2UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
total genus 71
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ukdA00
2XITA 2G0TA 5ELXA 3AKYA 2A5YB 1RJ9A 2BJWA 1G4UR 2O8DA 1Y63A 3IBGA 3U3KA 3GJ7A 2NO0A 4A6XA 2XZOA 4NBSA 3RVBA 4I1OA 1KO1A 1VG1A 5FOSA 1N6KA 2J0VA 3GD7A 2F3RA 4QBIA 2O8BB 4KSBA 1Q1ZA 4B3CA 1H8EA 1WBDA 5F9FA 2GEDA 5CM9C 1F2TB 1CR4A 4TL9A 4TQAA 1MO6A 1G7TA 3KKNA 5E7JA 4PQYA 1G3RA 1PV4A 2R6FA 1IN8A 3B9QA 3BS4A 3U44B 5KPDA 1DBSA 1O87A 4ASUD 4HDCA 2E87A 1CIPA 1GKIA 1X6VA 4F91B 4J0QA 2ZRKA 3K53A 3SR0A 4QXAA 2WKRA 1FL9A 3K9GA 4DVGA 2CCGA 4DDTA 2QZ4A 4Q03A 3IKJA 4PSAA 2QAGC 1YZKA 3KDSE 1IXSB 5DI9A 2ZYUX 4IOMA 4BLSA 1RRGA 2VBCA 3U3JA 4B3FX 5TXGA 4AKGA 1XTQA 1A82A 1DELA 2R6GA 2ZRMA 4W7SA 4ERNA 4TWZA 5FPYA 1H8ED 1VCOA 3QXJA 3ICQB 1QHYA 3LW8A 1E3MA 1NSTA 4JZKA 4P4SB 2YV5A 3E1SA 1TF2A 2QEQA 3IIJA 4P3YA 2ONJA 3ZGXA 3ZLJA 4B2PA 1S4QA 2C5LA 3X1XA 2O8EA 1D2MA 3SQWA 3K0CC 4QFMA 5F98A 5DHAA 3B8HA 3OE7D 5KNBA 1W5TA 3OAAD 4IDPA 4B44A 1FMJA 3RRZA 3BERA 2PL3A 1KI7A 5FPHA 3VKHA 2FN4A 4GP6A 3KJGA 2CDNA 1FZQA 1VCMA 3TGPA 1FUUA 1ZP6A 2NO6A 2ZI6A 2X2FA 4RJLA 4QHYA 2JLVA 3DM9B 4H1VA 3EWAA 1RIFA 1W48A 3MSXA 1VCIA 1S1MA 4G01B 1XPUA 5KSOA 1UF9A 2QSZA 3BC1A 1QVRA 2QTFA 5J40A 1CBUA 1T8TA 2CBZA 4DKXA 2FZLA 1KY3A 1DADA 3T1VA 4O2RA 1ZCBA 1UKYA 2C98A 1MABA 4D26A 4ZDKA 3GLGA 3CLVA 4B35A 1CXZA 1MT0A 2NPFA 3U6KA 4A2QA 3GFOA 5KTYA 3WHLA 5AR1A 2DWOA 2FGKA 2RGGA 3LQRA 3FYHA 2Q3MA 2WKPA 2FG5A 3GEEA 2HXYA 3M0EA 2ZI9A 2QBYB 1OXXK 2JLRA 3CR8A 3NG1A 4KAXA 4E09A 4UNRA 2QP9X 3THXB 2ZVQX 4V03A 1DAFA 4EFLA 5H1YA 4DCSA 1Q1QA 3CH5A 2AR7A 2NG1A 4AC9A 4DHEA 1E2GA 3VKGA 4G5GA 4HAUA 1ZM2A 1E6CA 1FQJA 2CL0X 1T6NA 4ZPXA 1GM5A 1KHTA 4HYYA 2GJ9A 2CLSA 5G53C 5L3SB 2IHYA 2J1LA 2OO7A 1K5DA 2H18A 1M8PA 4KBFA 3LVRE 3G82C 2QORA 4PFSA 1RRCA 1YZGA 4HAYA 5LB4A 1GUAA 2IYTA 4NL4H 5DISB 3GLFE 1WE2A 2GEVA 4FINA 2GAAA 1XTRA 5FR2A 4V0NA 3TSOA 3CPHA 2JJ2D 3TBKA 3QXHA 4KHZA 4KODA 4PAOA 2VP6A 2V4ZA 5C4GB 2QP4A 3ZVRA 1D9ZA 1TUIA 4GI7A 4C4PA 3S1AA 4X8MA 1JR3D 4JKYA 1LS6A 4S2EA 1DARA 1E2NA 4B6FA 1NF3A 4DSTA 1DPFA 1ESNA 1OYWA 2C2HA 4AG5A 3KQKA 4O25A 4OK3A 1JR3E 1XEWY 4NYMR 3SS8A 1G64A 2PBRA 1E32A 2QMOA 4WVFA 1D5CA 4C0JA 4QBHA 2GNOA 2RKOA 1OJLA 3VTKA 1XZQA 1BS1A 1ZM4A 5DH9A 1CTQA 3VFDA 3PUYA 5KPJA 1U9IA 2C78A 5FTJA 2F9MA 1F2TA 2AK3A 5JHHB 1M34E 1JPJA 4Q1AA 2OV2A 4XIGS 5KSZA 3DZDA 4PANA 3DL0A 3UIEA 2ZE7A 4YXWA 4A2PA 4A1FA 4PX9A 2P2LA 2DPXA 4CGZA 4D0GA 5BXQC 4GMDA 3A8TA 3NXSA 4U00A 3PCRB 5KHOC 4CT5A 3PVSA 3H86A 2Q3HA 1G8PA 3MLEA 3W3ZB 1EGAA 2ZPTX 3CNNA 3VNUA 2VA8A 3TNFA 1IJFA 1E0AA 4MYUA 4E07A 4MGIR 1KO5A 1ZW6A 2DCUA 3A1WA 1AGPA 2YC4C 3BB1A 821PA 4R2HA 2REBA 2D06A 3BB3A 4Q9HA 3T35A 2ZM5A 4B34A 3NVAA 1PUIA 5CITA 2GXSA 2J0UB 1H8HA 2GA8A 1E2KA 4LHWA 2BIFA 5EE3A 1EX6A 3SBEA 3SJCA 2F1RA 2OESA 1GZSA 5AJWA 3EZ9A 5CJ2A 3B82A 3W5JA 2EYQA 1VTKA 3LRPA 4GNKA 2ZUBA 2NOAA 3BH7A 2MSDB 4HEJA 1QG2A 4HUQA 4B71A 2QROA 1G7CA 4CIDA 5JWRA 2NGRA 3N2EA 1P9WA 2Z5FA 4URWR 1Z28A 3WNBA 2IEZA 4BFSA 4LYHA 2B7BA 2CL6X 3R7WB 1DO2A 5C46F 1DOAA 4LCBA 4YONB 4DT1A 4I4LA 1GRNA 3OEED 2ANBA 1R5OA 3LO5A 3DKPA 1E9SA 5KDOA 4NCJA 2DWQA 1VG0B 4KLZA 4O0MA 1UAAA 1R8SA 2ZI5A 1VMAA 3KJEA 5K8TA 3PENA 3FHTA 521PA 4KYUA 1FFHA 3TSWA 3LFUA 4BFWA 4JLNA 4KI0A 2ATVA 2ZTSA 4A8JC 2IX3A 3QNUA 3K9NA 5B64A 4JVSB 5J47A 2VIIA 1G6HA 3QXXA 2FV8A 4Q4JB 3WP0A 4PHHA 2NIPA 3ZZ0A 4YDHB 3B60A 4NYJQ 3A4NA 3SHFA 2FFHA 2PX3A 3THWA 1R0YA 4TMXA 3VR2A 4A2WA 2FEOA 3BK7A 3OIYA 3UMRA 4HLUC 2N42A 3MJRA 2OUKA 2VP0A 3A37A 3AQ4A 2FZ4A 3C14C 4OBEA 2F9LA 4EFMA 3S1AB 5TMPA 3SFVA 2FPMA 3TRFA 4TLDA 3UKDA 3X1ZA 3Q5EA 1E9FA 1FPMA 1Z6TA 5CK5A 2RHMA 5C1BA 5JRJA 1AM4D 1ZU5A 4YMWA 1KSGA 2MMCA 1G6OA 3A1VA 5AJZA 1Z0IA 3NC1C 3N2IA 2C9OA 4TMKA 1DS6A 2AWNA 4DWJA 2VP9A 1MH1A 4RFSB 5FPTA 5L3SA 3LLMA 1WMSA 3I92A 5FR1A 1B0UA 4IRUB 4NP6A 3AVYA 3GQBA 1C9KA 1KOFA 2YHSA 1BH2A 1TMKA 3TJZA 4H1UA 4DRZA 3I5YA 3TUJC 2J5XA 3GLIA 2VP2A 3REFA 5HCIA 1FMLA 1L7VC 1ZM3A 2P67A 2ZS7A 1UFQA 3IQXA 3VAAA 1SXJD 1BKDR 1QF9A 5CK4A 4BZQA 2WJGA 1J99A 4OYHA 2O8FA 2YYZA 1BMFD 1SKYE 1G20E 3FTQA 4LZZA 4MKFA 4LHVA 1SXJE 4R2IA 3TQCA 3WY9A 4EQ6B 3I1FA 1KKLA 4C0QC 1OF1A 1NI3A 3HYRA 4D4LA 3PJRA 2OCAA 1RRFA 1UKEA 3LXRA 3PR1A 3ONWA 1TUEA 1UKVY 1S1CA 3OAAA 4XH9B 3LA6A 2GVDC 1M74A 3C8UA 2FMXA 1E1RD 1Q22A 4YC7A 5A0FA 3U3MA 1OIWA 1DTSA 1R2QA 1Z08A 4ITRC 1Z8FA 1OXVA 2D7CA 3K09A 3GJ0A 1SXJA 3I62A 4JL5A 4DUGA 1EX7A 2E1RA 2IYZA 3PEVA 1AKYA 3BB4A 5C4MA 4P32A 2W6JA 1Q44A 1KAOA 1EFCA 4LUCA 3CIOA 5FL7A 1Q20A 3E70C 1QHXA 3W6NA 3LH5A 1UM8A 5FUWA 2R9VA 3EPKA 4W9MC 2ZRNA 5BN4A 2GCOB 2ZR7A 1XTSA 2UVQA 1ONBA 1VKJA 5GADl 3B9PA 4I1SA 2JJ8A 4YLGA 4BZXA 4GOJA 3AF4A 3DO6A 5SZIA 2WSMA 4HDQB 4HLUA 1SVLA 1GSIA 2CVHA 4Z8XA 5IF9A 1CLUA 4B2LA 2VSFA 2B21A 3KXLA 5EXSA 4PC3A 4DCTA 2P5TB 4FCWA 4Q7JB 3W90A 2WJHA 4DB4A 1E0KA 3PV0A 3KXIA 4WIAA 4JBYA 1HA3A 2ORIA 3L8ZA 4RD2A 4XSHA 3O47A 4FXPA 3VU9A 3VNVA 1NBME 2OHFA 3LV8A 4RZUA 1G1MA 2XOKD 1G5PA 1KK0A 5JMTA 2A78A 3KB1A 1NN5A 2ZAMA 2C8VA 3SJZA 3MG9A 4NCIA 3RS3A 3WYAA 