2UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 71
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ukdA00
1R8SA 1DOAA 1G5PA 1G17A 2D4HA 3JVUA 1KDOA 2P5SA 3KL4A 3A4MA 4LHWA 3SYKA 2XNSA 1RVDA 2XJ4A 3C7KA 3PEUA 4NCKA 4GMDA 5FOVA 2PBRA 2ZQ5A 1ZCAA 1XZQA 1VKJA 3RWOA 3FKSD 3GLGA 2IUUA 1MO6A 4B71A 3WMEA 2RGDA 621PA 1ONBA 4XSHA 1F2UA 4HB3A 1L7VC 2IXGA 2FZ4A 4CVNA 3SHFA 1N6KA 1IBRA 3BC1A 1P62B 3B78A 5EZ5A 1FTNA 3EAQA 1Q3HA 3SFZA 2J0VA 5G3ZA 5TVKA 4MRPA 1E2IA 1LFDB 4H9GA 3PIRA 3NHAA 3J81k 3K70D 2FSGA 3IQWA 4ZCIA 1IY1A 4OYHA 4A6XA 1UKVY 3EPJA 4GT1A 1Q57A 1RRPA 3DO6A 2CBZA 2BM1A 3AP3A 3OIUA 4IOJA 4NKRA 5EZ6B 5KUTA 2H1LA 1JI0A 1EK0A 2R6AA 1GDDA 1PUIA 5J5CA 4TZ6A 1GL7A 1P61B 1KI4A 3A1SA 2XOKD 2HDNB 3HR7A 3RSOA 5JJKA 3FDIA 2JCSA 2ZRFA 4UQOA 1E9EA 2ZJAA 4PPGA 2JATA 2GJKA 4DT1B 2VO1A 3OEEA 2RGAA 3CM0A 4MGZR 1MOZA 4RVCA 4OKSA 3BRWD 3U3RA 1KI6B 3I8XA 3K1JA 1R4AA 2KJQA 4PPNA 3RHFA 1W44A 2GXQA 3LRPA 4DIEA 1P5ZB 3I1FA 1KGDA 4I1OA 3LBNA 2X2FA 4IXNA 1KK0A 1JR3E 3CLVA 1YQTA 4XWKA 3ZJYA 2K5UA 1XEXB 4HLUA 2GJ9A 1DAEA 4TQAA 3VX3A 2ZRLA 4RD3A 1N3BA 2ZJOA 1DARA 3WMFA 3THWB 5DYGA 2H7VA 2NG1A 4GZMA 1M8PA 1W47A 3AKDA 3MFYA 4WXPA 5FPHA 4GMXA 2FEMA 3FHOA 2QT1A 2WICA 2NQ2C 4Q9IA 3CZQA 3VR3A 4WBSA 2QMOA 4M4SA 1KOFA 4D0GA 5J47A 2GF0A 1SHKA 3NXSA 3WHKA 3T1VA 5C2JB 4JVLA 2HUPA 4LHZA 2PJZA 2IS4A 4NYMQ 2GEDA 2D7CA 1P75A 3HYRA 1CJMA 3ECCA 4V0LA 3CX7A 3IO5A 1OSNA 2QRZA 2RB4A 1XTIA 2VL7A 3QXXA 4OQMA 4B75A 5JEDA 3PEWA 4CZ2A 1JR3D 4NE2A 1ZP6A 3GFTA 3NH6A 5LDDC 5DSZA 1P2VA 4KSCA 4TYWA 2A5YB 5FI0B 2R6FA 3M0EA 4OQNA 2VHTA 2ZJZA 4Q1AA 4B2LA 1GVNB 1YZGA 1IY0A 4DT1A 4ABYA 5KSZA 3QKTA 5CIWA 3D6TB 1GRQA 4BFYA 4Q7MB 5DI9A 1DE0A 4MYCA 1JEDA 3CBQA 2G1KA 4ARZA 3NC1C 2QTHA 1GM5A 1S3SA 1Z63A 2JDID 4HAVA 3I4LA 2W00A 2AXPA 2Q9BA 2O8DA 3NBZC 2MSCB 4Q1BA 4AIIA 4ZDKA 2CCGA 2GILA 4B6FA 4BZQA 3Q5EA 2QBYB 1OXTA 1XEXA 3T1TA 2O8BA 1GL9B 3QI2A 4EAQA 3THWA 3AVXA 1DS6A 1KTVA 4HAWA 5FBQB 2AFIE 2OCPA 3K09C 1OB5A 2ZJBA 1E3MA 1T3HA 3MWYW 5L3QA 4UNPA 4JT2A 3ASZA 3BXZA 2OFOA 2WJVA 4BQSA 5L3SB 2Z4RA 1E1QD 1S0UA 1D2NA 5KPDA 2JLYA 5HCIA 1S1MA 3IIKA 1IN6A 3ASYA 4HAZA 4YMWA 2Z0MA 4L9WA 4DCTA 2FE4A 2QAGB 3C5CA 3TW4A 3WYAA 1FUUA 4D81A 3U6BA 2A5JA 2BJVA 4HDOB 1HE8B 4O25A 2C9OA 4JMPA 5FOTA 2PEYA 4LYHA 4DDUA 1GL6A 3H2YA 4MA4A 1E69A 2RGEA 4NONA 4LV6A 1FZQA 1F3OA 3KJGA 3F5FA 1LS6A 2ORWA 3CWQA 3P27A 4QNMA 1J70A 1KK1A 4JLDA 4F92B 5C1BA 4IDNA 3P20A 4C0BA 1SKYB 4DSTA 4MGYR 3QVVA 4MKFA 4DLYA 1DAKA 3T5DA 2J0SA 2J46A 1G8FA 5FTNA 4BLPA 1S8FA 4JIMA 3ZD7A 4KJZA 4PFSA 3KJHA 4XSGA 3B6EA 1R5OA 2R9VA 2G83A 1K5GA 1E94E 3TVTA 5KTYA 4DLUA 4NCIA 2FF7A 1QF9A 4GP7A 2V55B 1JPJA 1XTJA 4RZXA 1X8KA 1AGPA 1QVAA 5L3SA 1XEFA 1I4DD 4JZKA 2ZIAA 2ATVA 2ANCA 3ZZ0A 4ITRC 3E1SA 2QAGA 5JWHA 5AJZA 4JLMA 4KITB 2ONJA 2B8TA 3WBJA 2GAOA 4BLRA 3O8CA 1M2OB 1XPOA 1G6OA 1R6BX 2HEIA 2IS6A 4EFLA 1GKUB 4OK6A 3TLXA 2GBLA 1MABA 1S96A 2J9RA 1S1CA 5G3YA 1JAIA 1SGWA 2REXB 1E9RA 2XITA 3G82C 1E99A 1R10A 1HYQA 1US8B 1NMXA 2EFHB 3P4XA 4G5QA 4QBIA 2ZU0C 4A82A 4TYNA 2R2AA 1N6RA 2ZRCA 3NDBB 3LH5A 5J4KA 3RS5A 3FE2A 5B64A 3LW7A 3W90A 1HUQA 1BH2A 4P4SB 2CL7X 4PQYA 3KDSE 1XEWX 2W0MA 3ICQB 3T61A 3K53A 5G41A 5CLLA 4LYFA 2PJRA 2FGKA 1S4QA 4O2RA 1W0JA 3LVQE 3CX6A 1TL7C 1GP2A 5AJXA 1XMJA 4S35A 1RPZA 2GJAA 3L8ZA 1ZVQA 2J87A 3T06B 1Y63A 3MMPA 4DCSA 1NVXQ 2W6IA 2NGRA 5EUQB 3H1TA 2O0KA 1F60A 3TQCA 3OAAA 4O3MA 3V4FA 4HB2A 2JLVA 5LB2A 3A8TA 2ZYUX 3NH9A 1LVGA 2O8CB 1GAJA 4CW7A 1E0AA 3CNNA 5J40A 1ZYUA 4F38A 4KV9A 3QXHA 3PUWA 4DDWA 1E1RD 2AL7A 4F4CA 4WAUA 3WMGA 2MMCA 1LB1B 2W6ID 1US8A 2FPKA 3HWSA 4RJLA 2CEAA 4IVPA 5CITA 2ZVPX 1CR2A 1W2GA 4Q9JA 3LQRA 5KSYA 5A4JA 1LF5A 1LTQA 5JWOA 1W4CA 4B74A 4D4MA 4A4DA 1QZXA 1E4VA 1E2QA 1H8HA 4P4SA 5IT5A 1Z6AA 4C0QC 2ERYA 4AG6A 1BIFA 3BH0A 4PC1A 4OQLA 1NG1A 2YWHA 2IYRA 2AK3A 3AEZA 3BD9A 4C7OA 4MRRA 1NKSA 2I3BA 3LFUA 4X8OA 1KJYA 4ZO4A 4KXFB 2NO1A 2RHDA 2EFCB 2N1BA 2QUZA 4NTZA 2HYDA 2DB3A 3A4LA 5BXQC 2JJ1D 4Q4HA 5AR1A 1XMSA 2P6NA 5D3MA 1OW3B 3QKUA 3AVTA 5AUQA 2ZAMA 1X8JA 4PAOA 4RD4A 3RS7A 2F43A 3IDQA 3R20A 2AWNA 3KTAB 3BE4A 5DIFA 1VG8A 5EE5B 2R6CA 2ZI6A 3Q7PA 2WAXA 4BRWA 5DO9A 4BASA 4U02A 5UKDA 3QKRB 4W5WA 3U44B 1YR7A 4DSNA 3CNLA 2G3YA 1KSFX 5JI3E 4B2IA 3W34A 3WYFA 3ZVMA 4DLTA 4IJMA 1NF3A 1WA5A 3CF2A 5HE8A 3WYGA 1XJQA 5HR5A 2CHGA 1L4YA 2EWVA 3WNBA 5JSZA 3VAAA 3W6PA 1HH4A 4CEIA 1QHXA 1L2TA 5DI3B 5J4HA 1NIJA 2WM9B 4M2LA 5DN6A 1NVVR 1XU4A 2ZVQX 5KPJA 4V0KA 1U98A 3EC2A 4V0ME 2P6UA 4HZUA 3VNUA 4E03A 1G4AE 1WE2A 4LBWA 5J4YA 1WP9A 3GJ8A 2BC9A 2ZI4A 4HUTA 1SHZA 2YC2C 1Z0FA 4LI0A 3UG6A 3X2SA 1OH7A 1I2DA 1E4YA 1XCPA 3QG1A 3FYHA 4NCNA 2HF8A 4JLAA 3MRSA 2VQSA 1N5KA 1E9CA 1VHLA 1TNDA 1TPZA 3N2EA 5HKKA 1K6MA 1NIPA 4CRWB 4A92A 1C4OA 3BK7A 4B32A 2KB0A 2OHFA 2FWRA 4LUCA 5FTKA 2IYSA 3T1OA 2WPDD 2OBLA 3CRRA 3HU3A 4GSYA 3VR2A 5L3RA 3K9NA 2V4ZA 4TSFA 1XPUA 2KBFA 2PLRA 5JZVA 4F91B 2RHMA 3W3AA 1KO7A 3QKSA 2VSOA 1OLOA 3CWZA 1U90A 3C41J 5CB8A 1Q1EA 5FPYA 4XWAA 1E0JA 4MYUA 4IXMA 1NRJB 5HKKD 2V54A 3K70C 3SQWA 1JR6A 1E9BA 