2UDPA

Udp-galactose 4-epimerase complexed with udp-phenol
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray structure of UDP-galactose 4-epimerase complexed with UDP-phenol.
pubmed rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 131
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2udpA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2udpA01
4TSKA 2C54A 2NTJA 5EESA 5KVSA 2EGGA 4WNCA 4TKMA 4HP8A 3ONFA 2QYTA 1LBEA 5EIOA 4CLOB 4S1VA 3O38A 3PJGA 2CZCA 4XR9A 4AJLA 2I67A 2GZ1A 1F14A 4W9NC 4BB5A 1PGNA 3U3XA 4AJ1A 4YDRA 4MIOA 3PQFA 1YDWA 4J0EA 1HE4A 5A5EA 4YR9A 2VWQA 3JQ7A 2Q3EA 3F4LA 1P1JA 2C59A 5JCJD 5DZSA 2Q2QA 1GY8A 3L4BA 1NM5A 4BKPA 3SBOA 1L7DA 4CLXA 4NFYA 3EVTA 1GV1A 3F6YA 3Q1LA 4IDDA 2VHXA 1BW9A 2NLOA 5JMPA 3I9LA 1JVSA 2G1UA 1E7RA 1KVSA 1ZK0A 1QV7A 1WDLA 4R41A 3CZRA 4PRLA 1DHTA 4XIJA 3VOSA 3U0BA 5JPIA 2BHLA 2VWHA 1XU9A 4LW8A 1ISFA 5L7TA 3EZYA 1YO6A 1PX0A 2PZMA 5DCWA 4J1SA 5EERA 1T1RA 1XCBA 5KNLA 3LC7O 2CF6A 3EYWA 4CLRA 3QWAA 3L0DA 1D1SA 1XKQA 1RM5A 1YE3A 1O95A 3MJ4A 4HV4A 4CM6A 4J16A 5CP8A 5A9SA 3A06A 1IULA 4BGVA 3QVXA 2VHYA 5KCZA 3RUHA 3WQRA 2GSDA 2J5RA 3JD3A 2J5QA 4LSWA 3ZHBA 1P1KA 1EMDA 1ZJZA 1A7KA 1FMCA 4LK3A 3VH2A 5C7LO 2IRWA 1VSVA 2IXAA 3RASA 1DC5A 2FR0A 3A9WA 1AE1A 1OC2A 4YRBA 1NFFA 4TQGA 4N18A 1HDXA 3ENNA 5U1PA 2FRDA 3L4BC 2XAAA 4EGFA 7ADHA 3I6QA 4W4TA 1RM4A 3DBHB 4BL5A 1A7AA 4M1QA 2YV2A 2V6BA 3GA0A 1G0OA 3QVSA 4PLYA 3D3WB 4W7IA 3R3JA 4MKRA 3UUWA 4RDIA 4Q3DA 9LDTA 2AG5A 2WDZA 3ZWMA 3FI9A 3AW9A 5G4KA 5CDTA 1WWKA 1YDEA 3AUUA 3R1IA 4Y6RA 1DEHA 3JD1A 4OXNA 3QIVA 3UGKA 4B8WA 1Q1NA 1X15A 1PZFA 2CVQA 4I9HA 4J4BA 4UEOA 2X9GA 5G0WA 2RH8A 3ANLA 4O1MA 1Y81A 2ZJ0A 3G1TA 4UVGA 1TB4A 1CERA 4KTTE 4DWVA 1R4MB 2X7HA 3T7EA 3C24A 3WGZA 3IKVA 1OC4A 4D45A 4BO6A 2DVMA 4QQRA 3WFJA 3LQFA 3JQ6A 1Y9EA 3UFXA 5JAZA 1WAMA 1KVRA 4IMRA 1PZHA 4W99A 2HK8A 3KB6A 5L9AA 2I66A 1PJ3A 2UUPA 3JYNA 3VPGA 4MIYA 2AQIA 5L7WA 2HCTA 4FIZA 5A9SB 3S1LA 4IDCA 4RF2A 4ZQFA 3DHNA 2DAPA 1P9LA 1KEVA 1R12A 3OJOA 2G5CA 3GY0A 3QWFA 3RIHA 4CR8A 2YYYA 3ZV6A 2W4QA 4RZHA 2C7VA 1N7HA 3QV1A 3O26A 3U49A 3KHUA 4RVSA 4GLLA 1VL6A 3C7DB 1C0KA 3TOXA 3TJRA 3DOOA 1X0XA 4GWGA 1P1HA 3BA1A 5IDYA 2BI8A 3SX2A 4BVAA 3HN7A 4Q39A 5ER6A 2DFVA 1P33A 1O0SA 1E3JA 4K6CA 4TROA 4ALIA 4M86A 3S8MA 5BSEA 2HK7A 5JSFA 4IPTA 3H8VA 4CQMD 4MPDA 3GZNA 5KJFA 3L9XA 4Q3BA 3AK4A 4KMSA 3C1AA 3H6KA 2DTDA 1LSSA 4XYGA 3LT1A 2HMUA 1ZVMA 1P1IA 4CM8B 5DOVA 3GG9A 4Y8VA 1U3VA 3KEQA 4ITUA 1NP3A 1QYVA 2CF5A 2YHIB 3QVWA 5K6AA 5LDGA 2O7QA 3KYCA 1UP7A 3GNQA 3SC4A 3Q3CA 3K9QO 4KZPA 5TGDA 5TLSA 2ZTMA 1Z7EA 1LC3A 3HDJA 4WGGA 3CKYA 2QZ9A 4XQGA 4MIEA 5IZCA 5L4NA 3C8MA 2DPHA 1B8UA 4EEZA 1ZXBA 2O3RA 4PG7A 2WE7A 1YB4A 2ZTUA 1Z7BA 2Y1CA 2YDYA 1FXSA 4WLUA 4DXHA 4BQPA 1I3KA 4PN3A 4BS9A 5TJ9A 3WWZA 2UUOA 3WYBA 3QA9A 1JQBA 4RORA 5ICSA 3H5RA 2BRUA 3WGGA 3WWYA 3K6JA 4AJEA 5G4LA 5T5QA 4R69A 2TMDA 4Z0HO 5JO0A 2FN7A 1GCOA 4P4GA 3I5MA 1XG5A 2I5PO 2ZB8A 4L0QA 2X6TA 4XCVA 4LSMA 3DTTA 2JL1A 4B8ZA 5K9ZA 4HFRA 5CPFA 1OOEA 1AUPA 3KZVA 4YBZA 1MG5A 2I99A 2OO5A 3F46A 4PFJA 4CR7A 3B20A 5JE8A 1PJ2A 3H3FA 4XX0A 5T6BA 5G0VA 3VHRA 5CDSA 4HFJA 2QRKA 1ULUA 4AJJA 4J2HA 3AUAA 3B6ZA 1ZEJA 3GT0A 5I9MA 4BKQA 2WYUA 2Y1DA 3B70A 5KJ1A 4CUKA 3IIEA 3RUAA 4J0FA 3W1VA 1KVTA 3CUKA 3KTDA 4FJ1A 1U3TA 1BW9B 2ZATA 4E30A 3FN4A 3OEWA 2FPIA 4PLWA 2C20A 3VH3A 4GVXA 1PZGA 4HNGA 3OJEA 2GASA 4I1IA 1D8AA 1HEUA 1ZO8A 4PG4A 3F3SA 1JN0A 1O5IA 3DMYA 4Q3NA 3E9QA 1LRKA 2A35A 2EKPA 4CV0A 5K0ZA 2RHCA 3HNPA 5H81A 4ND2A 4MP3A 2OL4A 3OM9A 4BKUA 1HYHA 2D3TA 4GMFA 4CM4B 3HZZA 4FSHA 2I9PA 5JCXA 3AM4A 4M55A 4G5HA 5CDGA 3FNFA 1S6YA 1M67A 1Z45A 3TZHA 4WCDA 5T57A 1ISJA 1MFPA 1V9LA 3BTVA 1E7WA 4L73A 2J3IA 3K2BA 4WLNA 2Q46A 3PI7A 4B4OA 2IEBA 2NQTA 4P22A 4RCVA 4UUOA 5F5LA 3PWSA 4A10A 1E92A 4WECA 5JCJA 4N54A 7MDHA 4KUGA 3ZWBA 4GVLA 2DUWA 2C7GA 3QE3A 3GRPA 3DL2A 2WJPA 4FD3A 3KSZO 3L9WA 1I3NA 1PQWA 3AY7A 3S2EA 2PD6A 3MOGA 4FOSA 3VPSA 4AJKA 1ZMOA 4NU5A 3OBBA 4DLBA 1DC4A 3IUSA 1I8TA 2CY0A 3H7AA 1N8KA 1FDTA 1WXDA 3GUCA 4XB1A 3VZSA 1YB5A 1E7QA 4UVEA 3L6DA 2JFFA 5DOZA 1NYTA 1K6JA 2PLAA 3K2EA 3TRIA 3WGHA 2O2YA 4UVIA 4FFNA 1YQXA 5TT0A 4KWIA 4JBGA 2PKQP 1TT7A 1W8DA 1ZK2A 3KV3O 4E12A 3EW7A 3GRKA 1LDNA 1UZLA 2O4UX 5JC1A 1DIAA 3AI1A 1C1XB 3BMQA 4AJ4A 4J7CA 1ONPA 3P2YA 1F12A 5IXSA 3OP4A 3JV7A 4R68A 2AQKA 1E5QA 3RQSA 2QX7A 5BSGA 1M75A 4D42A 4R1SA 3SJUA 4YT8A 1R6DA 3DOJA 3VDRA 1VKOA 1NAIA 4CLEA 1HXHA 1W6UA 5IZCC 4CMIB 1ZH8A 1F8FA 1U5AA 1XQ6A 4CQMB 2UAGA 3LLSA 4BKOA 2FHSA 5DBIA 2VYNA 1BXGB 4ND5A 5AXDA 3RJ9A 1QSGA 4DC0A 3FWNA 3PK0A 5DBFA 2D5AA 5COAA 1JDJA 3D0OA 4E3ZA 4J49A 1T26A 3HWRA 4YVFA 4AJPA 1HL3A 4Z0PA 4N7RA 4B4UA 1VJ1A 2O50A 2IZZA 3F5SA 2JD1A 1XYGA 1V35A 4R1TA 4RVFA 1DO8A 3GVIA 4GLOA 2O48X 1Y5RA 1Q7BA 3KOUA 4E13A 2JFHA 1DXYA 1X1TA 2OMEA 3ANNA 2VUTA 3RKUA 1PJ4A 2P9CA 1Z75A 2HDHA 5MGBA 3W6ZA 5AVOA 5G4KB 1C3VA 2O4CA 2BGKA 3AOEC 3EHEA 4L4XA 1ZEMA 4WK6A 5KIAA 4MDHA 1XELA 4LN1A 1VE9A 2D4AA 1E1MA 1NFQA 3OJFA 4BUCA 1HYEA 4UEJA 2GYYA 1HF3A 1YQGA 3U09A 1H93A 4Y67A 2XF8A 1J49A 3MWEB 