2BBTA 4IFBA 1IM2A 4P4TA 3ETLA 1E94E 1TNDA 1ZUNB 2F43A 4Q1BA 1RYHA 3EIQA 3KQHA 2YWGA 3BE4A 1U90A 3CNOA 1N6NA 5B58C 1F2UA 4DZZA 4BFZA 2W00A 4F7WA 4CF7A 5KUTA 4E22A 3D6TB 2V7QA 1U0LA 5FI0B 4JVNA 4A36A 5EXXA 1JEDA 4HI0E 2WTUA 2PH1A 1IN7A 3NIBA 2QNRA 1CRPA 1AGRA 3LBHA 4GRAA 3ASZA 1X3SA 2XOKA 4M9SA 2B8WA 5JJLA 1MKYA 3ZDQA 1TQDA 3FMOB 2IXEA 5EJEA 4Q4AA 1OPXA 1Z0AA 2ZIAA 3A36A 3WMGA 4M1WA 1IAQA 1CKEA 3KKQA 5FBWB 2QMUA 2EWVA 2OAP1 2WWIA 5DGXA 1MRSA 1RZ3A 2Z43A 4JLKA 1XXHA 2QP3A 2D62A 2B8TA 2GWHA 4JMPA 4N1AA 4GZLA 4JT4A 5CLQA 1NN1A 5GVRA 4DLTA 2A9KA 3EASA 2OG2A 3FPAA 4LJ8A 3EPHA 2RGNA 4HLCA 2EWWA 4AG6A 2D74A 4Q9IA 3AB3A 4DLVA 3RSLA 3PQCA 1G7SA 2GXQA 5FL3A 1U0HC 2IUSA 4CEIB 2CVFA 1ZNWA 3B5JA 4LI0A 2KB0A 4F93B 4RFVA 1ZAKA 2LKDA 4I81A 5FBQB 2QN6A 2WMOB 3AUXA 1KK2A 3NBFA 4OHXA 4PC2A 4KYIB 2O0JA 4M1OA 3H4MA 4R71A 1D8TA 1N25A 4GOXA 3ZQJA 1NVUQ 3B1YA 3QBTA 1UDWA 5KDDA 2ZJYA 4MRNA 4URZR 3I8XA 2O8FB 2P5SA 3TVDA 3T1QA 4DLXA 3AP1A 3QY0A 2ZR9A 1TX4B 4JLJA 4LJYA 3BH6A 4FMBB 2DYKA 1OFTA 2AKYA 1OYYA 4PZZA 4QC2A 1VYUA 2OCYC 1OXSC 1QBKC 2GCPA 4V0ME 4C0BA 3VR5A 4CEHB 4CEJB 4MH0R 1JNYA 2WJIA 4DDUA 4TYYA 2ZSBA 1U81A 1QHIA 2QA5A 5B30A 4NZYA 4GSYA 5JJIA 5DHFA 3QIAA 5KSPA 4TMWA 2K5UA 4DXAA 1Z2CA 5AWFC 5EP2A 3TAUA 2BOVA 5B2ZA 4QM6A 5D3QA 5IT5A 1N0VC 2FFBA 6Q21A 3QVUA 2H5EA 1P4SA 4A0FA 3D8BA 2Z6VA 1R0ZA 4OK5A 1G19A 2QT0A 3QOFA 1G3UA 4QBFA 2V3CC 4HUTA 4XSGA 3DOFA 1XEXA 4UNSA 2KE5A 3B1ZA 1OIVA 3GJ6A 4TTQA 2CNWD 5JZVA 4EFNA 2ZSFA 4PHTA 1Z6GA 1ZM7A 2J3EA 2JA1A 4JT2A 2G83A 3HU2A 3K1JA 1HT2E 3VR1A 3C41J 4LGMA 1R0WA 3K0EA 3X1DA 5DE3A 4Z1MA 1F6BA 3V9PA 3LW7A 3VKWA 2IYXA 4EDHA 1EFUA 1E9BA 1U94A 2KJQA 2PEZA 3OIVA 3THOA 4RD3A 3HJNA 4B3BA 1KMQA 2IS6A 5F2EA 4G1UC 221PA 1GRQA 2AFHE 4B3DA 2R2AA 2VF8A 4M21A 4ZDIA 3GLFA 1NVWQ 4NMMA 5FTKA 5JI2E 1SVIA 2H92A 1SVSA 4Q4HB 1W36C 3VU9B 2OXCA 4Z54A 3IHLA 4L9SA 3DVLA 4PPFA 4FW9A 5DLQC 3BOSA 2ZYTX 3QKRA 2UZ3A 4HB4A 3F3YA 3IUYA 1OHHA 4Q4AB 4BRWA 4N3NA 2ZITA 1WDTA 2P6NA 3P32A 1II8B 3PUZA 1IONA 1ZD8A 2XZLA 3AV0B 3RWMB 4RD1A 1QHHB 3EZFA 2VEDA 4V0KA 1W0KD 4FD2A 4FMCF 4XTCS 4ZV4A 4MGYR 4B73A 3QQ5A 4LRWA 1NVVQ 1NJGA 2HYIC 2EU8A 2A30A 2WSSD 2R44A 2OLKA 3KFVA 1GILA 3DPUA 2PZGA 2OE2A 1Z6AA 5KO2A 2BM1A 3AF0A 2AFIE 2Y8EA 3EG5A 1BMFA 5GJVC 4IXMA 4A0GA 1CS4C 5HZHA 2YOGA 8OHMA 2QE7D 3CRW1 4GDFA 2QQ0A 3GJ8A 2UZIR 3T1TA 2JJ1A 1YHNA 2WAXA 1T5LA 3CF2A 3W3AA 1G5RA 3ADCA 2QU8A 3ZVMA 2NO9A 5JLJA 1OH5A 3QXSA 1UDXA 3KFXA 1CR2A 3RANA 1S2MA 2JCSA 3U4QA 3BAFA 5BWMA 3OFND 5D3MA 1A2KC 4FMDB 3AVTA 1LTQA 2CCKA 3GLHA 1G3QA 1CU1A 1TU3A 1X1RA 3BBPA 4HAXA 1YJ5A 4C30A 5K8UA 1JR3A 4KV9A 4WBSA 2P65A 1QVAA 1G5TA 2XSZD 1LV7A 3QKUA 4NCNA 3PXGA 3R7WA 4B3GA 5EQTA 4DLZA 2PJRA 3TLXA 1LVGA 3ZS8A 1OKKD 2OLJA 4BLOA 4JVMA 5AUQA 3RS0A 4BEBA 1IXZA 4TTPA 1OV4A 2D2FA 1IY1A 3SJAA 3WYGA 3X1WA 3CUEF 1ZMXA 3R8FA 2ZYVX 4IEIA 3ECCA 4JSYA 4DLSA 3GLHE 4C7OA 3HPRA 4H9GA 2C9CA 4JLAA 2A5DA 3RABA 3AVOA 1ZC3A 4G5SA 2B6HA 1GOTA 2FJUA 2G0NA 3B1VA 3MWKA 4MRVA 3VQTA 4JLDA 2WHXA 1GG2A 1N5KA 3RLFA 1FP7A 2XSZA 2GZDA 3I32A 1C1YA 1D2EA 3U44A 1Z0DA 1MO3A 2ZJOA 1BO6A 2YNMA 1XMVA 1WBBA 4DT1B 1P2SA 1UKZA 1RKBA 4LJ9A 4WA7A 4IXNA 4QGAA 2J45A 1UEIA 2F6RA 3EXAA 5CIWA 3W6OA 1X86B 3SC3A 4MDEA 1XB2A 5FTNA 4WAUA 1Q1BA 4M53A 1KZ7B 4OHWA 1KNXA 3RHFA 2OM2A 1T91A 3W9YA 4BFVA 4FN5A 4PO9A 1IXRC 4JL8A 4MGKR 5BN5A 3CO5A 2GETA 1YRBA 4TLEA 3U3OA 3VX4A 1FX0A 5HCNA 2LCFA 3VX3A 2ATXA 3AUYA 3TVTA 2W0MA 1KMHB 1OXTA 3R9IA 5JWOA 3AH8A 3UK6A 2N46A 4US2R 5C2JB 1Q57A 4KITB 2O8EB 4XOIA 2WPDA 4GT1A 1ZD1A 1IY2A 1PZNA 1T8UA 2GK7A 3SYKA 5IHPA 3Q7PA 4B75A 1NSFA 5FPKA 5FOVA 1Z07A 1AZTA 3ZD7A 3B13B 1P5ZB 2QRZA 3TIFA 2CHQA 1E1QA 2JLZA 5FOUA 1G18A 1XPRA 4TSFD 5KDLA 3LQQA 2ZRBA 3TH5A 1S3GA 4QGHA 1N0WA 3LBNA 5BN3A 2FF7A 3GJ5A 5AUOB 1AS3A 4V0MA 4FI3C 2PT7A 4DIDA 1E2QA 4ILEA 2QAGB 2PCJA 1AJEA 1XJQA 3W6PA 1KGDA 2QSYA 2Q21A 4F4CA 2FSHA 3U7GA 2FFAA 3NHAA 4BGDA 4Q48A 1KSFX 3NEJA 3GPLA 1P73A 1TL7C 3FB4A 2BC9A 4NU0A 4F38A 3EIEA 4QG7A 1ZU4A 4OI0A 2IL1A 1TQ4A 5E95A 3CH4B 2OBNA 2XTNA 1G8FA 3QKSA 4QL3A 3ADDA 1NVXQ 2IS1A 1E9DA 1W2GA 2FA9A 1DO0A 4LBYA 1YZNA 2ODWA 3AF2A 2WM9B 1N6PA 5EP1A 4ACAA 1MO4A 4ARZB 1VYVA 4P4SA 4PR0A 1AIPA 2D4HA 1QHSA 4DSNA 1UPTA 3IO3A 3FMFA 4XVUA 1PLJA 3BRWD 4DDVA 3T5DA 1U8AA 2VSXA 3WP1B 2JLQA 4TQ9A 1WB9A 2R62A 1M1YE 2HXSA 5HKKD 1PVOA 5G3YA 5J4LA 4KBGA 4DCVA 1Z0KA 1E4VA 4K8OA 3FMIA 2VHTA 1BYUA 1FOEB 4HLDA 4LX0A 3P4YA 1TAGA 2P6UA 2XJ4A 2JLXA 1AK2A 4HZUB 4R9UC 2VSOA 2CHGA 1TEVA 2WWFA 3FVQA 2JASA 2QY9A 3TUIC 1JI0A 2JAQA 1G4AE 1N5JA 3CF6R 3EZ7A 4LJ5A 3SBDA 1E79A 2IS2A 5JI3E 4UXHA 1NMYA 4B74A 1X8JA 2QGNA 4KFUA 5FBRB 3LX5A 3H2YA 3U7FB 1E79D 2QQEA 2NO1A 3K8YA 1CJTC 4KVAA 5HKKA 2VHJA 2J46A 3EIHA 3UWKA 5AUNB 1GVNB 2EW1A 1U8YA 4CRWB 1HYQA 3WNCA 2IWRA 4LY6A 2QT1A 5AJXA 3IPYA 4TL8A 4GP7A 3W5IA 1T0HB 5JECA 2NZJA 5EE1A 5F3WB 1FX0B 1NMZA 4DUGD 1G17A 2P6RA 3OF5A 4PSKA 3Q7QA 2X2EA 4QBGB 4FWIB 4OL0A 4Q7LA 2QPTA 4PXAA 1E2IA 2HLDA 2IYVA 1E9RA 4UJ3A 3FWYA 5BQ5A 1TF5A 3HPQA 3P27A 2CLDX 2WKQA 4IVQA 2CLCX 1NKSA 2ZJZA 