2UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
b'SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 71
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ukdA00
2GXUA 3RRZA 2QSYA 3LBIA 1P7CA 3IEVA 2WJVA 1U0JA 2CNWA 2WSSA 1T8TA 1J90A 2RGAA 3IBGA 4WZAE 5TARA 2QQ0A 2ZYVX 3NBYC 3GJ5A 4LCBA 1KO8A 2P6UA 2D4HA 1WB9A 2GEVA 3NHBA 5HR5A 3QXHA 3EPJA 1FX0A 2BEKA 1SXJB 1QVAA 3VTKA 2ZRHA 3IEUA 4TN1A 4ESHA 3C5CA 4HDCA 1GP2A 5DISB 1E2QA 1GRNA 1XJCA 4NYIQ 3SDZA 4C4PA 4LV6A 2PMKA 3TUJC 3H84A 2HV8A 4LY6A 4BRWA 4BFVA 1P9RA 4OK3A 3RVBA 2IL1A 3TKLA 3NG1A 4TQUS 5EZ5A 4JJKA 1SKYE 3AUYA 4PTLA 1W7AA 1CTQA 3N2EA 3PUYA 4I1OA 1G3MA 4PPGA 3KKNA 2O8CA 4AKHA 3HU3A 1ZM7A 2NPFA 1CS4C 1U2RA 2RKOA 3BIFA 4TYQA 1BS1A 4ZDKA 2FPLA 4DB2A 5G40A 5FH9A 4OBEA 2F3RA 4AD8A 1OSNA 1OFIA 2ZRMA 3U3JA 4AY2A 2OUKA 4JLJA 4P4SA 1S2MA 2ONJA 4I1UA 4B44A 4PQFA 3BXZA 4RD6A 1HA3A 4DCUA 4MGYR 1Z0FA 3E5HA 1XF9A 1XTIA 3FKSA 4LHYA 5J5CA 4DC9A 4EPVA 2CXXA 1SQ5A 3EZ6A 1B0UA 2ZI3A 4Q9LA 2PCJA 1CF4A 3K09C 1R5OA 3QXJA 4LC0A 4QJ5A 4M9SA 1Q44A 3NC1C 1DAMA 2DWQA 1ZCBA 2ZUDA 4UNRA 4F91B 4KJZA 1E9DA 4AYWA 3DOFA 4OK6A 3VU9B 5JS8A 1G6OA 4OHVA 2UZIR 2WMNB 2AX4A 3M1IA 2VF8A 4US1R 2B8TA 3CX8A 3TW8B 3NH9A 2ZRAA 4CEJB 1U90A 2IXFA 2MMGA 4B32A 2C98A 2J1LA 5LDDC 2WKRA 3SHWA 4JBYA 5K8IA 2ODEA 5FOUA 4XIGS 3WXMA 3HDTA 3MWKA 1Z0KA 5EP3A 2FFHA 1U98A 2WWGA 3B13B 3SFVA 4LWZA 2AWNA 5BN5A 2VHUA 1EX6A 3UG6A 3MMPA 5HZHA 4BQSA 2FGKA 1KJWA 2VF7A 2H17A 2H92A 1VG1A 1UF9A 4EFMA 5CDFA 5JCPA 4TLBA 1KKMA 2CCGA 1COWA 4JL5A 3THWB 2BBOA 2VSFA 2NQ2C 2IT1A 2R6FA 1BH2A 5FPTA 3KZ1E 1QRAA 1W2HA 2CNWD 2QROA 2QQEA 2WSSD 1TMKA 1GG2A 1JNYA 4OQNA 5KNCA 1HT2E 2WZQA 3N2IA 1WXQA 2QMOA 3PUXA 1AZSC 2KSQA 2P5SA 1XB2A 1OXTA 1US8B 1U8ZA 1KI4A 2G83A 3FMOB 1P62B 3ZH9B 4DDWA 2Q9CA 3QEOA 5CK5A 2IYYA 5BWMA 5EQTA 1MR3F 4PHFA 1XEWX 3IIKA 3CIOA 1TF2A 3KL4A 1G5TA 1NN5A 3RAPR 4KAXA 4HAXA 1OHHA 3T1VA 4QGAA 4ZKDA 1Z07A 3NDBB 4ZCMA 3GD7A 1Z8FA 2IYQA 2J0QA 4B47A 1R7RA 3KFVA 4O3MA 2YOFA 2G77B 3EX7C 2O8DB 4LK2A 3W34A 3LA6A 5CYOA 3GLGE 3EZ9A 721PA 2Y8EA 4LPSA 1Z22A 3QKRA 4KFUA 4D0GA 2QY9A 2ZSDA 1ZP6A 2ZPTX 1RRGA 3AVTA 2WWWA 4DCNA 3FKSD 1KSJA 2NO7A 2PLFA 2VSXA 4I1SA 3PEWA 1HEIA 1OXXK 3SC3A 4UJ5A 4EFNA 5J4LA 3ASZA 1L8QA 2R8RA 3P32A 4QHTA 5CLQA 1KKLA 4BFSA 4M22A 4TYNA 4M4SA 1KO7A 1FUKA 4E07A 2IXGA 3T1OA 3ADBA 2FSFA 5KSPA 4Q9HA 1OIWA 2ZRLA 4NYMR 3UKDA 3W5JA 3GLFE 2C9OA 4GMXA 3Q5EA 1G7RA 3FOZA 2FPKA 2WSMA 3IILA 3KKQA 3P1JA 4FCTA 3X1XA 4Z54A 3OEHD 3I73A 3W90A 1KK3A 1Q12A 2WOJA 3WHLA 4CT4B 3LQQA 3I32A 2XZPA 4Q1DA 3AVYA 2FV8A 1GKUB 1A5TA 1WF3A 1GL7A 1IBRA 2WBLC 1H8HA 2QRZA 2EFGA 4W5HA 4XVRA 3WP0A 1SXJC 4BFWA 1CJMA 3B6EA 3RS7A 4D0LB 4P33A 4PR0A 3KUCA 3TMKA 2WJIA 4MDEA 3OAAA 3O8BA 5J4HA 1N3BA 4CYMA 4N0EA 4LX0A 2C5LA 4QM7A 4RD0A 1EESA 3RRNA 1Z6TA 3MD0A 2QL6A 1COWD 2G3YA 3JZMA 3K70B 1M8PA 3I5YA 4A4DA 2R44A 4DLXA 3R8CA 4D6PA 3RRMA 2FEMA 4POAA 3EW9A 1Z0JA 2RB4A 2OG2A 2C96A 5JJIA 4BWYA 2VP9A 2XNSA 1DEKA 1XZQA 5IT5A 1ESNA 2WVJA 3GPLA 3LX5A 2ZRDA 1TF5A 2P65A 4IEEA 4LJ6A 2EU8A 3ZJYA 4D81A 3REFA 3CRVA 1R0XA 1LVGA 2EW1A 2QT0A 3GFTA 4KI0A 1HT1E 3BBPA 3WNCA 1OFHA 3TQCA 3VAAA 2O8BB 2AHOA 4M9ZA 1IN6A 2G6BA 4FWIB 1E32A 1SHKA 1E2PA 1OHHD 1TNDA 1M7HA 2V1XA 2RGNA 4HUQB 5CLLA 3QPUA 2C8VA 5EXXA 3UMRA 2IHBA 2OE2A 