 3S7TA 3ZY4A 5J47A 2GB4A 2VL7A 3AFGA 3CN7A 3E5MA 4YHHB 1CZRA 4H3KB 5F2OA 1VJ0A 3B38A 1NE2A 3OM9A 5IH7A 3H65A 1JZSA 1YU6A 2BL4A 3LIPA 4ABYA 5T6MA 4BNUA 4AJ2A 4P3PA 3MWKA 1N8TA 2D59A 3A1EA 3OP1A 4MUHA 4MW9A 5HKKD 4GGMX 2GCPA 1AQJA 5ALRA 4N7JA 4XJTA 4ZYWA 3UAYA 1G98A 3QPAA 2P65A 3HB1A 4N65A 4QTZA 5K3AA 5TLSA 4WUVA 4Y0VA 1QLJA 3I8OA 2F4NA 1Y7HA 5KWSA 5KSWB 3OA0A 1FP4A 5JEEA 1BMQA 3UKDA 4ZVQA 1OSNA 2D13A 2OR3A 2GZRA 1KR2A 3TOCA 2JAXA 2XVYA 3JU3A 1E0JA 2DBVO 1PKXA 1YBHA 1T2NA 3MC1A 1EJ0A 2PQ2A 4PAWA 4B6SA 5CX1A 1GSHA 4Q4JB 4MJLA 1QLHA 4CM3A 3P2KA 4PZYA 2JCGA 2AOWA 4JI8B 4TVOA 1FJHA 2ZJAA 3TN7A 3IUJA 3H1PA 4NS4A 4DTCA 1OJ7A 2QUKA 1G2PA 1ISMA 3FTQA 3Q15C 1DARA 1U8UA 1JJBA 7MDHA 1IK6A 2ZRJA 3H97A 4FSDA 4W6QA 2EZ8A 2BMJA 1G5FA 3CEMA 4R8LA 3HKEA 5FB3A 3SSMA 3KCQA 2Q6KA 4JC5A 4TRNA 4AT1A 4M1ZA 4YV0A 4BP8A 3GPBA 3H5AA 2JCBA 2ZIEA 4YJHA 5I8WA 3WE7A 3ZLTA 1NMSA 1QH8A 1C7FA 1CQZA 1BAPA 3O95A 4YDRA 4BMOB 4ND5A 3VGJA 1E5LA 4AF8A 3HQ4O 4DLUA 3RLIA 3U4GA 1Y3CE 1ZM9A 3H5WA 3LK6A 4YQYA 2QRJA 4TZ0A 4DG8A 1Y7PA 3RF6A 1HEYA 4G0QA 4NLLA 3C3PA 2REQB 3HXOA 1PR0A 3O9VA 2VRWA 3KPWA 4NOKA 5J2TA 2FR8A 3AVWA 4EFNA 1KOJA 3ZUPA 3ZHSA 2WZBA 2Q3EA 4IQFA 2W11A 1N9KA 2J48A 5CVJA 2UUBB 1VBNA 5C4GB 1RQGA 2O06A 4JEIA 4JD5A 3WKDA 4LJ4A 1JEYA 4QULA 2ZI5A 2X9QA 2PGNA 3O9ZA 4KUGA 3ZNQA 1ZK4A 4F92B 1Y1KE 4BAZA 1AUQA 4YAWA 2VDVE 1WSDA 1N2BA 1WVGA 3E5HA 1C80A 1NVBA 1H2FA 2LKCA 1DOAA 3CFYA 3DTVB 3JZAA 5SY9A 5BWLA 2GK4A 3IEVA 2PBFA 2OKGA 3K9QO 1XFAA 1WPGA 4KFTA 2VTBA 1E8DA 3VBCA 3CCFA 5AHKA 2F4VB 3QVGB 4LGCA 1C9DB 3VNSA 3TNYA 1NVMB 4YRBA 2AI2A 3L7JA 4RHUA 4ZYUA 4I9HA 2XA2A 3V4LA 4RPKA 1NV8A 2I4NA 2CT8A 3RF7A 5CVUA 5JDCA 4EECA 2VNSA 3CE6A 3SN6A 1BN6A 1G64A 2ZUCA 1GTRA 2VPTA 1KSGA 3EVZA 3X1JA 3N76A 2BN4A 2Q2OA 2R6CA 4WJLA 2FZ4A 5BRJA 3HDJA 2ZIUB 2FFRA 1P19A 1DKUA 1ZI6A 2Z8XA 3X2EA 4B9AA 3T5DA 4JVLA 4YV2A 1A7JA 3I53A 3QMVA 4XYMA 3IFSA 3FYTA 2NVUA 1DUVG 4M1OA 4OHXA 5KIAA 5F73A 3SHQA 1GA6A 2CN1A 4I9NA 3RARA 3SXUB 2LV8A 3HY6A 121PA 1UIRA 3FOZA 4N8DA 2PMWB 4R98A 2F62A 2FDRA 2OB2A 1MB3A 2NAPA 2V1XA 3BE6A 3E8MA 3LUKA 4UM5A 1TKRA 