1LSOA 1QMGA 1R4MA 1PS0A 5TQVA 3PYXA 4FFLA 2VT3A 3RKRA 1MC4A 4BO2A 3RUIA 4YACA 2BI7A 1OFGA 3Q0EA 4OOEA 5DP1A 5BR7A 3QHAA 2EP7A 4CM7A 5BT9A 5ILGA 4CMIA 2FSVA 1GDHA 1RM3A 1TLTA 4YAKA 4U5QA 3ZU4A 3FPCA 5FEUA 1GQQA 4HFMA 5C3MA 2NADA 4BO4A 1JWAB 4RLHA 4Q9NA 4OAQA 5GMOA 2YV1A 1I30A 1KERA 4DGSA 2Y1OA 3BMCB 4BNFA 4CUZA 3Q2IA 4INAA 5DF1A 3X2EA 3D4NA 5TIIA 1RYEA 1L1FA 2W98A 3RFVA 4XYLA 3I9NA 1DC3A 1KVQA 1W0CA 3JYLA 4MVJE 1BWSA 1D4FA 5JLAA 4OXYA 1I3MA 5A03A 3KETA 3O03A 3OETA 3MCVA 3DZHA 3OFSA 4I5EA 4R3NA 1HZJA 1H6DA 1I2CA 1VSUA 1V6AA 1Y8QA 2OBYA 3C3XA 5B4UA 5JY1A 1DHRA 5F5NA 1Z74A 4GSKA 5C5IA 4RDHA 1U7HA 2DTXA 2EKLA 2RAFA 2AEMA 4J4HA 4RPGA 2AEFA 4F46A 2CFCA 4D7AA 3AFMA 4IQ8A 5U9CA 4YRDA 5LC1A 4AFNA 4NDNE 1UZNA 1ZIDA 2I3GA 4FC6A 4BNNA 5H83A 1X7DA 5TJHA 3D1LA 5CFZA 3PWZA 2J3HA 4OO3A 1E3WA 4JX8A 2R00A 4R9SA 2BGMA 1TT5A 3A28A 4PIVA 1FDVA 3GPIA 4CM4A 4K26A 4YYZA 5JO9A 4R5HA 4TZTA 4Z3KA 3QWIA 4AJ2A 2OFPA 1U7TA 1B0AA 1BG6A 1ORRA 2PZKA 1GYQA 3RC2A 1ONNA 4XJSA 1ISGA 4ZU3A 4JNKA 4D0RA 1V3UA 3DOCA 3GMDA 3BTOA 3HDYA 3V8BA 1NHGA 1E6EA 4AJHA 4OQZA 2OUIA 2X4GA 2ZKLA 1AGNA 3LC2O 4QT0A 5GY7A 4CMHA 2DBRA 3GFGA 2PD3A 3ADOA 2VUSA 5KTKA 2JAHA 5TC4A 3AM3A 1JKIA 1H2HA 1OMOA 1Q0QA 2B4QA 3I9KA 4WLVA 3V2GA 1PL7A 4BV9A 1DIRA 2R00C 3E48A 1DB3A 4EJ6A 3IC5A 3DXFA 3OJ0A 4BOYA 1E1NA 4QO7A 1N2SA 1C1DA 4A26A 3KBOA 3PHIA 5A3JA 3D64A 1LRLA 3FRJA 3PPIA 4DLLA 2DKNA 3DAGA 3HADA 2B5WA 3JQ7B 2PFGA 2ZYGA 4BO5A 1CJCA 2P5YA 3SLGA 3GPDG 4XB2A 1X13A 4MP6A 1PGJA 3FBTA 3RAJA 1UXKA 4ND4A 1L7EA 1P31A 3VAZA 4OMUA 5BNTA 4HXYA 1DRWA 3RCBA 3QVTA 3STHA 1KYQA 3GGGA 3WTCA 4OIMA 1UAGA 1CWUA 4ZN6A 3L07A 3KEOA 3VPFA 4PLPA 1UXJA 3DQPA 3I83A 4BNLA 3FTPA 5IN4A 5JW6A 4A7PA 4RPJA 1LI4A 3VKUA 2NNLD 5C7IO 4KDEA 1KC1A 3BMQB 4GGOA 3LT0A 1ID1A 4KQWA 5JYEA 4IXWA 2Y0DA 4NH4A 1E1LA 3SXPA 4XZ3A 4LGVA 1RM0A 5KKAA 4PZDA 2O3QA 3DBVO 3VPXA 4BNYA 5CG2A 3JD0A 5JYDA 4L9RA 1MA0A 3PEFA 2BFAA 4LVCA 1H2BA 4K9DA 4YAJA 3WJAA 1HKUA 1ENOA 4LCJA 3IDSA 3I9MA 3PRJA 1C1XA 3PP8A 3TSCA 3GMSA 4I5GA 3BHJA 3PYLA 1XQ1A 4DC1A 2HMSA 4WJZA 4ZQHA 2WSBA 4D44A 4GQAA 4WEOA 3VDQA 2X58A 2YFHA 5F1PA 5AYVA 2DM6A 4OHUA 2BFPA 4BNTA 4E2YA 2YUTA 1GQ2A 2FMUA 4G81A 2YY7A 1PR9A 3KLMX 3NTOA 3BMNB 3IMFA 3MOIA 3ONDA 4IDGA 3RWBA 3FPLA 3ZU2A 2XOXA 3ZZNA 2AEJA 2BKAA 4BO8A 3CPSA 3PQEA 5G2OA 4L76A 3ITKA 3SLKA 2VT2A 4RL6A 3V5NA 4WNIA 3AJRA 3JQ8B 1B15A 1DC6A 1QYDA 1MXFA 4J91A 3EAGA 2Y1FA 3HE3A 4LRTB 4BGIA 2Y67A 1WDMA 5C7OO 1R4NB 3WG9A 1N1GA 3S2GA 1KOLA 5K6AC 1GL3A 4OJNA 1X0VA 4WEQA 1YVEI 1BHSA 4FS3A 3JQGA 4B4VA 2AQ8A 4XA8A 1NTOA 1HE3A 2H9IA 2W2LD 1DBVO 2E82A 1F17A 4G65A 3JCZA 4L74A 4E6PA 5A9RA 1QLJA 3GG2A 2WMDA 3ZH2A 4CLRB 3GGPA 3NRCA 4CMBA 2AXQA 4HBGA 2A92A 4BNHA 2VYND 5DN9A 2PY6A 4XQ9A 2DT5A 5L3ZA 1ZSVA 1TA4A 1Z73A 4DYDA 1DRVA 4U7WA 4R5MA 5DNAA 3JD4A 3WMWA 1ISHA 2D5CA 1V3TA 1RYDA 1J4AA 1GV0A 4O6VA 4ILKA 1YB1A 2HAEA 2Y1GA 3IAHA 4NG5A 5I8WA 5L4SA 4EBFA 2DBZA 4FGWA 4LMPA 4IY1A 2OOSA 3BXXA 2Q2WA 3DBHA 1U2DA 2VOEA 3EZLA 2JCVA 2DU8A 4IINA 4M49A 4B3JA 4BNVA 3W4JA 4J7UA 4NMHA 3S2IA 5AXCA 4E5NA 5KJCA 3RUCA 3BYZA 3FR7A 2FWMX 4FR5A 3TNLA 5LDHA 4NJMA 4XYMA 3RD5A 3WXBA 1R37A 1U2GA 2UYYA 3ZWVA 4WPGA 1BXGA 3BMCA 2X9VA 2CDBA 3G0OA 4PVCA 3ZV3A 3OIDA 1E5LA 3JQGB 3ZW8A 4YA6A 3KUXA 5ICMA 3OIFA 2A4KA 4JLWA 4B4WA 1GD1O 3INGA 3KYCB 2IYPA 4JJGA 3WIEA 4KDFA 3ZNOA 4E5YA 2WD7B 3K30A 3TWOA 4YJDA 4R9RA 1BXZA 1YRLA 2YW9A 4YAIA 3WB9A 1Z82A 5EL0A 3ASVA 4S3MA 3H9GA 3ROPA 5A4DA 5JDCC 3E1KA 1D3AA 1LC0A 3WLFA 5BSHA 1CIVA 1EK5A 1MP0A 4MVJF 4IJWA 4FFMA 1FK8A 4DLAA 1LSJA 3GR6A 4PLGA 5DULA 5IFLA 4BV8A 1FDSA 2FY8A 1U28A 3PHGA 4XDZA 1HLPA 3GVPA 1CQIA 1GADO 1T2DA 3GC6A 4QUKA 1QYXA 2Y68A 1VC2A 1A5ZA 1UJMA 2B4TO 3HUDA 3AOGA 1OBFO 4YJGB 2I65A 3ZU5A 1E3EA 5TX7A 3KYBA 3I4CA 4FFPA 1EK6A 2QRLA 3OIGA 1UXGA 1YWGO 3NT4A 4HADA 3O8QA 3PIIA 4BHTA 3JQCA 3LF2A 3WGOA 1LQUA 2AQHA 1NBOA 1P1RA 3BIOA 2YZ7A 3JQEA 3G49A 3UKOA 3M6IA 1E6WA 2HUNA 2VRBA 1C1DB 3PVZA 1R66A 4WCFC 4B3HA 3R0IA 3PTZA 2QIOA 1I2BA 1GR0A 3GZNB 5A3VA 1QRRA 2JFGA 3HG7A 2GLXA 4GX5A 1R0SA 8LDHA 3PJEA 3HQ4O 4L4RA 3DFZA 3WBBA 5DCYA 3UHAA 1YBVA 3K92A 2HMVA 2VWPA 3GHYA 3D5QA 1E7MA 1GUYA 2CUKA 3WICA 2VQ3A 3V1TC 2BGLA 1IYZA 3GLQA 5DBGA 1OZAA 5HRUA 1EDOA 1LNQA 3AU9A 5KKCA 2ZQZA 4YRAA 1NNUA 1AXEA 1AHHA 3X2FA 5TSDA 1NPYA 2Y05A 3H9QA 4DVJA 1BTOA 1EUCA 3GAFA 4JBIA 4IGEA 4IIVA 3AU8A 3AUTA 5KVVA 1U3WA 3L77A 2FSSA 2PNFA 3PDUA 2RCYA 4E0BA 1NQAO 1I5RA 1NR1A 3CH6A 3PHHA 3GZ4A 4R51A 1DPGA 2RIRA 3UXYA 1GUFA 4J1QA 1YGYA 4BO0A 1KY5A 4PLTA 2P4QA 4NU6A 2H1SA 1TT5B 2R6JA 3E8XA 1T24A 3TFOA 3HFGA 4QTZA 5EPOA 4ZVVA 1B14A 4HWKA 3ZWNA 2C5AA 3PQDA 4BGEA 4HNHA 4ZHSA 4C7JA 1O94A 3OICA 3JQFC 2OP0A 4IM7A 3RUEA 1MG0A 3P2OA 1YBAA 3RROA 3ZGYA 4L75A 3QY9A 6ADHA 4DIBA 4H16A 4M87A 3OMLA 5CDUA 4CV2A 1IE3A 1UR5A 3C1TA 3I4FA 1PL8A 4IXTA 4IZHA 4RO0A 2B5VA 1PJLA 4NFSA 2X0IA 3DZKA 3OHSX 3WIDA 4BNUA 3T4EA 1I36A 2H6EA 4L4SA 5DCUA 1KETA 2O3JA 4GSLA 4D79A 2B35A 2QRJA 1GQYA 4CJXA 4BB6A 4I5FA 2WE8A 2QYSA 4XYBA 4F45A 2NV6A 4ZQGA 4CODB 4HUJA 1R4NA 2DLDA 5CAEA 4FBGA 3ONEA 3ABIA 1E0DA 3H3JA 