4XD7A 1HT1E 2BEKA 3IO3A 1NVWQ 5IK2A 2V7QA 2FPLA 4TSFD 3OHMA 1E79A 4PHGA 1Q12A 3IBGA 5H8WA 3DOEA 2GTPA 3N70A 1S2MA 2BVNA 2IHYA 2VSXA 1E2FA 2ONKA 2YC4C 3LQQA 2AKAB 5BYKA 4QGAA 3RS4A 3GLIB 1JBKA 2OLJA 4PQFA 5JS8A 1CULC 1CKEA 1TQ6A 2IS1A 2DWPA 1DELA 2FZLA 4NYJR 4P3YA 3UG7A 2QSYA 2RGNA 1F48A 3EXAA 5D3QA 4EPVA 4TN1A 5JHHB 3P26A 4KU4A 4LX0A 5FI1B 4B44A 1AQUA 4DXAA 4Q03A 3SYLA 2IYLD 1T8UA 3VR1A 1NN5A 3FB4A 4B43A 3CW2A 2E1RA 4ZKDA 3RDPA 2V1UA 4IEEA 3A36A 1R0ZA 5AUNB 4C0JA 1UKYA 4J0QA 3EIQA 4RFSB 2Z4SA 1OXUA 3AP1A 2J0UB 4DLRA 3FVQA 3Q85A 4FN5A 3GJXC 3DDCA 2XEXA 4TMKA 2JIZA 1FFHA 4W7SA 3K0FB 3QF4A 1TU3A 3RC8A 3TJZA 3B1XA 1U2RA 2D2FA 3FMIA 4G1UC 4MRVA 4R9UC 1E6CA 5EUMA 1T5LA 3LX5A 1DAMA 4MKGA 2JLZA 1DBSA 1QG4A 2IF0A 4LPSA 4MKIA 2EFGA 3M6AA 4QHSA 1JQJC 1HV8A 2WJGA 2XNDA 4U7DA 2H92A 4PSAA 3U61B 3TSZA 1OB2A 1VIAA 3CO5A 4LOAA 4LYJA 2YOGA 2DWQA 4A8JB 2ZI9A 1CJUC 4TYYA 4F4JA 1EWRA 4CEJA 5AK0A 4ERNA 1Z2CA 1W46A 2B21A 5E7MA 2A5GA 1X8LA 4URZR 1QHIA 3TW8B 3IUYA 1OH8A 2ZYWX 1S9HA 1FNNA 1U9IA 4M9SA 1D5CA 3FFAA 1G8HA 3LX8A 4C9BA 4WW0A 5EXPA 3F8TA 1G291 2XNDD 4HYYA 3KQNA 1FUKA 1UEJA 4EJSA 1IQPA 2EVWX 3R7WA 4M21A 1PLKA 2FSHA 1KDRA 4WZ6A 3SN6A 5E3HA 1LS1A 5IRCD 1N5LA 1W36D 3DZDA 1GITA 4QGHA 4FMDF 4B34A 2BM0A 4N1AA 1QBKC 4B3CA 3LV8A 3SBEA 2J0UA 3QSYA 3SS8A 4MRSA 2W2XA 1X1SA 1ZRHA 2CMKA 1NP6A 3KJIA 4GPTA 2C5LA 1E2NA 2WMNB 1AZSC 5FOWA 5AUOB 4ZV4A 1HURA 1NKTA 2ZSBA 5DE3A 4HAXA 4AYWA 4ZIRA 4LHYA 2IYZA 3RS3A 4EIWA 5FL3A 3UWOA 5E95A 4AC9A 4US2R 3GD7A 1FW6A 3ZD6A 3AB3A 5DH9A 3V00A 3VKGA 1G6HA 4CYMA 1WF3A 2FJUA 1GZSA 3T34A 2QE7D 3ZH9B 2QZ4A 4Q4JB 2YOFA 1EFUA 1VHTA 3UXMA 3AF0A 3WRYC 1OHHA 1QG2A 1ZM4A 2AX4A 1NN1A 4ZDIA 1MR3F 2ZITA 1KJZA 3P32A 2BIFA 2QL6A 4TL8A 4C0KA 2CJWB 3EIHA 2WWXA 3GLGB 4OJQA 1E0SA 5CB6A 2ZETA 4TL6A 1GKIA 3K70B 5F9HA 1PVOA 4FCWA 4PPFA 4BUJA 6Q21A 1F2UB 1G7SA 3B1YA 4PC6A 3TR0A 3EPLA 1ZUNB 1OHHD 2WBLC 1RRCA 4BLTA 4KODA 1N6HA 4NYIR 3NG1A 2BCGY 2W83A 2WJIA 1KKLA 3FMFA 1LV7A 4WZBE 5K8IA 1EFRA 5JI2E 3ZYCA 2X19A 1H8EA 1P6XA 3B5JA 3AV0B 3QXSA 1E2DA 1XMVA 2ERXA 3CUEF 1XD2A 2HT6A 3LAWA 4KVGA 3QY0A 1T0HB 2OBNA 2ZS9A 4M0LA 4E09A 1T91A 3CH4B 3CPHA 4HLDA 4DKXA 1R0WA 3SZRA 3LLUA 4TZ0A 4Q21A 5AJWA 1DG1G 1EFRD 2O5VA 1CJVC 1IHUA 1W4AA 1Z83A 2BKUA 1XCMA 2PT5A 1II8A 1M7HA 2ZE6A 4AY2A 1N5IA 1EFCA 3GFPA 2CJWA 3D8BA 4IEIA 3IPYA 2O8FA 3DOFA 3SI7A 4GI7A 3NBYC 1P3JA 1ZW6A 4OQFA 2QTFA 1XEWY 1RZ3A 4ESHA 2F9LA 4B3DA 2IYUA 2ZRGA 2GZAA 2C9CA 2QAGC 5FUWA 5G40A 2CVFA 4D0LB 3A58B 4JVSB 1AJEA 1M6NA 3TUJC 1I4TD 4I4LA 4TLBA 3GJ7A 1SXJE 4QGGA 4QHTA 3L43A 1A2KC 2XOKA 2CLCX 2QENA 3SJBA 4P0TA 3AVOA 2A3RA 2GBLC 3AF4A 4TYQA 2WV9A 3EZ2A 4YDHB 4FMCF 4Z54A 1DADA 3WP0A 4BRUA 2BHRA 1G3UA 1NY6A 4DBLC 2BMEA 1RKBA 2ZUBA 3ZIAD 4CDGA 4Q47A 2GXSA 2NO7A 2WWFA 2OILA 4DHEA 1VIYA 2W58A 1R0XA 3TAUA 5KHOC 3GMTA 3I73A 3R8CA 4PTLA 1EG7A 1HQYE 2C77A 1JXMA 5SZJA 2OEPA 5B2ZA 1SXJD 2QGNA 3FGNA 3X1ZA 5KSOA 4ACBA 4KLNA 2J7PD 1KO4A 2W6JA 4LC0A 1QHNA 2PL3A 4GNKA 3AVYA 1OT3A 4ARZB 2ZRPA 2XAUA 5EXSA 4JBXA 5FOXA 3CNOA 2C9YA 1PZNA 2O8DB 4YMTA 2ZI3A 3LY5A 3TRFA 4QJ4A 1AA9A 1NG9A 3A6PC 2WMOB 3LDAA 2BOVA 2HXSA 3Q8XB 5JLJA 1Z0KA 4LK2A 3CH5A 2X77A 4RSGA 2O8BB 5JEEA 1Z5ZA 3RYTC 1JR3A 3CRQA 2AHOA 2W6JD 2Z5FA 1OYYA 3AP2A 1GTVA 5L3QB 5JRZA 2ZJ8A 4DCVA 5HZKA 5F3WB 1E2HA 3QJYA 2I4IA 1W48A 3ZS9A 2FDCA 1N6LA 2FSIA 2VTKA 4TMWA 5SZKB 5BW8A 2VP6A 4BPBA 4G01B 2G88A 2FFHA 1ZCBA 3IHLA 2XZLA 2NOAA 3LBHA 2JDIA 1UBGA 1OIWA 1UBFA 3X1XA 1Q3TA 4I1VA 2OZEA 5TV2A 1VCIA 2HT1A 1A1VA 2RH5A 3PXGA 1TUIA 4GOKA 1G7RA 1KNXA 1VG9B 4RCZA 3GQBA 1ZD9A 3OESA 2N46A 4BWYA 1KSHA 1O3YA 4TQUS 1F6BA 1NN0A 2A9KA 3O8BA 1R5NA 3UANA 1Z47A 1W7AA 1IM2A 2F1HA 4CT5A 3OFND 1XZPA 5TB5A 5LD2B 4BEJA 4TLDA 3CRW1 1ZD1A 1N0VC 3L0OA 4PPQA 4U00A 1E1QA 3FPAA 1AS0A 4MUBA 2BV3A 4FMBB 4FW9A 1XCGB 1BYIA 4D4LA 1OXXK 4WVFA 4JLBA 2F3RA 3HJNA 3MCAA 4TL7A 3K0SA 2D7DA 4AKIA 2ECKA 2KE5A 3QQ5A 1UBCA 1OFUX 2HLDD 3LW8A 4IDQA 5CK4A 1RE0A 3BB3A 1ZBDA 3LO5A 4IDHA 1YR6A 4PHTA 1FX0B 2IYYA 3PENA 4FINA 3B7GA 1FL9A 1BO6A 1G3QA 3BBPA 1W5TA 1KSJA 4EFMA 4N0EA 821PA 1M1YE 4JJKA 1UF9A 1MT0A 4FMDB 2QMUA 3CONA 4AKEA 3SJCA 3AF2A 1M7BA 3HPQA 1EWQA 1ELOA 4DLXA 1U8AA 4JLOA 5EE3A 1MABB 1UJ2A 3AF1A 1LW7A 2VRWA 3F0TA 2ZI5A 3R9IA 1E9AA 3A37A 3IIJA 1ZIOA 3CX8A 5TDHA 4QOSA 1BMFA 2VP5A 2EQBA 4DCNA 3THYA 1AN0A 1E2KA 4XTCS 1W0KD 1H65A 1E9SA 2CK3D 3EG5A 3H0KA 3VR6A 3AM1A 4Q48A 3TAHA 1ZNYA 4W5HA 2DFNA 4O0MA 2JASA 2XB4A 4DEYA 1G3RA 1N6NA 1XNJA 3FHCB 4EPYA 1YZQA 2YZ2A 1GIAA 2UZ3A 1SVMA 3AGQA 1XD8A 1ZNXA 1BMFD 2C8VA 1LY1A 1NI3A 5HCNA 3TBKA 2ODWA 4HAUA 2NO6A 2D2EA 4M9QA 1ZJ6A 2YWGA 3CPJB 4L16A 4L5BA 4C30A 5BWMA 5DNYB 1GFIA 2HJVA 3IGFA 5ELXA 1FX0A 1KO1A 1VCNA 1YR8A 3G5UA 5G53C 4LBZA 4C4PA 1NMYA 5FPTA 1OFHA 3IQXA 1GRNA 2AK2A 3CRVA 3WY9A 1PLJA 4JKYA 4FIDA 3OEHA 1MKYA 2LWIA 3NC0C 4Q1FA 4PHFA 2AXNA 3BB4A 2ZRAA 5KDDA 4LWZA 1G18A 1XTRA 2NZ8A 5H68A 4LZZA 4TT3A 1KDTA 4QG7A 2HYIC 4DIDA 4MYHA 4QRHA 5FBLB 1AS2A 1EX7A 3MAAC 4B3BA 1HE1C 1P72A 2GA8A 2VP0A 2IXEA 2CL6X 2Z83A 4LJ4A 2RGNC 121PA 5F2EA 