3LQKA 3R7NA 4YP5A 4MLCA 1X1QA 1G7CA 2WJYA 2GN9A 3EGWA 1K68A 1B14A 1EUDB 1OPXA 2IXTA 2R44A 4G0MA 4LZZA 3UBMA 4YMGA 2IOYA 4FJ1A 4NAUA 5I7VA 2OXIA 3WNCA 4EUKA 1M1YA 5CT6A 4G0ZA 5BSWA 4RIGA 1W2GA 1AUOA 4E4RA 3GCXA 4EHHA 1ULBA 3GEPA 4BVLA 4B6FA 5LFAA 3VKWA 5ALVA 1I4TD 4UJ3A 3TRHA 4F3KA 1SELA 4FEEA 3ORHA 3NH6A 3VR2D 2DC1A 3OI7A 3PYLA 2IYYA 5H80A 3D31A 1DU4A 1IXRC 3VNRA 1O6CA 4L02A 1PO7A 1V4NA 2FJUA 1A5ZA 1FNDA 1XPJA 3HEBA 4H7PA 3KLNA 4V0MA 5EOVA 2I3ZA 4KXUA 8ABPA 1UT6A 1ENPA 4INZA 3S1SA 2CFSA 2V59A 5AXAA 5TT1A 4MX8A 1DHTA 2YXPX 4DLKA 1JKJB 2QA5A 3WWOA 1MIOA 2AE2A 3EPPA 1VLVA 3M82A 4G9EA 4EM6A 5A1TA 3TQRA 2WJAA 4XD7A 4ZT4A 4MHTA 3ACBA 1P2VA 3GV0A 3G0CA 3H2BA 1LQTA 3EVCA 4RSRA 1BZYA 3FSJX 1KKLA 5CH3A 2ZREA 821PA 5LZ9A 3DAYA 3PRYA 5BNTA 2CL0X 1YZGA 4F3NA 5D7NA 2R79A 3ZX5A 2QX4A 2H1HA 1N34B 2FQQA 3GARA 4QDOA 4LJ7A 3DWEX 1TCBA 3Q3GE 2FSUA 2OSBA 2WKSA 3F97A 3R40A 1IG0A 2GWHA 1T8YA 2C9MA 2OCKA 4HGRA 3T15A 4C22A 2YWJA 1KDYA 1CX9B 4BB5A 2HFKA 4BC1A 2QD3A 3K7EA 1EDDA 2YIJA 4QGBA 5EJFA 4PFQA 1U2TA 1R4NB 4PVDA 3ENQA 4F84A 4URVR 1DWPA 1Q5PA 1TUEA 4Q4AA 2HHAA 1NVKA 1QH0A 3RVQA 2CLDX 1NE7A 2V4UA 4MZDA 5J43A 2O52A 3D3WB 1HE3A 2ZANA 4DYDA 2QROA 2XYPA 3N5KA 4RK1A 4ZAXA 2FN7A 3DLAA 1OXUA 1O6BA 4EG0A 1FBTA 4ZCRA 2QL6A 3PR1A 3BBPA 2BZSA 2D4HA 4N54A 4P36A 2HZ7A 5HRUA 1XQWA 5LSAA 2F8LA 2YWDA 4CFZA 4XWAA 1OBFO 1HL7A 1XTQA 3ZXYA 4JP1A 3OX4A 5GGYA 4A2WA 5AH0A 5ITWA 1MC5A 1T0UA 1ZMRA 2IC5A 1KK0A 2VC2B 2WFLB 5BQPA 1Q7EA 3SBEA 1EB9A 3EYAA 5JSQA 3IXMA 5FNZA 2E4XA 4IFTA 3FMVA 1VMAA 4NYMR 3B20A 4A4DA 3BAFA 3FMPB 3BQNB 4EITA 4ZRMA 4Z4EA 4CKZA 2C29D 4NULA 4MS1B 5LL6P 2IPMA 3A04A 2W6ZA 1IYZA 1ECCA 3I5AA 4DT1B 4YRPA 4L78A 2OFWA 2QI9C 2VG8A 1YK1A 1ZD9A 3HLTA 4XCQA 4EX6A 1H23A 4QYWA 5BT9A 2ZUFA 1OTXA 3OTGA 4LV6A 3V8RA 2YXBA 3WBFA 1O7JA 3DAHA 1UUFA 2GSDA 2VSQA 4FGZA 4WKGA 4C5AA 4LV5B 4I6JA 1Q2XA 3QVKA 3EZNA 4DA9A 3PFBA 2CHFA 4I55A 1ZD8A 4UU7A 3T9FA 4DJDC 1XXLA 4ZJYA 4JKIA 4WK0B 2ZTUA 3ENKA 2QT0A 3DP7A 3MBIA 3TI7A 1FJXA 1E2UA 1VL6A 1J0CA 2C98A 2NG1A 3NWJA 3ZJ4A 3K09A 3GLIB 3G0DA 3ZDZB 5KTYA 2ESRA 2H63A 2WTXA 4RVHA 