5EXPA 3THXA 1JJVA 1XCGB 4A8JA 1II0A 2AK2A 3IO5A 1RW4A 4BFTA 4B43A 2BCGY 4DLYA 5EE0A 3CKLA 3IGFA 4AI6A 1YR6A 5JHGB 2BJVA 1NBMD 5J4VA 3U7EB 1RE0A 1KY2A 2XZPA 1RC8A 3DMDA 4MITA 4QGGA 1SKQA 3KJIA 4NCKA 2Z83A 2GAOA 3HR7A 1IJEA 4OJQA 2W6ID 3WRXC 1KDPA 4AKEA 1NBMA 4HATA 1OE0A 4DLUA 1CJVC 1EFRD 2XNDD 1VG8A 2XXAB 1U99A 3SNHA 4DB2A 4WZ6A 1EWQA 4PZLA 1R5BA 2A5GA 3HWSA 2OBLA 2J0UA 2V7QD 3CB4A 4RZXA 3OIWA 1VIAA 2W2TA 5HR5A 1FNNA 3Q72A 4TYWA 4PQFA 1E9EA 1LNZA 1Q1EA 3LLUA 2J87A 3CX8A 2ZJAA 5LD2B 3ASYA 2P3SA 4M1TA 2VRWA 2GF9A 5CB6A 5CIQA 2IWHA 5K8IA 1YZTA 2PLFA 3GLIB 3BIFA 3C7KA 4LC0A 1P6XA 1XMSA 4V02A 3AKDA 1G3IA 3SOPA 1E2FA 3A1SA 3THYA 1ZYUA 1RFLA 5FUVA 4QKQA 1P62B 2ZQ5A 1YE8A 1E0SA 1TTTA 4Z8YA 3NBYC 3T34A 1II9A 5LDDC 1Z22A 3B7GA 4Q5IA 2DFLA 4C2UA 3AKCA 2ZUDA 1ZIPA 4C9BA 2GK6A 3QF4A 2JDIA 4B48A 1W0JD 4LJ7A 2WBLC 4EPVA 3LVQE 3K0FB 1KI1A 5TV2A 2O8CA 3D7MA 4Q66C 1TQ6A 4D4JA 4G0NA 2JDID 2G3YA 2FH5B 5CYPA 3MMPA 1TQ2A 3PEWA 1XD2A 4MUAA 1S96A 3ND9A 3CZPA 1N6IA 1KJWA 5BYJA 3KQLA 2JATA 3W8RA 1KO7A 3GLIE 4CEJA 2WMNB 3CF0A 3LBIA 2GDJA 4YMUA 1JR6A 2FEMA 1SHKA 4IW3B 2PLRA 3SEAA 3VR4A 1VG9B 3RRNA 3TK1A 3WXMA 2CCJA 2ZE5A 5L8VA 1QHGA 2NZ8A 1RPZA 1ZVQA 421PA 2V9PA 3F8TA 4BFUA 4E5UA 1J7KA 2ZAOA 1W0JA 2PEYA 4LOAA 5GJBA 2AD5A 2I3BA 4XD7A 1GL6A 2X77A 4GFDA 4LJAA 4KFTA 1FTSA 2Q0HA 2VF7A 3GLFB 2BCJQ 2V6IA 4GOKA 5HZKA 3NBXX 1CULC 2GZAA 4PC1A 2HT6A 4LPSA 1T3SA 4TLBA 5DN6A 4LSGA 2H7VA 4LJ6A 5CB8A 3EPLA 3QKRB 3OEEA 2IYYA 4PPNA 2F7SA 2O52A 4A4DA 1GL7A 1KI6A 1ANKA 1GIAA 4QOSA 2O0KA 2LWIA 2BMJA 4PQRA 2DHRA 2YWEA 4KFSA 3FKQA 2C96A 1LY1A 3P26A 4M0LA 3L0IB 2DR3A 2WIBA 2GXUA 2GZHA 2OFXA 2O8DB 2G77B 2QTVB 4G5OA 1KI9A 3NH6A 3ZYCA 4BECA 1EFTA 1CR0A 1G9XA 2EVWX 4M22A 4OI4A 1XNJA 3P20A 3ZD6A 2HUPA 2FGJA 1MV5A 1QG4A 3TW8B 4GBMA 2VHCA 3QKTA 4TL6A 4RSGA 5IK2D 4GMXA 1KO4A 3DHWC 1W5SA 2QTHA 1YR9A 2WJVA 2ZRJA 3R9WA 1Z2AA 3WHKA 3C5HA 4ZKDA 2CNWA 3E5HA 1QHHA 1G8HA 1W46A 4LWZA 2PX0A 1WP9A 2GJKA 4OJKA 2AN9A 5KSYA 1SKYB 4A6PA 2JLUA 3R20A 3D31A 3NBZC 4TN1A 2NMVA 1G3MA 2ZSDA 3X1YA 1KDOA 5FPSA 1UJ2A 3FOZA 4Z1MD 3MFYA 4URXR 3B1WA 4MRSA 3MUFA 2A5JA 3G0HA 5FUYA 2QPOA 3JZMA 4M9QA 1AN0A 3P4XA 4PAMA 1EXMA 1GDDA 2OCPA 5H8WA 4EPWA 3AGQA 4BFYA 2ORVA 3EA5A 3HU3A 1G41A 4QJ5A 1ZBDA 2VH5R 1MO5A 2ZI7A 1R5NA 1DEKA 1UADA 4KU4A 5DNYB 3D3QA 3PITA 3RS2A 2AWOA 3RWOA 4LV6A 4JVLA 3GMTA 3HU1A 1H65A 1I4DD 3CX7A 4W5WA 3CR7A 3WBKA 2OT3B 3IQWA 3K0FA 1D2NA 2BBWA 2YZ2A 4OQNA 4W5HA 3ADKA 3EARA 2F55A 1VHTA 1XD2B 1JALA 3SFZA 4EIWA 2GTPA 2GCOA 1XMIA 1ZD9A 1NVVR 4FMCB 1NKTA 3TW4A 4BQSA 1G7RA 3QENA 4ABYA 3THYB 4PPQA 2OFWA 4ZIRB 3MWLA 1ETUA 2JLWA 1EG7A 2HYDA 2QMEA 2BEKA 3PUVA 2ERXA 2IXFA 1N5IA 4OI2A 4POAA 3KKMA 3UPUA 2R6DA 3AVUA 3EA0A 4WOPA 3UANA 1T0JB 5AUPB 4M1YA 3LAWA 3H0KA 4L16A 4ESVA 1E2LA 4DIEA 3PFIA 5JJKA 2LKCA 2VHUA 5FFMA 2HJGA 2J7PD 3RRYA 2GJSA 3AVQA 2ECKA 5A5GA 3A4LA 1FTNA 1XEFA 1K5GA 4MDFA 2C04A 2FSFA 1IHUA 1IY0A 1Z0JA 4NDZA 4ZCLA 2VYFA 1YQTA 1JPNA 3IHWA 5DI3A 2KBFA 3HR8A 3AEZA 1SVMA 1JECA 2JLYA 4B47A 4Q4LA 1ZIOA 3K70C 2BMFA 2Q9BA 1ZNYA 1Z6YA 3U61B 1NRJB 4YQFA 4UNPA 5GVSA 2ZRGA 3AKEA 3IIKA 1E98A 2ODNA 1TADA 1XX6A 1W4BA 1E2MA 1LW7A 5G41A 3I61A 2KBEA 1GP2A 1KJYA 4IDOA 1GITA 2PZEA 4WXPA 1P7CA 1DE0A 4PTLA 3U2QA 1HTWA 4EPTA 5JCPA 3B6EA 3CPJB 4BRUA 2VP4A 1XWIA 4JBXA 1TEXA 3ZIAD 1E99A 2FX3A 3CW2A 1W36D 2CJWB 2BKUA 4MQBA 1E9AA 5TY0A 4US1R 3A1TA 1AZSC 2EFHB 5CM8B 3IEUA 5KYKA 2W6IA 3K0AA 1W4CA 4LV8B 4WW0A 5SZHB 3DM5A 2J0QA 2WWYA 4BLPA 2FNAA 1KZGB 3F0TA 4D6PA 1J70A 3UG7A 1KKMA 2REOA 4ESHA 4M9ZA 1P75A 1G291 1I2DA 4LV5B 1XBTA 1W36B 4NKRA 3KXKA 3ZZUA 2O5VA 2WWWA 1S3SA 5L3QA 2GILA 1JB1A 5G3ZA 2P0EA 1JQJC 4FCTA 3KL4A 1EK0A 2GBLC 2X8AA 4URYR 1QHNA 5JEDA 3CX6A 2I4IA 3K9LA 4HB2A 1WCV1 2TMKA 4K46A 3NKVA 1N6HA 5E4FA 3VR6A 3ICEA 1Z5ZA 1N6OA 4RKEA 2IYQA 2N1BA 3WYFA 1KSHA 2Z0MA 2BEJA 3CWZA 4AD8A 1XDBA 4AKHA 1LB1B 3AVXA 3MJHA 3TKLA 3MWYW 2GJ8A 4ZDWA 4IFEA 2V1UA 1ZUHA 4Q1DA 5JSZA 4ZI2A 4MKGA 3B2EA 1P2UA 3SZRA 1KAGA 1P2TA 3U5ZB 1WF3A 3I8SA 4A0HA 2FE4A 3B85A 3B78A 2RGCA 1U9IC 4HZIA 4QRHA 4ASUA 4Z51A 3UATA 5FOXA 2IYSA 1P9RA 5GJWC 1J8MF 1YKSA 1IBRA 3A6PC 2BMDA 4V0OA 3UWOA 4F4JA 1KYIA 3KQUA 2WV9A 4QHTA 2CL7X 3Q8XB 4AIIA 5TVKA 3TMKA 3BFXA 1DAGA 2WWGA 2ZJBA 3HP1A 5SZKB 2YWFA 3L82B 3UMFA 2IXGA 1NG1A 4RVCA 2IYRA 2IBMA 2XJ9A 2CXXA 1F48A 4RZ3A 4EKDA 1VCNA 4LPKA 2XTZA 1FQKA 3I72A 4YMTA 4C0HA 2R65A 1CJUC 1MRNA 1JAHA 1NN3A 3LXXA 3FHOA 4U02A 5EUMA 4OHYA 4LHYA 4D80A 1OXUA 4CVNA 3VHLB 3KX2A 5HPYB 2ODEA 4JJKA 4URVR 4BLTA 3NWJA 1YRAA 4BPBA 5AJYA 4X8HA 2F1HA 2GHIA 1XEXB 2ODBA 5TB5A 1V5WA 4KJZA 3H1TA 2J9RA 1UEJA 3AGPA 5EZ5A 4RKFA 1UBGA 4B32A 2GBLA 3SDZA 2CJWA 1NJFA 2ZRFA 2G88A 5IRCD 2ZR0A 3JZAA 4JLMA 3RDPA 4AURA 5DIFA 3LDAA 2BWJA 2A2ZA 3SYLA 1IN6A 3U4QB 2IYLD 1HV8A 4KLNA 3IEVA 4TT3A 1WQ1R 3C4JA 1Y3AA 3O8BA 5D3MB 3IBYA 1W7AA 3RS7A 1Z83A 3CPEA 2JIZA 4EQ6A 1Q21A 1A4RA 2Q9AA 2OXRA 4CZ2A 2BM0A 2HLDD 1J8YF 2ZXUA 1KI2A 1OHHD 1UBEA 3Q85A 4HB0A 1L4YA 1N2CE 1HY3A 4NYIQ 4TMVA 4U5XA 4UQOA 5E3HA 3GLGE 1GKYA 1T9HA 1L8QA 5K8LA 1R8QA 