3LD9A 4DLWA 2HJGA 1JALA 3OEHD 5EE1A 1AGRA 1T3SA 1II9A 1Q1BA 4A0HA 2GCOA 2FU5C 4M1OA 3VX4A 3MG9A 4JJZA 2DFTA 5E7IA 2ZXUA 1SKYE 4TT3D 3U5ZB 4PO9A 521PA 4URUR 2GJSA 1RYFA 3SC3A 1D8TA 4JLJA 2FGJA 3W6OA 4C7OB 2GZDA 3LXRA 1AKEA 4QBFA 5K8TA 3HPRA 1E1RA 4IVRA 4Q7JB 2JGNA 4LJ8A 1ZM3A 1WDTA 4RD0A 2J45A 4AKHA 4A2WA 3QUSA 3NEYA 4CT4B 2ZRDA 1T9HA 3OZXA 3X1YA 5H1YA 3QE0A 4Q4HB 3I5XA 2DCUA 5D3MB 2WWGA 3D3QA 3C4JA 4CEHB 1NY5A 2F43B 5CYPA 1UKZA 1B0UA 2J3EA 1AKYA 2OUKA 1RFLA 1NN3A 2CCKA 2ZYVX 4Q4LA 2RGGA 3K9HA 2JAQA 4FMCB 4JL8A 4JVMA 3U6KA 4PANA 1KI3A 4LC1A 2ZRKA 721PA 2GJ8A 2VBCA 4DB4A 4E22A 3TGPA 3QBVA 5CIQA 1JJ7A 3BB1A 2IC5A 1U9IC 2G9NA 1ODFA 1A5TA 3T12A 2ORVA 1U8YA 2PX3A 2BBOA 5JSZB 3FTQA 4QC2A 2JJ1A 3X1WA 2J59A 1Z28A 1TEVA 2VYFA 1T3LA 4CEIB 1TQDA 3AVQA 4D2IA 4EJSC 1KZGB 3HU1A 4M1KA 4UJ5A 1PLLA 2G0NA 4BFUA 5BN5A 1YU9A 4MKHA 3TSWA 2WJHA 1UAAA 4NBSA 4ZI3A 1OKKA 3ZGXA 4DZZA 2D62A 1AK2A 4G5SA 2QMEA 4HZUB 5JJIA 2C99A 2ZI7A 4IW3B 5B30A 2R6DA 1TUEA 4JS0A 1N0UA 3NVAA 2MSDB 1XD9A 5KDLA 2QGZA 4IFBA 4TLAA 3NBFA 4CIDA 1W1WA 2BDTA 4YMVA 1ZC4A 4DC9A 3CZPA 3KB1A 1Z2AA 2RKOA 1UDWA 4TQ9A 1HTWA 2AWOA 2VH5R 3RRZA 4QL3A 4CEHA 4LV8B 4BGDA 1YZKA 1R5BA 3SFVA 1OKKD 3GLHE 1RW4A 5EJEA 3QXJA 4RZ2A 3HR8A 4QKQA 5EP2A 2GHIA 2YOHA 4ZDWA 3KQUA 4Q1DA 2DFKB 2QRNA 3N2IA 2C78A 1WRBA 1KJWA 4DUGD 1G5TA 1G5RA 4LJ9A 3BS4A 4A8JC 4PHHA 3GLHA 2NZJA 4L8GA 3QKSB 2ZROA 1SVWA 4TMXA 3O8RA 1HT2E 2FEOA 4KFSA 4A0GA 3I8SA 4B47A 1Z0DA 4TWZA 4DB2A 1KYIA 1VMAA 2JLWA 2CHQA 4LJ5A 4XVQA 3RRNA 2JJ8A 1OPXA 3Q5DA 1MRSA 4ILEA 4DCUA 4A36A 2VHJA 2GCNA 1X3SA 5KDOA 1P9RA 3FKQA 1CP2A 2YWFA 1E32A 4PX9A 3I3SR 4PC2A 3PFIA 3TQFA 2OCAA 5EE9A 4EUNA 2H17A 2RGXA 1KO8A 2NPFA 5FOUA 1TAGA 5EP4A 4EPRA 1KAOA 2FPMA 1P9WA 3E5HA 3VQTA 1KMQA 2WPDA 2NMVA 2RCNA 2FFBA 3T35A 4AWXA 1U8ZA 4PZLA 5B58C 1II0A 4UNSA 2IWHA 3SBDA 2WWWA 3GFOA 4OI2A 4YC7A 5EP1A 2A30A 5JMTA 4Z8XA 4V0MA 4D26A 3OF5A 4YMUA 4P33A 2CE2X 8OHMA 1OYWA 2P0EA 4PSVA 4UXIA 2PEZA 4Y0VA 4R71A 4QFMA 1U0HC 4JLNA 3U7GA 3KUCA 1DVRA 4OL0A 4KFRA 1D9ZA 3UWKA 1XDBA 3DMNA 3HU2A 4RD1A 3EIEA 2JA1A 4FD2A 1OV4A 4EPWA 3ADBA 4QNRA 1OXSC 3GEHA 4LBVA 5JS7A 2A7QA 1Z6XA 1NLYA 1AM4D 1ZD8A 4LGMA 1XF9A 3OE7A 4OHWA 1VECA 3B9QA 1EX6A 2NO0A 3BFKA 4FWIB 5AJVB 4MH0R 2NTYC 4Q9HA 2QTVB 1DAFA 2HCJB 4EPXA 1XTQA 3QBTA 3TH5A 3QF4B 3SJZA 3HYTA 3U3MA 3RWMB 4JSTA 3AH8A 3SOPA 4BLQA 4QJ3A 1F2TB 5CYOA 3ND8A 1T0JB 4PZZA 1JQLB 4TL9A 4KBFA 4D4JA 3QEJA 3P1JA 1OFIA 2Q3HA 3OE7D 1OE0A 4LJ6A 2BBWA 1JAHA 1XXHE 3BFXA 3KUDA 4CEJB 2Q21A 1W36B 3WHLA 4TMTA 4Q19A 5FUXA 1ZINA 1GNRA 3BWDD 2QA5A 1DAGA 4PAMA 2Q0HA 4DDVA 2E87A 1E9DA 3TKLA 1XXHA 2R65A 1AS3A 2ZU6A 3QF7A 3U3JA 2F1IA 1TQ4A 4BECA 3Q3JB 2JLUA 2IYWA 5CM9C 4US1R 2ZE7A 4EDHA 1TADA 2JJ2A 4ASUA 5KYKA 1KI9A 1XJCA 2MMGA 2V3CC 3AF3A 4EJSB 4LJ7A 3UMFA 4IHQA 1S3GA 2IHBA 3ZVLA 3R7WB 3RRYA 2G1JA 3MWJA 5GJVC 2ZM5A 2IA5A 3IIMA 4LYAA 2DY1A 3QG5A 1GUAA 2V8OA 4V02A 2WIBA 3UIEA 1YZNA 4AKGA 4Q1CA 4RZ3A 1F5NA 1HQCA 5CK5A 2ZSFA 1Z29A 3RANA 2VIIA 2O52A 5CDFE 2VP4A 2FNAA 3NIBA 4HUQB 4XTRA 4Q4AA 2JJ2D 4IOMA 2JLQA 4OI1A 4ASUD 4P31A 4BLOA 3KJEA 4NU0A 3EA5A 4YLGA 3Q72A 4W9MC 1MO3A 3C5HA 3DM9B 1ZMXA 4ZIRB 4WOPA 3CR7A 3ETLA 5E7JA 5J4VA 2OXCA 1F2TA 421PA 5B57C 2ZUCA 4C2TA 4MYTA 4HLUC 4C0SA 3R9XA 2C98A 2EYUA 4JYBA 4MRNA 3UPUA 3RABA 4BFXA 3WRXC 3T1QA 2QSZA 3ZVRA 2KI5A 2AD5A 3IBYA 4OJKA 3TK1A 3PUVA 3EZFA 4R2IA 2H5EA 4C0HA 1PV4A 5IF9A 3WNDA 2TMKA 3RLFA 3TMKA 1DG3A 4KSBA 4PC3A 4NYMR 3C8UA 2FA9A 2CNWD 4L9SA 4A6PA 1G64A 2FG5A 3KKQA 2WSSA 3TNFA 4QBGB 4OHZA 1COWA 1SVSA 3D31A 1CTQA 2HXYA 2ZREA 2ZRBA 1RIFA 3W8NA 3BERA 1U0JA 4F93B 1CBUA 4C0LA 2P65A 4MUAA 4M8NE 3K0CA 1KI1A 2BEJA 1ZC3A 3SR0A 4KO8A 2OO7A 5TARA 1G1MA 2QE7A 4RY2A 3BFVA 3CF6R 2CL0X 5CLQA 4B33A 1Z06A 4I1SA 2UKDA 1OIVA 2ANBA 2JLRA 2VP2A 4A0FA 4HUQA 1KY3A 1XD2B 2QM7A 2WSSD 4TMZA 4HDCA 3ZQJA 1COWD 1KIMA 2DWOA 4R7ZA 2ZSAA 3MSXA 4TLCA 1Z07A 4XIGS 2GZHA 3D7MA 1R0YA 2QP4A 3VR5A 2IYVA 2EYQA 1XTSA 1EXMA 1A2BA 1TX4B 5C4MA 1UFQA 4EQ6A 5KU1A 3KFXA 4OHYA 3FFBA 2DFLA 3BOSA 2VF7A 3NWJA 3KZ1E 5GVRA 4KYUA 3F3YA 4LRWA 3QXCA 1P60A 1II8B 3KX2A 3E2IA 5C18A 1SVLA 1FPMA 2IK8A 3RSLA 2WTUA 2A5DA 4II7A 3PUYA 1T8TA 1IOZA 1D6JA 4PC7A 1SZPA 2O8FB 2FFAA 3H4MA 1LNZA 1ZIPA 4B3FX 5JWRA 1G9XA 2OCBA 2ZR7A 1XB2A 2WWHA 4LV5B 2QY9A 3GJ5A 3M1IA 1E2JA 3GLFE 1Z8FA 1G8GA 5GJCA 1DAHA 2REOA 3PUXA 3K0AA 4UXHA 2XX3A 3SJAA 3U60B 2PLFA 3VR4A 2O8EA 1U0LA 2XTNA 3KKNA 1AIPA 4X8HA 5IHPA 3GLFA 4HDQB 4KFUA 1IAQA 1SXJB 2OESA 5L8VA 4MGIR 3RS0A 4JKIA 2AKYA 4KBGA 2F6RA 3PVSA 5LB4A 1WBBA 4LHVA 4Z51A 1NVVQ 1C9KA 1VDZA 2RGCA 4R98A 5LD2C 1FOEB 1M7GA 1J90A 1UEIA 1Y3AA 2B92A 4QXAA 4G3XA 3U4QA 3GEIA 3W6NA 4XOIA 3VKWA 1YR9A 2VPPA 3OIWA 4QGFA 4DEXA 3NKVA 4A0RA 4LHXA 1IJFA 2QNRA 5H70A 2QG6A 5FFMA 4M1SA 2V1XA 1AZTA 5FL7D 4G5RA 3ADCA 4LDJA 3EC1A 2WVJA 3EASA 2F7SA 1ZU4A 2XJ9A 3VU9A 2ZUDA 1GKYA 1G3MA 5KNBA 5K8LA 2DYKA 2C04A 2JEOA 4HLQB 4TYPA 2F55A 2FV8A 4W5JA 1T4GA 1UBEA 2B8WA 3EARA 5J4LA 3PEYA 2GNOA 3ZIAA 2AD1A 3QOFA 4JLKA 4X8LA 1TF2A 2WKQA 3NTUA 4O2LA 4M1YA 1Q1ZA 