3IBCA 2Z58A 4ZQFA 3FF4A 4Q7EA 5JSYA 2C4TA 3AHCA 3JARA 2CKMA 2GM5A 3VR6D 4G36A 2DJ5A 4OFWA 3G5MA 2BZ0A 4MXDA 4EW1A 1VMDA 2FUG6 2V6GA 3Q88A 4Q3NA 3TWOA 5ICGA 5KTKA 1CQXA 1FFHA 5HXAA 3WHPA 4ZTUB 2BONA 3D8SA 2RJOA 4JJ8A 3EF1A 4F6LA 4ALNA 1FLDA 2H07A 2ZYDA 4JUFA 1C7ZA 2AKEA 3BEOA 3FPBA 3AEQA 1NQAO 3D3KA 2WIAA 3L7CA 4GYJA 1TYZA 1FUEA 5ED4A 1VLJA 4Y18A 3SQOA 2GO7A 1CP3A 3MMSA 1NHGA 1QZUA 2COUA 4Z5XA 3QVLA 1ECLA 3GPDG 1DOHA 4B33A 5J23A 2WV7A 5TVGA 2FWNA 3QVGA 4DBZA 4DR4B 3ZYCA 4BV3A 3AKDA 1E66A 4Z7JA 3W1EA 4U7WA 3W8RA 3K35A 2AX4A 4QYXA 3DMRA 3I6BA 4LHWA 4FR5A 1XZCA 2W4QA 4IIDA 2PU7A 1KGSA 4V0KA 5D1HA 3BWVA 4HVCA 2B83A 4QPZA 1N5IA 2GN6A 4P80A 4YO7A 1R0YA 5TMDA 3PQ2A 5D87A 3C70A 4NXMB 1ZD2P 4YPOA 1JMYA 4B7CA 4F5DA 1M6WA 1T9BA 3MERA 1ZIPA 4PCUA 3JAWB 4HGQA 2BUCA 3BF7A 1HURA 3HVIA 4JP3A 1XD2A 3CZ4A 5B1EA 1E3WA 1H3FA 3DSRA 4UPEA 5DE3A 3IIMA 4RENA 5FAKA 1COWD 4PHCA 4BS9A 3D7LA 1SH7A 4M9XA 1M2VA 3SZRA 5L3SB 1JHQA 3WJAA 4HPWA 1LXCA 4LG1A 2ARKA 3AMVA 3B2QA 3Q0TA 1J99A 2B8TA 3HYNA 1JLKA 1JWBB 4RVDA 3K0SA 2R8XA 3TH5A 4PV7A 4JXJA 1NRJB 2B9VA 1VE3A 2QUIA 5KTNA 2I29A 3BSWA 3ILSA 1Z74A 3BMQA 1KI7A 1A2OA 1TLLA 3NBUA 1BVRA 1T91A 4YP6A 3AKCA 1T9DA 1RTTA 4LRQA 5FT9A 2WUWE 5T4EA 4AVYA 4BGUA 4JI2B 2PUHA 3IMKA 4DKJA 1WTCA 3HYLA 1KS9A 2HDOA 3LJKA 1T25A 1OCEA 4Q3BA 3RVOA 1HYGA 1TVEA 4IMIB 1P1FA 3Q6IA 3DEJA 3MWJA 2LUOA 4MS4B 3OCVA 4P7BA 3TB4A 4C4RA 1E61A 2ES4A 3PUVA 4GHWA 3ZHCA 1QZ3A 4BB6A 3B78A 3IDZA 3A3NA 5A9SA 2OHFA 4BO5A 4NE7A 2I4TA 3Q7PA 5G4LA 1XZHA 1QTIA 4KH1A 4WZAA 4MDFA 2VYND 2KM1A 5K99A 3IJRA 1F20A 1T9ZA 3B2EA 4KV9A 3FX2A 1TZKA 4KBGA 2J59A 4JMLA 1RJFA 4EHKA 3C3CA 3EQ6A 4B35A 3IHLA 4CDGA 5CK5A 2AD1A 4BZXA 5IPFA 5AJWA 1I1NA 2P9TA 3JQDA 3KJGA 5TJHA 4GPBA 4TTTS 1C8LA 1E9FA 2X5XA 1GQ2A 1GTMA 1LBQA 2QQGA 5HMLA 1YZHA 4BAGA 2V7UA 1AO3A 4LVOA 4JB2A 3LX8A 3OZRA 1O87A 1MA3A 4U2FA 1ILEA 3BIJA 1U1GA 3U1TA 4RTRA 3FG9A 3RAFC 3GJRA 2HJSA 2X0JA 3LP5A 5IEBA 2N3ZA 3ZHOA 4EY5A 4TTVA 1IY2A 5HVNA 2NW6A 3N8IA 5C1PA 2BDEA 1FS6A 2WSBA 2SICE 3FSRA 1XCOA 4U2DA 5ALLA 2WF9A 3QWFA 1TGVA 1JJAA 3I52A 2EZ9A 3M5WA 3IE2A 1Z8HA 