3WTBA 3M2TA 1NWCA 3TZKA 3MTJA 3N74A 4QFCA 2C0CA 1IHYA 4OQYA 1Q0HA 1IB6A 3GVXA 1D1TA 4UREA 4EI2A 3DR3A 5C37A 3RFXA 1WZIA 1JVBA 3H65A 1EVIA 2J5KA 3RC1A 4DA9A 5A04A 3WNVA 3CSDA 1BXKA 3Q2KA 1LLDA 2D8AA 2RHRA 1JAYA 4OKNA 4XD2A 3I3OA 4MOWA 4WCFB 2X5KO 3IKTA 2IZ1A 4MKZA 2C82A 5JY6A 4IDFA 4JGBA 3U62A 1YJ8A 3JSAA 3FBGA 5F1OA 1LU9A 1SB8A 2V6GA 3GNSA 3KSUA 2PK3A 1EQ2A 4BNWA 2A94A 1PTJA 1VM6A 5A05A 2VNSA 5B37A 3JQDA 1S7CA 1X7HA 1NX6A 4IJVA 5CEJA 4DRYA 1TEHA 4XQCA 2NVUB 1LDMA 2AMFA 2DFDA 4F6CA 2CD9A 2Q50A 2GDZA 2ZTLA 3FNEA 3HDHA 2DTEA 1QORA 4UUNA 3BTSA 1YBMA 4GBJA 4RV9A 4DIOA 4CMGA 1M66A 3RI3A 2GN8A 3FSRA 3LK7A 4Y6SA 1TVEA 3P19A 4M8SA 3KRTA 5IN5A 1N92A 3NDRA 1BDBA 2Q49A 2VHZA 1MGOA 5EN4A 1VRWA 1IY8A 3VKVA 2Q99A 3MJTA 4WOKA 3MWDB 4CMJA 4RJTA 4FOOA 3COSA 2IYOA 4F6LA 1LTHR 5IAAA 4HX5A 3VVBA 3AM5A 3JTMA 1HYGA 1UZMA 4PG5A 2ZJ1A 1PEDA 4WASA 3MJSA 3TPCA 4PCVA 1BGVA 1EVJA 1SPXA 3NEPX 3FF4A 3ROQA 2H5LA 3HHPA 3WYCA 1DRUA 3QP9A 1XU7A 2PR2A 2J3KA 3HB5X 2ET6A 1FDWA 3JD2A 4YJHA 3RVDA 1GEGA 3GUYA 2X5OA 4EITA 3DAFA 1ZW1A 5JAQA 4EJMA 1B26A 2NQ8A 4M89A 5B4TA 1QLHA 1HDZA 3EGOA 3PHJA 4GKBA 2J6IA 1Q7CA 3E5MA 1WZEA 6LDHA 4Q3EA 4YEDA 4EYEA 1B8PA 2ZK7A 4YQYA 3GEDA 1XWFA 2JD2A 3PLRA 4BNGA 5JMWA 1WMBA 4YJGA 2NM0A 3S55A 1T2EA 1KS9A 3ASUA 4H15A 3WBFA 5L7YA 2E37A 2F00A 4XYEA 4TKLA 4ESOA 4P8RA 4Z9YA 5EJ2A 3OA0A 1GPDG 1GPJA 2YHIA 4NBVA 2I3AA 1R0KA 3VTZA 4CM3A 4FQ8A 3PZBA 4O5OA 3DAPA 4YJFB 4FJ0A 3AY3A 1DFIA 3W4IA 3GH3A 1WVGA 4P38A 1CQJA 1HDGO 3CMCO 4NK5A 4RPHA 4GX0A 3TZQA 3ZWPA 3C7CB 4IDEA 1LLCA 1NWHA 3LYLA 3W8EA 1WDKA 1RKXA 4ND1A 4QXMA 5CG1A 1DJQA 4RPKA 3ON5A 1IL0A 2TMGA 4YB8A 3QLJA 3NGLA 1T2FA 1C14A 2DQ4A 2GZ2A 1XHLA 5FF9A 4NJMB 4IZIA 1PWXA 2Y1EA 2BELA 4FC7A 5GZ1A 3BMOA 2GN6A 3EC7A 3PFWO 4ZQBA 1I01A 3ZWAA 5CPBA 1E3LA 3KYDB 4B7UA 1FDUA 2YQ5A 1H9BA 1PIWA 1Y9AA 2VHVA 2YJZA 3WNQA 3DBLA 2B37A 4JP2A 3JQBC 5I9NA 2A9FA 3R3SA 5AXAA 2WD7A 3N58A 5EINA 9LDBA 1UXHA 2VZ8A 1QYWA 4ALJA 2DPGA 4D3SA 1HTBA 2G17A 2P2SA 4PLHA 3K31A 1PS9A 2VN8A 4PZEA 3RBXA 2EW8A 2ZTVA 1LDGA 4IDAA 1EVZA 4D46A 3CMMA 4W7HA 4A2CA 3ORFA 3IP3A 3P7MA 3ZWOA 4FFOA 1EDZA 2JHFA 3H4VA 2VZ9A 2ZB3A 3NX4A 1PGQA 4JK3A 2P91A 3F47A 4DPKA 3Q6IA 4U8GA 1U9JA 2QHXA 3DO5A 3WQSB 3PYMA 2CDCA 4JBHA 4R01A 1HLDA 1UUFA 3RC9A 3L6OO 1YL7A 2B4RO 2HK9A 3NT5A 5BNIA 1CF2O 1MX3A 1X1EA 5I9LA 2HKIA 2NWQA 1HDOA 1LA2A 2EHDA 1WNTA 5T67A 3WLEA 1OI7A 4KP7A 2NU9A 4DREA 4E31A 1K6IA 2Q2VA 1LRJA 2WYVA 5TF4A 3QVOA 1MLDA 3HDQA 3ICPA 2ZCVA 3I9OA 4OKIA 4MJLA 3QWBA 4UEKA 4CLOA 3H2SA 4UVHA 5ITVA 4Z6KA 3DB2A 5IDWA 1HWYA 5ITWA 1DJNA 4AJNA 1ZFNA 4PG6A 3V1YA 1ENPA 2PH5A 4GGPA 1DLJA 4K28A 3NYWA 4M54A 1AXGA 4CQLA 1GU7A 4RVUA 1XDWA 4NNJA 3GEGA 3F1KA 1H9AA 3UF0A 2GF2A 3C85A 3OQ6A 4WKGA 1O6ZA 3GNTA 1KC3A 4OH1A 2FPPA 1NVMB 2F1KA 4D3DA 5CHEA 3F9IA 3HFSA 2OP1A 4AICA 2RH4A 2G76A 3W6UA 3D7LA 3KO8A 3H5NA 2GN4A 4OM8A 2YQ4A 1BMDA 1ZMTA 3HN2A 4A73A 1YS4A 2J8ZA 4GWKA 3H9JA 3G3EA 3DTYA 5FYDA 4MVJD 1EFKA 1BVRA 1ZUD1 4BO9A 1DFHA 2VNAA 3FWZA 4CMEC 3WGQA 2E48A 3K96A 1HE2A 3NGXA 4II3A 4QFDA 3AUSA 3GFBA 4WCFA 3FTNA 2X22A 2EWMA 4IGFA 5B12A 4TRRA 1A72A 3LLVA 1NAHA 1NFRA 1PR3A 1KEWA 1B7GO 4EUHA 2C07A 3ST7A 4DPLA 3G1UA 2NVUA 1M76A 4QO8A 5TS3A 5CEFA 1LJ8A 3WFIA 4MINA 1K2WA 1P45A 4C7KA 4E2XA 3CINA 1CETA 1Q2XA 2EKQA 3DMTA 3WDSA 3U4CA 1FJHA 4I9NA 3CTMA 3PZRA 3DHYA 2NU7A 4TVOA 3GHHA 5B4VA 2DUUA 3UCXA 2CSUA 3F1LA 2HO5A 5J23A 1QKIA 3LF1A 1ZK3A 4MVJG 2AE1A 2VTEA 3ZWWA 1EVYA 4R3WA 2YDXA 4U0KA 3V2HA 2GO1A 1QV6A 2CVOA 1ISMA 1F8GA 2E6UX 1GZ4A 2P4HX 3MJEA 3Q9UA 2QG4A 4I8XA 3VVCA 2BLLA 4HKTA 4BNIA 3JYQA 4JCOA 2EJWA 2Q1SA 1F06A 1XA0A 2PA3A 3ZN2A 1H5QA 3AY6A 3K8ZA 3E5RA 4Z3DA 4KQXA 4L8VA 5I7VA 2C2XA 2Q1WA 3RUFA 3ZW9A 3JQAB 5ENDA 5I8ZA 4EUEA 3WSVA 4O63O 1ARZA 4KOAA 1KVUA 4CMAA 3INTA 4IJKA 2EEZA 3GK3A 3CEAA 3FNHA 1EBFA 4GX2A 1IPEA 1VLLA 1ZK4A 3VH1A 4DYVA 4GH5A 1C0LA 2GGSA 4FGSA 3KVOA 2O7SA 4CUJA 4DPMA 5JBIA 3PHLA 2HSDA 1ADCA 4IIUA 3I1JA 1MV8A 3BMNA 3G79A 2D0IA 4J2OA 3DDNA 1XIVA 3F4BA 3W8DA 4B79A 2IZ0A 1NQ5A 4GPD1 1IZ0A 1RPNA 1HDCA 4JROA 4LRSB 4NBUA 1SMKA 1YONA 4RLSA 3UH1A 1D7OA 3FCOA 4I08A 1PZEA 2JD0A 2CDAA 3PFFA 4RF4A 3ZNQA 4CMEA 5IDQA 1XSEA 4EZBA 1V8BA 4GAEA 3WQQA 1PJSA 4K6FA 2JCXA 4ZJUA 4OSOA 4FJ2A 4CV1A 1R15A 1LLQA 4XRGA 2I6TA 3E18A 5JDCA 2WYWA 1SCUA 5BQFA 3OA2A 3T4XA 1ULSA 2PD4A 2Q4EA 4TWRA 4E4YA 4XWYA 1PWZA 2C2YA 1Y1PA 1JU9A 1LDBA 1EFLA 1U8XX 5JS6A 4OL9A 2PH3A 1ZXLA 1NHWA 4JJFA 4CLDA 4IS3A 1MC5A 3ENKA 2VHWA 1I24A 4YJHB 5A9TA 3K5PA 5TNXA 2JJYA 4E5KA 3G17A 3TFQA 4YT2A 3LT2A 2IEDA 4PLFA 4G2NA 5ENVA 2XXBA 1CYDA 3EDMA 2E4AA 2NTVA 4JQCA 2EV9A 4EJ0A 3VC7A 5JXWA 1SZJG 3RU7A 3EK2A 2PGJA 5HS4A 4QX6A 1O9BA 2ZB7A 5JDIC 3WSWA 4E33A 2CMDA 1PJBA 1QYCA 3VZPA 1JKFA 2YV3A 3I52A 4NBTA 2NSDA 3GAZA 1NPDA 4ALMA 3INRA 2FR1A 4YAEA 2EXXA 1TXGA 2X8LA 5DT9A 4E2WA 4A0SA 3MEQA 1B3RA 1CDOA 1H6AA 4YCAA 1DOHA 1PU2A 1K89A 1VJTA 4RVHA 2NU8A 1ZBQA 2NUAA 3QSGA 3SJ7A 1LUAA 4YJFA 1U4SA 3AWDA 3H5AA 4GI2A 4TRMA 4WLEA 4WUVA 2RBEA 1MXHA 5EQDA 2BH9A 3RU9A 1JKJA 2AG8A 2B36A 3IOYA 3OEYA 5A06A 1H6BA 4CL8A 5IG2A 2W90A 4RVDA 