3KFVA 3THOA 2CDNA 4M1TA 4V0NA 5GJWC 4BFSA 3KKOA 2P3SA 1E98A 4LJYA 4BFZA 1RRFA 3R9WA 2NO9A 1P7CA 1G7CA 1KMHB 2YKGA 3AKEA 4L4UA 4DJTA 3GJ3A 1E96A 4MDEA 3RNLA 2OSBA 3TIFA 3SYNA 2WJJA 3PV0A 1SXJA 2ZJYA 4HEJA 4OHVA 4P32A 3L0PA 4NPHA 3K8YA 1KNQA 1OJLA 5TY0A 2J7PA 1E2MA 2WWIA 2YHSA 3ZS8A 4Z1MD 2XGJA 1GG2A 5AWFC 4Q18A 4GL2A 1VCOA 4JVNA 4D6PA 2WKPA 2JLXA 2EFEB 2EWWA 3CR8A 4LY6A 3FHTA 2XTZA 4TMVA 1P2UA 3NEJA 3AVVA 1UKEA 1E2LA 3X1DA 1CEEA 3WP1B 1KSGA 1EFTA 3AVWA 2WSMA 3QIAA 4NYJQ 2OLKA 2XXAA 4BFVA 1ESMA 1N6PA 2QN6A 2R6GA 4M9XA 3S1AA 4F7WA 5LBIA 2P6RA 1DPFA 2VP9A 3AVPA 3OIYA 1JXOA 1Z3IX 2WHXA 1RRGA 2F3TA 2FOLA 3NDPA 2LKCA 5KNDA 3EZ6A 1MH1A 1ZM7A 2NPIA 3DVLA 5FH9A 2VSFA 1YZLA 1Z22A 1JJVA 2ZRIA 1BKDR 4UXJA 2IEZA 3TUIC 1M74A 1SKQA 2B7CA 1T5IA 4B3GA 1KMHA 3SEAA 2ZSEA 3RAPR 2BMDA 3HP1A 2OT3B 5CM8B 2DPXA 2B6HA 2R62A 1CIPA 3CIOA 1N6OA 3EZ9A 2PMKA 4PZYA 3P4YA 1I4LD 1RJ9B 2Q6TA 3GEEA 4BFTA 3V4RA 4C2UA 1CRQA 4EFNA 4ACAA 4US0R 3OFNA 4URXR 3OEED 2C2HA 4NHOA 3T15A 5FBVB 1TTTA 3MJRA 5FUYA 2CHVA 2XSZA 2PZFA 2F1RA 4NDZA 3B2EA 2YJTD 3W5JA 1Z6YA 2Q3FA 3L0SA 2KSQA 4DSOA 1Q1QA 1MV5A 2IUSA 3UK6A 2GVZC 2ZE5A 4A2PA 5C46F 5F98A 4CF7A 3GJ0A 2E9SA 2A2ZA 2HLDA 3B85A 2H18A 3THYB 5KNCA 1CU1A 1KZ7B 1MO5A 2OG2A 3AKCA 1C1YA 3CF0A 1XJ0A 4MITA 1J8YF 221PA 3Q9LA 4D25A 1PUJA 1ZUHA 2G0TA 1XMIA 1YE8A 2XSZD 3PR1A 3Q7QA 4QBHA 1SVOA 3TSOA 3IPXA 2PCJA 3B1WA 1A7JA 3H86A 3LBIA 2IEYA 1XP8A 4K8OA 1GSIA 1K8RA 2UVQA 4POAA 4AG5A 5BN3A 3B1ZA 3DL0A 1OH5A 4E07A 3PQCA 1S9DA 1UM8A 4G5GA 4JSYA 1KI6A 3B13B 2D74A 2C03A 2QP9X 2GVDC 4YXWA 3WBKA 1DTSA 1N0WA 4A9AA 3IEUA 1GNPA 1RJ9A 1YZTA 1R8QA 1RC8A 4N3NA 4B6EA 2RMKA 2FFQA 3I61A 1W0KA 2CK3A 1LF0A 4Q9KA 3W8RA 5F9FA 2GKSA 4GOXA 5SZHB 5BQ5A 4RKFA 3W5IA 3I62A 4P4TA 2PX0A 4D0NA 3FWYA 1DAIA 2VHUA 2OM2A 3GCGA 4NH0A 4TTQA 4YXWD 2VA8A 2GF9A 2YV5A 3QEOA 1QRAA 2GETA 5M04A 1KI2A 2IX3A 2YINC 2QQ0A 3KB2A 4XVRA 3RRMA 1G20E 4ZPXA 4B48A 3AKYA 4NCHA 2O0HA 1L8QA 3FOZA 3IKJA 2OAP1 1J7KA 4C3ZA 3ZQ6A 2HF9A 4YONB 4UNQA 4WXRA 1OF1A 4BZXA 4D82A 1SULA 2QM8A 2WAYA 4KAXA 4NYIQ 3FMOB 4AI6A 4GP6A 1NJFA 1CJKC 2GCOB 3QNUA 2V9PA 4HLCA 1T6NA 3O8DA 3SNHA 3KKPA 2PH1A 4NP6A 2BCJQ 4V0OA 1NBME 4PSKA 2ZYTX 4HB0A 2GAAA 2W2VA 2IF2A 1X1RA 4G0NA 4EPTA 2Q3MA 4JBYA 2OFWA 3UATA 1NBMA 2CLSA 5JHGB 1KY2A 1IONA 1YZUA 2ZRJA 3BIFA 3TE6A 3QENA 4HZIA 2QBYA 1O87A 5FTMA 4IRUB 2N42A 4H1UA 4JL5A 2Y8EA 2HCBA 3EPHA 1ZNWA 2QU8A 5HTKA 5K8UA 2PZEA 4UNNA 4K46A 5FPKA 4TTPA 3QPWA 1NBMD 2C95A 1IJEA 4FWTA 3V9PA 4YMSA 5FUVA 2ZTSA 1CR0A 5DGXA 2ODNA 1KAGA 4RCYA 1BS1A 2G6BA 2ZRHA 3HDTA 1FP6A 1XX6A 3WXMA 2OXRA 4B35A 2BMJA 3QVUA 4OK5A 2VF8A 3RVBA 4LBYA 4AYXA 2J7KA 4Q5IA 4RZUA 4KHZA 4IFEA 3KQLA 4GFDA 2KBEA 1W5SA 3W3ZB 3KXIA 4DVGA 3U7HB 2WZQA 1SVIA 5GJBA 1GILA 3I32A 1OXVA 1XPRA 4FXPA 4LPKA 2Z6VA 4FI3C 1KI8A 5DHFA 4C0AC 2BKEA 1VG1A 4OI0A 2WWYA 3DM5A 1K5DA 1J2JA 2ZJ2A 1NSTA 5CJPA 4TLEA 3I5YA 4V03A 1CXZA 3UKDA 4GDFA 1EGAA 3ICEA 3VKHA 5FR2A 2F9MA 2FN4A 2PZGA 1GOTA 3L0IB 3QPUA 4M53A 3A4NA 2ZPTX 4Q9LA 5FR1A 3LLMA 2V6JA 3A1TA 5EXXA 4AYTA 1Z0IA 2OE2A 3ADDA 3EWSA 2ZR0A 1R2QA 1G21E 3FMPB 2H8KA 2UZIR 4KLZA 1E2PA 4UNRA 4A2QA 1P73A 3GLHB 3LVRE 3PITA 4MGKR 3PG5A 1V43A 1I2MA 1NJGA 4JL6A 1W36C 1D2EA 4IVQA 2C96A 1QHSA 1XWIA 1E2GA 2QQEA 4GOJA 1NL3A 3AQ4A 4Q02A 1IN7A 2GXAA 4KYIB 2ODEA 2REBA 3KXKA 1FTSA 4DLZA 4NCJA 3ZDQA 1VCMA 2V6IA 4XWOA 3PJRA 1W0JD 5KO2A 2W2TA 4BE7B 2QROA 2JLSA 2BBTA 2Q9CA 2QPAA 4WA7A 1UDXA 1CS4C 1TF5A 1N2CE 1X6VA 5DHAA 2IWRA 2QI9C 3U3KA 2ZS8A 3K0CC 2QT0A 5IDVA 1JEEA 1G16A 4YQFA 3OAAD 3THXB 3RS2A 4DUGA 1G4UR 4Q7KA 2DR3A 5L3VA 2J1LA 1D2MA 4M1WA 3KKMA 2WKRA 3IEVA 4PXAA 5DLQC 1D9XA 3MGCA 1GWNA 3K9LA 1G8YA 3LXXA 3UMSA 4KCGA 5JCZA 2J5XA 3AUYA 3E70C 1G41A 1P4SA 2QP3A 4L15A 2BWJA 3L8YA 4BFWA 4Z8YA 1W4BA 2GK6A 4FCVA 2NIPA 4D4KA 4DSUA 1ZM9A 3PEVA 2LCFA 3GJ4A 4GRAA 1QHHB 5DYIA 4DDTA 4QHYA 1WCV1 1JB1A 1E9FA 5EE0A 3ZZUA 1CR1A 3MWLA 4BLSA 2ZS7A 4OHXA 1GNQA 5EQTA 2EU8A 2QAJA 3BAFA 3CRMA 4OBEA 3SHWA 3SQXA 1H8HD 2A5FA 5SZIA 3EX7C 1QHYA 2O8CA 2IBMA 1P2TA 4HB4A 4X8MA 2W0SA 2QORA 2SHKA 3G0HA 2VLIA 2XB2A 2PMDA 4K81B 5KOYA 2IS2A 2WJYA 3K09A 4ZCLA 1KDPA 2QEQA 5JJLA 3SU8A 1EFHA 2EW1A 3SE0A 1KI7A 4AURA 2GEUA 2ZANA 3JVVA 1Q20A 4Q00A 4Q1EA 2CVHA 4BEBA 2GRJA 4ZCMA 3GPLA 1VYUA 3THXA 5GADl 1YJ5A 3B8HA 1HA3A 3C15C 3BJIC 3LWNA 1XRJA 5E4FA 4URWR 2ZRNA 3BGWA 3K9GA 1Z0JA 4PO1A 4EKDA 1XXHB 1J99A 3L2OB 3MUFA 1DEKA 4GBMA 3W9YA 2ZAOA 4JLVA 2AFHE 1A4RA 2CLDX 2EFDB 5CJ2A 3B9PA 4ZDJA 3B82A 3DPUA 2QPOA 5AUPB 4B2PA 1U94A 3ZZTA 2MSEB 3EA0A 2CCJA 4B73A 1HEIA 5EP3A 4DRZA 5FBRB 4GZLA 4JT4A 4YDSA 3DKPA 1QHHA 1G3IA 2GK7A 3TR5A 4QJ5A 2IL1A 4URVR 5HPYB 2D3WA 3SDZA 2Q9AA 3REFA 2DHRA 1GRRA 1CRPA 1IN5A 2WIAA 2P67A 5ANRB 4Q4AB 3AGPA 3VTKA 5DN6D 5FPSA 5TMPA 5FOSA 3CB4A 2B7BA 2OFXA 1ZUIA 2BBSA 2YNMA 3KTAA 2I1QA 4HI0E 2IW3A 1CJTC 1DO2A 1OFTA 4PO8A 1X86B 3QKRA 5LPNA 3U44A 2CXXA 3ND9A 4N0DA 5JCPA 4ZI2A 1TF7A 4URYR 5HZHA 4CGZA 3A1VA 2R44A 4OQXA 1B23P 1OH6A 5A0FA 5JRJA 1Z6TA 1IN4A 1Z6GA 2ZE8A 3RC3A 1SXJC 3C14C 1TEXA 2GEVA 2OV2A 1IXSB 