3ICPA 2YL2A 3A6KA 3G0BA 3OEHD 4WLNA 4C4AA 4UHKA 1TTTA 5F21A 3NALA 1CUBA 4F86A 2ODTX 3E9ZA 2XUZA 3DAGA 3G59A 3IPYA 1Y9ZA 3HYSA 5HCIA 3WYAA 2PJRA 3UQZA 3SM9A 3UZUA 1UODA 5B6PA 4XM1A 3GEGA 5LIRA 2PZJA 2H51A 1L7MA 2FRDC 4B3XA 3PRKE 1AKTA 4FVTA 2GJ9A 2H2GA 2Z3VA 4Q1VA 1D5CA 4Y7CA 5F1YA 4CMJA 4E13A 2XUHA 1HFEL 4AJ1A 1I5RA 1V0JA 4KBFA 1ZVMA 4TV8B 1P81A 4TS4A 4JJIA 1JAHA 3ISTA 3Q6MA 1G63A 3CV3A 1NYRA 3ABRB 5H9VA 4RLSA 1UWLA 5K3OA 1RAIA 4PLWA 4YRTA 1MU0A 2JG3A 2F64A 3ZGOA 3H19A 3T3NA 1PSZA 4U7PB 5JYCA 1AS0A 1PLJA 3O4IA 3PNOA 4F3YA 2XLCA 4HQNA 3WGHA 1XNRB 3MFYA 3AVXA 1ICIA 3KUUA 4FYPA 4TV8A 3NG1A 3MUFA 2EXXA 1L5ZA 4NDZA 4NOJA 5CMLA 3GU3A 1DTWB 4MQFA 3TE6A 3UAOA 4LOAA 4AQ7A 4EMSA 3CMMA 2V6FA 4IQ4A 3VR3D 3WO0A 1TA9A 5DNCA 2B37A 5DHQA 1EZ4A 5D3MB 3TW4A 3I2KA 4P92A 1TCAA 2GZDA 4GZ3A 3V2GA 4PCAA 4R8RA 1RMYA 4YJ3F 4UFPA 2Q5EA 1TTQB 2WF5A 3EQ9A 4UUBA 4H31A 4JSRA 1VB3A 4NNOA 3TOZA 3UC5A 3W5SA 5HUJA 3V2UA 4QUKA 4BHHB 1DAPA 2X13A 3VR2A 3S2FA 1ZUNA 1R7RA 3G7NA 1KJIA 3D7MA 1Z08A 2Z5FA 4XGKA 1XVLA 3QLEA 2ST1A 3PA6A 1HNNA 3IEMA 3IDQA 1KO8A 3JW8A 3U7FB 3I5MA 3MT7A 1RWKA 3HB9A 5T41A 1EFTA 2NUPB 3BPSA 2Q21A 1PJZA 1N8KA 3ORRA 4X7MA 4F72A 1S7GA 2G71A 3CW8X 5K6TA 1VMKA 3HSKA 1LV8A 4JJ7A 3EW7A 4V2IA 3QF4A 3U9LA 3M6XA 1GCGA 2BFBB 1NMXA 1YFJA 1H42A 1GRQA 2HGZA 2F9FA 4XIFA 1IOZA 1MB2A 2AG5A 2H65A 4BV9A 4NWIA 1AMUA 1BGVA 5FYDA 3TZ6A 1J07A 4PYJA 1QE0A 3GP5A 3TKLA 3BMOA 5J4KA 2Z04A 4OYHA 3HKDB 1F06A 1TCVA 2BEVA 3KZNA 4U5QA 1ACMA 4H7KA 2HQRA 1NP3A 4HX9A 3TLYA 2WRZA 4LBWA 5DCLA 1Y6RA 4OYYA 1CY1A 2WMNB 3BOSA 3PUHA 2VJNA 4HAYA 1C9JA 1Z7EA 3Q2IA 2NTJA 3FPAA 4D7AA 5HS4A 3D4NA 4AWXA 2WF6A 3QA9A 4MYHA 4YC7A 3RR2A 1KAMA 5AUOB 2JLXA 4OGWA 4HDSB 3MNFA 2DULA 4KIWA 2V7VA 3OC0A 3TD6A 3KPVA 4NECA 5KOYA 2WD7A 5LA6B 3CR8A 3KTOA 1C14A 2H29A 4E46A 4PG4A 1FVHA 2FWIA 4DIBA 3HP1A 3RUHA 3ZQKA 4HB4A 5I4CA 2IDJA 2XIQA 4US1R 5KOHB 2HSJA 2JFPA 3Q8KA 4NU6A 2HC9A 1J00A 5EP2A 2AZTA 4NK4A 4EATA 2GD6A 3H1AA 2I99A 1IY0A 3ZZ1A 1TM3E 4M83A 4DL9A 1ZLXA 1GARA 2NXEA 5B3LA 2XMBA 1XAJA 5GAJA 3GX1A 4LPKA 3PXBA 3RABA 2INGX 5K0SA 4G5OA 1CNMA 1VJTA 