5FFFA 1DFGA 1SEPA 1KIFA 2NACA 1ML3A 5L53A 4NR0A 1LDYA 4LMRA 4FPXA 1LSUA 1WMAA 1KY4A 2EIHA 3T7CA 4BMSA 4GL4A 3FNGA 1JLLA 2HMWA 5KVCA 3UOGA 3TL3A 4TVBA 3S2FA 4MVJM 1SO8A 4JJIA 4MKXA 2V7PA 3A4VA 1BRMA 1SOWA 3NUGA 3U4IA 4R54A 2ZQYA 4ZD6A 1R16A 1PS8A 4II2A 2FP4A 4ZGWA 4F3YA 5THQA 2HRZA 3ZHYA 4IBOA 3DEYX 3U4DA 1I32A 3DC2A 1G6KA 4E21A 3LDHA 1SC6A 1NPTO 1YOVA 4IQGA 4YQZA 4UVDA 4CQLB 3DONA 3HB4X 3SVTA 3CXRA 3UW3A 3H9EO 1HSZA 3IS3A 1Y7TA 3DHEA 3CE6A 3NAQA 4B7XA 3AFNA 4Q3AA 4BNKA 3K73O 3NJ4A 4MVJP 2YFQA 4PGFA 4Z9XA 4I5DA 4AG3A 4D0SA 5L51A 2D59A 4OYRA 5G0TA 1PL6A 4J9UE 1BSVA 4DUPA 5JAIA 1B16A 1ADBA 4R1UA 1AN9A 2VTDA 2NVWA 4X54A 2DBQA 4GX1A 5IDXA 4YAGA 1KEPA 2WTBA 2V6FA 1GZ6A 2I76A 3ICCA 3M1AA 1WLYA 1LDEA 3ETDA 4OSPA 1XR3A 1GUZA 3PXXA 1JTVA 3SC6A 1X7GA 4K1LA 5JC8A 3FHLA 2WEKA 2O3TA 4W82A 1UP6A 1XEAA 5HTOA 3C7AA 3EMKA 3VPHA 3IJRA 1M2WA 3ADPA 2X5JO 2WD8A 1SAYA 5B1YA 1IZ9A 4URFA 4RVGA 2NVBA 3ZI0A 1ZZEA 5TRTA 2G82A 5AQ1A 2OORA 5L40A 3D4PA 3ZWYA 4N5MA 4EDFA 3JQ9C 3LU1A 3CIFA 4J1NA 1ZNQO 2Y93A 1QP8A 1YOVB 1QG6A 2OGUA 2ZB4A 3L4SO 3LSYA 1WW8A 4BGUA 2D1YA 4BNMA 2WM3A 1YXMA 4RPLA 1PQUA 2GERA 2ZCUA 1DSSG 2Y99A 1GYRA 4JIGA 2GR9A 1J6UA 1B3BA 4B3IA 4NIMA 4CM5A 1GFSA 1NVTA 3ZU3A 4IS2A 1VL0A 2P5UA 2FPGA 4TRJA 2BMAA 1SB9A 5FI3A 3JQ8A 1P1FA 2IXBA 3ROKA 1IHXA 2P9EA 4FW8A 4MVJH 2X23A 4BNXA 3F5QA 4XEHA 1SNYA 1LXCA 3D4OA 4IMPA 3TF5A 2JCYA 1DIHA 5AXBA 4R16A 4YT5A 1RWBA 2X9NA 2Z1NA 3FD8A 4WLFA 4TMFA 5IXYA 1IOLA 1M6WA 1PSDA 5DDIP 3BAZA 2ZIZA 1FF9A 2PZLA 4B7CA 1YH3A 3OJLA 5IZ4A 4CPDA 1DDOA 3H9UA 3TZ6A 4DQVA 4CMCA 3V2UA 3HJAA 4CQMA 2P9GA 3ROMA 5COBA 1IPFA 4PLCA 2UVDA 2PWZA 2ZYDA 3C1OA 3GQVA 4IDBA 4Y6PA 4CL3A 3GEMA 3BTUA 4R1NA 3PGXA 4FDAA 3ULKA 4J3FA 1I3LA 4A27A 1B2LA 4BO1A 1F0YA 4H7PA 1CRWG 4CM9D 5HM8A 1ZCJA 4ND3A 2ZYAA 4D41A 4IJUA 2EG9A 2HMTA 4OGWA 4P4LA 3DFUA 1YJQA 1UP4A 1I0ZA 1NQOA 5GZ6A 3RSHA 4EW6A 4W9NA 4A03A 1U4OA 1NASA 2QW8A 3NTQA 4ZRNA 3IL2A 4RF3A 3O4RA 1A9YA 3OQ1A 1NVGA 1U1IA 2YHUA 4UULA 5HS6A 4CR6A 1ONOA 1YL6A 1Y5MA 3E9NA 3TDKA 1LX6A 4ZRMA 4FB5A 3NDIA 1R0LA 1YQDA 2FZEA 3V1UA 3R6DA 3U9LA 2J3JA 3U4HA 4J90A 2Y66A 4AJIA 2GZ3A 3L6EA 3WS7A 1ZJYA 2BF7A 1K6XA 1HSOA 4KWHA 4MVJI 4XGIA 2AA3A 4PRKA 1A9ZA 3NJ8A 2B69A 4LCEA 4MVJA 2HU2A 3ZWXA 3LC1O 1E7SA 1SBYA 4LISA 4O0LA 2HLPA 3DMTC 4UUMA 3UN1A 3ZV4A 3ZCXA 5A02A 3D3EA 4XQEA 5FI5A 5L45A 4BKRA 1DAPA 3GN2A 3LVFO 5COQA 3NKLA 5U4QA 1K5HA 2HRBA 2O23A 2V65A 2C5EA 2DBVO 1GYPA 3PJFA 1E7YA 1V0JA 1P77A 1W4ZA 4RQUA 2VZ0A 4Z0TA 5FWNA 3ITDA 4N5LA 1Y8QB 2VWGA 3O9ZA 5T8KC 2EF1A 4J43A 4DBVO 1XGKA 3TZCA 2X86A 3BHMA 4BNJA 5ADHA 3JQBA 4YT4A 5KOIA 4NK4A 4FN4A 4ALNA 3E82A 1H94A 4H3VA 1J5PA 3O8QB 4KUHA 1PQPA 1V3VA 4D43A 4R4JA 5JDIA 5GZ3A 5JAMA 1W73A 1Y8RB 2W8ZA 1B8VA 4Y98A 3WGTA 4AJOA 1EUDA 3RUDA 2POQX 1Q7GA 3W8FA 4HFNA 4QEDA 1ZSYA 1Y6JA 1LEHA 3DZBA 4UUPA 1E3WB 1SOVA 3E6AA 1X14A 3DBRA 3DZGA 4XR4A 1C0PA 2HQ1A 2W2LA 3OH8A 3IQDB 4KUEA 2Q4BA 1EE9A 2Q45A 1A4UA 3BZUA 2IE0A 3P5SA 1UDBA 1H0KA 4ZQEA 3E03A 1ENYA 4BMNA 1E6UA 2G0TA 1A4IA 5HA5A 2OHXA 4TRNA 1Z6ZA 3QWHA 1T4DA 3QW2A 5THKA 5I7SA 1AHIA 1TI7A 5HBRA 1OAAA 3D5TA 4A5OA 4EUFA 3I9JA 1A27A 2B0JA 2EGHA 4AVYA 3CZMA 1VPDA 1JW9B 4KTVE 2P68A 3BHIA 5ILOA 4JXKA 3SEFA 4DQXA 2JKVA 2BD0A 1ZSNA 3WMXA 1PJQA 1LLUA 1DIBA 2PKQO 3I23A 1G1AA 3MJCA 2LDBA 3PLNA 4CM1A 2OZPA 3JQFA 4J7XA 4YTEA 3OQBA 1VI2A 2DC1A 3I6IA 4J4TA 3UCFA 1E1KA 4P4NA 3ZHZA 4E5PA 1E3SA 2VRCA 3JYPA 1Q0LA 4IQ0A 4Q3CA 1EEHA 1GZ3A 4ALKA 3GDOA 2D2IA 3RJ5A 5MDHA 3N7UA 3ZNPA 2CNBA 5BSFA 3DZFA 3BMOB 1UDAA 3IJPA 4XGNA 2GCGA 1QXSA 1P0CA 1I33A 2GUGA 3QJ5A 4YPOA 5KJEA 5CDYA 1I10A 4DL9A 4J9VA 1ISIA 3DBLB 4W6ZA 3HSKA 2X0NA 1NQTA 1U5CA 3TL2A 4E32A 2Z95A 3D3WA 3ZHXA 1I2ZA 2PZJA 3QQPA 4U6QA 5ER9A 1YL5A 1GEEA 2V6MA 4CLHA 4QSMA 2O3UA 3NT2A 2EJVA 1GCUA 1HDYA 2EP5A 1IUKA 3NDJA 1VKNA 2GPTA 3RBZA 2FR8A 1T1SA 4ID9A 2UDPA 8ADHA 5H82A 1EE2A 2B83A 1YKFA 2NTNA 2VYVD 1GAEO 3OF2A 3Q9NA 1EBUA 1HRDA 2FOIA 3NV9A 1N9GA 1HT0A 4RF5A 4J1TA 3IP1A 4I9UA 1NXQA 3PIDA 3W4KA 4JN6B 4CV3A 5L4LA 4TZKA 4NI5A 3ANMA 5EQFA 5LCXA 5F1KA 4NZ9A 1VJ0A 1PGPA 3WJ7A 1T2CA 2AHRA 2CVZA 3WX0A 5JNLA 4OXKA 4ROSA 2Q1TA 1U8FO 3RBVA 4LVUA 3VTFA 1HZZA 3M2PA 5F3RA 4N5NA 2VRCD 1UAYA 2PGDA 1PGOA 2AE2A 4WE3A 2H63A 1GTMA 1N5DA 3M1LA 1ZKMA 1EZ4A 2NU6A 5G0UA 4BIIA 1DIGA 4AL4A 2BFOA 5TT1A 2Q1UA 1J0XO 4JP3A 1U3UA 2VOJA 5ES3A 2UV8A 3E9MA 2AW5A 4IUYA 4J6FA 2Z5LA 5CEEA 3UICA 1XLTA 2QZZA 1BDMA 3JQAD 1MB4A 3A1NA 4ZICA 3PWKA 5KJ6A 4BO3A 4XGKA 2ILTA 1ADGA 1MFZA 1ADFA 4UAGA 1WP4A 2Y0CA 1K0UA 3GF4A 1A71A 5IF3A 1K3TA 1JAXA 4NBWA 2IDZA 3JYOA 1HDRA 1RJWA 1UDCA 1P0FA 2EW2A 2LDXA 4ALLA 1N9GB 4U0JA 3OECA 1T4BA 2VYVA 1SEVA 3QRWA 4CM8A 5I7FA 3WOHA 2SCUA 3GDFA 1LQTA 4DBZA 5A5FA 3KLPX 5KVQA 4YXFA 2JAPA 3RC7A 2BFMA 1JWBB 3B1KA 4Y9DA 5BNFA 3UAGA 2HJRA 4DQUA 4NBRA 4XDYA 1P74A 2OBNA 4Z9FA 4GMGA 3ZV5A 3DWFA 1ENZA 3KXDA 2PTGA 1CEQA 3WR5A 2OXIA 3B1FA 1N1EA 4GKVA 4ONEA 2Y0EA 4PLZA 5L95A 2HJSA 2W2KB 3H2ZA 3JQ9A 1JA9A 4NHEA 3DZJA 4CM9A 2C29D 1KBZA 2PGLA 5T8KA 1EUZA 2R2GA 3EY4A 3TN7A 4BQRA 1E3IA 3U5TA 1H6CA 5KWEA 4FFRA 1C0IA 