4PHGA 4N0DA 4ON9A 4V0LA 1GL9B 2EFGA 1KDTA 3WRYC 2OCBA 3QF4B 1D9XA 3KB2A 2BV3A 4PHFA 2AKAB 4HAZA 2G1KA 1IN5A 2FOLA 2FSGA 2O8CB 2ZETA 3NHBA 2XB2A 4DLRA 3WMEA 3CZQA 5LB2A 2GCNA 3GLHB 4Q1FA 2HCJB 1G21E 1DAIA 4P0TA 3U6BA 5CYOA 3AVWA 3LNCA 3B1XA 5J5CA 1B23P 4IVPA 2IUTA 4ZO4A 5J4KA 4LDJA 4ZCIA 5B57C 4II7A 3PEYA 4IOJA 2REXB 4BWYA 2IUUA 4TMTA 2CE7A 3A58B 1U98A 4P33A 4C0LA 4IDNA 5H68A 2ZREA 3CM0A 2HEIA 1VDZA 621PA 1K8RA 2C03A 3A4MA 4NYMQ 3UMSA 4QM7A 2VPPA 3FKSD 4M1KA 3KZ1E 4Y0VA 4OQLA 1PJRA 2V1XA 5CDFA 1CR1A 1ZJ6A 5P21A 5EZ6B 3NDBB 1YU9A 4D0LB 2GEUA 5A4JA 5IK2A 3ND8A 3L0OA 3EPJA 1KO8A 1XJCA 2WJJA 4HAWA 2DFNA 4UJ5A 1GNPA 3OESA 1W4RA 1VYTA 1EESA 1NMXA 2J7PA 2YINC 2XX3A 1QZXA 3N70A 4C0SA 4NH0A 2QE7A 3QBVA 2ANCA 2F43B 3PG5A 3WNDA 5EE9A 4HSEA 1R10A 1Q3HA 5FOTA 4C0AC 3TSZA 1ESMA 1PUJA 4BUJA 4RCYA 4XVRA 4M8NE 2H8KA 5E7IA 4YMVA 3KUCA 1FP6A 4TYQA 5SZJA 4B33A 1RYFA 5G40A 3SE0A 4UXIA 4TYPA 4DDWA 4TMZA 2ASEA 1L2TA 1XU4A 2ZJ2A 4RD4A 1V43A 2QAGA 4KXFB 4AK9A 4Q47A 4B2IA 1OH8A 1KMHA 1E96A 3AVVA 1NLZA 1F60A 2FFQA 2IW3A 3TR0A 3MAAC 5L3RA 1ZNZA 3L0PA 1SVOA 2IF2A 3UG6A 4IEEA 2QBYA 3DDCA 1OKKA 2J41A 4KO8A 2EFDB 2PT5A 2WWHA 1VIYA 2OEPA 2ZANA 1CJKC 4LC1A 3WMFA 4TQUS 4HLQB 2VLIA 2ZSAA 4IVRA 4UNQA 3NTUA 1GNRA 3GEIA 1FUKA 4LHXA 4Q7KA 2OILA 2ZRCA 5FH9A 2B92A 1JQLB 4TLAA 3K0CA 3I5XA 1IOZA 3FFAA 4RY2A 4ZKEA 4OQMA 5JBQA 3N5CA 2C9YA 2KSQA 1M7BA 1VHLA 1CP2A 1SGWA 2JEOA 3BFVA 4BASA 4ARZA 2WPDD 1YR8A 3IIMA 2BBOA 2RGBA 2B7CA 2KWIA 5F9HA 4ACBA 2AXPA 3BJIC 1P9NA 4Q01A 3VHXA 1KI4A 4BFXA 1DAKA 1P3JA 1I2MA 2AHOA 5DN6D 2XEXA 1Z3IX 2MMGA 4OQXA 121PA 2WZQA 3TE6A 3PIRA 4LYAA 5JS8A 1XFAA 3EZ2A 1JXOA 4GL2A 4M1SA 3L2OB 3KTAA 2OZEA 3F5FA 1XCPA 4NYJR 4PO8A 2ZRDA 1DAEA 5KNDA 2EFEB 3EX7C 1G8YA 3ZVLA 4DSOA 1E1QD 4QJ3A 4ZIRA 2D3WA 3NC0C 4KVGA 1TU4A 4XWKA 1W4AA 2Z4RA 2FPLA 3SJBA 2EYUA 3M4YA 4P31A 4JLPA 1DAMA 4R7ZA 4RZ2A 2RGAA 3T06B 3T12A 2RB4A 2ZRAA 3I4LA 2CK3A 1OSNA 3V4RA 2DB3A 1XF9A 3RC8A 3O8DA 2H17A 1N5LA 1MOZA 1S9HA 1SVKA 2RGXA 3M6AA 2BKEA 4LBWA 3REGA 2RGNC 1NLYA 3E2IA 4JL6A 1Z29A 2R8RA 2WWXA 3GFPA 5J4HA 2RMKA 4NPHA 5AK0A 2RH5A 3P1JA 2V55B 4N0EA 4M1MA 2CMKA 4OK6A 4QNRA 3U60B 3THWB 1W2HA 1NG9A 2X1VA 1KI8A 3G5UA 1NL3A 1UBCA 2HJVA 1E0JA 1XRJA 3QE0A 4GZMA 721PA 5E7MA 5JCZA 5EE5B 2GKSA 1LFDB 3NH9A 2D7DA 1HH4A 4MRPA 4A8JB 3ZH9B 4DBLC 1W49A 2OSBA 1OFIA 5H70A 2PMDA 4DCUA 2MSEB 2J0SA 1E2DA 2ZI3A 3OZXA 1R4AA 1HE8B 4C0KA 4DCNA 2CE2X 1GRRA 1LS1A 4HZUA 1Z6XA 2ZSEA 1I4TD 4HUQB 5EXTA 2A5FA 4XWAA 2OAQ1 2QMHA 5KOYA 3AF3A 3EWSA 4CW7A 1E1RA 4XWOA 4UKDA 2V54A 3QUSA 4LBVA 4OKSA 2GJAA 3OE7A 4JIMA 2UKDA 5EP3A 2I1QA 1FW6A 1GAJA 1AA9A 4AYTA 2AXNA 5KNCA 5LBIA 2QAJA 3K0AB 4Q7MB 4HAVA 2DY1A 2AX4A 2ZU6A 3GJ4A 5DYIA 5BW8A 5CLLA 5FL7D 4PZYA 2ZYWX 2EFCB 1U0JA 1YZUA 3FGNA 4NYIR 1T3HA 4IKEA 2WIAA 4NCHA 3JVVA 4B76A 5DO9A 1JBKA 1Z63A 3SU8A 3FMPB 3MRSA 4MYCA 4UXJA 1M2OB 4I99A 5FOWA 4Q4JA 1TF7A 2QG6A 3Q5DA 3I3SR 1VPLA 3SQXA 5AJVB 4AYWA 2ZJ5A 2YKGA 4EPXA 4QNMA 1VECA 4F92B 4KSCA 4A15A 3DKVA 3VMFA 4C3ZA 4JLOA 2XAUA 3KUDA 2QL6A 4AY2A 4LBZA 3FHCB 4WXRA 1XMJA 5FBVB 1XPOA 1C4OA 1DVRA 3ZZTA 2IA5A 2XB4A 3L8YA 3T5GA 3CRMA 1XTJA 5HE8A 5JWHA 4O3MA 4PPGA 4YMSA 1AQYA 1E2EA 4AYXA 1DG3A 3QPVA 2CEAA 5L3QB 1XD9A 3ZVNA 4MUBA 3LWNA 3V00A 3A1UA 5GJCA 1D6JA 3AF1A 1KJZA 2BHRA 2W83A 2YC2C 1EFHA 4Q1CA 4MKIA 3RS4A 2G1JA 4TL7A 1P60A 3RRMA 4BLRA 1SXJB 2BMEA 1JXMA 2GVZC 4D4KA 1M7GA 1NIPA 1MABB 1SVWA 4DJTA 3T15A 2PMKA 4URUR 2HT1A 2A7QA 2JLSA 1GKUB 1OT3A 4NONA 4PC6A 1HT1E 2XNSA 3CNLA 3FE2A 4NTZA 4P4UA 1U8ZA 4CDGA 3FKSA 1XTIA 3BORA 3DEFA 5FTMA 5J4YA 2SHKA 4RD6A 4Q9KA 4FIDA 4CYMA 2YVUA 4IJMA 4TYNA 4L8GA 4WZBE 4DLWA 3KJHA 3QF7A 4ZCMA 1CJMA 4AKIA 1GWNA 2NTYC 3FFBA 3WBJA 4Q1EA 3BXZA 2ZRIA 4L9WA 1EFRA 2XNDA 3BGWA 3RSOA 4BE7B 4D4MA 1FNMA 4JJZA 2HV8A 1OB5A 1XP8A 4W5JA 2ZE6A 4NE2A 1XTKA 2JJ2A 1ZM9A 4JLVA 1OB2A 5L3VA 3QXCA 1KIMA 1SHZA 2YJTD 4DC9A 3SYNA 4MKHA 3QI2A 2QI9C 2AL7A 4A0RA 2DBYA 4QJ4A 4YXWD 2FWRA 3CWQA 4OI1A 1ZUIA 5UKDA 1E9CA 2WJYA 2BBSA 1PLLA 4D81A 2R6CA 1CRQA 4QHSA 1NNEA 1ZRHA 4MA4A 1OLOA 1SQ5A 3RC3A 4LYJA 3CONA 3TUZC 1BIFA 1HUQA 3ADBA 4MYHA 1OH6A 1QRAA 3RAPR 2H16A 4TZ0A 2D2EA 1XJ0A 3X2SA 3O8RA 1MR3F 2W2VA 1Z47A 1Q3TA 2WVJA 1RVDA 5HE9A 2QRNA 2ZVPX 1P2VA 2PZFA 3FDIA 4OHVA 1GFIA 1KI3A 1O3YA 4FMDF 2V6JA 4EUNA 3K0SA 2IHBA 2DWPA 4OQFA 1K6MA 1OFUX 4DEXA 4HB3A 4E03A 2DFKB 5TARA 1H8HD 4ZI3A 4JSTA 1LF0A 4DEYA 4M2LA 4G3XA 3L43A 2HF8A 4JKIA 3SI7A 3C15C 3QVVA 3SHWA 4BLQA 4DSUA 2EQBA 3K70B 4EAQA 2GESA 3BD9A 1US8B 1WRBA 1ZC4A 2C99A 3QG5A 2ZEJA 3DMNA 1F2UB 2GF0A 2Q3FA 1X1SA 2VL7A 3GJ3A 2J59A 4JBWA 3T61A 2ZRLA 3QEOA 1TPZA 1W44A 2YWHA 3QKSB 5C18A 4IDHA 4XD7D 2FSIA 4JYCA 1JJ7A 1SXJC 2IEYA 2WICA 4KFRA 3QPWA 1F5NA 4I1VA 2KI5A 3BWDD 4MYTA 3IPXA 3UXMA 4EPYA 2HCBA 4CEIA 2R6AA 4D82A 5JS7A 3GEHA 2QPAA 1N0UA 3DOEA 3I73A 4TT3D 4D0NA 4RD0A 1IQPA 1CEEA 3VR3A 4GPTA 3GJXC 2JIZD 3EAQA 3NDPA 2NO7A 4HDOB 3RNLA 2G6BA 3MD0A 4RCZA 2VO1A 1XXHB 5DSZA 4G5QA 4IOLA 1KK1A 4Q9JA 4B6EA 2BDTA 1X8LA 2ZRHA 2ZS9A 4K81B 3PUWA 4BZPA 2RGDA 1J2JA 3K70D 