4PAMA 1Q21A 2FH5B 1FP7A 5L3SA 2XXAA 2GF0A 1TPZA 4QBGB 5IK2A 4QNMA 4NCNA 1AS3A 1DARA 3QUSA 5SZHB 5JLJA 1WQ1R 1E6CA 1YR6A 1F6BA 5FOVA 3UXMA 4Q7JB 4BE7B 3A4NA 5HE9A 5KOYA 4M1SA 3GLGA 5DYGA 4ZKEA 1XD9A 5HPYB 1JJ7A 2X77A 3J81k 2JJ8A 2QPTA 4Q4AB 1G21E 4KYIB 1JJVA 3PJRA 5E7MA 1RC8A 3AH8A 4A0RA 1E9BA 1CRPA 2ZROA 2W2VA 2YWFA 4RZ2A 3LD9A 3QQ5A 3X2SA 3HU2A 1TEXA 5KSOA 1W0JA 1JQJC 3TUIC 3UANA 4QNRA 1ZUNB 2FZ4A 4WA7A 4LSGA 4MYCA 2ZTSA 1GUAA 5ELXA 1IJEA 5CM8B 1OXVA 2OM2A 3UWOA 2A5GA 1KIMA 2ZAMA 1KI1A 4R9UC 2BC9A 5JJKA 2CJWB 4JLNA 2V55B 1S1CA 4H9GA 5FFMA 2C03A 2RH5A 4DIEA 2GWHA 2JJ1A 1O87A 1FUUA 1PLKA 2OO7A 1XWIA 4OHWA 5JFGA 4JBWA 1I4TD 3GFPA 3KXKA 3K0FB 4BRUA 3EC2A 2ORIA 2YVUA 4UNPA 2QG6A 4JVNA 2F1RA 1OH6A 4C9BA 3B1YA 5GJBA 2QNRA 4HZUA 4Q7KA 5HZKA 5L3RA 1H8HD 4LV5B 1P2TA 2BHRA 2OZEA 3AKCA 4PPFA 3RSLA 2HXSA 121PA 2XGJA 4NYJR 3LW8A 2R6DA 2WHXA 4EPWA 2J45A 2QBYA 2FG5A 4JKIA 3R9IA 2V9PA 4HI0E 5AUNB 3OAAD 1VYTA 4TWZA 3FTQA 4LDJA 4MRVA 1Z28A 1UDWA 2QPAA 2OXCA 4DB4A 1VIYA 1NIJA 1G4AE 1XTQA 4JVMA 3FMIA 1IN4A 5K8UA 2H18A 3T34A 5LD2B 3QXCA 3GJ8A 2JLVA 4YQFA 3ZZTA 2QM8A 2O0KA 4MUAA 3CPJB 4TL7A 4BFZA 5KNDA 1N6KA 2BEJA 2ZI6A 3OE7A 4DLYA 1G3RA 3PIRA 4XWKA 4DLUA 4A6XA 1Z83A 3DM9B 1RKBA 3QJYA 4AI6A 4CZ2A 2GJAA 3TJZA 1D2MA 4AKIA 2YWHA 2Z5FA 1PZNA 4BUJA 3OIYA 2IEYA 1CJKC 5FI0B 4LYHA 1VIAA 4Q1CA 4HB3A 4W5JA 1Z6YA 4ASUA 1GRRA 1W4AA 3B1VA 1GFIA 3LLMA 1NY5A 4XTRA 4R71A 3L0OA 2ZI5A 1G8GA 3AQ4A 4MKFA 1V5WA 3U7EB 1KK1A 1PVOA 4DHEA 3PCRB 1G5PA 1EWQA 3FYHA 3LFUA 4HEJA 2BOVA 4Q03A 4RFSA 3S1AA 1D6JA 2Q3HA 2DBYA 5FTMA 5E7IA 4MRRA 1VYUA 2ODBA 1EFHA 2K5UA 4H1UA 5JWOA 1KGDA 4K81B 2HEIA 5F98A 2IYUA 4Q9JA 5AJVB 3A1SA 3AKDA 5DI9A 4HB4A 4ZIRA 3CWZA 5D3QA 1KMHA 2JLWA 4FMDF 3A1UA 4C0BA 3KQNA 2OSBA 2GAAA 2WJYA 3T5GA 4DSUA 1XMJA 3U7GA 4DSTA 1VDZA 2JIZA 3PUWA 2FN4A 4LI0A 1W0JD 2W6JA 2W0MA 3FKQA 4PC7A 4ARZA 2JAQA 2ZYWX 2PL3A 1V43A 1G17A 3GJ7A 3TR5A 1K6MA 2CLSA 4G5RA 2H1LA 4IDQA 2FFQA 3VHXA 4TYWA 2ZRNA 4EFLA 1AQYA 3K70C 2QAGB 4HAWA 4DLSA 4C7OB 2FMXA 2JJ1D 1I4LD 3IQXA 2QORA 4CDGA 3WYGA 4OHXA 5K8TA 3CF2A 4LHWA 1N6OA 4RZXA 1U9IA 3BH7A 4RSGA 5JS7A 1YJ5A 2O0HA 2ZJ2A 4KHZA 4DZZA 3RS2A 2WAYA 5BN3A 3HWSA 4M2LA 4WBSA 1FNMA 3NBFA 4L9SA 4TLCA 4MKHA 3V4RA 3IPXA 1FX0B 2YV5A 4QJ3A 1ZMXA 5GJVC 1G6HA 4US2R 4A8JA 3C5HA 4TL8A 3DPUA 4HAZA 3NIBA 3ZVNA 3RS4A 2XNDA 3FMFA 4IDPA 4HLUA 4MRPA 4F4IA 1N6HA 3TSOA 2BM0A 1M1YE 1SULA 4Q1FA 1RVDA 1W49A 1X1SA 3K1JA 2FSGA 2F9LA 4RCZA 1OH5A 2OCYC 2HJGA 4LHZA 1NLFA 2QUZA 4KITB 4B3GA 1E0JA 3ZQ6A 2WWXA 2A2ZA 5JECA 3OE7D 2D74A 1GSIA 2O8CB 3KJEA 3BE4A 1OB5A 1N5JA 2GBLC 3FWYA 3GLHB 4GMDA 3LH5A 4MYTA 4BZPA 3PFIA 3T1TA 1LY1A 5B64A 1EFTA 1MO5A 2FWRA 5GVRA 3ZD7A 4PC1A 2JJ2A 1P9WA 4DEXA 3BJIC 2QENA 2V6JA 5LBIA 2XB2A 1CU1A 3BOSA 4YONB 3I4LA 4MKGA 4PFSA 4BASA 1ZVQA 3ZD6A 4DT1A 1J8YF 1Q57A 2QRNA 3EZ2A 4Q1BA 4IJMA 3TIFA 1D2NA 1LS1A 2J87A 3B5JA 4X8LA 3WYAA 3A4MA 2IYXA 4BLSA 4AKGA 3B78A 4EJSB 4JT4A 4FW9A 4Q01A 4UQOA 1XMVA 5SZJA 1OJLA 3B1XA 2FF7A 4OI0A 1XMIA 1KO5A 3SJZA 1Q1EA 1Z0IA 2I4IA 3B9PA 2VP5A 4TQ9A 3MRSA 2ATVA 3TUZC 4L5BA 3BFVA 2ZRCA 4UNSA 4MKIA 2VTKA 1CR2A 2GDJA 3N70A 3ICQB 3DM5A 2JIZD 3C16C 1G3IA 1E2HA 5J4KA 4FXPA 1G19A 1G7TA 2W6JD 3GCGA 4A6PA 3ZVLA 4PANA 1N5LA 1T3HA 1KNQA 4DRZA 4GSYA 2D06A 4NCIA 2HF8A 3BS4A 