5ALMA 3QG1A 2RCNA 3FH0A 3H9JA 5C8ZA 2IRWA 5DXFA 4JXXA 3AUJB 3ER8A 1XQ9A 1FMTA 5EMKA 3EIEA 4D02A 2R87A 2PIAA 2EIHA 3WV4A 1J42A 2J8ZA 3KP1A 4BB9A 1DBSA 3LFHA 4W7IA 2YV5A 3T7TA 2RGBA 5DPMA 1GNLA 4XEHA 2NSYA 1POWA 1GHTA 3G8DA 1HDOA 4L4XA 5JYEA 2LPMA 4TTAA 4CEJB 1KORA 2QJTA 3JAWA 3GWZA 2EG9A 1TECE 2ZR8A 4GRDA 2P6MA 1Z2DA 1F9AA 3E22B 3C41J 4TMYA 1UEIA 3B60A 2EDCA 2H52A 2IP2A 3F46A 1ZGHA 5JO0A 1J1IA 4HH4A 2QVCA 4LVCA 3PICA 1VDMA 4LNHA 1CNEA 1Q84A 4XLTA 5E6UA 1IN5A 1Q50A 2OD9A 3H5IA 4RQTA 4Y9DA 1GGHA 3QLUA 4BYMA 3M89A 3C3YA 4Z2AA 3AXSA 4V0QA 1IHOA 3PXGA 1ZJWA 2NZVG 3KQPA 3MA0A 3B6MA 3SX2A 1DCKA 4U0JA 3RIEA 4YCMA 1H2HA 1N6HA 1N4AA 1NMQA 3KLMX 1GUAA 1RXYA 3RJZA 2VP3A 4LRXA 2ZPUA 1NFRA 3DXFA 3HWSA 1F8UA 1SR8A 1AZSC 2PLWA 4II3A 4WKOA 3NHBA 4GX2A 3TMAA 3CVOA 1AQNA 5LDHA 4Q16A 4YJKA 3DZHA 3EXG1 4AD8A 4IYRA 2A58A 2O2JA 4I55F 3SSNA 3ROZA 1BXGA 1ACLA 1COZA 4K2AA 4OP3A 5BMVF 2QTBA 3E5RA 2EZ4A 3KHKA 4QRIA 1CTQA 1VSBA 4WNYA 3WJ2A 5M5BA 5GJWC 4J0KA 2K87A 1VIDA 2KWIA 4EPXA 1UK7A 4HB3A 3UMJA 3FAKA 4IDPA 4YRNA 2O23A 3MTDA 3C7AA 5HKKA 1FDIA 1OZFA 2D5BA 4HVAA 2QZJA 2ZIXB 4GT1A 1K97A 2G77B 3BAZA 1QK4A 3FN4A 4FLFA 1BXRA 4IIEA 3GOHA 2V55B 3M1IA 4FXOA 3OZDA 4C0LA 1AX9A 1BXZA 1I1QB 1NBIA 1W4CA 1XZNA 1VG0B 2PZEA 2WYUA 1YKFA 4FFSA 1SCJA 3MS4A 5I9TA 2R25B 1QHXA 4HNAA 1FNMA 1BW9A 3A4MA 3LLCA 4IOJA 4CQMA 1P0QA 1GQQA 2EFJA 1GPMA 2VWHA 3DVSX 3DD5A 3DOEA 4L28A 4PAOA 3WMFA 5CA0B 1L5QA 2PRIA 3HNOA 4LYHA 4XVCA 3QUCA 1VJRA 3OWHA 2WSIA 3QV2A 4RAQA 2Q7DA 2I7DA 2ZXUA 4W5WA 3C3KA 2YICA 1YJ8A 1OJLA 1Z28A 2TMDA 4LK2A 3TVTA 4MVJD 4CZ2A 1P4AA 4E12A 4HXFB 4C4ZA 5T7BA 1RM4A 4WZAE 4INJA 2X4DA 4WFIA 4MTLA 4WOCA 5LLTA 5HFAA 4O5OA 5CLHA 2JGKA 3NIFB 2QOEA 4I2VA 4RM3A 5MGBA 1JEAA 2DRIA 2HWYA 1R0LA 2QK4A 3L6EA 3QBEA 3AOEC 1PFWA 4G5XA 4NG5A 3RJ9A 2M32A 5JAIA 3KJEA 4ZZIA 3HVUA 2VDRB 4LXHA 2AF4C 1WDMA 1YBMA 3N86A 3UWKA 2PWPA 2WAOA 1RWMA 4X5OA 3N6RA 3TPZA 1E3JA 1D6JA 4HDRA 2EW2A 1G5RA 2B6HA 3UGKA 4AG3A 1FQJA 4OQXA 3R5JA 1G21B 2PX0A 2JJ2A 2I0FA 2WHXA 3AQ4A 2QLBA 3E8XA 5GTDA 1XAGA 3BRCA 3QLTA 5DHFA 1PQYA 3F6CA 3L7OA 3OLCX 4TYMA 2FUNB 