1KK3A 1E2HA 1S8FA 1LF5A 2ZU0C 3RYTC 3IILA 3ZS9A 3EZ6A 4KCGA 4L5BA 1GTVA 2FU5C 4X8OA 2MSCB 1UBFA 3K09C 3O8CA 5CDFE 2YOHA 1L4UA 2QUZA 4Q00A 2ONKA 3HYTA 4BEJA 1YZLA 4LYFA 4JS0A 4D25A 1R0XA 2VHQA 2HF9A 4A92A 1R6BX 2XGJA 3AVPA 2FPKA 3C5CA 1NLFA 1AS0A 5IDVA 1DAHA 1RRPA 4NHOA 4WZAE 3M1IA 3QJYA 1JAIA 2RGEA 1OIXA 2IYUA 3LD9A 3QEJA 2ORWA 1OH7A 1BYIA 3MWJA 4EJSA 5LD2C 5M04A 4LK2A 3EC2A 1BOFA 4Q4HA 3IDQA 3GP8A 2CHVA 4TZ6A 4O2LA 1A5TA 3PUXA 2Q9CA 1NP6A 4L4UA 1ZNXA 4Q9LA 2G9NA 2FDCA 1EWRA 5FTLA 1N3BA 3OHMA 3EC1A 3K9HA 3AM1A 1GNQA 2O0HA 1HE1C 4LJ4A 3R8CA 3QSYA 5KU1A 4CEHA 2IK8A 5FBLB 1SULA 3ZJYA 4XVQA 1W47A 1II8A 2QENA 1P72A 1X8KA 2WSSA 4A82A 4XJXA 1Z0FA 2QGZA 1JEEA 4D2IA 2NQ2C 1XXHE 1RJ9B 3LY5A 2H57A 3PEUA 1T3LA 3R9XA 3U7HB 4Q19A 2RAPA 1W0KA 1N6RA 5DYGA 1G8GA 4FWTA 1XCMA 2JJ1D 4Y0AA 1A2BA 3TQFA 2O8BA 5BYKA 1A1VA 1HURA 1OFHA 2VTKA 1YZQA 4RFSA 4JLBA 1WXQA 2Q6TA 5FUXA 4TLCA 2XTMA 1G16A 4B3XA 1XZPA 2E9SA 3OFNA 1YR7A 2XXAA 5DI3B 2H1LA 1E4YA 4XTRA 3TAHA 1CF4A 5FI1B 1J90A 3CRQA 1Q0UA 3MCAA 1QDEA 3TR5A 2L0XA 2WOJA 1M7HA 2I1VB 5EP4A 3U3RA 2JGNA 2F3TA 5LPNA 4PC7A 3BH0A 2C77A 2IYWA 3H84A 2IC5A 4FCVA 4EPRA 3T1OA 4AWXA 1T5IA 4C2TA 1ELOA 1HQCA 1I4LD 2AD1A 2WOOA 3BFKA 4IDQA 2QM7A 3SN6A 2C95A 4I1UA 2HDNB 4F4IA 2V8OA 3OIUA 3ZIAA 2IF0A 1P61B 2A3RA 3OEHD 3KKPA 4IOKA 4PO1A 2W6JD 1KNQA 1E69A 1DG1G 4JYBA 4S35A 5ANRB 4OHZA 2F1JA 2GXAA 2NPIA 1NN0A 1KSJA 1AQUA 1AKEA 2VP5A 2ZROA 4Q21A 1HQYE 3LX8A 3CRVA 3OEHA 4X8LA 2PCLA 3Q3JB 3Q9LA 1S9DA 2RCNA 3DZ8A 5HTKA 2ZE8A 1NY6A 1US8A 2W2XA 1AS2A 1N6LA 1T4GA 2OFOA 3GLGB 1ODFA 4EJSC 5JEEA 1KDRA 1W1WA 3V4FA 3J81k 5JFGA 2Z4SA 3W8NA 1YVDA 2IT1A 2DFTA 3L0SA 1PLKA 5TDHA 3CBQA 3KTAB 1U2RA 1Z06A 1E2JA 4CT4B 1IN4A 4MGZR 1M6NA 2QM8A 3MGCA 4IHQA 4MRRA 2PJZA 5CJPA 4A9AA 1HEIA 4PAQA 4UNNA 5JRZA 1R7RA 2BVNA 2W0SA 4G5RA 1COWD 2W58A 1OW3B 4M9XA 5EUQB 1ZCAA 2VQSA 3NEYA 1Q12A 4L15A 4Q18A 2OBMA 3QPUA 4PSVA 3KQNA 2ZI4A 2ZJ8A 1S0UA 3HDTA 4TSFA 4C7OB 4EJSB 1COWA 4Q02A 3EW9A 4QGFA 2YOFA 2ERYA 1NIJA 4M4SA 3JVUA 1WA5A 2ZRPA 4TTRA 1XEWX 3GCGA 5JSZB 3ZQ6A 3AP3A 3RS5A 2ZUCA 3CRRA 2IS4A 3C16C 2GRJA 4U7DA 1SZPA 3GFTA 1ZINA 3W34A 2ZS8A 2F1IA 4YDSA 1NY5A 2RHDA 1KI6B 3KKOA 4US0R 4ZDJA 2WAYA 3QG1A 1F3OA 2X19A 1E2PA 2CK3D 1A7JA 1KTVA 4LHZA 2J7KA 3AP2A 4R98A 1XD8A
chains in the Genus database with same CATH superfamily
1HG1A 1Z15A 2BUBA 2AYXA 4J1TA 4AMBA 3AKYA 2BJWA 2P11A 4BO7A 3PC8C 1G4UR 2O8DA 1GARA 3KOXA 5HUJA 3L06A 1OUMA 3JPWA 4NBSA 4EM6A 3I01A 3RVBA 3I04M 1V45E 3I9FA 2GRAA 5KWEA 2JKZA 3B3AA 2NP6A 3IKTA 2PVSA 1N6KA 3GD7A 3UAZA 2F3RA 1EIWA 1Q1ZA 4B3CA 3GK3A 4HTFB 2WU4A 1EFLA 1EINA 1UOPA 4PIMA 5EMKA 1RXSA 1CR4A 2IP2A 4G37A 1H1DA 1G7TA 1I3LA 3HC7A 1GZVA 1G3RA 2EJCA 3LL4A 1GHTA 3NU1A 4MHOA 4PS1A 4B5KA 1JSLA 3DAGA 1LNQA 1P74A 2YJ5A 3I6IA 1N0HA 1EKXA 3CA8A 2BDEA 3FPSA 4RW0A 5AOBA 1W1IA 1MO2A 1U7UA 1NE7A 3NV7A 3TFWA 3TZCA 3FROA 2ZRKA 4JEIA 5C1OA 5JNRA 4HDAA 2W2QA 1C41A 3SR0A 2LNDA 1Q7CA 1FY2A 3M6IA 1X1QA 3Q2KA 3AR4A 3PXEA 1IJKA 1QR2A 4EB8A 3NV9A 3AJDA 2HKIA 2QZ4A 3PHLA 4Q03A 5TVGA 3TLAA 4ER6A 4PSAA 1YZKA 3KDSE 1IXSB 2NSDA 3HSKA 4E1AA 5JIBA 2ZYUX 1JJBA 4IOMA 2J07A 2VBCA 4JXJA 4KXUA 3GIDA 3TW8A 5I48A 3K9FC 4RPLA 4TWZA 3TEMA 1H8ED 4HADA 3ICQB 3IIIA 1QHYA 3FY4A 4CLDA 1NSTA 1OX4A 4LRSB 5FOQA 2VJKA 2QEQA 2IUFA 4DV1B 4MQMA 2CJPA 3ZLJA 2JCYA 4G0VA 4B2PA 1S4QA 1WABA 2OVBA 2YN4A 4FHDA 3X1XA 3IE0A 1D2MA 2O8EA 1UFRA 2RAFA 1QRRA 1GO2A 3NBQA 4LYGA 2XVZA 3VPDA 2OGZA 3SQWA 4M9RA 2P68A 4KQ9A 4R8KA 1LDNA 1VJ5A 3OE7D 3OAAD 1BGWA 1AKVA 4B44A 5TPZD 4B8YA 2QX6A 1DKQA 1PT7A 2FUEA 3LGAA 3VKHA 4DPMA 2FN4A 4JUBA 4MJXA 1IB0A 3D6JA 2L2QA 1Z82A 1I2AA 3RUDA 4M0UA 4C4OA 2W6OA 3UKJA 1W48A 2W93A 3ZI7A 2Z1NA 5CCEA 1UF9A 2W2KB 2I34A 5B4VA 1CRZA 3RYHA 1Q14A 3O8OB 5J40A 1T8TA 2HA7A 4IMJB 1MC5A 4RZQA 4WE3A 1EQAA 4HRXA 4YYZA 5BQFA 2I80A 2BUAA 1YJ8A 3C1UA 3O1JC 3T1VA 1LWOA 1D0VA 4O2RA 1EWYA 1RMYA 4UFOA 1ZJYA 2C98A 1I24A 5AO9A 4BXOB 1THGA 4D26A 5LWHA 2YMLA 2VAXA 1QNFA 3BMCA 1ARZA 1V6AA 5DHQA 4Z5XA 1CXZA 5IWAB 3D2BA 3D7KA 3OE4A 4IXWA 1VI2A 2BFCA 1VE3A 4MYSA 5ERXA 5D3KA 3WHLA 4LOKA 2FGKA 4MICA 4XGIA 3FYHA 4IS2A 1G5FA 5IT0A 2DKFA 5LU8A 5LKRA 2MINA 1Y33E 3MB5A 1RYDA 2TSYB 2ZI9A 5FXMA 3S5UA 1Y7IA 5G4LA 2R4TA 3DMGA 3RQIA 1EK1A 4E09A 4E2ZA 3KLBA 5EIEA 3FNFA 3P52A 4C0XA 4CCSA 1ZR4A 4FGWA 2PZKA 4U2KA 1XDDA 4L2IA 3BF8A 3CJQA 1Q1QA 2QHXA 3CH5A 3JQ7B 4L27A 1RADA 3VH2A 3OPQA 4DCSA 3NATA 4G5GA 5BV2P 3JQGB 4DJDC 6GPBA 1U7DA 2PA3A 2PRJA 3L4SO 1K6JA 4HS9A 4ZPXA 1GM5A 1KHTA 1V8ZA 3O7WA 2RARA 4KRGA 1YI8A 1KORA 1GFZA 1KMIY 5G53C 3GG9A 2IHYA 5ES3A 3A9UA 5HIIA 4GE0A 1K5DA 4YP5A 4KBFA 1MVOA 2QX7A 2PZLA 2XMGA 3LVRE 4HWOA 1R6AA 1U2DA 2WSYB 2QORA 2YIJA 3D4BA 5LB4A 5A4DA 5K0BA 2FTKE 3WYCA 4NL4H 5DISB 3NT5A 3MVEA 4A2CA 4AZTA 4E51A 3TBKA 4N5NA 1R50A 3QXHA 4KODA 1C30B 2TYSB 4PAOA 5C4GB 2B0CA 2QP4A 5D6NA 4C4PA 3RAFC 4GI7A 4KR0A 2WG0A 4X8MA 2XE6A 4JKYA 1LS6A 3OM9A 4R1UA 4RA6A 1MHTA 1ESNA 2WHQA 1PR4A 1OYWA 3JQQA 4A8PA 1JQDA 3KQKA 1UMBB 1E4EB 5SV2A 1XEWY 2C82A 2CDRA 1G64A 2PBRA 5K5EA 4O4LA 