2Q3FA 1IM2A 2BCJQ 1XEXB 3EPLA 3ADDA 1KI6A 4MA4A 4WIAA 1AKEA 2J9RA 3MGCA 4WOPA 5JI3E 3CPHA 3BERA 4OJQA 5KDDA 1W4CA 3AKYA 1ZW6A 5L3VA 1ZC4A 4NH0A 3TR0A 1NLZA 2D3WA 2QMHA 4O0MA 1ZRHA 3CRQA 4AG6A 4TL9A 2BMEA 1XCMA 4YDHB 4Q4HB 4EAQA 3AF2A 1OT3A 3B8HA 3PEVA 1Z0DA 4C0KA 2OEPA 1OLOA 3THYB 1Z63A 2KWIA 4A2WA 1NN3A 2ZRFA 2QI9C 2XNDD 4IVRA 2RCNA 2GVDC 1HE1C 2P3SA 1XXHE 2GCNA 2HXYA 5JSZA 3IHLA 1YRBA 4OL0A 4DLWA 1W5SA 2GCOA 1D8TA 1FFHA 1ZU4A 2GJ9A 2ORVA 2ZUBA 4HLCA 1W4RA 4LYJA 4WXRA 1C1YA 3T35A 3QEJA 5FOTA 2DY1A 3W8RA 4V0NA 1DAGA 5AUPB 4D4KA 3K9LA 2ZANA 1G4UR 2EQBA 3FMPB 4G5OA 4WZBE 2R65A 3FPAA 3QKRB 2JJ2D 1VMAA 5DI3A 1KDRA 2IUTA 4GZMA 4MUBA 5FPYA 3K0AB 1W36B 1OFTA 1D2EA 4QM6A 4Q4JA 4AWXA 1YR8A 1HE8B 5E7JA 3RS5A 1AIPA 1K5GA 3QNUA 3ZVRA 3LO5A 4M1TA 3W3AA 2C77A 3NVAA 4TYYA 4EQ6A 2NOAA 1OKKA 4ITRC 1Z47A 1P73A 2GXQA 2YHSA 4E22A 2QP4A 4JSTA 4PZYA 2ZE6A 4CEIA 4J0QA 1KAGA 2XB4A 3HPRA 4URUR 3C7KA 4BPBA 1XD2A 3FHOA 2QAGC 2ZJYA 3B2EA 4LYFA 4KU4A 3X1ZA 1Y3AA 4NZYA 4NKRA 4CVNA 3T61A 1R8QA 3L82B 2GCPA 4M1OA 4P4TA 2ZYTX 4JT2A 1II0A 1E2LA 4CEHA 4ZCIA 4RY2A 1XEFA 4JIMA 3ADKA 4LJ8A 5KUTA 1ZUHA 2RGDA 1IN8A 4B2IA 3IIJA 3A8TA 2DB3A 1DS6A 2FE4A 4D2IA 3VKHA 1Q3HA 2GZDA 5KPDA 1AJEA 2GF9A 2CK3A 3VMFA 2WKQA 4NBSA 4B48A 3CH4B 4D80A 3DO6A 4JLMA 3NWJA 2AD5A 2V8OA 2XITA 3F0TA 1KAOA 3KJIA 3DVLA 3I8XA 3H2YA 3LBNA 4URZR 4BFUA 2ZR0A 4HUTA 5B2ZA 5TVKA 1SVIA 2A5FA 2KBEA 4GOXA 1RIFA 4YXWA 3SJBA 1K5DA 1SVMA 2ZVQX 4KLZA 1KMQA 5CK4A 3UATA 3QPVA 3Q72A 2IS6A 4YMTA 2OLKA 2VYFA 3ECCA 2PJRA 3RS3A 1Z6AA 4WVFA 4BFTA 5C4GB 1SVSA 1VG0B 2ZR9A 1XPOA 1TF7A 3KQLA 4M1YA 1F2TA 5G41A 4PSKA 4U5XA 3U4QA 1OPXA 5DNYB 1ZNXA 2Z6VA 2DCUA 4KVAA 4AURA 1XXHA 4C2UA 3P4XA 1YHNA 2HT6A 1MT0A 3KFXA 3TSZA 1AN0A 3GLIB 2A9KA 1K8RA 2Q6TA 4EJSC 1RJ9A 1ANKA 3NEJA 1HURA 1TU4A 4C0HA 1LV7A 3DKVA 5IF9A 1NMZA 3QBTA 3GJXC 2ODWA 3UMSA 2HUPA 4LOAA 4YMVA 2RAPA 2J7KA 1T8UA 3GLGB 3R9WA 2O5VA 2GNOA 1GOTA 3W3ZB 1YZUA 2J0UB 4QBFA 4M1KA 1DO2A 2AKYA 1TU3A 5JRZA 3AVOA 3EIQA 3GJ0A 3OEHA 2EFHB 1Z5ZA 2RHDA 4K8OA 4OI2A 1RFLA 1CJTC 2HCBA 4D4LA 1L7VC 1YKSA 4U7DA 1OKKD 1ZINA 4RKEA 4AIIA 2PEZA 3AVWA 5H1YA 4B34A 3RSOA 4W9MC 5BN4A 4C2TA 5EJEA 2R9VA 2UZ3A 2YOGA 3BH0A 5FOWA 4GFDA 3KQKA 2RMKA 2OFXA 4NYJQ 3K09A 1P2SA 2YYZA 1IAQA 2F7SA 2ZIAA 4WXPA 3SEAA 3E1SA 3JZAA 5HE8A 2YINC 1KI9A 3GLFB 1OXUA 3HR7A 1E2EA 1T91A 2EWWA 3O47A 2WKPA 4QOSA 1M7BA 2WWIA 2FJUA 4MGZR 5KTYA 3R7WB 3E70C 1YZTA 2DFLA 2F6RA 4HZUB 4WAUA 5FUXA 4XSGA 2QP9X 4IDNA 4M0LA 1HTWA 1TAGA 5HTKA 1RYHA 4KSCA 3VX3A 2ZJAA 2QBYB 2CK3D 4GL2A 1KZGB 2REBA 4CIDA 2CEAA 3AP3A 4P0TA 1GTVA 3RDPA 1T5LA 3FE2A 4DBLC 2FSHA 1IY1A 1ZIPA 3NH6A 4OI4A 1E2IA 3SYKA 2GK7A 1IXSB 2ZS9A 1AZTA 1UBCA 2A3RA 3BB3A 4QG7A 4YXWD 1WMSA 1ZD8A 1AGRA 1S8FA 2GETA 2HLDA 2MSDB 3ETLA 4JVLA 1AQUA 1ZM4A 5AJXA 5TB5A 2ZSEA 3WRXC 1AS2A 3LY5A 3VFDA 2JLUA 4DSNA 3V9PA 2YC4C 2MSEB 4BEJA 4PHTA 1ZM9A 1NNEA 3QF7A 2CL7X 2D2FA 4G3XA 2BV3A 4RCYA 1IY2A 2OAP1 1A2BA 3RRYA 4F38A 4ZI2A 1NKTA 3WNBA 2J7PA 1W36C 4QBIA 3K9NA 3SU8A 4B3FX 1YR7A 3CLVA 3GJ4A 1DVRA 1R8SA 4UJ3A 2QTVB 4BLOA 2P5TB 2YJTD 2ODNA 3REGA 2NZJA 2O0JA 4M53A 2GZHA 1CBUA 4Q9IA 3KKPA 2PT5A 2KBFA 1TQ4A 1P75A 4MYUA 4RFSB 3RLFA 1E9EA 4JLVA 4FI3C 5JEEA 3FVQA 4TT3A 3RWMB 3L43A 4AK9A 1GL9B 1KI2A 3VR3A 5EXTA 3TAUA 2QGNA 5G3ZA 