3I72A 3H84A 3NBXX 3PCRB 1VYVA 3K0EA 4IKEA 4WZAE 3UMRA 4B3XA 3IHWA 1A82A 5DI3A 1ZU5A 1YVDA 2AN9A 1N6IA 3MLEA 1JNYA 1KK3A 5BYJA 5JBQA 3U7FB 1ZAKA 2FMXA 1Z08A 2RAPA 4NZYA 4IDOA 3DKVA 3GP8A 1FMJA 3VFDA 1Q44A 1N25A 1JECA 4KFTA 4S2EA 1R7RA 4XD7D 1IXRC 2CE7A 4XH9B 2RGBA 1OIXA 1QHGA 1W4RA 2QPTA 2ZSDA 2AR7A 5KSPA 1YRAA 2V7QD 5IK2D 1KK2A 1E79D 1E2EA 4UJ3A 2I1VB 1U99A 3DHWC 4ON9A 5EXTA 4I1UA 1WMSA 1NLZA 1SQ5A 4PQRA 3EPKA 2VHCA 5CDFA 1TMKA 4JLPA 2CNWA 2P2LA 4JBWA 4AD8A 2GWHA 4P4UA 4EQ6B 4PR0A 3B1VA 1DO0A 3VHXA 1FP7A 4MDFA 5A5GA 1VYTA 2H57A 2VEDA 2WOOA 1PJRA 2D06A 4FCTA 1VTKA 2GESA 1IY2A 1WBDA 2YYZA 3O47A 1FQJA 4IDPA 4LJAA 4A15A 5GVSA 2LKDA 4ZKEA 2J0QA 1FNMA 3JZMA 5AJYA 4HSEA 1G8PA 3KQKA 1IN8A 3WNCA 2XZOA 3GLIE 2FSFA 3U3OA 2ORIA 2R8RA 1TU4A 3EWAA 2HV8A 1XBTA 1IXZA 4A1FA 3R8FA 4R2HA 5FTJA 1Q22A 3VMFA 3K0AB 1KKMA 3MJHA 4Q01A 3GLIA 2X8AA 1YHNA 2FH5B 4F4IA 2YVUA 3DMDA 1SVKA 2JIZD 2O8EB 4HAYA 5FBWB 2H16A 1JPNA 1QDEA 4I99A 4LCBA 4Y0AA 4XJXA 3GLFB 1EESA 4IOLA 1XTKA 4H1VA 3N5CA 2YWEA 1UADA 3PUZA 3I92A 2IYXA 3ADKA 4ESVA 2IUTA 2G77B 1NVUQ 4M1MA 1FMLA 1M34E 5P21A 4AK9A 1P2SA 3ZVNA 3U7EB 1ZM2A 3NHBA 3MD0A 1RYHA 4DWJA 1Z0AA 2PT7A 4NL4H 1J8MF 2ASEA 3OIVA 3U4QB 4QM6A 1NNEA 2X1VA 4M22A 5JFGA 2OAQ1 4D80A 3AVUA 1CF4A 2GXUA 2A78A 1ESNA 2KWIA 3TVDA 4RFSA 3EW9A 3TUZC 1MRNA 4NMMA 4HATA 3LA6A 3DEFA 1YKSA 2QMHA 5BN4A 1G7TA 4Q7LA 2ATXA 3CPEA 3GJ6A 1V5WA 2O0JA 1W49A 2X2EA 2IYQA 1WQ1R 1XFAA 3REGA 2Z43A 2ZRMA 3QPVA 1BYUA 3K0FA 3VU9B 1KHTA 2BJWA 4PAQA 2ODBA 2ZR9A 3VHLB 2BMFA 3DZ8A 2ZEJA 2F1JA 1VG0B 4RD6A 1ZNZA 4M9ZA 2P5TB 1CR4A 2GCPA 2FX3A 4OI4A 4B76A 1FQKA 1CLUA 3U2QA 3JZAA 1G19A 1U81A 4JYCA 3BH6A 1Q0UA 1Q21A 4A8JA 5JECA 5FTLA 3CKLA 2L0XA 4DLSA 1WXQA 1WB9A 4OK3A 3L82B 4BZPA 2XZPA 1HY3A 2IXFA 4MQBA 3C16C 5FL7A 1AQYA 4LSGA 3A1WA 5C4GB 2IT1A 4I81A 4UKDA 2ZJ5A 1W2HA 4XVUA 2XTMA 1NLFA 3IILA 1ANKA 2PCLA 1MO4A 4RD2A 4E5UA 3B60A 3KXLA 3EZ7A 2OCYC 5TXGA 1BOFA 3KQHA 4Q66C 4RFVA 2XXAB 1N5JA 1ETUA 1KO5A 4TTRA 2GDJA 3VNVA 2VHQA 4RKEA 1UPTA 3S1AB 1L4UA 2WOJA 3BORA 4U5XA 4DLVA 2OBMA 1QVRA 1VPLA 2J41A 1P9NA 3MWKA 3M4YA 3FKSA 4QM7A 1NSFA 4KI0A 1TQ2A 4IOKA 3ZLJA 5HE9A 3AUXA 2IYTA 3ONWA 4Z1MA 1E0KA 2DBYA 3A1UA 3BH7A 4WIAA 1H8ED 3LNCA 3GLGE 1NMZA 4Q4JA 4KVAA 4G5OA 1YRBA 5DISB 3T5GA
chains in the Genus database with same CATH superfamily
2D4HA 2GEKA 4Q4CA 3SYKA 5BO5A 4Y9SA 1R16A 2XNSA 2XJ4A 4NEGA 4C22A 4LMBA 2QLMA 3IB6A 1KYXA 2RHCA 3X2EA 1FMTA 3GLGA 3KWMA 2IUUA 4U8HA 5MHTA 4ZO9A 2CXRA 3WMEA 1OGYA 4B71A 2V6GA 3MB5A 4ND1A 2YXEA 1QSGA 4ZAGA 2ETXA 4HFJA 4Y8VA 2WK1A 4XSHA 4HNRA 3U56A 2QR3A 1L7VC 4NQRA 3C6MA 1QFJA 1T2FA 3GLTA 5GIOE 2PU7A 3MQ4A 2DQ4A 2W6NA 2G9ZA 4MX8A 2YBEA 4R2XA 5SICE 3SHFA 4HDMA 1D04A 1ECLA 1IBRA 3JQEA 4RK7A 4G0VA 3B78A 3EVCA 5EZ5A 1FTNA 1IOLA 1FFBA 1SCDA 4KPUB 5DOZA 4ZU6X 4IHAA 4B83A 3E0QA 4QTXA 5G3ZA 5CURA 5U1PA 3V9AA 1N1EA 1E2IA 3C87A 4EENA 1J8VA 3IQHX 4NHEA 2FSGA 3IQWA 1JF8A 1CT9A 3KSRA 3UFBA 4HMPA 3UJ3X 4ZCIA 4Q3KA 2B3TA 2OD2A 4IJQA 3X1KA 3DLPX 2MYUA 2QZZA 4IJVA 3HLTA 4E0BA 2CFIA 4GR9A 2O50A 5EZ6B 1MUUA 1AT1A 3OIUA 4X64B 5B2FA 5BY2A 2H1LA 1JI0A 1O96A 3RS8A 1D0SA 1JIJA 2OXEA 1GL7A 3FWZA 2DMRA 4LDRA 4ZZ1A 3KAQA 2DBVO 4X65B 2ZWAA 2JCSA 2ZRFA 3DCIA 1E9EA 4P2BA 4M0PA 5G1OA 2GOYA 1ORWA 3EOAI 5AVXA 5JAMA 4MGZR 3TM5A 1TKBA 1L8XA 1VLQA 4RE5A 1CZRA 4BQPA 4XDZA 2X9NA 1R4AA 2KJQA 3K1JA 4PPNA 5J63A 3AHEA 3RHFA 4CKEB 5A02A 3ZCTA 1EINA 1XRPA 1KGDA 4MJ3A 2X2FA 1M6WA 2ZSIA 1EZ1A 2NAPA 2PS3A 3ZJYA 2P4QA 1XEXB 4HLUA 1RWBA 2GJ9A 3LWZA 3R5KA 2ZRLA 4TQAA 4RD3A 4LF9B 4OSOA 5DM60 2ZJOA 1BVHA 1DARA 3DL7A 3KR0A 5CU7A 5AJHA 3OKAA 3WMFA 4RW0A 5DYGA 2C7OA 1H1LB 5JE8A 4C5BA 1M8PA 1W47A 1QYVA 3AKDA 1EE9A 5K3FB 4GMXA 1CUZA 3M9LA 3QEMA 2HK6A 2WICA 1WBBA 1WOMA 2XKBA 5D1HA 3CZQA 3VR3A 1UK7A 5TLSA 1KOFA 2EGHA 2I4LA 5F33A 1SHKA 3NXSA 3WHKA 1B2RA 3PGKA 1IG0A 2Q8QA 2OWDA 1SG0A 4S0XA 4NMLA 4O33A 1R9NA 4F12A 3RRBA 1W85A 1QU2A 5J58A 1W88B 2PSEA 3CX7A 3FYDA 3IO5A 3Q5GA 4JI3B 2PZJA 4B75A 5JZSA 4R1OA 1SQFA 1JR3D 1PU2A 1OZGA 2Q7OE 3ELUA 3A6EA 5EHXA 3GFTA 5IT4A 5KVSA 3RSQA 1OD6A 5DSZA 2EV9A 4BVBA 2FZ5A 5LDDC 3H9QA 4MR8A 2HXGA 2A5YB 2OXFA 3FN4A 3I4FA 3OM8A 4KSCA 5FI0B 3VR3D 4RPIA 4DT1A 2Z8XA 1GVNB 2DLCX 4GPBA 4ABYA 1X15A 3QKTA 3AR3A 3BRSA 1ISRA 2Y27A 5CIWA 5DSTA 2BGIA 3ZE9A 1YD7A 4BFYA 4Q7MB 4DLBA 2UU9B 1N34B 3CBQA 3I5AA 3GCXA 1F1JA 1X1BA 1TZMA 5LIPA 3FLBA 3HKDB 1PTKA 1Z63A 4HAVA 4WUVA 1U7UA 3N59A 1TIBA 2W00A 2O1SA 4A0QA 4JQYA 2CLFB 2R87A 4O2AA 3ZHZA 5ITZA 1X7HA 4BAGA 4YLYA 2ISCA 1D09A 4EF6A 3BWXA 3E7WA 4PBTA 3Q8MA 3Q5EA 4CDRA 3PDCA 1OXTA 2QBYB 4QWWA 5H9VA 2IRWA 4TKVB 3THWA 4YRRA 1RQNA 3GH1A 3HCDA 3MIIA 1OLUB 1KERA 5FBQB 2AFIE 3OLYA 4BGUA 2FZGA 3K09C 4MEBA 1E3MA 1GFSA 4KH1A 2OGUA 2QLLA 1GUBA 2CN1A 3QGMA 4XYLA 2YRXA 1P1HA 3BXZA 2OFOA 2WJVA 1YFJA 2Z4RA 1E1QD 1C80A 3ZU3A 1S1MA 3HS3A 3IIKA 1DIBA 1NHWA 2VJKA 3FD8A 1KVQA 4IGIA 1MH9A 3V1UA 3WYAA 1E7RA 5JSYA 5CA1B 3GP3A 1VGVA 3WIBA 2ET6A 3RIHA 3MW8A 4BL5A 4CQNA 4O1MA 3IDSA 3OMXA 1CVRA 1VC2A 2CNLA 3GRYA 2RGEA 2Z58A 1FZQA 2J6CA 