2AR7A 1WCWA 2B61A 3Q12A 2AFRA 3RSOA 5IF3A 3J81k 4KE7A 4TKUA 4K8RB 1OYWA 4J0GA 3K4PA 5B12A 3WKEA 1NPTO 1C9EA 3DH0A 2FOLA 3QPWA 3I1IA 4GX0A 4JEUA 1VBFA 1OGIA 4AYXA 4Q9NA 3LU1A 2CVFA 3OX3A 4HAOA 2H85A 3EZ6A 1N2EA 3DCIA 5AW5A 3SF8A 2J3LA 4YK7A 3ZBQA 5KJ1A 2GXUA 4GPD1 4AWBA 3I28A 2RSLA 4IIVA 3TB6A 3HCAA 3CGGA 4NZOA 3KZOA 1GPDG 4JODA 1U8XX 3D6HA 1FNBA 1SC1A 4D4HA 2P1RA 4LYFA 1GL7A 2AMYA 3H7AA 1IPEA 2MHCA 4GC9A 1DBRA 2GD2A 1NNSA 4QXRA 1Y7IA 4Y1FA 5B1DA 1P7ZA 3BTUA 3MWYW 4YDSA 1YZTA 3MS7A 2YWHA 3QKRB 1CW2B 1LU9A 4N8EA 1SKYB 5LDDC 2Q3DA 4N6GA 2FLWA 4PHTA 2H1WA 1H1TA 2Y0PA 2IUSA 1OWMA 4HAZA 1X8JA 3BTSA 4M2LA 3T3MB 3EF0A 3W90A 2B3TA 2QVYX 2WVJA 4ZVOA 5JECA 5TF0A 2FKAA 5SZJA 4D3YA 2O48X 2L0XA 4CJXA 1RZVA 1SC9A 2DH6A 2X8BA 1U0RA 3NT4A 3I5YA 1Z83A 2V5AA 3QNMA 4UPDA 3JD4A 3ZLVA 1QP0A 4KR3A 2BJVA 2GLUA 4FEAA 4GBGA 3ESDA 1ECFA 4IJ5A 5KHOC 3M33A 3LOUA 5NLLA 1Q44A 2WPDA 4U7JA 2C7PA 1E5TA 1ZSVA 3FDIA 2RI6A 3CZQA 4JS0A 5JDIA 4F21A 4EO7A 1Q1AA 2P90A 4J1TC 3LHKA 3OQ6A 2HBQA 2Y0EA 3PQ4A 2FWJA 4IGEA 3OF2A 1U2EA 2IZ5A 2I6UA 3GT0A 1XDZA 1VKRA 3BXGA 4KKVA 4TVSA 3I01M 3DOIA 5LQNA 5DRYA 1EFDN 5IASA 3G23A 1NN5A 2M1XA 4A0FA 2HHHB 1WQ1R 3VU9B 4G09A 4R2WA 2AUMA 2HNKA 4GPTA 4OAOA 6GPBA 3WFIA 1CDEA 4XPZA 1YNSA 3D6NB 4M0LA 5EP1A 1A76A 4CUKA 2JF0A 2PV7A 2G9NA 5HUHA 1K5HA 1BDMA 2EWWA 2YZGA 5GV8A 1YS4A 4HSGA 2NADA 4UQPA 5I7UA 5EI5A 1P7YA 3NC0C 4FW9A 4FGSA 5TQ2B 4K9PA 1NBME 1NN3A 3P4YA 2R9VA 1D1SA 3G9XA 4GS5A 3Q8MA 2E49A 3D2LA 3FD8A 3LPDA 2CFIA 2QU7A 3AY7A 4JUAA 3TNDA 3U7QB 4IIFA 1U3VA 3R5HA 2K5UA 1OFTA 4W5HA 4C7JA 4PLZA 1IIBA 3SJUA 4EK9A 4BFCA 1V37A 2OHVA 1JAYA 4IDBA 1OREA 3U62A 1JQBA 1V26A 6NULA 1QMGA 1T24A 3I09A 2YXNA 3PFCA 2IEGA 5ARDA 5ILGA 4LFAB 1QFXA 2AN9A 4U7HA 5LXTF 3E2PA 2DYKA 3TVDA 4Q19A 2XQVA 1XZEA 4UC0A 3JWPA 4H0NA 1Q6ZA 3LKZA 1CIPA 2WLSA 4FEYA 3IMFA 5D6OA 2EG5A 2H31A 3NATA 3PXDA 3TSYA 3KKEA 3U4DA 1P0FA 3LPLA 1AA6A 2P2DA 1Y82A 4MRRA 5K3FA 2ID4A 3L1JA 3OAAA 2W22A 4QZVA 1ZCAA 4OGKA 2GPAA 3WXBA 3WQBA 4BFTA 4XR4A 3A2KA 1NXOA 2NQTA 2DBRA 3GXBA 4PLHA 4ARSA 1K3TA 3EHEA 1CJCA 1GG2A 2FW0A 4ZXFA 3W5UA 1ZHOA 