1QHNA 1KK0A 4B76A 1VG9B 1N6PA 1UEIA 4MRSA 1P4SA 1E3MA 4B2LA 5FPHA 2BIFA 1OV4A 1DOAA 2NG1A 3QF4A 3CX6A 1UEJA 1FNNA 4G1UC 2ZI9A 3F8TA 3X1YA 1GILA 3THXA 1E94E 4D25A 2XOKA 4N3NA 3TLXA 4ZI3A 4DEYA 3AKEA 4ARZB 1LW7A 4Q48A 4V03A 3H4MA 3TSWA 3VR2A 2F1JA 3LQRA 4PZZA 4GPTA 3TE6A 4C30A 2CLDX 1NN1A 2C9YA 1ELOA 3I62A 3QY0A 4MH0R 2OILA 5G3YA 1WBDA 4PHGA 2AXPA 1BO6A 2OCAA 3CBQA 2FNAA 1M6NA 421PA 2ANCA 4KXFB 2VA8A 2HYDA 3OZXA 3RABA 2IEZA 1IOZA 1E9AA 1NKSA 3I92A 1I4DD 2N1BA 3K0SA 3JVUA 2DFTA 3CRMA 4GOKA 1MO6A 2L0XA 2RGEA 2F55A 2R62A 3NC0C 3W6NA 1E96A 4QHSA 4EPXA 5GJWC 3RC8A 2F43B 5LPNA 1Z3IX 1PUIA 4GZLA 5FBQB 3HU1A 2HYIC 2ZRIA 1M74A 4KFRA 3QKUA 3LXRA 2EWVA 2JGNA 1CJVC 4Y0AA 3U61B 2E1RA 3CF6R 2WIBA 1M7GA 1NG1A 1DPFA 3ND9A 1RRPA 2AXNA 2Z4RA 2XJ9A 3OESA 3D3QA 4IOMA 4US0R 3LAWA 1P72A 2X2EA 2NTYC 4PZLA 3A1VA 3ZS9A 5FR2A 2HLDD 1II8A 5FBLB 2ECKA 1FW6A 3QKSA 4UXIA 3TAHA 3VKGA 5M04A 1G3QA 2GTPA 4LGMA 5AK0A 2XSZA 2ORWA 5FBWB 2O8FA 2ZJZA 3CPEA 2J7PD 1T0JB 2KJQA 2ZJOA 3B7GA 1KSFX 2H7VA 2BKUA 3U3RA 2PZGA 5DN6A 4ZDJA 1P2UA 4RZUA 5JHGB 1MH1A 1FQJA 1CRQA 1DAKA 1UBFA 1VYVA 4EPRA 3CX7A 1ZNYA 3BK7A 4HDQB 4DT1B 3CR8A 3AVXA 4QRHA 3TVTA 4II7A 3CRW1 1JI0A 1S9DA 2ATXA 1OYWA 2PZFA 3FFBA 4FWTA 3UPUA 4TT3D 5JMTA 3A6PC 4ACBA 3ZYCA 4G01B 3NEYA 4G5GA 1KNXA 2B6HA 3EAQA 3DZDA 1G8FA 2VH5R 2ZSAA 4XVQA 4TTRA 2IXEA 1E4VA 4RZ3A 5E4FA 2PT7A 4IFBA 4TQAA 3VU9A 1WA5A 2EYQA 2VIIA 1XPRA 4YC7A 3I61A 2B7CA 3EA0A 2ZQ5A 4QXAA 3GJ6A 4KBGA 4B43A 2XOKD 2ZJBA 4B3BA 2WJGA 1OB2A 1GZSA 2OLJA 3Q8XB 4URYR 1ZYUA 5D3MA 3KTAA 1P3JA 3MJRA 1W44A 4QL3A 4ERNA 2PX3A 1XEWY 4OI1A 5AJYA 2MSCB 2WOOA 2ZYUX 4QGFA 1GITA 1JQLB 3HR8A 1KY2A 3WRYC 1NLYA 1NSFA 2GEUA 1Z6GA 5FL3A 1YZNA 3MWYW 3IO5A 3THWA 3G82C 3OIVA 5FTJA 1D9XA 1GIAA 4F4CA 4TLDA 4YDSA 3PR1A 3K53A 4DJTA 1GDDA 3WMEA 3TQFA 1T3LA 1BMFA 1OW3B 3IPYA 4URXR 1X6VA 1T9HA 2LWIA 5TMPA 1YZKA 3A37A 3I1FA 4DLTA 2CLCX 3HPQA 3ICEA 1YR9A 5JSZB 3A36A 4AYTA 4L4UA 5FBVB 4XOIA 3B9QA 4DLVA 3ZZ0A 1ZNZA 3BH6A 2CE2X 4TZ6A 8OHMA 2QPOA 4DWJA 1NL3A 2VP2A 3LV8A 2ZRPA 3W6OA 3CH5A 1OE0A 2WMOB 3BC1A 1H8EA 4GT1A 1JR3A 2IF0A 4I99A 2XSZD 1JEDA 4V02A 2ZRJA 5DI3B 4TTQA 3QVUA 5DN6D 2CHVA 1MKYA 2O8DA 4Q4JB 4NE2A 1JR6A 5KO2A 2WWFA 1F5NA 2RHMA 4V0MA 3TRFA 2B92A 3IHWA 3M4YA 3SBEA 2H8KA 1NRJB 4Z1MA 2F9MA 4PAOA 2JLZA 1U0LA 4OK5A 3R9XA 4PC2A 4PPQA 5EE0A 4EQ6B 5FR1A 1QDEA 5EZ6B 1HUQA 5UKDA 2H16A 1E0AA 1KDOA 5EP1A 2AKAB 5DYIA 2HJVA 3IBYA 1E98A 4CRWB 3SE0A 1KJZA 5BYKA 4LHXA 4ABYA 4M1MA 3AGPA 3LBHA 1OXSC 2YNMA 5FPKA 1AK2A 3KQUA 2FSIA 1W48A 2BBSA 4P3YA 1PV4A 3AVVA 1D9ZA 1KJYA 3C41J 2FFAA 3MAAC 5GADl 4GBMA 5CIQA 3TK1A 3WMGA 2W83A 2ERXA 3AGQA 3PEYA 4Q4LA 2G1JA 3LVQE 1IHUA 3K9HA 2FU5C 3K0CC 5C18A 2GKSA 2QMUA 1HQYE 2GAOA 1FTNA 3FGNA 3SI7A 1DG3A 3P26A 1U8AA 2QE7A 2IYVA 4L15A 3MG9A 4DDUA 2IWRA 1GKYA 1UBGA 5SZIA 5EUMA 3Q3JB 4NMMA 4RFVA 5P21A 3U44A 1R6BX 4U02A 2Z0MA 2YC2C 1YZGA 1R0YA 3PQCA 3L2OB 1TTTA 1ZAKA 4XD7A 2BJWA 2FGJA 3EPKA 1PUJA 2DFNA 1XX6A 5CJ2A 1S1MA 2VEDA 4ZPXA 1J70A 1RRCA 2KB0A 3EWAA 5BXQC 2PH1A 3C4JA 4HAYA 4DLZA 5BW8A 2OFOA 5KU1A 3THOA 2G0NA 3EIEA 4FIDA 2BMDA 1BMFD 1G20E 3CNNA 3N5CA 3WBKA 1F48A 2DFKB 4ACAA 3SYNA 4YMSA 2W2XA 4QGHA 4QJ4A 4W5WA 3TH5A 3R8FA 3TBKA 4HB2A 4LJ4A 1UM8A 1CJUC 3VR4A 3D8BA 4GOJA 4P4SB 2V6IA 1Z0AA 4PHHA 4RJLA 