3TTTA 3ZDDA 4IGEA 1QJCA 4AZ3B 2PRSA 4A8HA 1DKQA 2I7XA 5CX1B 4Y2QA 1XIVA 1J70A 3AV3A 1AQJA 4M46A 1RJFA 1BE1A 2PX8A 4DJ5X 1NSYA 4FQ5A 1AMOA 1FSZA 5LSAA 5LL6P 3CSDA 3QLUA 3T5PA 2IHNA 1DAKA 1Y1LA 2P68A 3T5DA 3GAMA 1PEYA 1BRTA 2ZAIA 1NDQA 2C9MA 3O21A 3BFJA 5CDGA 1BDMA 4KJZA 1ISFA 5I6DA 3CKYA 1OAKA 3BWYA 4K87A 2R9VA 2G83A 4NLLA 1K5GA 3PXXA 1T4DA 3TVTA 5KTYA 5LJIA 5EJ6A 2IZ1A 2JJQA 2R1UA 1QF9A 4GP7A 1I7QB 1YRHA 2RK3A 5ALIA 4ZJZA 3JYNA 3CZAA 1EK2A 4PWZA 1JPJA 3OHSX 4MI9A 2OGZA 4OGLA 4YAIA 3OOHA 1A8HA 2PV0A 1X8KA 2XA1A 4CLXA 5SY6A 5HKOA 5AVQA 4MPPA 1QVAA 4NXMB 3EUAA 3AYXB 1XEFA 1MX1A 3KQPA 4DY4A 3GRZA 1YTUA 4ECAA 2ATVA 2XCSB 2DE0X 2JHGA 3ZXYA 2PMCA 1LPOA 2VSNA 3ZHTA 5EJ5A 2GD0A 3E1SA 4RC9A 1YRQA 2BFCB 2BI8A 3G8DA 4KKXB 4EKYA 4XW2A 4KITB 1CUBA 1BXGB 1P6UA 2ATCA 3SFTA 4RIIA 2XE4A 1AY0A 2XDQA 2R25B 1CZKA 1XPOA 2PO7A 3AETB 2AYYA 2UYHA 1J22A 4M6WA 2HEIA 5E6UA 3WK5A 1NQVA 4EYKA 3UW1A 4OK6A 3M6MD 3TLXA 2J9RA 1S96A 3O8NA 3HKBA 3NX4A 5EAIA 3CE9A 2ECOA 5AM2A 4F21A 1P33A 2REXB 2JD2A 2R85A 4QOIA 1TEZA 2C4TA 1US8B 5CB4F 5CCXA 1NMXA 1OBOA 2EFHB 3L6OO 4RA9A 1YU6A 5T64A 4RGYA 2M9MA 3FMGA 2ZU0C 5LQMA 3K5IA 3NV9A 1NURA 4DG8A 4A73A 3MBOA 4W6QA 3UYKA 3K4QA 3BQNB 3AHGA 3MB8A 2Q1XA 3ROZA 2JL1A 4F8YA 3RS5A 2F00A 4NJEA 1BH2A 2EGUA 4P4SB 5T6BA 1RAAA 2CL7X 4PQYA 2QTAA 1C50A 4LXXA 3EE6A 3SZUA 3ICQB 4KL8S 4ZO6A 5G41A 7REQB 3NBAA 3EVTA 4LYFA 1HFJA 2ZUWA 4FXOA 3LVQE 1JG2A 1R0RE 3L0ZA 5AJXA 5AJUA 3OZEA 4LY9A 2GJAA 1RPZA 1GEEA 3L8ZA 3U7QB 3UHAA 1MMFB 3T06B 1KARA 2DQKA 1X39A 2DKNA 1LQUA 1A71A 3FSJX 4J4BA 4RESA 2DTXA 4O3MA 3DMPA 1BWSA 3HYLA 3LBAA 4OFXA 1XMXA 1NE2A 2WSIA 3A8TA 3SIPA 3VZSA 2H5JA 4X91A 1RVV1 1LVGA 4UUBA 4REQA 1SK9A 4CW7A 4AULA 1KPGA 2QX9A 3CCBA 3ESXA 1P7YA 2COEA 1T9BA 1X7YB 3GAAA 1U7OA 3KPJA 1IEQA 4L0DA 4Y9UA 2ZYSA 3TJMA 2G25A 4LYYA 4MOWA 2VT3A 1H6AA 1K68A 1IVSA 3F5DA 1YIDA 1EIZA 1YL6A 5FNVB 1HTBA 1D2CA 1Q7BA 2HI0A 5AXDA 1KY5A 5TGTA 2YR0A 2G4VA 3P94A 1XSEA 1BE8A 3GR6A 2HV9A 1V9SA 1AK1A 3LHIA 1EYZA 4GOND 3W4JA 1TYDE 5CM2Z 3TOXA 1HNZB 1ZOPA 2GGSA 4KWEA 3FVRA 3MWDA 3OWOA 1TYEB 4XXHA 1PZFA 2Y2UA 1KZ4A 1MEJA 3RSSA 1W4CA 4D4MA 5E0KB 1U8TA 4YR9A 4YVFA 4UM7A 5IT5A 3PC7A 5CNKA 1HZJA 3L01A 1EXVA 1TD1A 1Z6AA 3MINB 3I2KA 2B34A 3AFHA 4AG6A 5KVVA 2JZOA 2Z98A 3WGTA 4OQLA 2CC2A 3C2QA 4A7PA 2WHPA 1JKFA 3AKZA 3DL2A 1NKSA 3LFUA 3OSUA 3IKLA 3KT3A 4GLFA 3SDSA 3WSTA 2R7KA 4B3IA 5C8XA 4EUSA 2EFCB 2Q5LA 2ZBPA 1YASA 5D7NA 2HYDA 4RTPA 5BXQC 4B2YA 5LYYA 1JLMA 4Q4HA 3ITDA 3AMVA 1EM6A 4HGPA 3S99A 1UC4B 3IXMA 1AKUA 4CF6A 4JB3A 3AVTA 5KJEA 3STYA 3H1PA 1EQ2A 4XGQA 3NEAA 2GBIA 2OHOA 4Y98A 1UKAA 5ALUA 2A8YA 1STOA 2R751 3BE4A 5JNVA 4EATA 5KTRA 2H2AA 3K71B 2OR3A 4BHTA 4ZGGA 3ZPXA 2ZJ1A 3Q7PA 4IGFA 4QRDA 3G85A 3UBTA 3EMDA 4U02A 4DA7A 1Q7GA 3A3PA 4UVGA 4ZZ2A 4MMYB 2OV8A 5JXJA 4UCXA 3D4PA 3IP7A 1F06A 1KSFX 3HLKA 3JV7A 3QLTA 1NJSA 2PZ8A 3W5VA 1C3EA 1EKXA 2A0FA 5EPUA 4TWAA 2F9FA 3D8SA 4IJMA 1NF3A 1WA5A 2WZDA 1KDYA 1XJQA 3B2QA 2CHGA 3LDHA 2EWVA 4QYIA 2BISA 3OWXA 4Q82A 4D3DA 5FOQA 4QU9A 3G2KA 2H3HA 2O7QA 3W6PA 4F1WA 1V4NA 3IJEB 4J0IA 1NWHA 1ZNQO 1XNQB 5TC4A 1L2TA 2BF7A 5EI5A 1NXOA 1NIJA 4M2LA 1U0SY 2JCYA 4IUYA 1NVVR 2Z2JA 4NZMA 5DN6A 2PN1A 3EEQA 5AOAA 2NAFA 3G7SA 3QVWA 4H3SA 2KS6A 2Y0CA 3SX2A 1PG0A 3VNUA 4Z0PA 3WKEA 2AUMA 1WE2A 4LBWA 1EFLA 5J4YA 3Q7IA 1CQIA 4JMLA 5K8CA 3WYNA 1XKLA 4JDPA 5IJ0B 3UUGA 4F3CA 4OATA 1Q7RA 3ILXA 2H63A 4MUHA 1A5ZA 5ES4B 1KPHA 3BXFA 5B3JA 2IODA 5EWJA 1CFJA 3VC1A 3I04A 3UA4A 4NCNA 3QFTA 3GGCA 2JFZA 1E9CA 1YDHA 1K6MA 3DMGA 4ZODA 2L19A 4ENRA 1K5PA 1NXXA 3ORSA 2KB0A 4KXMA 2FWRA 3HJAA 3QPBA 2IYSA 2DR2A 2WPDD 5KREA 5IDXA 2OBLA 4L74A 3NVKI 2QRHA 1GN8A 3G1WA 3HU3A 2V7WA 4AQ7A 1G2IA 3K9NA 1CUJA 2XWJI 4MWDA 3KVOA 4TSFA 5K3BA 3E22B 2PLRA 1U2GC 3KKEA 4MW1A 3VHXB 5JZVA 5KWEA 2RHMA 1ECFA 2FN9A 3W3AA 3IOYA 1IZZA 3CWZA 4NH4A 3PNOA 5J5VA 1AZWA 4NV1A 1WETA 3RVKA 4XWAA 5CFQA 1T2EA 3IELA 4FD3A 4JB2A 3T1NA 1NRJB 1ZBQA 1UT8A 3ICOA 1JTEA 4O29A 4BJ6A 5BUSA 3WV4A 3VXKA 2VPTA 2BPOA 5FXMA 4ZICA 1EEXB 4BV8A 1HT1E 1QB7A 3TOZA 1JVNA 1VSQA 1RADA 5F5XA 4J1TA 2V7QA 4JU8A 1GG8A 4O2AF 3ESCA 4R01A 4TSFD 3OHMA 4E12A 4Z4IA 1O6CA 2GTPA 3I12A 1R4ZA 1S2MA 3W3AD 4AX8A 1E2FA 2YC4C 3D7KA 2I2XB 4WZAA 1ZD4A 2VT7A 2OV6A 4HVTA 5BSEA 2OLJA 2Y93A 4W99A 5AKXA 1JKJA 3NCHA 1YJQA 4Y1RA 1DFGA 1RXEA 2XUDA 4FX5A 4UUAA 1V35A 4NYJR 5DHSA 3QM1A 3UG7A 1DV1A 4DCCA 3F90A 2RGNA 5EIWA 1PJZA 4XJTA 2OO3A 1T35A 1N1DA 1LVHA 4PYJA 4DILA 3FVTA 3AOEC 2QYOA 3FYUA 5DYNA 2HA6A 3TO5A 3F9RA 4B44A 4DXAA 3BGIA 3SYLA 1A76A 2IYLD 2IV7A 2RK4A 5BVHA 1NN5A 1SUIA 1ONSA 3FB4A 4B43A 5F7XA 3SEFA 1R88A 4WNAA 3TZLA 2R4TA 3U6BA 4WLEA 3RK1A 2CUKA 3G5TA 2IH2A 1XNGA 4C0JA 2FTKE 2ACVA 3ROGA 5LP6A 1NVTA 2R8OA 1QYWA 2E0IA 2Y1FA 3EQ7A 4OJNA 2COKA 5DBEX 4BVKA 1QO0D 3IVMA 5T41A 2CV0A 2VT2A 4FN5A 4JJEA 3DDCA 1O97C 2EXXA 3NONA 3ABSB 3TX2A 3TQTA 3DVAA 1FMFA 2XEXA 4FZRA 4MAFA 3RIXA 2PXHA 5KHAA 4B09A 2G6TA 3ETNA 3EIFA 4J6EA 1PJAA 4G1UC 1N7IA 4R9UC 1IPHA 3RAFC 3BX1A 3DD5A 2N1MA 4YJKA 2CLKB 2CLOB 2EF0A 4QXQA 1DBSA 1H4VB 1KL7A 