2A7XA 3FLBA 2V9CA 4PR0A 4UAGA 3RVNA 1KVUA 3HBAA 1IB6A 2FFHA 2UYYA 3GDHA 4OQ4A 3RUEA 4RF5A 2JGNA 2PKWA 3WYGA 1YCGA 1SWVA 3EC2A 4CLRB 2Q5FA 3TL6A 4E7OA 2VF7A 4LRTB 1P6QA 2Y0DA 2FZCA 4HTFA 1KWGA 3PQCA 3VVMA 3G89A 4V3BA 3MOIA 3DEHA 1DS6A 3O2NA 4Y6GB 1EA5A 4BNHA 4KZKA 5IHXA 3QUTA 1M6HA 1MOQA 2PH5A 1GPAA 1F6WA 4I5EA 2JB9A 3AIOA 5B1YA 2B9EA 2CVPA 2A3NA 2QPLA 4NBLA 2BDTA 3S68A 4M53A 2PE5A 4RF2A 2OHXA 2P4UA 5LDGA 2NM0A 2EFHB 3EWNA 4DIOA 5CB4B 1XHLA 1O77A 4NIMA 4ARUA 2ZTMA 5AW0A 3B5JA 1LPBB 2JAOA 3E5NA 3C3MA 2GZMA 4BKPA 4I3FA 1R88A 4UUPA 2YJ5A 3IDFA 2CF6A 1OWNA 1UPXA 2YWXA 3B48A 4XGRA 1OV6A 1REQB 3JQ7A 3LQ4A 3T5GA 2W2VA 5JXWA 4O4HB 3AEZA 1J9EA 2XTJA 3QM1A 5DTJA 1QDEA 2O8CB 2PPVA 3CF2A 3EWIA 4F7DA 5ALJA 5EL0A 3QFCA 1CUFA 2GK3A 2OV2A 4FK8A 5HJ7A 4JB3A 2VHCA 4IOLA 4GX5A 1J8MF 3EUWA 5DT2A 1U02A 1FZQA 1L8OA 1Z7GA 3DPIA 2WFAA 3OOYA 4DGQA 2AZDA 2O2CA 3AKZA 4KLZA 4O2AB 4EPYA 5JWRA 1CUAA 3W6ZA 4DVJA 4UXJA 1K8YB 2PTGA 4WA8A 3WR5A 3WBBA 4AO7A 1X7DA 1KPHA 3AB7A 3JQAB 5THQA 1CIJA 1OLSB 3KZCA 1A7AA 4LXGA 4AS2A 4RJTA 3D3JA 5F7JA 3QTBA 2XXAB 3QKWA 3UHOA 1PJAA 3RU2A 4ZC1A 1UAAA 4Q18A 3CONA 4BGEA 4JU8A 2WHQA 3G9QA 4PQYA 3VX3A 2Y1OA 5KPJA 1KDPA 2FCRA 4H16A 1SFRA 4WXHA 1NTRA 1U7WA 5GONF 2MSCB 3UK0A 4LJKA 1J2YA 1N5DA 4RADA 2I1VB 4RVNA 2IH5A 1MX9A 3CLUC 3RT9A 4DVGA 2EKBA 4L0QA 4FKMA 2NPIA 4N39A 3MRVA 4OFZA 3T52A 4LDJA 5E1MA 1NJ1A 2P9YA 2QAJA 2BELA 2ZS8A 1M33A 3TMYA 3L0CA 4NV3A 2A9JA 1ZA1A 2I2WA 2NTNA 3LUAA 4TL7A 1TUBB 1ZG3A 3G79A 3SMQA 3MINA 4J6EA 4KXVA 5L6LB 2CL5A 1TO2E 2XGOA 1QQ6A 2ID8A 3UKOA 1JHDA 2BMDA 3A70A 4ZU3A 3EIXA 1L4UA 2X0RA 3K8ZA 4GP7A 4L9AA 4UMVA 5M34A 3RYCA 4QYSA 1YB1A 4JK3A 3EXEB 5KYNA 3AU8A 1Z2OX 2QSJA 3DFUA 1ZN2A 3I04M 4D97A 2P79A 1AMOA 1G20A 1WD7A 1U9IA 1P44A 4UNIA 3TAUA 1G8HA 5IKEA 3KETA 3IIEA 3K31A 1W73A 5G2OA 1NIPA 1YF3A 2BVNA 3NHLA 4EFLA 3TD2A 5BN3A 2QQFA 5H8WA 2HA2A 4DC1A 1HXHA 3S81A 1MABB 1XRRA 4M7RA 3SEAA 2N42A 1TYEB 3BULA 3BMOB 4XZ3A 3GEEA 4ZJUA 1E0DA 4YAJA 1RLIA 4LZOA 4H18A 1GV0A 1H65A 4KVFA 1USVA 2I2DA 3U7IA 4IHAA 3ZDEA 5AUPB 2JHAA 1A9OA 2XRMA 1X1TA 3FR7A 1NC3A 1Y1QA 3C4QA 