4ZV4A 1N6IA 4EIWA 1MOZA 2FOLA 4LHVA 3ZS8A 2VLIA 3DEFA 3FB4A 1NVWQ 2BWJA 1VG8A 3QXXA 1FPMA 2ZI7A 1XJQA 4C0QC 4RD3A 2HT1A 5DHAA 4KFSA 1H8ED 1W1WA 3NKVA 3IQWA 4MGKR 4HUQA 1JR3D 1QHHA 5LB2A 2AK3A 2XJ4A 4V0LA 2C99A 4NDZA 4TLEA 3U5ZB 2GBLA 4BZXA 1KOFA 1QG2A 1XP8A 3IDQA 1KHTA 4F92B 5J47A 4PQYA 4Z1MD 5KDLA 4JLKA 2JLRA 1MABA 1KDTA 4Q4AA 3AF3A 5CIWA 2TMKA 1CXZA 2PJZA 3BAFA 4KBFA 4LBYA 4HLQB 4LBZA 1P9NA 621PA 2V4ZA 4QC2A 2VQSA 1MV5A 4Q47A 3NDPA 4B3CA 1DAEA 1J99A 1LNZA 1LF0A 2O8EA 1G291 2VHQA 3W8NA 3RANA 2J3EA 1SZPA 1W47A 3A4LA 2ZSFA 1DELA 2IHYA 5LD2C 5DO9A 3O8RA 4A0GA 3PVSA 4V0OA 1HH4A 3DOEA 3PENA 221PA 3K0FA 1A7JA 4MDFA 1OYYA 1DBSA 5JI2E 5F9FA 4JL8A 1UKEA 2QM7A 3VHLB 4F7WA 2ZE7A 2QE7D 5K8LA 1ODFA 2J0SA 4R7ZA 5GJCA 3KKOA 4GI7A 4BECA 1MRSA 3CO5A 2EFCB 2CL6X 2OXRA 5JJLA 1NVUQ 3LNCA 2CBZA 3SHFA 5HCIA 1E99A 3TNFA 1NJGA 4GP6A 4UNNA 1LTQA 3KDSE 3GEIA 1EGAA 2C04A 1P5ZB 5FOXA 4XD7D 3K70D 1XTJA 5FOSA 1CLUA 1N25A 4NCJA 4OQFA 1E9CA 4LV8B 2IA5A 2WPDD 2G9NA 4DVGA 1ETUA 3KXLA 3ND8A 2NO6A 1HYQA 5DSZA 1SKYB 2FEOA 3CW2A 2WJHA 2QT1A 4LRWA 1JALA 2V1UA 2DWPA 4JLOA 1N0VC 2O52A 3BB4A 3SJCA 2ZR7A 2ZSBA 1IN7A 3IKJA 4B35A 4HDOB 4D26A 2R6GA 1NBME 4IOJA 5CYPA 2ZREA 3AB3A 2YWEA 1KO1A 2YWGA 3GFOA 4IDHA 1T6NA 4IOKA 2CHGA 2OBMA 2EFDB 4OJKA 3HYTA 4LJYA 3AVPA 3ONWA 1ZUIA 2IF2A 1AM4D 1W46A 5IRCD 4DDTA 3MWJA 1XU4A 1PLLA 1ESMA 3DMNA 4DXAA 2ZE5A 1Z08A 1S3SA 3SQXA 4Q5IA 2VP6A 2C2HA 4LJAA 4AYXA 1E1QA 4HAUA 1CP2A 1NIPA 1ZNWA 3MJHA 3CNOA 3V00A 1FMLA 4I81A 1JEEA 4RD1A 2LKDA 5C46F 4EPTA 3RHFA 3R20A 1N6RA 1RRFA 2DYKA 2IYLD 5AJZA 3B1WA 1GNPA 1LB1B 2IS2A 3F5FA 3RWOA 2PMDA 4A82A 5L8VA 4XWAA 2NMVA 2GILA 3BD9A 1ZU5A 5JWHA 2D2EA 4NCKA 1IQPA 4E09A 5GVSA 2XZLA 3SBDA 3EG5A 3UG7A 2QZ4A 2NPIA 4R2IA 2J59A 2AD1A 3M0EA 2RGCA 2B21A 3WP1B 1EK0A 1SVLA 2PBRA 2XZOA 1GNRA 3B60A 1OF1A 3UWKA 4MRNA 1GVNB 2ZM5A 1T0HB 5AJWA 1P61B 1N5IA 2EVWX 2Q21A 1R4AA 4P31A 4XVUA 1WBBA 4JS0A 1A2KC 2OCPA 3TVDA 3Q9LA 2NO0A 2JLXA 4EPYA 2QTFA 3BORA 4C7OA 4RVCA 1VCMA 5KPJA 2PX0A 4TMXA 4DCVA 3P27A 2WTUA 1NVXQ 5F2EA 4D0NA 1U0HC 3P20A 1E2KA 3QPWA 3DDCA 2AWOA 4KLNA 1R10A 4FMCB 1DAFA 3C8UA 1KDPA 4TMTA 4KSBA 2Q9AA 1CEEA 4C0AC 2PZEA 1ZJ6A 2J5XA 1AS0A 4B74A 1YZLA 4PSAA 5EE5B 3HP1A 5TV2A 2IX3A 4N1AA 5JEDA 5JRJA 3Q5DA 2A5YB 3CM0A 1T4GA 4Q9KA 4X8HA 4B6FA 4IXMA 4XSHA 1PLJA 4L9WA 1Z29A 1TUEA 5TY0A 4OYHA 1G41A 4LZZA 2FFBA 1ONBA 3EWSA 4LJ5A 1S9HA 2F1HA 3B1ZA 1HV8A 1II8B 1GWNA 4BLPA 2V7QA 2BKEA 1ZCAA 1XBTA 5DIFA 3QKSB 1E9SA 4MQBA 1FTSA 1KTVA 3CF0A 4E5UA 4A2PA 5L3SB 2XXAB 1EFRA 2O8FB 2BMJA 1TQ2A 1IJFA 1FQKA 2GA8A 2I1QA 2NO9A 3LLUA 5G53C 3GLHA 6Q21A 1NP6A 5FL7A 4LBWA 1NBMA 1YVDA 1IXZA 1ZBDA 3ZVMA 1KZ7B 2P6RA 2SHKA 1XTKA 1S3GA 3LXXA 2MMCA 3CWQA 3JVVA 5F3WB 3MWLA 3OEEA 5AR1A 4FCWA 4TMWA 4XTCS 1YRAA 2PCLA 2ERYA 3PV0A 5C4MA 4YMWA 1FOEB 1N0UA 2B8WA 1E1QD 2X8AA 1YU9A 2IYRA 2FDCA 1F60A 2QN6A 1KI8A 4PC3A 1WDTA 5EP2A 3RYTC 5KNBA 3H1TA 2IYSA 1E2JA 2CL0X 3OIUA 4EJSA 2J46A 4JJZA 5AUQA 1DAIA 3SN6A 4BFXA 1XDBA 1OIVA 1G7SA 4B6EA 3OHMA 3EPHA 1FMJA 4JL6A 5HCNA 2Q9BA 4B33A 1JBKA 3U3OA 5AUOB 5JHHB 4OHYA 2GRJA 3MCAA 3ASYA 5D3MB 4MYHA 1W5TA 2AR7A 3KTAB 4N0DA 3MUFA 1F2UA 1ZM3A 2C9CA 4TL6A 3RC3A 3GQBA 4BEBA 4V0KA 5TDHA 2W00A 4KVGA 1SXJE 2JDIA 2GK6A 4LYAA 3CR7A 3SNHA 1XEXA 3DHWC 1QZXA 4M8NE 1UPTA 