3KR0A 2BHLA 1SG0A 5ESWA 4UPVA 4C0JA 3CRNA 3FG9A 1CVIA 2F67A 1VHQA 1OJLA 2PA0A 1ZM4A 1BS1A 1ZJ4A 3C98A 3QX7A 2BZSA 5DH9A 2O2GA 2WZDA 2W70A 1SQFA 4OBWA 1T9CA 4RAOA 5FTJA 2B8NA 2A33A 3AHIA 1OWPA 5IDXA 2AK3A 2HAEA 4ER0A 3KTDA 3RWBA 4BMZA 4WFQA 2V7EA 4RE6A 3H8VA 5IXJA 4QYWA 1XDGA 1AV7A 4H18A 1KYZA 4YXWA 3F98A 1I6LA 5FNVF 1SJ9A 1Z37A 2DPXA 4TSKA 2XLBA 3ESBA 3VBEA 1N8TA 1WPGA 4IZ6A 5F51A 3LPDA 4D0GA 1J2YA 3A8TA 4QBKA 1XA0A 3NXSA 3MYRA 4J2TA 3JATA 3OPMA 4U00A 3E22A 3UB4A 2IE8A 3V4PB 2Q5JA 4FGSA 1YBMA 3PVSA 2G04A 2JNWA 4HVLA 1E5XA 4ZZ2A 2RGYA 4TRNA 3W3ZB 3WNDA 1V7CA 3OURA 2DKOA 1X92A 2YJ4A 4CWAA 2DETA 1WUKS 4LF5B 3QU2A 4C0BA 5LQAA 2QTNA 1IJFA 3A6HA 1DSSG 2X0IA 1T43A 4UARA 4OUKX 2FQXA 4BNIA 4BTLA 4E07A 1WEKA 4F6LA 1KO5A 2XIQA 3PQ4A 1N2BA 3A1WA 4ZO9A 3IFSA 4ZK2A 5I7FA 2XGGA 3BB1A 1DIOB 1KYYA 2G0AA 3HFGA 3ZEIA 1WDWB 821PA 3A6JA 3K0BA 4CMJA 2ZM5A 4B34A 4ALKA 3MXTA 3NVAA 4B4KA 5NLLA 4FE4A 2X0FA 1E2KA 2BIFA 2HSZA 2EHJA 1F5SA 1GEEA 3SJCA 4JHLA 3DOUA 3KKZA 1MZVA 2QUIA 4Q7EA 3DC7A 3SQMA 3EZ9A 3WNVA 5CJ2A 1N75A 3WLRA 1QM5A 1BE8A 4BDSA 3FCXA 4DWOA 4F6CA 2OK7A 3QM1A 4GNKA 4NMWA 3BH7A 1RU3A 5TJ9A 2OLEA 3NLLA 4Z4IA 1CQIB 2QJTA 3P0RA 2VK1A 5JWRA 2GASA 2WABA 3A6GA 1BX0A 4OIFA 3WJ2A 4HDKB 4YJ2F 4F11A 5LSAA 4LYHA 1AUQA 1PE0A 1JGTA 4IGFA 1DO2A 2FLVA 3EOBI 3H9UA 3V1LA 2GPSA 2VHXA 2GPNA 3EYAA 1DOAA 4LCBA 4YONB 4CV3A 1YB5A 1ADFA 1TIPA 1VSUA 2ANBA 2LUOA 1O2DA 3OPYB 3LO5A 1MOPA 3L4JA 1RLTA 2BEUA 3WLMA 2GZ3A 4KLZA 4R2MA 3DVAA 1UAAA 5AK0A 3PC7A 3VDRA 3JS5A 4QE3A 5K8TA 4QELA 3OE1A 4EG4A 2Q4RA 521PA 5IJ0A 3LFUA 4H7IA 1G5HA 1A1SA 1V1RA 4F2PA 3CZCA 4A8JC 1BROA 1KR2A 3MT0A 4Q3KA 4FZVA 2QZSA 2VIIA 2O19A 1ZOLA 2V0GA 3QP9A 4GYKA 4CR8A 4PHHA 2R4QA 2DQZA 4YDHB 2JK1A 1J49A 2XOEA 4Z2AA 1HDIA 1DXQA 2FFHA 2PX3A 3IKMB 4TKVB 3WMRA 4AF7A 1KH3A 1U65A 4ZN6A 1P3DA 3BK7A 3OIGA 3I2FA 3NDRA 1GTMA 2N42A 2VH2A 3UMRA 3OEWA 4RZHA 2IQIA 1JR4A 1QO0A 3I9JA 1H2WA 3C14C 3D64A 1A8HA 3ZW8A 5FJIA 1DHTA 2QWXA 1U7WA 2JGEA 4YFVA 1BE1A 3TRFA 4TLDA 4TTVA 1LPSA 3ZBUA 4YV2A 4U7JA 3Q5EA 5C1BA 4HCJA 2X2PA 1KSGA 3Q98A 1JV2B 1RLOA 1S6YA 1XZ8A 1SOAA 3NC4A 3CEMA 4FT2A 4W1QA 5EZYA 4BJHB 2PMWB 4CMGA 4DMHA 4QRDA 1PNQA 2GKOA 3ZU6A 1VSVA 3PA6A 3DGEC 1PG5A 4JDUA 5AW9A 5LXTA 4PR3A 4PNHA 3Q3VA 3V32A 4TZTA 3LLMA 4DLKA 3I92A 5FR1A 1B0UA 1J07A 3W8EA 1FDWA 1NJ2A 3RKRA 2JD2A 4WPGA 1KOFA 2YHSA 2PH5A 1BH2A 1EH5A 2WU0A 2R1VA 1AD2A 4KIJA 5BQ3A 1B6RA 4TS4A 3DDZX 4DAEA 4IG4A 1VLZA 3R6DA 1DMRA 5HCIA 3UPTA 1ZM3A 2F3QA 2DMRA 1UFQA 2XGMA 4XQ0A 4BO0A 1L7RA 1QF9A 1SXJD 3VO9A 3WTCA 5CK4A 1JE1A 1CPYA 4OYHA 3ZWWA 5AM2A 2FUKA 1QONA 4TV9B 3IPAA 1K08A 3K6KA 3TQCA 1SXJE 3C6KA 4R2IA 3WY9A 5J43A 2DLCX 2Q5QA 4MX8A 3CZ9A 4D4LA 2PLNA 4RSMA 1O9BA 2OCAA 1YI1A 1YKGA 1RRFA 3ZUPA 1PJTA 3PR1A 2HFJA 3ONWA 1EFAA 3TZLA 3FNRA 4QYIA 2VVTA 1PDVA 1THTA 5HIKA 4CXMA 3ZWBA 1T0PA 3QWHA 3TLBA 2GVDC 1NOIA 2P27A 4KX5A 1A69A 3T3DA 4BMYA 4AJ9A 2FMXA 4Z9XA 3K20A 3K5WA 4YC7A 3U3MA 5CRIA 3AILA 4CM8B 2PKCA 4BVFA 1Z08A 1Z8NA 2XZDA 1Z8FA 4ODIA 1KTIA 1YFLA 3NUQA 1VE6A 3GJ0A 1AHPA 1SXJA 2QTMA 3W9SA 3KVNA 1EX7A 3DWIA 2E1RA 2IYZA 4OA5A 1AKYA 5CDSA 1UBUS 2P40A 2UZ0A 4ZMRA 1T2AA 3FVWA 4W7IA 3CIOA 4RS4A 1FS4A 3E70C 1QHXA 4YLEA 5FUWA 1UM8A 3PNOA 2FAXA 2R9VA 4YCSA 4HV4A 4W9MC 4RVGA 4U9HS 4FVTA 3UGTA 1QAQA 2UVQA 3HJCA 4D6YA 5IC5A 1ONBA 1G2IA 1VKJA 4FHZA 1PUXA 4KPUB 1GU1A 4I1SA 2B8JA 3WFZA 1EHIA 2JAUA 3DO6A 1CY4A 1TEZA 2WSMA 4HDQB 2I2CA 1R6VA 1ZLYA 1RKXA 2ZT8A 4LYDA 3I23A 4NBTA 5IP5A 1NYLA 3C8MA 3ENZA 4Z8XA 2Q45A 2UZ1B 4H6VA 2GH1A 2AR9A 1SXIA 3NM4A 1OYVA 2EJTA 4H1TA 4PC3A 2P5TB 5AVYA 3V4LA 4RDIA 1B6GA 4LNHA 1VLHA 5GM1A 3QK7A 3VSEA 4YJ3F 4E3WA 3H8SA 3LM8A 2AX3A 2NZYA 3CEPB 2IV7A 2FJPA 4JI7B 2BTEA 5E1DA 3ENQA 3LV8A 1HMPA 4RZUA 2ZZNA 2FRDC 1B26A 4D98A 2WIJA 3KB1A 3OCXA 3EGWA 2ZAMA 3FD8A 4JR0A 5AOCA 5JS2A 1CDDA 3R5FA 3O91A 4RF2A 3MIZA 3VNAA 4N3CA 3IOMA 5A6SA 2B69A 3N8NA 4BKRA 4N3GA 3EF1A 1IM2A 3FFTA 1PFYA 4N7RA 4ZCQA 2XCUA 2PR2A 1GPJA 2GD1O 4NCBA 4LXUA 1XYYA 3EMBA 4Q1BA 4LX8A 5CU7A 1PJCA 3MJSA 3GI1A 2ZYDA 4WY8A 4W82A 5DIZA 5L3ZA 2ZYHA 5C7IO 4JI5B 3T52A 2HU8A 2X22A 2W00A 2GHRA 1LBHA 2VJBA 4UE6A 3VPCA 4DZZA 4CF7A 3D6TB 2XW6A 4CE6A 4QLAA 5EXXA 1JEDA 2WTUA 3AWDA 5CX4A 5G0UA 4MVYA 4ER3A 3M81A 1CRPA 1A88A 1AGRA 3BEOA 4BX2A 3KSAC 3ASZA 5ALIA 4L51A 1PBTA 3UGJA 2J0EA 1VRVA 1K9SA 2JBHA 1TQDA 3CNBA 4Q4AA 1CCWA 1XLVA 4ZAFA 1OPXA 3T3HA 3ZDEA 1IAQA 4QTTB 1QWOA 5ER9A 1YTUA 1HDGO 3I45A 5KYUB 1MRSA 3LVFO 1EVKA 1OFUA 3KZCA 4MEAA 4JLKA 4ZO6A 3RNOA 4D9FA 4AZSA 1SCAA 2VDMB 2XD9A 2GWHA 4JMPA 2AQ8A 1U2TA 4GZLA 3R44A 1DX6A 3EASA 4DIOA 3BGIA 1N2ZA 3OJLA 3CBGA 1SBCA 4HLCA 2BISA 5I01A 2P9JA 1YH3A 4FFDA 4M1ZA 3TZEA 4EHAA 1G98A 3AB3A 2PGIA 4EZEA 3G8AA 4XUDA 3HCAA 1U9JA 2EX4A 5C37A 2IUSA 1KQOA 2CNBA 4XRGA 4IJQA 3LSTA 2AI3A 4I81A 2CLFB 4UDOA 4PFJA 3BA6A 3KSUA 1WUYA 1KK2A 1WVMA 2EZ9A 2ZBVA 1Y9DA 4M8LA 3RJTA 2QX4A 3L4EA 4PC2A 3IQIX 4OBBA 4XXHA 3L7NA 2P9TA 3UJ7A 1WTCA 2QUBA 3EDCA 3LIIA 1N7IA 2FEXA 1UINA 1DQRA 3L5KA 1Y9ZA 721PA 2ZJYA 4QGSA 3I8XA 2O8FB 2CXTA 1M2EA 2P5SA 4QPCA 