4E2ZA 2PV7A 3PJDA 4BNZA 1G0NA 4BO7A 3FR8A 2VUUA 3ETGA 2JHGA 4E5MA 3ZWCA 1Y8RA 3IUPA 3ZNNA 5A1TA 3AI2A 3ETEA 4NPCA 4DMLA 2VCYA 3DZIA 1O8CA 3EVNA 3GGOA 4DTIA 5HWSA 3DBRB 2GN9A 2FZWA 4XRRA 2GRAA 1UXIA 1NR7A 4PLVA 3WGYA 4O59O 3GVCA 1PJCA 4NJOA 3B1JA 1HETA 2IODA 4U6SA 5AOVA 2WWRA 2O3SA 4CMKA 4D3FA 1T25A 2EERA 5G0SA 3JQAA 3GDGA 1BVUA 3GOHA 3VZQA 3KYDA 3VZRA 4RZIA 5I7EA 3ZDFA 4XJTA 3MTGA 3LT4A 1P44A 1VL8A 3KSDO 3KM0A 4XIYA 4DIFA 1M6HA 3UVEA 4BMVA 1P3DA 3AOEA 2W2KA 4C4OA 3TQHA 3WGIA 2GD1O 3OSUA 4WOJA 2X1HA 3TOZA 5F21A 2E49A 1DLIA 1MUUA 1ZK1A 1DAOA 1QR6A 4OOFA 5IJZA 4QECA 4ZA2A 4MO2A 4MP8A 2PKRA 4DMMA 1HE5A 5T64A 2XPCA 4PZCA 1UH5A 4PG8A 3Q11A 3WYEA 3MZ0A 5JFOA 2XXJA 2QQ5A 3LZ6A 4YWJA 3GVHA 4WLOA 4XKJA 2X0RA 3A14A 3NTRA 4PVDA 3GN1A 2O2SA 3RFTA 5DP2A 4RGBA 1PJTA 3MJVA 3PGJA 2Z1MA 3PDJA 5EMHA 1KEUA 1N7GA 4HY3A 2GNAA 1EQUA 4FCCA 3VH4A 4EEXA 3EUWA 4NFHA 4NQZA 3UCEA 1T2AA 1O89A 1WPQA 3AI3A 4RQTA 2X0JA 1E77A
chains in the Genus database with same CATH superfamily
5K8TA 3G8DA 2C54A 4EZEA 3VYUB 4XWOA 3GLFE 4FWTA 4HXFB 2A9VA 4D9CA 3OHPA 3GFPA 2EGGA 3ND6A 3EXG1 2F64A 1MDBA 4O2BB 3JZMA 4P98A 4QIHA 4Z7OB 1NXVA 5JRDS 3IFSA 1R9NA 4HGQA 4HP8A 3ZBQA 1V3QE 3OTGA 4Z8YA 5GOZA 4CIVA 4YUXA 2CZCA 2GWHA 3GBPA 2RHWA 4E3WA 5KB3A 1NOIA 1VSBA 3LNCA 4W9NC 4DEYA 2OXRA 1LS1A 1PGNA 4V2IA 2CD7A 1G1MA 1G98A 5M29A 1ID8A 3FZGA 1N25A 5BN3A 1LZKA 3PQFA 1T0BA 4HX9A 5CLQA 4JNGA 4RD3A 2AIRA 3KAPA 4Y2QA 4F4FA 2DJIA 1UMDB 2Q3EA 1FBNA 4KOEC 1XDZA 1UT8A 3QUCA 4LWOA 4NMWA 5CDFA 4X91A 1PUJA 1RI2A 3CVOA 5HRAA 1WB9A 1GY8A 3L4BA 1NM5A 2WU4A 1R64A 4P6VF 2IWRA 3D3NA 2GM3A 1M7HA 3CF0A 1V5WA 4EUKA 4IDDA 3T1YB 4OU4A 2PIDA 5K0LA 1SC3A 3LM8A 5JMPA 2G1UA 4C0JA 1TZKA 1ZN9A 1FU8A 1ZK0A 2C8JA 3GOQA 1QV7A 3UMJA 4XM2A 1OZHA 1SXJB 3CLUD 4PRLA 4O4IA 4XIJA 5E8JA 4LJRA 1XTUA 3TLAA 1E59A 2BHLA 5DM0A 4LW8A 3EFBA 1SUCA 3G2PA 1LW7A 1UKYA 3VI3B 4AZVA 1CUFA 1DADA 2PZMA 2C9YA 3IDZA 1M7GA 3LECA 3WAKA 3KDPA 4IRUB 2OBBA 4UHHA 1T1RA 3KLNA 3M81A 1IEXA 2YHSA 2Z2KA 4RU1A 4TUYF 4RADA 4F6RB 3VI4B 4TUYA 3UB3A 1JDVA 2C99A 1SUAA 1D1SA 2F3PA 4LTNA 2BUBA 2XZLA 2R6DA 5G1OA 3TLCA 4NNOA 2FZ4A 5CIQA 5D2CA 5A9SA 3H5TA 6NULA 1EX1A 1IULA 1RQPA 3Q7PA 4EAQA 2R1ZA 2XUGA 5KCZA 1LB1B 3RS7A 3E1SA 3WQRA 5HTOA 2J5RA 3JD3A 4M9RA 1D4ZA 3ZHBA 1ZJZA 1FMCA 1XEWY 2GK6A 2X2OA 4KR3A 5EMKA 3R5HA 2CB0A 1DC5A 4ZAVA 1QFXA 1AE1A 1ZYUA 4YRBA 3G9ZA 4FDMA 2EDAA 5FEMA 4DDKA 4EGFA 2P6PA 2ZBDA 3I6QA 3KHKA 1RM4A 4W4TA 3CLUC 4M1QA 1WZCA 1PHRA 5IP5A 1MN6A 5CUQA 5JSHA 1BH2A 3QVSA 3IESA 3VU1A 3PDIB 1P61B 3AB7A 5ADUS 3P96A 3R3JA 4W7IA 4B9AA 5KYUA 1Q20A 4A5SA 3ZBTA 4ZTBA 1E58A 1DKUA 3FI9A 3AW9A 3OY2A 1C9KA 5G4KA 1YDEA 1ZU4A 3UMRA 1T5OA 1P0IA 5JJCA 3U56A 4X8MA 4H6WA 4RHXA 1E5XA 3QPAA 4GPEA 2C4HA 4DGQA 2WHYA 1KTVA 4FI3C 3DNFA 1VYTA 1X15A 2CVQA 4X44A 3EIHA 1OYWA 2XF2A 1HUQA 2RB5A 1OJLA 1Y81A 2ZJ0A 1H66A 3NHKA 4KTTE 2FR8C 3RLFA 4DWVA 3LKVA 3AF2A 4P35A 1FNBA 1Y7PA 3MWGA 5F1YA 5G41A 4FEAA 5IYZA 5CGQB 3OOHA 3IKVA 4KR7A 1M1NB 1OC4A 2J3DA 3EZXA 3G0IA 2D5IA 4RMJA 4Q9JA 4D45A 3AKZA 2XCRB 1CUXA 1ZQ1A 3FCSB 2XUJA 2ZBQA 3JQ6A 1BD3A 3PDWA 1VIAA 1C7QA 1Y9EA 2C9MA 1D8TA 1WAMA 2IKSA 5F64A 3T38A 3UFXA 2FX2A 4LXYA 5L9AA 3QNWA 1PJ3A 1W35A 2I71A 5CNKA 2CEKA 2JBAB 1J20A 1AH2A 3TDNA 3S1LA 4YDHB 3TGWA 3LKDA 1O4VA 1LS6A 4FFVA 2PXCA 4DCJA 1R12A 3RVRA 3OJOA 2G5CA 4YUWA 3DDOA 3RIHA 5F3DA 1WD7A 2WKPA 1G21A 4V39A 1EFHA 4QHYA 3UTDA 2GRJA 2QSYA 4BN4A 3U4QB 2E5LB 4UAJA 3O26A 3MT9A 1G2IA 1KH2A 4X97A 5EXSA 2VKQA 1GKYA 3U49A 4R7GA 4DCTA 1BU8A 1N1MA 1RWOA 1IN6A 5CYGA 4X71A 1X3SA 1FNCA 5P8WA 3TJRA 1JR6A 5AKKA 5B3KA 2N9UA 3DOOA 1X0XA 1YZUA 4BJHB 3HA2A 4GWGA 1KO5A 1GXSB 1EHCA 3DXZA 5CLHA 3HN7A 4BVAA 4EA6A 4GI3A 1FB5A 5ER6A 3AJAA 3QFRA 4LMAA 4AAYA 3FSEA 3PE3A 2ZE7A 4ALIA 1OXXK 4ZV9A 4DIEA 1FLDA 4N5DA 4CKCB 2J67A 2HK7A 2XHZA 1OY1A 5JSFA 2ZIGA 3IUJA 2FUG6 4MPDA 3GZNA 3MMXA 1RFLA 5FUQA 1FJXA 3L9XA 4YRLA 1NW9B 1SXJC 4D9EA 3C1AA 4CTNA 3H6KA 2CZGA 4U3JA 1U1FA 3D81A 4KX3A 4HDOB 4F9GA 3NHWA 1GZHB 2VS1A 3LT1A 4IDUB 4H1TA 3K1YA 1VE1A 1G20E 2IYUA 3WLPA 3ZJVA 2FP3A 2WWHA 4XUGB 5IEJA 1F2UA 3RK4A 5JTTA 4DADA 4K46A 3QYPA 1IZZA 4ITUA 3CLTD 1QYVA 3TJMA 1O03A 1BFKA 2RCNA 3OFND 4XSHA 1HI9A 5F35A 4BP3A 2CHQA 2CV1A 2PGIA 1UP7A 1IXRC 3SC4A 3BQ9A 2XVAA 2MCFA 5IANA 5TGDA 4LVNA 1C4WA 1SIOA 2ZTMA 1JLRA 3EGIA 3HDJA 4I9GA 4BVJA 3BIWA 3HCEA 4JITA 3M4NA 4QUBA 3QMVA 1KYVA 3IKLA 1EVKA 1B8UA 1JHMA 1VCNA 4HEHA 3U4AA 1GUAA 1UQRA 2VJPA 3N87A 2WE7A 1YB4A 3VKFA 2PL3A 8AT1A 3CRRA 4QDKA 3OZWA 3N2LA 1JZTA 3TVDA 3AP2A 4AM8A 4DXHA 1I3KA 4G0YA 3WLLA 1T13A 3P45A 2WHXA 2GZSA 2QVLA 4PN3A 1BQEA 3WWZA 2ZRLA 2UUOA 1N0WA 4NATA 3BBLA 3WYBA 5BSWA 3SQXA 1JQBA 1HDIA 4I4TF 5ICSA 4KBFA 2JK1A 3B2QA 3CLRD 3K1AA 4QUEA 5FWDA 1G19A 5JXHA 5FBLB 1U7UA 1WHTB 3K6JA 3ICWA 4AJEA 2UYCA 4R69A 4ZIRA 3RGGA 2TMDA 2V7WA 2OXTA 1MMFB 4HDMA 2JVJA 1FXUA 2FN7A 1GCOA 3S5JA 2C8LA 5BQPA 4ZYVA 2HIAA 3FPSA 3L5KA 4GFDA 4DY4A 1JFRA 2XGOA 2HREA 1AZSC 1EFVB 2JFOA 3A9CA 3BWVA 3GW8A 4JP8A 5J2TB 3DTTA 2JL1A 3AF6A 3P9QA 3SEQA 4HZIA 5CB0A 4N47A 4QBFA 3W5HA 2JAUA 1I4WA 1ZM9A 