4LPSA 1W35A 4LX8A 4MKIA 4AUEA 1QUEA 1RMTA 2CGEA 1YS2X 1EDEA 4U7DA 3MERA 5I4KA 4J7CA 1OB2A 1I80A 4TLLB 1JG4A 4FFVA 2BR3A 4LYJA 1SBYA 5IH3A 2ZI9A 4A8JB 4F4JA 2H9IA 4D8XA 2I3GA 4CEJA 5LMCA 3RVQA 5HF9A 5E7MA 2B21A 4JGBA 1ZR2A 2V96A 3TW8B 3UAGA 1N2SA 4RPKA 2I4OA 4BNMA 3K9FC 4E5NA 1I33A 1K0FA 1U9IA 2OC9A 4BN5A 4OLBA 3LX8A 5LVAA 2GRUA 3FIUA 5IJXA 2ZIUB 4GC9A 3ZX5A 1UZNA 1G291 3DP9A 2FR1A 2LCIA 4HYYA 3R09A 3ZN2A 3R5SA 1NTOA 1VKOA 4J90A 2P3LA 4WZ6A 2FSHA 3OTQA 5E3HA 1WUIS 5IRCD 1N5LA 3DZDA 4WY2A 1A8IA 2QDXA 3R6TA 4QGHA 4HFMA 4GI3A 3TMAA 4BNXA 4DR3B 4FMDF 1LPBB 2C1XA 4B34A 2BM0A 2XAAA 5KYUB 4B0PA 4B3CA 4M1ZA 5FP0A 4MYRA 3LV8A 3SBEA 2VUIB 3M5WA 4BNGA 1J97A 3OCCA 3PL1A 4LJKA 4BNNA 3BWBA 2C2WA 1XNHA 2PRKA 4F4UA 5AUOB 1HURA 1RCTE 4LZNA 2PAAA 2PL1A 1BCRA 2GN0A 3F8WA 1FP2A 3VA7A 1BGWA 2VTBA 4EIWA 4XM1A 4JYPA 3UWOA 1ZR4A 4GAEA 4PBSA 3PDJA 2ZCJA 1FW6A 1UAGA 3ZD6A 4ZMSA 1NPTO 5F77A 3B2NA 3M5CA 4Q3NA 5CPBA 3ZH9B 5AVKA 5BOSB 2ZJFA 2YOFA 3AEQB 2Y4OA 3WRYC 3EBOA 3WJ2A 3HBFA 2AX4A 2Q1SA 2CLLB 2ZITA 4LWQA 5HF5A 2BIFA 1C8VB 5HOEA 4C0KA 5EHZA 3EIHA 1IEWA 1Q84A 2LZ0A 4AY6A 5KZMB 2ZETA 5EEGA 1I3CA 4LE2A 4BMZA 2I8CA 5F9HA 1J0DA 1H0RA 4R7GA 2AQ8A 2PUGA 4PPFA 6Q21A 4GC5A 4N4AA 2C5FA 1TW3A 3CLRC 3Q11A 4O08A 4PC6A 2AF3C 1J07A 3L9XA 3NTXA 4ZQHA 1CUYA 4H6XA 3JWIA 1SUDA 2OMEA 1TJNA 3TR0A 2WBLC 3RUPA 4M87A 1X7WA 4G86A 1N6HA 1O95A 3WQSB 1GLGA 4YMGA 3HEBA 1KKLA 3Q9UA 1LV7A 4B40A 5ADVA 5JI2E 4QOHA 4G0UA 3DV9A 1JIVA 3HN6A 1P6XA 3HXKA 4I4TA 3BMXA 3AV0B 5DTEA 4C14A 1A5SB 5ICMA 5JV5A 5BPFA 3J81A 1P9OA 3BEOA 3DT8A 4IQFA 2EKQA 2XVAA 1YWGO 4L5JA 3M6FA 1KH3A 1O9GA 1ODCA 4KVGA 4WZBA 1OI3A 1D1SA 1N0IA 2JGMA 2PGDA 1M9NA 4UHDA 5BUCA 3W5AA 2H7XA 1QYIA 2AVNA 1RTTA 4I9HA 5F2OA 5DASA 3L9WA 3PPVA 2OBNA 1OLXA 2X7JA 1C8LA 3PIDA 2C9DA 1Q19A 2W6PA 3SXPA 4E09A 3W5DA 1IEVA 4M0FA 1LDBA 4DKXA 1O95D 5I8ZA 1NPDA 1R0WA 3H8JA 2IIQA 4TZ0A 4Q21A 5AKJA 1DG1G 2O5VA 5TRTA 1IHUA 3CUSA 4PG4A 3TMYA 2HIAA 2BKUA 4EHDA 2RIRA 4KOEC 2HR1A 1Z4PX 1U2DA 4YMLA 3TTXA 1NDUA 5FWXB 1FP1D 4WLFA 5G2OA 4OOFA 4C6SA 4DVJA 4M0CA 4X0EA 1OBVA 1EFCA 1IM5A 1OVGA 2CJWA 5FUBA 1G2QA 2EX0A 2GBGA 3SI7A 3ELWA 3HJTA 1P2BA 3NBYC 2H1VA 1ZW6A 4E32A 4CMJA 3AR8A 5DGIA 2HJ9A 3BGDA 5ER6A 2O19A 3FGPA 3PFFA 3W7VA 1VHJA 2IYUA 2GZAA 2C9CA 1PKEA 4K9NA 2CVFA 4D0LB 3MMZA 3A58B 4JVSB 4PF1A 4LF7B 3TUJC 1K7FB 4TLBA 1ZHFA 1ZUNA 2FUCA 1PFWA 4U2KA 4X7PA 1CERA 2Q46A 4JOBA 4AT1A 2W4IA 5CFRA 1A2KC 3DMFA 4IRXA 1DKMA 1FYVA 4IDFA 4R69A 1K9SA 3SJBA 2CF5A 5KNBD 3TTSA 3AVOA 2GBLC 3ROTA 3ROQA 4YJGA 4YDHB 2WV9A 5DTMA 3JQAB 4Z54A 2PZBA 4WNIA 1CEQA 4QAJA 2PPVA 3TZBA 4CMCA 3AC0A 4TVBA 1KZ9A 1G3UA 1H85A 4DBLC 1FB5A 2F64A 1L6IA 2UVPA 3NXKA 4IGAA 3RFVA 4RULA 2ZZMA 2H11A 1T1JA 4N0MA 3QFSA 2WWFA 3VZRA 1MC8A 2OILA 2VXBA 3E3MA 3HB4X 5D3ZA 5K0NA 1H6BA 1VIYA 4DHEA 2OB2A 2XGMA 1XRRA 3L79A 4DNXA 4PTLA 2CXSA 1EG7A 3O4RA 1QRUA 4P54A 5SZJA 1PGJA 3HCEA 1PJ2A 1TM1E 2Q4TA 1SXJD 2JKYA 3FGNA 4A2CA 5HUJA 2QPLA 3AO0B 3TI7A 4ACBA 3DZJA 3X2FA 5I01A 4KLNA 2VDWA 4CFZA 1WUHS 1QHNA 3TTYA 1C3OA 1P29A 1PG2A 1W9MA 2ZRPA 3UB2A 2XMBA 4QYMA 3GZTB 4ARZB 3FGOA 2C9YA 3SICE 2JD0A 3DAFA 5AW8A 4YN3A 2O8DB 3LCVB 2R6HA 3TRFA 3EQ6A 1AA9A 4QJ4A 4X63A 3W2EA 4CIAA 3F3SA 3LDAA 1NG9A 1PFQA 3ZWXA 2O8BB 2ECPA 2HJWA 1CQXA 1NC1A 3AR6A 1HNWB 2P35A 4R05A 3RUIA 1N8KA 3CRQA 3EG9B 3WRXA 3DXFA 1OYYA 2OQIA 3NNNA 1GRCA 2BHTA 2IHJA 2P40A 4FS8A 4GLOA 3S2ZA 3MQFA 3QUTA 3E18A 4UVDA 5JRZA 5JU6A 2ZJ8A 4DCVA 3BK2A 4KRXA 5F3WB 5KNDD 4YCNA 2YFKA 2YHUA 1L7OA 3N2ZB 2FSIA 1DQRA 1IPFA 4OGGA 3ZS9A 1QTQA 2F67A 4MEAA 1YA6A 5U9CA 1X2BA 3E84A 4G01B 4BPBA 1A2OA 2A0KA 3UXYA 4N5LA 4AJPA 3ID6C 2Y0DA 4D99A 4OOEA 2BEUB 1DEXA 2JDIA 1E7WA 4KN9S 3UUFA 1E5TA 3QYAA 5FYDA 4L1KA 1WNTA 4DWWA 1C7QA 4HT3B 4GX5A 1FXUA 4RA6B 5JY6A 1DOZA 4ZAFA 5TV2A 4KNWA 2HT1A 2B5WA 1TM3E 1K0UA 1XAHA 3PXGA 4B5KA 4MV7A 4AJLA 1Z5PA 3EVBA 3GEDA 4RCZA 3N2GB 4RIFA 4EKGA 4K9QA 5J9FA 3JQ9A 5JZ9A 5DOVA 4PLYA 4GGMX 5F78A 1XHFA 3DCJA 3HI6A 1K63A 1XK6A 1F6BA 1NN0A 1V7QA 3P0HA 1R5NA 4G5YA 3UANA 3WNZA 1Z47A 4GR5A 3WRVA 4IO0A 4CT5A 3DOJA 1DJLA 4RSRA 1T8WA 4QTTB 1L8OA 4BEJA 5FUMA 3T0IA 1HYHA 3L0OA 1N0VC 4PPQA 5LMZA 1GZ3A 3FZEA 4HGOA 1G0NA 1UBUS 4J76A 1U7TA 1XTVA 1XCGB 2ADFA 1WAMA 1XZHA 5JNRA 5HEKA 1S8OA 3JS5A 4WVFA 4D98A 1YB7A 2F3RA 3HJNA 4W1RA 5IARA 4IIXA 3ZW7A 3GT4A 3GQVA 5BOVA 2Q8NA 5JD4A 1HL3A 2ECKA 2W2MA 3BKXA 1FFWA 2AXEA 1X9GA 3W5BA 2L17A 1OFUX 4MROA 2C9BA 2HLDD 5CK4A 2GM4A 1YONA 1RE0A 1DDOA 5EYPA 3VDRA 1ZBDA 2I66A 1J8FA 5LP6F 4UEWA 1T2AA 4XYGA 5HJ2A 2QVCA 3AJ9A 3KYDA 4KH0A 5J23A 2AG0A 2LUOA 2YMMA 1QOZA 1CQJB 2H29A 1BE0A 3CRZA 3PENA 4LJSA 1BO6A 3HCNA 3L0DA 2IFTA 2OTCA 1ZXXA 3PCTA 1ZI6A 821PA 5ENZA 1BXRA 2R5NA 3LLCA 3VH1A 5HW0A 1VJTA 3FBWA 4JJKA 3T9EA 1UF9A 1MT0A 5A1JA 3CONA 1WKVA 2H1HA 1ELOA 2A94A 4JLOA 3HL0A 4HQLA 1MABB 1LW7A 1JFFB 2VRWA 3QU7A 5KBYA 4F6RA 4H1TA 5EEHA 1F17A 1RLJA 4G6ZA 1T8PA 1ZIOA 3EEYA 5TDHA 1BMFA 3RCBA 1GCUA 1HG1A 2EQBA 3THYA 3DEZA 1K8XB 1H65A 1B43A 5I7SA 1BMTA 4G97A 1L6RA 2BLNA 2P4HX 3QYFA 2JAXA 4JA0A 1X9HA 3NBQA 1NUAA 