1IH8A 3F9RA 4IF4A 3K32A 2Q6IA 1JIIA 1NPDA 2ZR9A 4JLJA 3TVDA 4FMBB 5AQEA 4PZZA 4QC2A 5EMHA 2OCYC 4J07A 1VLJA 2R2GA 4U7GA 3MRVA 4W8OA 5TPWB 4RF3A 1QAMA 4UDYX 1GGVA 4AIRA 1V71A 3ADPA 2WJIA 2YYYA 1L4GA 4GECA 4TYYA 2ZSBA 1U81A 5JY6A 2QA5A 5E2AA 4OLBA 1XTPA 4IUCS 1LVUA 3INYA 3Q4GA 1Z5OA 5EHNA 1U8CB 5AVTA 5KNBD 1JHZA 1N2OA 4FJ0A 3RUIA 2K5UA 4UVHA 4ZJYA 4MVJA 5EP2A 2PS3A 4G8DA 2BOVA 1QMGA 4HH1A 1E0DA 1SZJG 1YDHA 4FQ8A 1G20B 4AY4A 1N0VC 3JQGA 1J24A 3QVUA 3D8BA 2A4MA 1XAHA 3TLEA 2P7HA 4RPJA 5KX5F 2V6FA 4XB1A 1YRWA 2K4MA 4ZD6A 1TCBA 4L3OA 4HUTA 3AF6A 4XSGA 4RHCA 3GEBA 4IQ4A 3ZTYA 3H5NA 1H2BA 3B1ZA 1OIVA 2FW9A 2F3UA 4Q3DA 4PY2A 3KVVA 2CNWD 5JZVA 4WOJA 1AT1A 1ECGA 1Q0HA 2DUUA 1NOJA 4O1MA 4MV0A 1U9ZA 3G0OA 3MCTA 4U1RA 2IVFA 3K1JA 3VPAA 2PD6A 3FGZA 4UOEA 1R0WA 1RNLA 4Q6BA 5AVVA 3KR9A 5A02A 3IMEA 1D04A 3LW7A 3VKWA 4DC9A 2RHWA 4MVJD 3QYPA 5K4GA 3H4VA 4I4NA 4RD3A 4CG3A 3V1UA 1E3QA 2AQIA 3AK4A 3AFMA 3F7NA 4B3BA 3VR2D 3MCVA 1ESEA 1M5TA 1NUTA 1THZA 1YZ3A 1GRQA 1YB1A 2HI0A 2ACWA 2QS9A 3NIGB 4KE8A 3M1YA 4MP8A 3V8BA 3ZN2A 4CMEA 4Y9DA 4EG6A 3GLFA 2EZTA 3D8SA 4Q4HB 2OXCA 2R00C 5AI8A 5FA8A 1DRVA 1X1DA 2V96A 4LTDA 3VAZA 3H87A 4UM8B 4D82A 2BSQA 2H06A 1T1JA 2ZYTX 1N33B 4N3NA 3ZD9A 2DGDA 4B6GA 1O08A 3P32A 1II8B 4D9BA 1QV9A 1ZD8A 1TKCA 5BV7A 3AV0B 2V0NA 1QHHB 2FHSA 1A4IA 5EC8A 4PG6A 4C7MA 4YAUA 2W2LA 1H2XA 3L8CA 4N6GA 4R8VA 1RWBA 4KVFA 1F14A 4WEOA 2C4NA 3EISA 1QS0B 4LRWA 1P0PA 2G80A 2HYIC 2EU8A 3GDOA 4B40A 1RZUA 1WDMA 4KZPA 3D59A 1PFQA 1X1EA 3TQHA 2BH2A 4F3TA 1RJDA 3INTA 2AT1A 5KO2A 3DD5A 1K4MA 2Q0SA 1SC4A 4I3HA 1LA2A 5F7XA 1NI4B 4QUKA 4ZOEA 3GZNB 4IXMA 4FZ5A 4OLHA 3GZJA 1JQ5A 3JR3A 3LSYA 4TXHA 1N0IA 8OHMA 2JAPA 4MQFA 3GJ8A 1FSZA 2UZIR 1EBBA 2ZZKA 2JJ1A 5DN9A 1YF3A 3P97A 1VKOA 2A9JA 1T5LA 1CQJB 1MGPA 4A0SA 2ODAA 3CF2A 5G4KB 3ZVMA 1W8IA 2J6HA 2PUJA 2NO9A 1UIMA 2QU8A 3BMNA 3PDJA 1SEPA 4LZJA 4DIKA 2W2LD 1RLJA 4M60A 3RANA 1S2MA 4WMLA 3WV5A 2BEWB 2DVMA 2VPTA 5T5QA 4EI2A 2OHXA 1SXGA 1A2KC 3JV7A 4QGBA 2R6JA 3U56A 1LTQA 2PHZA 2KM1A 5IX8A 3G5LA 3KEQA 4HAXA 4C30A 3KJFA 5E6RB 1JR3A 4KV9A 3HRHA 2Z04A 4B85A 2J33A 2MTBA 2B9EA 2C2BA 2PJRA 2HA3A 3ROQA 3K35A 2XMZA 4UPDA 4ITUA 1A72A 4CCYA 2R5WA 4DJEC 3LQFA 3RHZA 3AG6A 1ZH4A 1ZCZA 3AYXB 4TTPA 5AW3A 1JYFA 2X9GA 1PZMA 2D2FA 5BR8B 2DBRA 1E8NA 1XFDA 1J97A 1WXHA 2YXEA 3Q6IA 3WOVA 4TYWA 1R0RE 2CKDA 2AEMA 4EH1A 2OHVA 4DLSA 4YWJA 5IT4A 2X2OA 4WFKA 1GADO 4LRYA 4H9GA 2WQ7A 4GQAA 1ZC3A 1DBWA 1SOMA 4TTTS 4G5SA 1P0QA 1MXFA 3B1VA 2QN2A 3MWKA 1C8BA 1RQ7A 1T1IA 3UXYA 3VQTA 4KJXA 1RAIA 4IXTA 4PLZA 1M6VB 5ADVA 1AUXA 1GG2A 4E70A 2I66A 1C1YA 1JFRA 3GA5A 5ESDA 3ORRA 4GKBA 3UT0A 3JAMA 4UTZA 2ZJOA 4X41A 2I3DA 2XKBA 2YQ5A 5AD1A 4I55F 4FOOA 3ZDFA 2D6FA 2XCTB 4TLMB 4CKBA 4LZLA 3ZDRA 4BLVA 4WA7A 5CIWA 5PGMA 3W6ZA 2PUEA 5KS2A 4OHUA 1CYDA 2GD2A 1UDBA 1MQ8B 5EMMA 4CR7A 4YRIA 3NONA 5CLHA 1EDEA 1Q1BA 3RPEA 1DJMA 3R75A 2H4HA 4WBNB 1YB4A 4OHWA 1KNXA 3RHFA 2C5EA 3ISJA 5IJ0B 3W9YA 4YV1A 1MJNA 3GUUA 3EEYA 3G2IA 3D3NA 1XTVA 1W581 3ABZA 4JL8A 3C8ZA 4PBRA 1JHOA 3U3OA 1FX0A 5HCNA 2H1RA 2LCFA 4MS3B 1Q84A 5TRTA 3KPUA 1FDRA 2R7MA 3OM1A 1WW3A 2W0MA 1NXTA 2ZYGA 3JASB 3PL5A 1O6ZA 1P1HA 1M1YB 2CYBA 3VVLA 2PJDA 3AH8A 2JFBA 4M89A 1NQ5A 1RLMA 1IRIA 1JPUA 2VBIA 3PRHA 1Y3BE 2CUKA 4LQDA 4ZT4A 3H5AA 5HG0A 5J5AA 4JV5B 1PZNA 3SYKA 5EWMB 4MWZA 1K27A 3Q7PA 1A5BB 5FPKA 3IT0A 4J6EA 1UQRA 2IYOA 1DWQA 4O2BF 2AZTA 3N5KA 1BN7A 4LSZA 3ZD7A 4G1FA 1P5ZB 4CDRA 3K0HA 1C1DA 2CHQA 2O1XA 4N3BA 4UOQA 3A4IA 1GGEA 1UP6A 1G18A 4NZZA 4BVAA 1FRZA 4TSFD 3WXBA 1XPRA 3CEHA 1TAUA 1DQZA 2HQ1A 3OCYA 4JB8A 3ZCXA 1P45A 1S3GA 1KP9A 1FW8A 4QGHA 1N0WA 4YB8A 3TH5A 2GM5A 4CUJA 5BN3A 5AW6A 4V0MA 3FNIA 4K2AA 3TCNA 4FI3C 3MA0A 4ZQFA 2PT7A 1KJ9A 2H1IA 3QVSA 2QAGB 3EXHC 4U8HA 2YXBA 5CCDA 2YFQA 2JG3A 3MMNA 2QSYA 3PNLA 1EIZA 3W5HA 4DQXA 3S81A 3VR5H 3IA7A 1IMOA 3PDWA 4WLOA 1TDJA 3HJHA 3OJ0A 3GPLA 5HIAA 5KNLA 2VBFA 4GLJA 1RFGE 5DP1A 4O6VA 4F38A 1U0TA 1E92A 1VGQA 3REOA 1BAPA 1ONPA 1CQXA 3RASA 3GGDA 3WKEA 4C03A 2QG9A 4U0JA 1Z6ZA 1BDJA 1XALA 2IL1A 3WSWA 1ISPA 3GCDA 1D2RA 1G8FA 2XTNA 3ADDA 2VK8A 2Y9MB 2LBPA 2ALJA 4JQYA 2IS1A 2FMKA 5JY1A 3ILSA 2Z95A 3NYQA 1C1XA 2E4WA 5LA6F 4MW0A 5ALOA 5JNSA 1CUHA 1N6PA 3QMPA 1JBEA 2FHPA 4ARZB 5BOSB 5IC4A 2VDQB 5JASA 4G4SO 2D4HA 5KWJA 3CFYA 5LYJF 2FSVA 2D4AA 1PLJA 3IKVA 4DDVA 1E1KA 3LWBA 3T5DA 4OGFA 3RVSA 3WP1B 3PEEA 5BURA 3OQIB 4D99A 1GCIA 1VP9A 5LVAA 3MTQA 3JYNA 3EGIA 1NATA 1WB9A 5EEGA 1JHXA 2HXSA 4TN5A 5G3YA 1HPLA 3VUEA 4JNCA 4K8OA 1DEXA 3FMIA 2VHTA 3DCIA 3P4YA 2B8EA 2XJ4A 1AKMA 1DRUA 2G63A 4R9UC 4YRRA 1Z4JA 1JYSA 2X4DA 1Z0UA 2GD6A 3H8WA 3ROZA 3U19A 4N01A 3F67A 2JASA 2QY9A 3EHEA 3TBHA 1N5JA 5K45A 4LTMA 2UXDB 2WM8A 3ICWA 3TECE 4D02A 4RTRA 3SC6A 3OT5A 2LCQA 4ARCA 4UXHA 1NMYA 2CV2A 3MERA 1Y1TA 4B74A 3C6XA 3HJUA 3OFSA 2WIKA 4KFUA 4RPCA 2A1TR 5FBRB 3KYCA 4YUXA 5HJEA 4FFOA 5F2NA 4I4TB 3L01A 3O73A 2QQEA 1JIVA 3K8YA 2QTBA 4WWHA 1CJTC 4KVAA 1ISMA 1ES9A 2Z9CA 4IO0A 2PSHA 2Y67A 2WHRA 4O4JF 4FSHA 2FWBA 1GVNB 2EW1A 2B34A 1U8YA 3B8EA 4MPTA 5JSKA 1Y81A 2RC6A 