1NI3A 1RWKA 1AUPA 1QDUA 2OLEA 4YBZA 1UXOA 3ANTA 1T35A 4AB1A 3CN7A 1SXPA 2CE7A 3QE9Y 2I99A 3LJKA 1LPNA 5LU8A 1VJGA 5DXAA 3H3FA 1WOMA 5T6BA 3WC4A 1QP4A 2HWWA 4L5CA 1FVXA 1RYZA 5CDSA 4AJJA 1JYSA 2YCLA 3DFIA 4KVGA 3CW9A 1OTHA 3C3JA 1JFFA 1TM7E 3ZH9B 3B70A 3V4VB 4X8OA 3RUAA 2IXDA 4UPVA 1UAAA 4JNCA 1U3TA 2O5VA 4HWGA 2ZATA 1AT1A 1QIGA 1PNOA 4GOXA 1QWSA 3FN4A 4MJXA 1ZD1A 4P3YA 5TARA 3ROZA 1LH0A 2CHGA 2Q3HA 3OEWA 4GECA 5IUJC 1M2GA 4GVXA 2VJMB 2HPVA 4GYKA 2WV9A 2AUMA 1E94E 1X9HA 3BXZA 5DT2A 5LQUA 2PYDA 1JH9A 1D8AA 1HEUA 4D3YA 1ZO8A 2I6SA 2QR3A 2QP4A 3MF4A 3O3MB 2AHOA 4Q3NA 3Q0IA 1LRKA 2A35A 2ZRFA 1I80A 4GD3Q 2P41A 2SBTA 8ATCA 3LIIA 2IYNA 2W6NA 4ND2A 3PD0A 1RRMA 3T5TA 3WL3A 3ZDBA 5FWYA 1BCSA 5ITZB 3HABA 1BNCA 2D3TA 3FTQA 4GMFA 4QREA 3SHQA 1KJZA 2X4DA 1U98A 2PCJA 4FSHA 4FYMA 4CM4B 1S8FA 3LY5A 4G5HA 1K8ZB 2AG6A 3F8TA 3S40A 2AWNA 3MVEA 4QJ4A 5FOXA 5DGIA 3GD7A 5FULA 5HIKA 3NH6A 3N8NA 2YOHA 4FLMA 1E7WA 1CEYA 4K03A 2J3IA 1ZH0A 1FLAA 2ATEA 5BV8A 2VJBA 1GNTA 4B40A 4P22A 4WKOA 4PEVA 5F5LA 4H7KA 2QVCA 3IVMA 4MX8A 1HNZB 1Z8DA 1TPZA 1ZMBA 2ONZA 4QYMA 1AS3A 1DOZA 1OWMA 2ZWPA 1NMYA 3T4PA 1OWOA 4Q66C 4Y7DA 1LVGA 1E9AA 4Z4EA 2BM0A 3K9CA 2DUWA 3N53A 2HW8A 2C7GA 1B0ZA 1HMPA 4L1KA 1JT2A 3U0VA 2DULA 4QTTB 3DH0A 3MS7A 2PX5A 3MN1A 3DL2A 1URPA 3FUTA 4FD3A 3K72B 4K6HA 3ZS9A 1EH5A 4BVKA 4B83A 3HI6A 1Y7HA 1I3NA 3V7NA 4AK9A 3GP8A 5K20A 4FOSA 5BQOA 4Y1RB 1G5IA 4QFBA 4Z49A 1QM5A 4ZQCB 1G42A 2H17A 4MPPA 3DF7A 4AXXA 3IUSA 2JRLA 3TZBA 2XNDD 3TXAA 5K4GA 3IMKA 3OESA 1I8TA 4G07A 2ADMA 4B6SA 3I5UA 4O1HA 1FDTA 4YCDA 4DJFC 5KYXA 4J8PA 2VF7A 2WSMA 2VYCA 3MTEA 3FDZB 1CJVC 2NO9A 3RH0A 2B4AA 1NYTA 2E87A 1SUFA 3UPUA 2PLAA 3K2EA 3TRIA 4EW3A 1YQXA 3T3GA 2CLDX 1P5RA 1TT7A 1W8DA 3W4KA 3MPOA 5DSXA 4JXJA 3RAFC 2BJWA 4P84A 1NLMA 2YMPA 3SMVA 3KJXA 1KZ1A 5BSUA 1ZNWA 4CFZA 1KWKA 3KTOA 4W9MC 5E4YA 4KRYA 3FVQA 1C1XB 3BMQA 4KSYA 4R0NA 4AJ9A 3U4QA 3SSOA 3D8NA 3P2YA 4CDRA 4TLDA 3LXXA 3LV8A 5CLFA 3ZHQA 4OBEA 1E5QA 2ZXEA 1F0PA 5ALKA 2F90A 3KC2A 4D42A 1V47A 4BIMA 3I9V6 3TUIC 2I62A 2B94A 1BOOA 2GJ4A 1KRXA 5I4KA 3U7JA 1R6DA 2G9VA 3MC1A 2NUTA 4INJA 4RJKA 3VDRA 1TVKB 1ULBA 4CMIB 1ZH8A 1F8FA 2BEVA 5IZCC 4YCJA 1U5AA 3IV9A 1XN4A 2PYZA 4BKOA 2PRZA 5BPHA 4UNIA 2FHSA 4GICA 1L1RA 1P60A 1BXGB 1VP3A 1U0TA 2YCBA 4OHOA 3IUYA 4FK8A 2D5AA 1CZLA 1XX6A 4TL8A 3D0OA 1YK0A 5EZQA 5B55A 3OQNA 5HHTA 3HWRA 4YVFA 1XEFA 1USIA 3PC8A 1U0EA 4TL9A 3QKWA 4RFSB 1U2RA 3HBMA 3V7WA 1AC5A 4RVFA 2V7UA 1FU7A 1UM9A 2O48X 4TYPA 4CI0B 4F2GA 821PA 1QIDA 2H4ZA 4HNQA 3KOUA 1Y4ZA 1T3LA 4NV3A 2FQYA 2VUTA 4MV3A 1PJ4A 4MYRA 4L8FA 1FUYB 2HDHA 5BOSA 2Z43A 5G4KB 1C3VA 2O4CA 1RE1A 2BGKA 3AOEC 5JARA 1I0LA 4ZCIA 1XCOA 3WA7A 1OH8A 1ZD9A 3W1EA 4Z2YA 7GPBA 1SBNE 4XXHA 2WIJA 2D4AA 2KPOA 4TWJA 3EF3A 3VKWA 1HYEA 3JAKB 4MO9A 1ELOA 1IOVA 4UEJA 5C32A 4RM3A 3P9IA 4DV4B 1X1CA 4B47A 2UZ4A 4F5DA 1J49A 5A3SA 1OTYA 2Q8PA 1YZQA 4GI1A 2FWJA 2P6UA 2JJ8A 2ZJBA 2BKUA 2DERA 4GW3A 5HE8A 2FWNA 4Z3OA 3BUSA 3SZLA 2ODAA 4MQFA 1F51E 1KP2A 1FX1A 3G7NA 1XMQB 1FEZA 3GEIA 3CC8A 3Q0EA 1ND5A 3WVNA 1HMYA 3GWGA 3IIIA 3VR5A 3IQFA 5AK5A 2ZRBA 4Y2GA 4CM7A 1WEKA 3D8SA 1OZ0A 4Z99A 4KYTA 5JWHA 4I4IA 1NXTA 5ESRA 4BTEA 3DW1X 2A1TS 3GBVA 4LG1A 3EPHA 4WX2B 2OFWA 2IVZA 3MELA 3OWOA 3UC5A 3D6JA 5JRJA 1ZUIA 1BIFA 1RHMA 2ZJ8A 4KQFA 3WLIA 3FPCA 4JIMA 4KNVA 4AS2A 2NADA 1ULHA 3PF9A 4XWAA 2PMCA 4INPA 1G8KA 4L8YA 3ER6A 2NO6A 4RLHA 3T35A 1DKPA 3HMKA 1CE8B 2HGZA 1ADYA 1JYFA 1K97A 3NCHA 4KH1A 4L5IA 1M3SA 4CUZA 4CYMA 5F7OA 5DF1A 2YVQA 4ZODA 3ELWA 1MT3A 3KP1A 3QVKA 3ZHRA 3Q8LA 1D5CA 4KPFC 4OXYA 2C2ZA 3NBFA 1TYZA 1LI5A 4DJEC 2H48A 4JJ7A 5BMVB 3S6JA 2JANA 3C3XA 2OBYA 2DR3A 4RJ2A 2IEAA 5C51B 1DHRA 1P7CA 4GR4A 1U7HA 2EKLA 1Z0IA 4BFTA 2REBA 4NYMQ 4M1SA 4TT8A 4RPGA 4GS5A 1J2YA 4K86A 2IZ5A 1EM6A 1EX9A 1L4MA 2ORED 4YRDA 5U9CA 4NDNE 3B6KA 2LP4Y 5KYTA 1OWNA 1ZIDA 4HK4A 3PC4A 2I3GA 1KEEA 4BNNA 1ATIA 2V96A 3DKPA 4X85A 1ZGAA 3M49A 4RXMA 5CB4A 1NW3A 1XCGB 2XCQA 1JQJC 1WDWB 4OO3A 1E3WA 1O7JA 2OC4A 3GCXA 4O4JB 2C84A 3ZQUA 5J4VA 4K1XA 3A28A 4PIVA 3KXPA 4TLAA 5FHRA 5B36A 2XUFA 5E4TA 5KTNA 3M4JA 4CM4A 2FPIB 2JH3A 1P0MA 4K26A 4EG8A 4Y2HA 4NAHA 4FKMA 4OP2A 3UJCA 2CLIB 2Q6VA 3K1TA 2HYIC 1XROA 1NSTA 2FWPA 3OCYA 5ICFA 4D9IA 4EPWA 1G7TA 1HK7A 2OWEA 1U7TA 2OFPA 4E88A 1QIIA 3NNDA 3D1JA 4GT1A 1ORRA 4JJZA 2JFWA 4IHQA 3DKRA 2ANCA 1K9VF 4XJSA 5EQTA 4ZU3A 2XCLA 1S2IA 4FXOA 1OE0A 5JOQA 1FPMA 1SRRA 2Y0BA 2JW5A 5FOVA 3KQOA 1NHGA 5JD4A 3OQHA 1LY1A 2OUIA 3O6VA 1E9CA 4J07A 1DCFA 2DR0A 1W4AA 4KDRA 4YK7A 3GX1A 5GY7A 2Z6VA 4GZ6A 2QLLA 1W5EA 1KTIA 3ADOA 2VUSA 2Y27A 1K7CA 4I3GA 1NUHA 2FE4A 3CM0A 4HAYA 5KTKA 1VHWA 4EHNA 4WLVA 4AROA 3V42A 4Q82A 6REQA 2OV2A 4ZO7A 3UW1A 5ES4B 3FPFA 4J0IA 1Y4AE 3IC5A 3L49A 4F2PA 4K40A 2WM8A 4EA9A 4YJ2B 1C1DA 3MRTA 4M9CA 3VNBA 3H05A 1HG1A 5BUZA 5A3JA 4NU0A 1QH8A 3CCFA 5LZ4A 5LQJA 1XNGA 2BFBA 2DKNA 4RW0A 1JDUA 1OWLA 1BJTA 2QTLA 4Y2VA 5E9JA 2B5WA 4WA7A 3HUTA 1SVOA 4DF3A 3HZRA 4P58A 4BO5A 2P5YA 1EWYA 4XWTA 4O02B 1LBHA 2XB9A 4XB2A 1R88A 4S1WA 521PA 2YINC 2ZRMA 3FBTA 4L9AA 4BFYA 4P92A 4F4HA 2F8TA 1MV5A 