1POXA 3QBJA 1MV8A 1Z5NA 2AL7A 2CZQA 4L1KA 2LR0A 4MGZR 5EWMB 5ITSA 4KFRA 2JFHA 1QQBA 3IH5A 5AK6A 3IQIX 5FFFA 3WSTA 1TT7A 2B4KA 4EEXA 2XXBA 1OTHA 3BMNA 4YPFA 5AKYA 1WPXA 4YP1A 1G3RA 2ZAIA 1PHPA 4QG3A 1PZFA 2E4YA 5KNBA 5KNBH 1G2QA 1PWEA 4H1VA 1RXIA 4HFRA 4FNGA 2HADA 3B7GA 2C58A 4L74A 4OPMA 4AX8A 2XWJI 4H08A 4KQ9A 4Q48A 4ZAYA 2FZVA 5KJEA 3WBKA 4B9EA 1QIIA 2BTQB 2OOSA 3LS2A 3EZFA 1Q0PA 3NKVA 2IHBA 3OM8A 4FCTA 4KLRA 4MYCA 1OW3B 3KX2A 1U2QA 2YASA 3VH4A 1SHKA 3KPUA 2YOHA 4B7UA 2Q3HA 5B1IA 4IF6A 1GZSA 2LNDA 3RADC 2XITA 1Z0FA 1CRZA 2BHNA 2NV2B 4Z9XA 3QFTA 4YGYA 4H3VA 4UZEA 4EKEA 1OYVA 3OO1A 2I2XB 5EA2A 5E6SA 1CZLA 4R5MA 5B64A 2QHXA 1Q17A 4FDLA 1AKQA 2PUBA 3UICA 2IIQA 4ALJA 1V8FA 4J0DA 2FF5A 5A4AA 3AM4A 1Q20A 3COVA 3DONA 5E3JA 1UK9A 3OD5A 5KYXA 2P6UA 3EDQA 1NW4A 1IK4A 1CUWA 1XZFA 3X44A 1GU1A 2R7NA 2B7CA 3TLGA 2C7RA 3FUXA 2X5JO 3M7IA 4P4GA 4ZQGA 2PZ8A 3GP8A 3U9TA 4BLPA 5BSEA 5C1OA 3OQPA 4G8JA 1QDLB 1VJGA 2O3UA 2X76A 3AEKB 3LUGA 3KVVA 1NNI1 4RVSA 4MINA 5FI3A 4J3JA 4C06A 3NUGA 1AQIA 1GOTA 4U2GA 2F43A 2J08A 1HBJA 1AUXA 3KEGA 1FDWA 4L08A 4L9RA 4DY6A 2FMTA 1SULA 2B25A 1O95C 3DHWC 3DJFA 2CB9A 2NU7B 3EXAA 5T4FA 1QHSA 4L5BA 1TLTA 4ZT2A 3K0FB 1U7HA 3UG6A 4E31A 3UT0A 2V45A 3D1VA 3AHJA 1IQ0A 3FWHA 3I05A 1FP1D 1WMDA 2R1UA 4DSAA 4ZEVA 1UWCA 4YGXB 3QU9A 521PA 1QJCA 2WD8A 1G5TA 1NI5A 1X1AA 4NFHA 1I30A 4YP7A 5AVSA 4PX9A 1GZHB 1QOPB 3M5DA 3LKDA 1NT2A 2H8KA 2EJTA 4CFYA 4IJVA 4O3FA 5TMPA 1ECBA 4X1IA 4JI5B 2HDHA 3SY8A 4WIAA 3FSGA 4R2HA 3WDLA 5BSHA 1U2SA 2PBRA 2QN2A 2ZWIA 1MFZA 2I2CA 3MJTA 1B3RA 2PX4A 1QRDA 4KJXA 3FYUA 3LUDA 3PQ5A 4M89A 4QECA 3MTBA 1T4MA 3O31A 1W85A 1A4UA 4XWTA 3NHSA 5K0ZA 1EFVB 4RS3A 1FX1A 1G3UA 4IFIA 4DDHA 2HRCA 2W71A 3FDXA 3MHTA 1FF9A 2Y71A 4C30A 3EEFA 4MDEA 3DDWA 4O2AA 1UAYA 4A9AA 1QANA 1CLEA 2ZIGA 3TGPA 3KEFA 2Q2VA 3QW4B 1UDXA 3P9KA 1QUFA 2HJVA 3JWHA 4NI5A 2OD7A 3HJGA 1H2WA 4Q00A 3IOCA 1K88A 2IIBA 1NUSA 1Y81A 1HH4A 1Y5IA 2ZBVA 3Q8WA 1GILA 1JYSA 4Q21A 4KE6A 4DUGD 4YDQA 1ZK0A 1FFYA 3KTAA 2ODBA 1OVGA 1NMZA 4YFYA 2VJLA 3U3DA 4YT8A 1KY2A 1R6UA 3RG2A 2GQ0A 5T4BA 2NVOA 3A7DA 3I61A 4ZU1X