3FJ1A 5AKEA 1Y3BE 5K2OA 5KCMA 2EIHA 1EWYA 2PHZA 2DFNA 1T2CA 1KZ6A 2ZSKA 1P7PA 2VDKB 3H7IA 4I50A 1N6NA 2EKBA 4V0RA 1YZQA 2YZ2A 2Q6VA 3VBCA 3OTGA 3H97A 5C8YB 2XD4A 4IX9A 3PDUA 1I5OA 2NU9A 4MS4A 1Y34E 4ZQGA 2Y99A 4PG6A 4N5DA 5KAMA 1BMFD 3TNDA 3BREA 4BYGA 4GRIA 3WG9A 1XZJA 3TBKA 1DUSA 4DCOA 4EB3A 1ZJ6A 3M9WA 5DNYB 5BWMA 1WZIA 1M6YA 2HJVA 3IGFA 5A4KA 5IN4A 2ZJ4A 3AY6A 1BEEA 3U13A 2QGFA 4AZWA 4DFDA 2ODTX 3OZAA 3DR3A 3O84A 3MCUA 4WN9B 3CRVA 1WVGA 1EFDN 2XUAA 4A5SA 3S4YA 3F7NA 3KD3A 5JCXA 2Z6UA 4JKYA 3D6HA 1MKYA 1NATA 3PNLA 1U7DA 2BFFA 4FYPA 2HWUA 4IO1A 4U0JA 3BB4A 3H87A 2ZIXA 5KDDA 3HYNA 1ZI8A 3IQDB 1XTRA 5JJCA 2VWHA 2ZTMA 3G1TA 4LZZA 5EC8A 4E2YA 4MUJA 1ZK0A 5IAOA 4TUYB 1SKBA 4J0EA 3VVMA 4E1AA 5DGTA 3N0RA 1SRRA 2P2DA 1HE1C 3HV2A 1AKMA 1CNFA 1MB4A 1WY5A 1M6HA 2VP0A 2YWRA 1AKQA 1X0XA 2F2TA 3E6AA 4OXQA 4YK7A 2G63A 4YYEA 4DIFA 3DC2A 3NHMA 3QUAA 4MEJA 4OYYA 2ZCUA 1JALA 4LGYA 5A04A 3R0QA 1Q1BA 2HSJA 4P4NA 3ZQKA 2GPWA 2G4CA 1FRFS 4JJZA 1SUFA 5AVVA 3WGMA 4IR7A 5CD9A 5EESA 1Z2OX 1SKYE 3JRXA 5BN5B 1IG3A 1LI4A 1UFRA 3RGGA 521PA 5EWMB 2BW0A 1GHTA 1D8TA 2UYYA 4EKIA 1W4ZA 4Y2HA 3OQOA 3QHAA 3QE4A 2JH8A 3LXRA 3BILA 4FHFA 1GTSA 1ZIDA 4BN0A 1LJ8A 2K7FA 1E1RA 2RFLA 1INLA 2VN8A 4I4TF 4LJ8A 1JZSA 1WDTA 2JH9A 5DB4A 4OX9B 3GJYA 2G72A 1Z2NX 2ZRDA 3AIIA 2QJWA 4E2XA 3QE0A 4D92A 5IWCA 3U26A 1YQGA 3PT9A 4CU2A 3NWOA 3RYHA 2DCUA 1PNQA 1W8IA 4BRSA 4LMRA 4P5DA 4DJJA 4HBGA 5D8DA 1J0EA 5J2UB 2F43B 3KZVA 4HEQA 5CYPA 2C4HA 2OUKA 2QN8A 4HHEA 2BZSA 3ERCA 1QUFA 4XB1A 2ZTHA 5I4IA 1NOKA 4D42A 2CCKA 1BOOA 1SCUA 3GCZA 3LUAA 2NQTA 4CMEA 3KSBC 3ZLUA 5KINB 4JL8A 3IUNA 1HFEL 3KR9A 1AE1A 4CG2A 2PKRA 2CFRA 2O05A 2CDBA 1UOQA 2ZRKA 4TQGA 3DFMA 4YAEA 1SXIA 3OA2A 1P2GA 3MXOA 5JZBA 5K6AA 2R7NA 1S2OA 1O6BA 2WVAA 3H5OA 3C74A 4E22A 4OQPA 3U17A 3U7JA 3FTDA 1E8NA 3RF6A 5JALA 4S05A 1WZCA 2JHCA 1LPMA 1P3DA 5I4BA 3Q7EA 1A8QA 1PDWA 2IC5A 4IWYA 1A5TA 3T12A 2ORVA 4RHEA 1GG5A 4YFYA 5DCYA 2KQUA 1DKPA 3EZNA 3LK6A 2JJ1A 4XGRA 3I01M 3X1WA 1BMDA 2VYFA 5TQ2A 1T3LA 4CEIB 4EJSC 1KZGB 1NVMB 3HU1A 2MSKA 1RM5A 1AQLA 5DF1A 1LZLA 3C3BA 3TSWA 2AEFA 5A4IS 1OKKA 4JC0A 5EWLA 2SCUB 3SX4A 1PI3A 2C99A 2ZI7A 1UMCA 2L18A 4ENTA 3UN1A 5B30A 2XUOA 3KTFA 1M67A 1DXYA 1N0UA 1UDAA 4X3PA 3NVAA 4BBPA 4DMHA 1XD9A 4N12A 3RH0A 4BKQA 2HU7A 4DV3B 4TLAA 5D87A 4D43A 2BDTA 4MUXA 1JEYB 4DC9A 2XUZA 2IPMA 1T6ZA 1SVUA 2H07A 3MRXA 3AW9A 1UUFA 2FQ1A 4B81A 3PQ7A 4PEVA 2JVIA 4QL3A 3TL6A 4KE8A 3WLTA 4I36A 3B6IA 4NESA 3LRTA 3JXEA 3DZIA 4NFYA 2QY6A 1OKKD 1O94A 1UANA 1RW4A 1W30A 2WT9A 4HTFB 2HMTA 4EEZA 5GWXA 2GHIA 3UJDA 3KQUA 2RAVA 1Z34A 1K75A 3I9MA 4NY1A 2Q5JA 1MAUA 2CW5A 1OZHA 4YT4A 1NFQA 1H42A 2FPGB 4YCDA 4A8JC 3GLHA 5C35A 3QKSB 1P7WA 3PQ4A 5JQWA 5D6OA 4KFSA 2B3DA 4R9NA 4B47A 3NIFB 1WB5A 4M38A 2HFKA 4TWZA 1J0XO 1QFSA 1VI2A 1VMAA 3IP3A 3B6JA 5CXXA 1V5FA 2B1GA 3QWAA 3RRNA 4EF5A 3Q7TA 4MP8A 3R7NA 3T4XA 5F2NA 3AFMA 3AW8A 1O94D 2I54A 3FRIA 2QTTA 4WMLA 2GM5A 2EJCA 2ZWOA 5FA8A 4JHXA 5KDOA 1E32A 1OMOA 3I3SR 3E3AA 3TQFA 3ZGYA 3L8MA 1TIKA 1KO8A 5AOVA 2VTVA 3J7TA 5CFOA 1P9WA 4KYVA 6REQB 2JBHA 1OT5A 3UT0A 4QUHA 3EOBI 4AWXA 2NMVA 1YRYE 4BVEA 3DLHA 3UM9A 4R5HA 3RK0A 1CETA 4BO4A 2H7YA 5DBFA 1PVVA 1CDDA 2IWHA 3GFOA 1M1NA 1AUOA 3T94A 1R0KA 4M0KA 1HYGA 4QRIA 1RTKA 4YMUA 3EY9A 4P33A 2CE2X 4PRYA 4RH3A 4KQIA 4FOOA 5BVGA 2PEZA 4EYEA 1MOQA 2B1JA 1Z6ZA 4JLNA 3KUCA 5IFLA 2VDRB 2Z5VA 4Y1GA 3ZXUB 2OVFA 1ZDMA 3HU2A 3OP1A 2CJPA 3N6VA 1K7YA 1J9ZA 5AHKA 4EPWA 4QNRA 3HTXA 3QVGB 2PRYA 2A7QA 1HPLA 3FPFA 5BUQA 2MR6A 1ZD8A 3CEPB 3T1YB 1XF9A 5DKFA 3OE7A 1RKUA 1Y4ZA 4OHWA 1ESDA 3RYCB 3ZWCA 2NWQA 4NBVA 3U49A 4FWIB 4IX1A 3UY4A 3W78A 4EL5A 2NTYC 1DBRA 4Q9HA 2VR1A 1ZJ5A 2OV3A 2QTVB 4JYMA 4BX8A 1HDOA 1W96A 3NEPX 3QBTA 3UVEA 5JT1A 4IH4A 3TH5A 2X6RA 4BKPA 4LQCA 5K0ZA 3IUQA 1J56A 4HQFA 3RWMB 3AL2A 4JSTA 1HDXA 1MIOA 1Z8DA 2WJWA 5JCOA 5C51B 1JG6A 3R3WA 2BEWA 1ODIA 2DBQA 4PCUA 4E46A 1PZHA 4MO2A 4MV3A 4PZZA 4KBFA 3QEJA 4MHTA 1OFIA 4P3OA 4HSGA 5DDIP 3JRWA 1RLOA 3OE7D 4HQ6A 1TAHA 4QE3A 1MXFA 4ZTBA 3BFXA 1R8JA 3MCWA 3DB1A 3GA7A 3KUDA 5E38A 3VH4A 4KQJA 3WHLA 4TMTA 3SGLA 3GJZA 4BTVA 1ZINA 3LPLA 3WGOA 1RYMA 3BWDD 1DAGA 5FAKA 3MLBA 1E9DA 1Y9JA 2RH8A 2DY0A 2EHDA 1SC9A 4YCLA 1AS3A 1DUVG 1FY2A 3MWGA 4OGWA 4BECA 5A5EA 2P2ZA 3QU4A 4TKUB 5A9TA 5EUBA 4US1R 2ZE7A 2QG4A 1TADA 4ASUA 1KI9A 2CHUA 5BVHB 3AF3A 5E9AA 2V3CC 3ZVLA 1S3GA 2XA2A 1YE5A 3NJ4A 3WXBA 1DSSG 4LYAA 3KSDO 4UBMA 1V2HE 2EBHX 3QTTA 4RPLA 2FE1A 4F5WA 3D3NA 1WZEA 4EDFA 5AI6A 1SFRA 3G8AA 4V02A 1IQRA 1Y5NA 3HCWA 4JNCA 3RFFA 3BTSA 2I71A 1HQCA 3C4VA 4C4TA 3I6ZA 4L8YA 5C8ZA 5LUAA 1FYXA 2HRQA 1BU5A 4KN8A 3BVPA 4ASUD 1YUNA 2B94A 3CLUC 3KJEA 4FX2A 1DQYA 2X5KO 1MO3A 1FDWA 2NXWA 3DM9B 4HV4A 4Z4CA 3AHIA 4ZIRB 3D7NA 5E7JA 3RAGA 1AURA 5J4VA 3S2SA 1F2TA 4K88A 2AUNA 4I50F 3EMVA 3CF4A 4DRXA 4AZSA 1W2WB 4Q6WA 3RVMA 4C0SA 3AB7A 4N48A 5K0FA 2EYUA 2OWEA 3AL0C 2JCXA 4BE4A 4HN2A 5GZ3A 2NW6A 2W11A 4HRAA 3Q3GE 5JPDA 3FWNA 1CEYA 3I39X 5IG2A 5ALQA 1VSBA 1NJ6A 1QH8A 3PUVA 4RY8A 3OIDA 1L5HA 4BX2A 1SUPA 2QTNA 2X15A 1E5VA 3GA5A