1HYQA 2RK6A 4X24A 2IWRA 5GIPE 3VC2A 1JEQA 1X15A 3WI7A 3UTDA 3VTFA 3NASA 1TMGE 5EL0A 5C52B 1V16A 2WFLB 4GP7A 1YQGA 2HA2A 4L7VA 5GGYA 1YR3A 3W5IA 3CVVA 5F3WB 4QEZA 2W90A 1NMZA 1G17A 4YAIA 2P6RA 4YCAA 2HFKA 3F4KA 5BNWA 1XMPA 3PEFA 1HNNA 2NVBA 5AVOA 2QPTA 1TQHA 2HLDA 4ML3A 3A2NA 1E9RA 4UJ3A 2YR0A 1V95A 2DAPA 3W7AA 2GGSA 3P27A 3WB1A 1E8MA 5FWAA 3WBBA 4JUAA 3O90A 3TKAA 3TL2A 1C3VA 4IVQA 1K5HA 4N8EA 1NKSA 2HBYA 2RJ3A 3IVMA 4H3HB 1N5MA 1P0MA 2K7FA 2IGBA 1EUDA 4INAA 5EZYF 4LSWA 5H4GA 3TI9A 2WT9A 1RW4A 1JWAB 1EFKA 2PBLA 2CB9A 4ND1A 3BYZA 4L0DA 3VYVA 5JHGB 1XRRA 1A50B 1F8UA 5LFAA 2CFIA 1RE0A 1LZKA 2BGRA 1M33A 3ZW7A 4Z7JA 1SHUX 2FUG1 4QGGA 2E5LB 2JFOA 4AS2A 5FPPA 4NCKA 5BMVB 2ZBRA 4G97A 4IR7A 5GONF 4EKIA 4OJQA 1MX9A 4LKOA 5DOVA 5BRNA 2JCXA 5IJ9A 2FSSA 4L0CA 1IYZA 2C07A 2HMAA 3IEMA 4DLUA 4DB2A 4IIJF 4BS9A 3SNHA 4Z1OA 1PO7A 3VSCA 5IBQA 1R5BA 4F4HA 5J2TA 1MOQA 2OBLA 2VOEA 2HF7A 2J0UA 2OKGA 4XE5A 2ZSHA 4X61A 4ZVKA 4CTOA 5T7BA 1G9TA 1OD6A 1VIAA 3OIWA 2VQEB 4NS4A 3OFVA 1FNBA 3DF9A 1R5JA 3IQZA 4KQIA 1N1GA 1E1NA 2J87A 2O0MA 1WXWA 3AI7A 4A6DA 4EHFA 5BY2A 3ASYA 1PR1A 2P3SA 5K6AA 5GIOE 3GEGA 5LD2B 4DR6B 3ZGVA 2AOUB 2QRMA 7AT1A 3GRZA 2IWHA 1YZTA 2C7BA 1J23A 1O97D 2W4QA 3DULA 2E18A 1V2HE 1P6XA 3GU3A 3KNZA 4V02A 4M9CA 1P7WA 4IMIB 3EBLA 2VATA 4N12A 3A1SA 3SOPA 5BN3B 1ZYUA 8LDHA 1RFLA 5FUVA 2ODTX 3THYA 4I1PA 3ERCA 4I1IA 1E0SA 1T25A 2FZ5A 1K3TA 3SQLA 3UKOA 4NJMA 3T34A 2FPGB 3O5AA 1II9A 1XMQB 1TJ4A 2EX0A 3PFCA 4WN9A 3RS8A 1XO1A 3R5TA 4E3ZA 1HGXA 1JILA 1UT5A 4PEVA 2BP7A 2PSDA 3M4JA 3AKCA 1ZIPA 5EWLA 3V46A 1BHO1 2JDIA 5LXTF 4AMGA 1C8LA 4LJ7A 4YCBA 2WBLC 1YS7A 4CV1A 3HXKA 2ATCA 1Q1GA 1XGKA 2HL6A 5EPUA 1XDUA 2XYRA 4B09A 1KI1A 4KWIA 5K3FB 3TG2A 1MAVA 3DJFA 3VZPA 3S2GA 4G0NA 1BE0A 1JNXX 5CYPA 3PEWA 4B4OA 1A2QA 5K0GA 3KXPA 3NHJA 4GXRA 1V4BA 1S96A 2C4VA 1ZJ5A 4GUDA 4UUQA 3ND9A 2P9HA 5FAXA 3S2SA 3UHFA 1N6IA 4NS1A 1CHDA 4NAUA 4E94A 2H4YA 1U8XX 3W8RA 2WMNB 5AP9A 3R7SA 9LDTA 3K8OE 1YO6A 3T9DA 2FEMA 1SHKA 4M46A 4MKXA 1YB6A 4X7PA 4GX2A 3RRNA 2FQ1A 3PP8A 3TK1A 2WWRA 3RVMA 1KEKA 1K75A 1SC9A 2ZE5A 1QHGA 4HR7A 3SZGA 2QRJA 3WL6A 2J48A 4YMIA 3GVPA 3F8TA 4NOKA 2QW1A 5I4BA 2ZAOA 3FPBA 4ND4A 3HJRA 4MK4A 1UJMA 2AD5A 3AIMA 3E05A 4O02B 4XD7A 5CVTA 2V8BA 3H3FA 2X77A 5L4SA 4LJAA 1GJRA 1M83A 1V5IA 3O94A 5IDQA 1QAOA 2BCJQ 2R8ZA 2V6IA 4EYQA 4GOKA 5HZKA 1UQTA 4PC1A 2GZAA 2ZTHA 1Y4UA 1XQVA 1K6XA 1JU9A 3HCBA 2W4IA 3LP5A 4XWYA 3ST7A 3R0ZA 2PKRA 1NPTO 1Z7EA 5AHRA 1T3SA 3FX2A 5ALQA 3PX7A 4J0FA 1QE3A 4R2WA 1KOJA 5AJTA 1M8FA 4XRRA 5HFAA 4KL8S 1K66A 2FR0A 2N1MA 2O52A 2PG3A 2YQZA 4IUBS 4PLGA 4EY3A 4O63O 1DC8A 1QLJA 1HYBA 4K3UA 3VZCA 3FCYA 1GL7A 2BGNA 3L0YA 4TWRA 1L7AA 3OFKA 5SYNA 4B8ZA 5IKMA 3KV1A 1QIFA 2LWIA 3C3EA 5AXAA 1G0NA 2BMJA 4BBPA 3ESZA 3KEMA 4OX9B 2YWEA 5C34B 3BGDA 4QU9A 3SXPA 4CKWA 3U80A 1RQXA 2OFXA 4LXIA 4G0MA 4E33A 3B7WA 1KI9A 3R3XA 5ITVA 1G9XA 4M22A 1VFPA 2J3IA 1XNJA 1YGPA 2M6KA 3A6LA 5EJ5A 2FGJA 1MV5A 1D5WA 1Y8CA 4PLPA 4AXBA 1AMNA 2HZ7A 1QPBA 2Y6VA 1KRHA 4MRAA 1CF9A 3L7LA 3QWBA 3HL0A 2X4GA 4L5AA 2WU8A 4Y7CA 4BNTA 3IODA 1G8KA 4GMXA 1CJCA 4N5LA 4N9WA 4F8JA 4LZWA 1OZGA 4OHOA 2V7PA 3VVBA 4DWVA 1YR9A 4A10A 3R9WA 1TYBE 1R4ZA 1YOVB 1NF9A 4N82A 1FX1A 1KZYC 2WTAA 2P5YA 1KDZA 1QHHA 1PIWA 3OX2A 4LCJA 2AYYA 4HFJA 2GJKA 1DLJA 5F73A 3EXG2 1TYAE 1TAHA 3JYOA 3RUPA 1U8UA 5TE9A 1RI1A 3D31A 2YL2A 3ABRB 3DZBA 4DG5A 3MTGA 1JDSA 4CM3A 3L07A 5FPSA 2RD2A 2C8LA 5TQ2A 4Z1MD 4CNQA 4URXR 3ZE8A 3AM4A 4O2AF 4TVKA 3E9MA 1CE8A 1ORHA 3P4XA 4ZWNA 2LDBA 5I7RA 1AQNA 5H8WA 2FUG6 4EPWA 3AGQA 2QVYX 2ZIUB 2ORVA 3AXSA 1TA9A 3A11A 4LDPA 1ZBDA 1H93A 1NQVA 5T4EA 4KIWA 4UTVA 4ZT5A 3ZHZA 1E3TA 4E13A 4YALA 4RCVA 4XM1A 1V7ZA 3DAYA 1I0ZA 3D3QA 3E7DA 4Q6WA 2EP7A 4G2NA 2O8VA 1GGKA 2E4UA 4EJMA 3RWOA 4LV6A 1XVAA 3HU1A 3MTBA 1ECPA 2H63A 1GGJA 1H65A 1I4DD 1V1MA 3A06A 1KS9A 5LM3A 4YV7A 1D2NA 1NDUA 2BBWA 2HRRA 2QIPA 2ZOSA 3BK1A 4LXHA 1KS2A 1JHPA 3EARA 4KE7A 3BRWA 4OQNA 2D2VA 5K3CA 2IEBA 5A7HA 3SSOA 4QDJA 2D5AA 4WINA 1VHTA 1XAGA 1XD2B 4EEKA 3DBVO 1U3UA 3RK1A 1GSHA 4DN6A 5HXAA 1DQSA 3ORHA 1PFKA 3E3OA 4QVKA 3TW4A 4CKEB 5FTWA 4ABYA 5A03A 1IHYA 1MLDA 2P3LA 2QZ9A 4N65A 2P78A 4NVRA 4UHJA 2OQVA 3TB6A 1U0SY 4E0BA 4N4AA 2OORA 4ZIRB 3FSGD 4XFJA 1HDRA 1U5CA 1ETUA 1F0NA 2VS1A 2YHBA 1G6Q1 1SK9A 3K9QO 2JLWA 2J9FB 3TXXA 4OI2A 4YBZA 4A5OA 1DOHA 4YP9A 2R6DA 2P7IA 2VXOA 3AVUA 1XKTA 3EQ7A 4WOPA 3WWOA 5K3EA 3UANA 1DKLA 1GXSA 3UVEA 1G8JA 3O1IC 4BP9A 1R8JA 3OD5A 3LAWA 4QWWA 3H0KA 1RCFA 4L16A 1E2LA 2C4MA 4OQPA 3TPZA 5AKJA 4ZT2A 1UKAA 4TKMA 4UHHA 1XROA 3WHPA 4ZP1A 1Z5UA 2VHUA 2WZCA 1PJZA 2J7PD 3GCXA 3RRYA 1JDZA 1CUAA 3VA7A 2G4LA 3AVQA 5A5GA 1XEFA 1ZMBA 2C04A 1Z0JA 2JGDB 3IIEA 4ZQGA 4XPIB 4YRBA 1Q7BA 3TE6A 3AHEA 2KBFA 1DO8A 2VJMB 1JECA 2ZQZA 4B80A 1GSAA 2JVIA 3DL7A 4Q4LA 4CLRA 3BULA 3KWLA 4EA6A 1UBMS 2Q9BA 3F73A 1T5DX 3CN7A 1USKA 2OQIA 5GVSA 5B7PA 5I5EA 1ZH8A 2BFBB 5K0TA 4HAIA 2ECQA 2ODNA 1P5HA 3HABA 1XX6A 3JWHA 3P0FA 4L8WB 4MWBA 4L78A 4U2CA 4BJ3A 1UPXA 5JQGF 1DJOA 2IZZA 3DOCA 3R3VA 4IWXA 2KBEA 2DHEA 1GP2A 5C8ZA 1KJYA