4BEBA 1FFCA 4ND4A 1PR0A 2A1UA 1MX9A 3CJRA 1P31A 3ONVA 1JIVA 4O2LA 4OMUA 5TQ0B 5TMBA 5BNTA 1ZR4A 3IT0A 1KI6A 1KYQA 2ZFUA 3BG5A 3WTCA 1ZISA 1T9CA 1OFIA 2XA1A 1NQUA 4CG0A 3L8DA 4DLTA 1T8SA 1GZVA 3H13A 4ODIA 2BL4A 1I7DA 2RBKA 2NPOA 3TD9A 5IN4A 1VFPA 1RQNA 4A7PA 4F4IA 5CCBA 2NNLD 4KPUB 1N2BA 5BOVA 1A0OA 3BMQB 3EXIA 2QN2A 2ZPTX 4OA5A 4ZXPA 3HBNA 3LT0A 2NZUG 2REXB 4KQWA 2D7DA 1Y1SA 5TQJA 1N5MA 3FJYA 1E1LA 2NT3A 4JLOA 3IP9A 2ZSHA 4PZDA 4BEVA 2RAVA 2BR3A 3URKA 1SR8A 2Q5IA 4LHWA 3JD0A 5JYDA 1CUSA 2QQ0A 1TIKA 4L9RA 4DC9A 4LVCA 1H2BA 2AN5A 3P9KA 3H5IA 4MI9A 5E6SB 3BWDD 1UKZA 3PRJA 3BQNB 4JB2A 3IMEA 4PXYA 3MQ4A 3L41A 3VSAA 2OWDA 1YB2A 3E7FA 4I5GA 4RFLA 2GZMA 2XNDA 2YFKA 5TPZA 2ZB2A 2C95A 2IUTA 1UC4B 1E2HA 3JSXA 4LC9A 4BY9E 4CTKA 3OF5A 4WJZA 1DX4A 1Z47A 2HWXA 4ZQHA 1XZQA 3KB2A 4WEOA 1TKCA 4OHUA 4JLSA 4J3JA 4E2YA 1OKKA 1CUWA 3IAUA 3W06A 2AX4A 1E0KA 3MOIA 4MR7A 4QUIA 3RWBA 4WN9A 3DLAA 3FCCA 4R2KA 1PE0A 1BFDA 3OLVA 1PNVA 5FR1A 2DFPA 3GLHB 1Z4KA 2GFHA 2ZYIA 3TR5A 3BRSA 5A4JA 3OPNA 2IE8A 1KFJB 1KQ3A 3PQ8A 3DVAA 4RNDB 5CA0B 3VPCA 1EYZA 2H8GA 3JQ8B 4V0LA 4J91A 4TXNA 1PKXA 4ZZ1A 3B3QA 3HE3A 5CBPB 4LF8B 2GXQA 1SVUA 2Y67A 1J8FA 3PFHA 5FBWB 4KE8A 4E7PA 2H9AA 4OXRA 3ML1A 3U19A 1WDMA 1XTJA 2EC5A 3TSAA 1QYRA 3VBCA 3AEQA 1U0HC 2ZIXB 3QE2A 3MTQA 4R8SA 1KOLA 2HRQA 1GL3A 1L4GA 1S8OA 1X0VA 1Y7IA 1BHSA 3EQ9A 1L7VC 3JQGA 4OJNA 2AQ8A 1HQDA 1OXUA 4CXMA 1H65A 1NTOA 4HXEB 2H9IA 5IBRA 1JEYA 1V45E 2B1QA 1AXRA 4NJEA 2VJDA 1D2EA 1JR2A 2Z6UA 1DBVO 1JBKA 1F17A 3JCZA 1O6CA 4E6PA 5JNRA 1CQZA 3AW8A 3X44A 4GP9A 3ZH2A 3BJEA 4HAVA 3IELA 3KVRA 5BYAA 1QK3A 4JODA 2VYND 3W8NA 2ZRNA 3SEAA 2E18A 2PY6A 5L3ZA 5C4IA 1TA4A 1Z73A 3NUQA 3G23A 5CJ2A 1CF4A 4C4SA 3RIMA 1N3IA 2D2XA 2J5BA 2QMHA 2EFJA 2GJKA 3JD4A 4ENSA 2GCEA 1YVRA 2ZJAA 2D5CA 4B3XA 3T5PA 2ONCA 2CUNA 5DLQC 2EQAA 5J2UB 1J5XA 1GV0A 1HOXA 4G37A 4HD8A 1S7GA 5I8WA 2HAEA 2Y1GA 2HLDA 3CKMA 4EG4A 3U7FB 2A7QA 3AINA 3PT9A 1FRVA 2X6QA 4M9UA 3WL8A 3BXXA 3DT8A 4MW2A 3DBHA 3LVRE 3IPAA 2JCVA 4TTSA 4IINA 3FTEA 3TW0A 4BNVA 1VGRA 1GXSA 2ZUWA 4LYEA 4QYXA 3W4JA 4KFUA 3PGVA 1GNLA 3E8MA 1D5WA 4R98A 3N0VA 1YTLA 3FUCA 3KK0A 3I8XA 2ODNA 3QOYA 4K9MA 3K70D 2CC2A 3A7DA 2HHJA 2CMHA 4U7HA 1RC1A 2IGTA 5GM2A 4OBBA 3WXBA 2QLJA 4A2PA 1R37A 3SCZA 3ZWVA 2BP7A 1D9ZA 2IF0A 3BK2A 2PVCA 3NWJA 3FYDA 4PYNA 4AKGA 4WZBB 2D0PB 1DP4A 4HAOA 3ZV3A 1PW7A 5FXMA 2YMQA 2Q9AA 1F2UB 4M0CA 5REQA 1T5LA 2ZRJA 1N1DA 2A4KA 2JFBA 3GELA 4JVOA 5CH3A 2IY7A 4B4WA 1U0BB 3RSSA 1Q1BA 4JCCA 4JJGA 1NDUA 1XZKA 3N0TA 2A57A 3T1OA 2WD7B 3K30A 4C5CA 3F74A 1HNNA 3T06B 1KJWA 1SJ9A 1YRLA 5CR9A 3TTSA 4JL8A 4YAIA 4ZHQB 5EL0A 1M2OB 4WBNB 3ASVA 1U6IA 2EZUA 3A9RA 3UFBA 5A4DA 2O2ZA 2KLHA 1D3AA 2WHRA 3W5SA 1FJ2A 1YR1A 1CIVA 1EK5A 4A36A 4JZYA 4MVJF 3WK8A 2PFSA 4IJWA 3WNCA 1FK8A 3BM5A 2QORA 4DLAA 3L4KA 2VAXA 4O2AA 1QE0A 2ZBEA 4BV8A 2VRNA 1Y33E 3PHGA 2HH9A 3IYLW 4YBRA 3GVPA 2HZ7A 1NF2A 2BM9A 1JHDA 1SXJE 1XLTC 1I7PA 5A71A 1XI2A 2ZQ5A 1A5ZA 1VLHA 1UJMA 3ILYA 4MVCA 4B3DA 2B4TO 3WIBA 2NUBA 3E15A 1YVDA 1OV4A 1SUSA 3AOGA 3EWSA 1OBFO 3K1AB 4YJGB 4YP0A 4MNTA 5F73A 5BV1A 3SZRA 5TX7A 4QUJA 1EK6A 1W85A 1BD4A 2XW6A 1YWGO 3NT4A 3VNAA 1ZJ6A 4BHTA 1SQ0A 4RK0A 2PJDA 3EUEA 3JQCA 1E3TA 3N07A 3FYUB 2Z8YM 5EMJA 2FUCA 4UBKA 5JMOA 1P1RA 4KQ6A 4PX2A 3VTAA 2F9MA 1UKBA 1DKOA 1SZCA 1E6WA 2HUNA 3PVZA 3C5VA 5JISA 4IDHA 4B3HA 1TX4B 1BJKA 2QMQA 4FYJA 2QIOA 3KX2A 2W4IA 1L7PA 1R7RA 2JFGA 2J08A 1G20B 3HGMA 2BFBB 2XMRA 3II6X 4OMFG 5KYYB 1GDDA 5F2EA 2FZ5A 1XQVA 1ZUNB 3WBBA 2WSSA 4ML3A 4NE2A 3C5EA 5DCYA 1JSLA 2W00A 5CHYA 3PFGA 4D82A 1X80B 4EKYA 2CUKA 3OKPA 4PAQA 4JJ8A 5FBKA 4B75A 5EKSA 1Z3IX 3RU2A 3V1TC 3OTHA 1IYZA 2Z5VA 2Q5EA 1CUIA 3GLQA 2ETXA 2X0FA 2OUKA 3F7OA 5DBGA 2UUBB 5TQ0A 2SKDA 1OZAA 5C9ZA 4FIDA 3AVQA 3AU9A 1CY2A 3AKYA 4PAWA 1IZ8A 3NM5A 4YRAA 5DGCA 5LZ8A 1YRWA 4ZI7F 4MVWA 5TSDA 2B1IA 1NPYA 3F97A 3C15C 5D84A 1LJUA 3EG5A 1X94A 3H9QA 4DVJA 3E3NA 3ENWA 4GM0A 3AM1A 3R3YA 3Q15C 5EIAA 3IHLA 3AU8A 4LDZA 2EVWX 1U3WA 2JFPA 2IHZA 2FSSA 3D7MA 1IK6A 3IQEA 4V1CA 5IABA 1WZNA 4KIUA 4R51A 1QIFA 2QLMA 4FX2A 1W0JA 2VHQA 2FETA 2SICE 5IC6A 3TLJA 1KY5A 2ZSUA 2P4QA 1G60A 4LGCA 4EPTA 2R6JA 3OZSA 4LYJA 3QEKA 3U26A 2FMIA 5HFAA 1T24A 1YJXA 3QA3E 2AFHE 4QAQA 1OTXA 3Q9LA 2R7LA 3UYKA 4E46A 4EMBA 3TFOA 2VQEB 3CJTA 3Q3VA 3PGMA 4HWKA 1N6HA 2CK3D 3P4XA 4Q9IA 3ZPXA 2WJGA 4AMZA 1C3LA 1NJ8A 5TF0A 1AUVA 1Q0PA 3HU5A 2QN8A 4HNHA 5IVDA 3JVDA 1ZI8A 3RAGA 3SS8A 4KR6A 1OX4A 3PNOA 1G5PA 2J3MA 2ZW9A 1RYYA 1K8YB 4IM7A 3RUEA 2BUAA 1JPUA 2MINB 4ZAXA 3TG2A 1XJ5A 4L75A 1WCIA 1NJFA 3VZBA 4H16A 4M87A 3WYGA 5EXDA 1NX9A 1IE3A 4CV2A 3UXHA 3K9GA 1A2QA 2GBGA 1FDIA 4BFCA 4AX8A 3EDQA 2E21A 2O1SA 4KXLA 2B5VA 1WHSA 4Q47A 5JO0A 4WN9B 1PJLA 1F6WA 1DNPA 2HA4A 1Q95A 2ZYTX 2QV7A 4RK6A 5HFJA 3S27A 4CKYA 5LQKA 3AJEA 3O84A 1BHJA 4L4SA 3S99A 1M8FA 3T4EA 2XGMA 3IR5A 1E18A 2O3JA 3OPQA 3QBJA 4X41A 2FUEA 3DVAB 1V6CA 2QRJA 4CJXA 3EZ9A 1VHDA 2NO0A 1XP8A 3DSRA 4I5FA 2QYSA 1Y3HA 3ROGA 4EHKA 2Q3CA 3AEUB 4BC1A 1T1JA 2XE4A 2NV6A 3REQA 1TKBA 5IK2D 1Y3BE 4CODB 2ASVA 2LD4A 1DEXA 3U3RA 4J29A 4NS1A 3PUVA 