2ZVPX 1SVWA 1X8KA 3HJNA 1WE2A 2OCBA 1RYFA 3QIAA 3ZGXA 5IHPA 4K46A 2W6IA 4A9AA 4PX9A 2VHTA 5DGXA 3EZ7A 4LBVA 3SS8A 5B57C 1QBKC 4LUCA 5J40A 4Q4HA 2QMEA 1BIFA 2GXAA 5KHOC 1QHYA 4Q66C 3U7FB 3THYA 4B3DA 1N6LA 1EWRA 1YE8A 3VQTA 1W4BA 1T3SA 2GHIA 1UBEA 5FBRB 5KSYA 4A0HA 4IFEA 5EE1A 3QENA 1W0KA 1EFCA 4RD2A 5EXPA 2KI5A 5FTKA 1E9RA 2ZU0C 3SYLA 3TGPA 4JLPA 5BYJA 2V7QD 1QHXA 1WRBA 4JSYA 3EIHA 4TMVA 1S4QA 4DSOA 3GLIE 1KI7A 2X1VA 3QG5A 3S1AB 3GEHA 2WWHA 3BGWA 1EFRD 3F3YA 4ZDIA 1L4YA 5FUYA 4M1WA 1F3OA 1Q1BA 2HF9A 3C14C 3DKPA 1H65A 5A5GA 2F3TA 1EX7A 3VNVA 4KFTA 4PPNA 3A1TA 4BGDA 4BZQA 1XD8A 5FL7D 1NBMD 1YZQA 3QI2A 4IOLA 3IGFA 4ZIRB 4HLDA 5DHFA 3SQWA 1KMHB 1P2VA 3IO3A 4NP6A 4NHOA 2FPMA 2LCFA 3K0AA 4URVR 4RKFA 3OEED 1BYUA 2P67A 3SFZA 3KQHA 1GRQA 3UK6A 1QVRA 1ZD9A 3BFXA 1TQ6A 4ZCLA 4PO1A 1O3YA 3SJAA 1BKDR 4B71A 2WWYA 2D7DA 1BYIA 1M2OB 2ZETA 5L3QA 3UMFA 2J0VA 1E4YA 3PUVA 1E2MA 2D62A 1II9A 4OKSA 4ON9A 1GM5A 2ZE8A 2W58A 4GNKA 3H0KA 2ANBA 3FDIA 4IEIA 3AF0A 5EXSA 3ZDQA 1I2MA 2ASEA 2H57A 3AUXA 5EE9A 5B58C 4C3ZA 1E2DA 2QEQA 4KODA 2QTHA 1VKJA 4A0FA 2YOHA 5F9HA 1G16A 1S96A 3FHCB 1SKQA 4LJ9A 4AC9A 1E2FA 3G5UA 1AGPA 3QBVA 1XJ0A 1NJFA 3L8YA 1Q0UA 1VCIA 1VECA 1A82A 2A30A 5H68A 4B2PA 1QF9A 1TL7C 4Y0VA 5B30A 2R2AA 1NY6A 2ZEJA 3QVVA 5H70A 1XPUA 2WJJA 1J2JA 3A58B 2OAQ1 4W7SA 4A8JB 4DUGA 4LC1A 1HY3A 3WBJA 1KI3A 3OIWA 3U44B 2CVHA 2JDID 1IN5A 1UFQA 4BLRA 2CCJA 4RD4A 2R6AA 3O8DA 1VHLA 1SXJA 1KSHA 1E0KA 2CCKA 2Z4SA 2IYZA 4G5SA 2J41A 4O25A 1UAAA 4TZ0A 1IONA 2W2TA 1U94A 5JZVA 3PG5A 5KSZA 2RGNC 4UXHA 3NXSA 1MO4A 2W6ID 1NMYA 4QGGA 5H8WA 5KYKA 3KJGA 1FL9A 1XNJA 2FZLA 2IS4A 2GEDA 1JR3E 2A5JA 2PEYA 4JLBA 1P60A 3QXSA 3H86A 4NPHA 2CMKA 4GRAA 3B85A 3AP1A 2OT3B 4DCTA 2H5EA 3M6AA 3WHKA 1ZM2A 3L0IB 4OQLA 4V0ME 4NYIR 4JLDA 3L8ZA 1A4RA 1W0KD 1X8JA 4A15A 3G0HA 2DWOA 2Z83A 4Q1AA 5TXGA 5J4YA 2JLQA 4CW7A 4P32A 5EE3A 4BLQA 4TSFA 2A78A 3CONA 2ZJ8A 1UADA 4QHYA 3KB2A 2A5DA 1QHHB 1WCV1 4Z8YA 5A0FA 1R5NA 1RE0A 2G1KA 4QFMA 3GLIA 1EG7A 2IS1A 1C4OA 1U81A 4A36A 1BOFA 2AK2A 4CF7A 4Q19A 2AL7A 2X2FA 1G7CA 2C95A 1E2GA 2DR3A 2QGZA 3IUYA 3AVUA 821PA 4Q18A 2C78A 4IXNA 1Z2CA 1I2DA 1W36D 1MABB 2E87A 4CT5A 3AM1A 2JATA 4B3XA 2J0UA 3BRWD 4A1FA 1DE0A 2EYUA 5ANRB 3T06B 4O2RA 1G3UA 1E9FA 5CJPA 1JXOA 4CEJA 3SR0A 4NONA 5DLQC 5EUQB 5IDVA 1NVVQ 2CE7A 2HCJB 4WZ6A 3AF1A 4DIDA 2O8EB 2GESA 2P6NA 3K0EA 5LB4A 2ZU6A 2AFHE 2A7QA 2GJKA 1KI6B 5AWFC 4L8GA 2ZI4A 4KYUA 4JMPA 4ESVA 2UVQA 1CR0A 1LF5A 1XCGB 3K8YA 3GLFA 1DG1G 4JKYA 1UKZA 4FMBB 1PJRA 2P2LA 3QSYA 2PLRA 2OHFA 1TX4B 3OFNA 3R7WA 3VKWA 2CHQA 3X1WA 4AG5A 2IUSA 5SZKB 1E1RA 4DLRA 4DUGD 3NHAA 2IK8A 1VTKA 1SVKA 2Z43A 2BBTA 1XMSA 3AV0B 3T1QA 5EP4A 1G64A 3T5DA 1JB1A 2ZS7A 2IW3A 3AVQA 3D7MA 1CIPA 4MGIR 1US8A 3GJ3A 4UNQA 1SXJD 2JLYA 1DAHA 3CRRA 2DPXA 4KCGA 5FI1B 3A1WA 1TUIA 2GCOB 4Q00A 5A4JA 3FHTA 4IDOA 1P6XA 4PO8A 3QE0A 5CITA 1MRNA 2ZJ5A 1XTSA 4G5QA 1R2QA 2DHRA 2ONKA 2FA9A 4C0JA 1SGWA 1WP9A 3B82A 1OFUX 3ZIAA 3UIEA 3EZFA 4FCVA 1XRJA 2V3CC 4NTZA 4OHZA 3CKLA 2G88A 3VX4A 4EKDA 4Q7LA 3VR6A 4C0LA 3LW7A 3AP2A 1ZD1A 2RGXA 2ZITA 4B75A 1CR1A 5FTLA 4TSFD 4BFYA 1B23P 3MFYA 3ZLJA 1C9KA 3FFAA 4JYBA 4TTPA 1N5KA 1OIXA 3TW4A 2QSZA 4ZO4A 1E0SA 1KK2A 1TEVA 1L2TA 2QU8A 2ZS8A 1G5RA 1G8PA 3L0PA 4R98A 4CEIB 5KDOA 4F93B 2ZAOA 3CUEF 