4FBGA 1KBQA 2PLFA 2E1PA 3EG9A 3B53X 1E0DA 3RRMA 1TM2A 4G4JA 4G4SP 4BV3A 1GTG1 2P27A 2PJUA 1KJJA 1W52X 3BGVA 1LBSA 1VB3A 2R5NA 1KAOA 2FFBA 4S1PA 1OJ7A 4QFCA 2F1JA 1IHYA 5GONF 3IJEB 3ETNA 2ZJZA 3IP6A 3PQ4A 2R8PA 4OM7A 1X8LA 3LCJA 4R05A 1NW6A 3L1VA 3FPEA 1F7VA 1NNEA 4B6JA 4FKBA 1KJIA 4C1BA 1GPNA 1JVBA 3H65A 2J5KA 4DA9A 1MW8X 4EY7A 2OPBA 4ETMA 5J2TF 1E79D 1KYXA 2FRXA 2RHRA 2TRSB 1XZAA 1JAYA 3L7NA 4E03A 4X24A 3ED1A 2YZMA 1NN0A 4CL0A 1F20A 2X5KO 1K5PA 3IKTA 5JY6A 3TQFA 2QM8A 4IDFA 4V0MA 3ZDYB 4EI8A 1YJ8A 3CRMA 5F1OA 5LL6P 1E96A 2G06A 1J42A 4Q7MB 2QUJA 1EJ2A 2OXCA 3Q6MA 2V6GA 4BNWA 2PK3A 4EKDA 1OAOC 3A6KA 1FP6A 1UBJS 6ABPA 1DKRA 3KBBA 2CCJA 5KAMA 5B37A 3JQDA 1P2GA 1ZIOA 3QMMA 5JYBA 2VRWA 5CEJA 3TW8A 1P2DA 3ZOKA 1I7LA 2P0YA 4WQMA 2NVUB 2AMFA 1VDZA 2R3SA 3M33A 2DFDA 5T6MA 2O5EA 2WUDA 4K5QA 1RCUA 4MUEA 3QELB 1QORA 4U2BA 4MW0A 2Q7DA 3DNPA 5M5BA 1NW8A 4GBJA 4DIOA 2BZ0A 3U7HB 3C6MA 2GN8A 1GQOA 1IHUA 3DLCA 1BKDR 1TVEA 1MRZA 2NSYA 2FF7A 5BP7A 1Y6GA 1TDJA 3IAAA 4HG2A 3ZD9A 1Z0DA 2AC7A 1VDMA 1BDBA 4GM4A 3CUTA 2VHZA 1MGOA 2BN4A 3KQUA 2AMJA 2O7NA 2EBFX 2Q99A 1VXOA 1AK9A 3GJ7A 5IK2A 2PJZA 5CD1A 3L8CA 3EWIA 2DG2A 3GUZA 3JY6A 4HX2A 1HYGA 1QTIA 1UZMA 2D00A 2ZJ1A 4ZEWA 4WASA 3TPCA 4EQ6B 3KOMA 4CCSA 1IOZA 3FF4A 1EEXB 1XRRA 4W5WA 2XCOA 2XQGA 3KQSA 3OM0A 4DSAA 3WYCA 4A82A 4Y2JA 1DRUA 1OLSA 1EAYA 1T1EA 3FDJA 1W87A 4LZNA 1FDWA 3OT4A 2H00A 2IDKA 4F92B 3PNSA 5AKHA 2GX6A 1IMJA 1BRTA 3DAFA 3NLLA 1Z83A 1P8JA 5A7GA 4EY3A 2WY2D 1HDZA 4DMFA 4HL6A 3PHJA 4GKBA 1KOJA 3GJYA 3M6VA 3MCUA 1Q7CA 1EUDB 1NT2A 2W2XA 2BI4A 4UATA 1NNSA 3E9DA 4YEDA 4C04A 2EG5A 1OHHA 1JAIA 4Q4AB 1DUSA 1JEYB 4BWFB 4LRUA 1RXYA 5A6SA 2PMDA 5HOEA 1TYEB 4M1OA 1SHLA 4BNGA 2XTJA 3CEPB 1R6VA 1JL3A 2FX5A 2WBLC 3I53A 4WBXC 4YJGA 3CUWA 1E3MA 2NM0A 3C4QA 3S55A 5B64A 1A9SA 1Y3AA 3RO7A 3C6BA 1BEUB 2HNBA 2X2EA 3WY9A 1BCRA 3CLTC 3OE7D 4N0DA 3L79A 4NBSA 4OBWA 1GPJA 3UAOA 4N5IX 4DZZA 1NV8A 2G08A 2I3AA 4FFDA 3VR4D 3CG0A 1C8BA 1PFKA 2CXXA 2O2EA 2YRWA 3IEPA 2KX7A 3PNVA 3RRFA 4URUR 1A1VA 4LKRA 5DTQA 1TUBA 3LE8A 3Q40A 1ZUHA 2RKWA 1D2CA 4FGLA 4LDAA 1E2QA 2RHHA 4IOLA 3HEAA 5C53B 1GN8A 1JAZA 4NK5A 3CE9A 2OFFA 5JFTA 2NNWB 3I62A 2NP6A 4LEIA 4F5WA 4OI0A 3TZQA 1MQSA 3L43A 1USGA 3EB9A 1ZMRA 3H2HA 1NWHA 1TO6A 4B31A 1PTJC 2QK4A 1P19A 2IX9A 1WDKA 1N3BA 2G4LA 2R84A 4EY5A 3FGPA 4MEAA 4YB8A 1L3BA 3AHEA 5I48A 1WRBA 3QLJA 3S7TA 3SKYA 1TQ2A 4EL5A 2I03A 4X1KA 1W1WA 4X9XA 3VNQA 2GZ2A 2NZ2A 2A3RA 1IWBB 3VDMA 1G63A 2WF7A 1V41E 2HFKA 1ZNXA 3KJEA 1US8B 3V8RA 2FSUA 1RWQA 1UBCA 1TMOA 2PN1A 3C4JA 1E6LA 2XKJE 4OBXA 4QQNA 5DMHA 2OCGA 5HKKA 4U1RA 5A3QA 3WK9A 4NL4H 5EMLA 4AZ0A 1PD0A 4BBZA 1JEDA 1HE1C 2ATXA 1E3LA 3FNIA 1TC1A 1Q1AA 2GPSA 3N8DA 3RTGA 1WPRA 4RD6A 2XBUA 4ZEVA 1FMJA 1PIWA 1Y9AA 1EFRA 1I13A 1VRVA 1RXIA 2O2JA 4WVFA 3KHTA 3VC3A 5EYPA 2Q2NA 2DWOA 2J3QA 4JP2A 4MCJA 2C7RA 5I9NA 3R3SA 2WYIA 3QX7A 1FYXA 4FZJA 3L4JA 1KK1A 1UXHA 4ALJA 1QYWA 4J0KA 1BMQA 2IP4A 1Q22A 4Q37A 4WDRA 2XWJI 2XUHA 1Q84A 1VLQA 1M2OA 3PDCA 4QARA 5LYJF 4UD6A 2YJTD 3AHCA 3K31A 2BHTA 5EJ7A 3S4YA 1NNLA 2YXLA 4BE9A 2NMVA 5LMNB 2G88A 3H5VA 2ZTVA 1LDGA 4OQNA 3MTBA 2G0NA 4MV0A 2DJ5A 5TDHA 1SULA 4C4XA 4W7HA 2VCHA 2LZ0A 2WHPA 5AWFC 1Q44A 4IJ6A 3KJQA 4JC4A 4MHOA 5JXGA 3BPSA 4XGQA 4LNUA 5DKFA 1X2EA 1XK6A 1E1RD 4EVIA 2F7SA 2RJNA 5IRCD 2Y77A 1PGQA 2GLUA 3R6GA 4JK3A 1GG9A 1K2VN 1V8PA 4AMGA 3A36A 1G21E 2COKA 3G2JA 1JA1A 3HJHA 4JOCA 4C3ZA 4OMDA 4UM9B 1BE6A 1JIJA 4ESVA 3SN6A 2QHXA 3NASA 4ZARA 3IKMB 1WHSB 4F8YA 1L5WA 1WO8A 2JJQA 1HLDA 2OA0A 2DHRA 3WP1B 1GNRA 4X65B 1EGHA 1CF2O 1MX3A 4D9KA 3OCJA 2CXPA 4F3CA 4UMVA 3MJRA 2FFQA 4EMSA 4X84A 3LUFA 3TLKA 2UXDB 1U11A 4M7RA 3F6CA 3A7EA 4KP7A 3KJFA 4ZVUA 3B6JA 4EFMA 1F7UA 5E38A 2FMHA 2NU9A 3E3MA 3DG9A 3JRWA 4HH1A 4MW4A 4E31A 1FJGB 4Y9TA 3DOFA 1VL1A 4EO9A 4B2PA 3RWOA 1V8FA 3D2AA 1B8NA 2XRMA 3DBIA 4M0LA 3PGLA 1E61A 1YRYE 5EZ5A 2HA7A 4MJLA 1RPZA 1VE3A 3M6FA 4UCXA 2V3WA 3H2SA 1UZAA 2Z58A 2A1UB 1Z4NA 2ZR7A 4NOMA 2XJ4A 2CJPA 4I7EA 3MCWA 1HWYA 2Z2YA 4DQ0A 5I7AA 4ENUA 1ENPA 1JJIA 2EQBA 3HLKA 4M54A 1SCNE 3DPUA 1AXGA 3EN0A 3I34X 4ER5A 4DUZB 1X9IA 3GFOA 3HA3A 4CN8A 1IHOA 1XDWA 2A9PA 1DELA 2YS6A 1XA3A 2O5CA 2C96A 3UF0A 3ZOZA 2XRZA 2Y92A 1TPYA 3D8BA 4GR9A 5DYWA 4XM1A 3M9WA 3TRHA 1KC3A 1D6JA 3M83A 1NVMB 2P78A 5B6JA 1B4DA 4V24A 5EIBC 4ENPA 1USVA 2ALJA 2ON6A 2G76A 4EAAA 4DSUA 4UOZA 1L5RA 1A9PA 3R9XA 2H4HA 2DPXA 2YQ4A 4PCLA 1BMDA 1ZMTA 4ZDWA 4A73A 1QZZA 4CEIA 2J8ZA 3P5BA 1SXJA 4C4TA 1MRNA 1H8EA 3G3EA 3S1AB 5J1SB 2O2CA 2IS2A 5FYDA 4MVJD 1QCCA 1EFKA 4TWIA 4IHJB 2GBLC 2YWFA 1EK1A 1QE5A 3LC0A 4KXQA 4CMEC 1BFUA 2E48A 1XJCA 1AKWA 3OEEA 5F9FA 3DLPX 4II3A 5ALZA 4ETIA 2J9RA 1OB5A 3PE4A 4DDUA 4S1OA 3FTNA 4Y18A 1H3FA 2Y1LA 2X7JA 4G0PA 1L7XA 2EWMA 5C8XA 4NESA 3RSOA 1G5HA 5B12A 1ZD5A 2QTBA 2XA2A 4O3FA 4BJ1A 3LLVA 1Y3FE 1NFRA 3VSCA 1U0GA 4HDNB 4KLNA 2C07A 4ZU6X 5ITSA 4GRIA 4EA8A 5DFAA 4DPLA 3G1UA 4ENRA 1EP2B 4Q6BA 4R8LA 5TS3A 2QE7D 1C9EA 2DFNA 2ZVDA 3A1VA 5KI6A 4BRWA 5WRFA 1P45A 4C7KA 2ZAYA 1ZIXA 2AJDA 4KQJA 5DX1A 1CETA 5JNSA 2QIPA 4D4LA 4F93B 1HE8B 2ZU6A 1W88B