4M21A 1XD2B 2AN9A 1Q22A 5CM9C 1VHTA 3EA5A 5IK2D 3I5XA 3OF5A 1R0ZA 4HSEA 4S35A 2UKDA 2WAXA 3EC1A 2XTZA 4TLAA 2OBNA 3W9YA 4EUNA 4ZDWA 2REOA 5DE3A 2YZ2A 1U9IC 3ADCA 3GEEA 3P4YA 4LJ7A 5CB6A 1GKIA 1GNQA 1IXRC 4IW3B 2ZUCA 2VSOA 4IHQA 4CEHB 1IY0A 4DCSA 3KX2A 2OESA 3LVRE 1JAIA 3QOFA 5C2JB 2X19A 4HZIA 3W6PA 2IC5A 3DZ8A 2NIPA 4IVPA 4A8JC 4GDFA 3WMFA 2JA1A 1GAJA 4HLUC 1DO0A 2VPPA 5JBQA 3W5IA 3KUDA 1N0WA 2G0TA 2OFWA 4NU0A 3X1DA 3D31A 1X1RA 4M9QA 3WYFA 1NN0A 1Z2AA 2JCSA 2WICA 1X8LA 4Q7MB 2N46A 1NMXA 3QG1A 4KO8A 5DH9A 1NG9A 1ZC3A 1NI3A 2OBLA 3I72A 4FN5A 4IRUB 3VR1A 2GVZC 3KB1A 3OFND 2BJVA 2WPDA 2VBCA 4YMUA 4PXAA 3V4FA 1KY3A 3WY9A 1E1RD 3PEUA 2KE5A 3U3MA 1JPJA 3K0CA 3T15A 3RNLA 2F43A 1QG4A 3Q85A 4Z51A 2R6CA 1CR4A 2I1VB 1F2TB 1OH8A 4QBHA 1VCNA 1XCPA 2WV9A 3U4QB 4TMKA 2P0EA 2OV2A 3I3SR 1RW4A 3KKMA 1XXHB 4EDHA 4G0NA 4S2EA 2AFIE 1KYIA 3CB4A 4XH9B 4E03A 3VR5A 4NCHA 1SVOA 1U8YA 2FX3A 1W2GA 2O8BA 4IKEA 2GXSA 1Q1ZA 1MO3A 1QHGA 4D4JA 1RJ9B 1TQDA 2QP3A 1M34E 2WM9B 4XJXA 3U60B 3ZIAD 4HYYA 3U3KA 2JEOA 4P4UA 4Q21A 1NSTA 4X8OA 3BB1A 1XTRA 2RGGA 4NL4H 4JYCA 1JXMA 5C1BA 2VL7A 2F1IA 3ZZUA 4F4JA 1L4UA 4ASUD 2Q0HA 3U6KA 1N6NA 3T12A 1G8HA 3BFKA 4TYPA 4FD2A 1XFAA 3K9GA 4UKDA 3NBZC 2RGBA 3LX8A 1J7KA 2JASA 2BDTA 4FMDB 1U99A 2XTNA 1X3SA 2BBWA 4Q02A 1UDXA 1VPLA 1T5IA 4DDVA 3RS0A 3NTUA 1CKEA 1G9XA 3IIMA 3CNLA 1AKYA 4JZKA 1JPNA 4MITA 3KXIA 1YQTA 3O8CA 2REXB 1Z6XA 3GP8A 1G8YA 3DL0A 5FTNA 1QHIA 2WIAA 3Q7PA 3ZQJA 5BQ5A 2W0SA 2CJWA 1NF3A 1S0UA 1VCOA 2QAJA 2VRWA 4M9XA 2CDNA 2HDNB 1E79A 4H1VA 4URWR 1X86B 2I3BA 4I4LA 4A2QA 2EFEB 5HKKA 1JAHA 3CZPA 4D4MA 1UKYA 1FP6A 1NVVR 2GJSA 1F2UB 4WW0A 4D82A 2VO1A 3LDAA 2NGRA 3QKTA 4HB0A 4OQMA 1R5BA 4U00A 2IBMA 3MSXA 4Z8XA 2ZRKA 2IUUA 3Q7QA 3VNUA 1UJ2A 1E2NA 1FZQA 1N2CE 3I8SA 4C0SA 3EASA 2GJ8A 5JCZA 4X8MA 1UKVY 1Q1QA 1R0WA 2ZRBA 2ZRGA 4R2HA 2LKCA 2VP4A 4ILEA 5E95A 1GL6A 3WNDA 2NO1A 4FMCF 2XTMA 3U2QA 4PC6A 2GZAA 1KO4A 2IYTA 4XWOA 1TADA 3EXAA 1JECA 2B7BA 4DKXA 1RPZA 2D7CA 4UXJA 1ZIOA 3LWNA 3GLHE 5E3HA 3U7HB 2XEXA 3LRPA 1KSGA 1EFUA 3D6TB 1DTSA 3BWDD 1Q20A 1EXMA 1D5CA 1LS6A 2VHJA 4OQXA 1J8MF 4YLGA 2N42A 1Z06A 4HATA 2NZ8A 4GP7A 4LPKA 1E69A 2Q3MA 2BVNA 2IYWA 3AEZA 1Y63A 4JBXA 4PO9A 4AKEA 4A92A 3EARA 1HQCA 2VP0A 3SOPA 4PQRA 5J4VA 2BM1A 1A1VA 4HAVA 2XX3A 3KJHA 5FUWA 4BLTA 3AF4A 2BMFA 1G18A 3MLEA 2E9SA 3QF4B 4TMZA 3HYRA 1DADA 4O2LA 5FUVA 4NYMQ 3DMDA 4I1VA 3GMTA 1Q3TA 3L0SA 3THXB 1XZPA 4JLAA 3NBXX 2BCGY 2ZXUA 1CULC 2CVFA 5L3QB 5CB8A 2YKGA 3C15C 4PSVA 521PA 4FINA 1G1MA 2VHCA 2XAUA 2IWHA 3SZRA 3E2IA 4B73A 1AA9A 4IVQA 4L16A 5CDFE 4KV9A 3PUZA 4PAQA 3CZQA 2QA5A 4JVSB 5FPSA 1SHZA 1OH7A 4Q1EA 4CGZA 1QHSA 3PITA 2V54A 2QAGA 5JWRA 1LFDB 2JLSA 1RZ3A 1E79D 3U6BA 5HKKD 3PXGA 4QKQA
chains in the Genus database with same CATH superfamily
1RAFA 1K1EA 2QSYA 1P7CA 1HMYA 1U0JA 2CNWA 2CW5A 1ODCA 5JSQA 5GINE 1L7OA 3KZXA 4RBNA 4LCBA 3UJNA 3GJ5A 2FP4A 3ROGA 4RZHA 3UJCA 4NK4A 2P6UA 2D4HA 4ARAA 2GEVA 4B83A 1ECLA 4PYJA 1ZJWA 1OA1A 2LTAA 1ZI9A 5AXDA 4AMVA 3O8NA 4OMFG 2V7GA 4FQ8A 2BEKA 1SXJB 1QVAA 1M8GA 4WFIA 3GLKA 3ZGOA 5BUZA 5L4LA 1HFJA 3IEUA 4TN1A 3C5CA 4BMSA 4QPNA 4XM1A 4QAJA 4UOEA 4K26A 4E1BA 3Q9UA 4LV6A 2PMKA 4DQLA 2HV8A 1BHQ1 3C3DA 3NUQA 4BFVA 5AFSA 3R5TA 3G85A 4GAEA 5HCUA 2O5CA 2IL1A 4BLUA 4IIBA 4TQUS 4UBJA 2I5PO 1YSCA 3IP5A 3AUYA 1KPIA 3HNOA 3LT5A 1QK3A 1JTEA 3FF1A 3PUYA 1HDRA 1G3MA 2GYYA 2Z9BA 3NJ8A 4I1OA 1A97A 4J6FA 4L8WB 3SLKA 3M6XA 5SYNA 1YF3A 2PUBA 4OLBA 2RH4A 1GPAA 1V1JA 1ZM7A 2TECE 4I8IA 3G9TA 2NPFA 2BMWA 4DB2A 2PMBA 2Z09A 2PH7A 3GVCA 4ND4A 1U3FA 3E23A 4TMFA 4F86A 2E4VA 2FWMX 3HDJA 4OBEA 4XQ0A 4QIHA 4E2FA 5K1ZA 4AD8A 4Z0NA 2KLHA 2AC4A 2XGGA 2ZRMA 3KAKA 1P7PA 2OUKA 4I1UA 2VDKB 5I45A 4PQFA 3STVA 1B6RA 4CMEA 1HA3A 2NTEA 3FFTA 3KXPA 3E5HA 3ZBQA 1XF9A 1XTIA 3FKSA 5J5CA 1LJ8A 1TJ4A 4L02A 2GYUA 4AYWA 4DC9A 3EZ6A 1YBHA 1B0UA 4NENA 1NJ8A 2FSUA 4L6IA 1ZKMA 2EL7A 3TPZA 1CF4A 3K09C 1R5OA 2QL5A 2UYYA 3RJTA 4D41A 4M9SA 4DXDA 4DQKA 4UTPA 1DAMA 2FP3A 3CJQA 4DEVA 4H1TA 3OE5A 4KQ6A 3DOFA 3IAM6 1J5EB 2ENUA 1RWMA 1VHWA 4UFNA 3H9BA 5JADA 2FG6C 1FLDA 4XRGA 4ZVUA 2DFDA 2DERA 3MJDA 4ZGGA 2WMNB 2M2IA 4RLHA 4PG5A 2AX4A 1Y33E 2HRDA 2O1EA 4LZOA 1I7NA 3EGDB 3A70A 1K06A 2VYCA 4US1R 3X3HA 2ZRAA 1EP9A 4TS1A 5C34B 5H7XA 3TS1A 1RJWA 3EBOA 5LDDC 2WKRA 5EFZA 3E9CA 2HCTA 3LZ6A 3SHWA 4JBYA 1DO8A 4XJVA 2PUHA 1KJIA 3OOYA 4D4GA 3WAKA 2OHJA 3D1LA 1WS6A 2FFHA 2XUKA 3B13B 3T0GA 5A2QA 4LWZA 4JBHA 3UKOA 4IR7A 5L4SA 4XQGA 4PNHA 4PTYA 3RT9A 1W59A 3OZ7A 1E1NA 1H23A 2WTEA 3OMLA 4OP3A 2YHBA 4RS4A 2G1UA 4REMA 3GA0A 3RFCA 3SQMA 3TRHA 4B4OA 1FFCA 3N2ZB 3FIJA 5CDFA 3ZY5A 3WGVA 4DCGA 1COWA 4P7GA 4JL5A 3THWB 2BBOA 2JAWA 2QVBA 1XLUA 2VSFA 4M49A 1WO8A 1R37A 5JPCA 4QREA 3PJDA 2R6FA 3F4KA 2YZGA 1QV9A 3KZ1E 4ZO6A 3PX3A 5C37A 3G2MA 1O6CA 2V58A 2CNWD 4MPDA 4K3VA 4WNAA 8ABPA 3ZBPA 2YIMA 1BCRA 4PLFA 3AETA 3FVRA 5KNCA 1HT2E 5JTTA 4RULA 2ZW9A 5B1SA 1S6YA 5A5EA 4G9GA 2P77A 2VEOA 5IBRA 2B25A 3O9VA 5A03A 1Q84A 1OXTA 1TB4A 2OM6A 1R0SA 1P1KA 2DP4E 3IAHA 1N2ZA 1JWAB 1P62B 2AJLI 4J0IA 4GECA 3ZH9B 2HADA 2Q9CA 4QDUA 7AT1A 4IG4A 2QSJA 3OJFA 3K9CA 2RHJA 3VVMA 1MR3F 1EG2A 2GN0A 5FBZA 5K01A 1GZ3A 1GCUA 1Z4OA 4M8SA 4D9NA 4O63O 3RAPR 1EIWA 1QYDA 2AEFA 1F38A 1VL2A 3T1VA 4YP6A 3HN7A 3O4HA 4QGAA 3RU3A 1IQRA 2EARA 3R6LA 4I50F 1R7RA 4O3MA 4G1FA 2FN8A 3RVDA 3RSSA 1GAXA 3IUQA 4MGHA 3L5KA 5D01A 2O8DB 4EI2A 1FFBA 1DC3A 1P91A 1QMPA 5CYOA 5E6UA 4WLFA 2A0KA 4GRDA 3PGLA 1GPKA 3FSJX 1DX4A 3DLIA 4JBNA 2IUYA 4G63A 1RTTA 4GI3A 5ILQA 1PSZA 3FYDA 4BTVA 2VJKA 2PVSA 3MTAA 2WWWA 2YFHA 2ZIXA 3FKSD 3OU7A 4IIGA 1L3IA 1W5AA 1OBCA 2PLFA 3R09A 4XUGB 4MYDA 1Q19A 1HPLA 4YQYA 3GPIA 4ZQFA 3BM5A 3ZWAA 4EQZA 2D1SA 5EJAA 5J1TB 1PN3A 3LC0A 3TOSA 2BFEA 3PXXA 4RLQA 9ATCA 3MEQA 4BO1A 1G1AA 5CLQA 4BP9A 4M22A 1V26A 1KO7A 4DCJA 2COUA 2IXGA 2K7ZA 2R86A 5L3ZA 3ZHQA 5LLTA 3WL8A 2FSFA 4Z4EA 3BHNA 1HDOA 1PT5A 3QPAA 4NYMR 4KXQA 4P7BA 3TD2A 2A8YA 2XT6A 4UHCA 3V6MA 1E66A 3UMJA 2FWJA 1EXWA 3Q8KA 4FCTA 1H0HA 1R18A 5EZQA 4L07A 3HY4A 2CYCA 4MLPA 4CT4B 1Q0ZA 5F3RA 4Q1DA 1KU6A 5CNJA 2AF3C 5HK9A 2FEXA 3CZ9A 3A04A 1M2VB 1IBRA 2COKA 2JGDA 3IFSA 3UB4A 3SD7A 3HGQA 4XVRA 5I4IA 4L3VA 4LJKA 1USWA 5E1OA 4DMHA 4BCBA 4KXUA 2IV7A 3TMKA 3KUCA 2R7NA 4E51A 3OAAA 2QIPA 1N3BA 3DVAA 3MQFA 4KX5A 4EL5A 5TC4A 1IHYA 3BX1A 3JQCA 4QM7A 1EESA 1G8KA 1COWD 1XZBA 3GT0A 3JZMA 3P5BA 3GDFA 3IP7A 2XTJA 2X3UA 4CCAA 3G2HA 2Q8NA 3MJSA 4DLXA 4D6PA 3ESAA 3F2VA 3ZY4A 1L7RA 2C96A 1P0PA 3TB4A 1AMUA 5JDCC 2XDYA 1CJSA 3DL4A 4MSUA 3F97A 3VC7A 4AMGA 1OAKA 4XVHA 1AU9A 5KNCD 1NP7A 5J3JA 4YJGB 3I05A 2WVJA 3NP9A 3IDOA 2ZUFA 1WCXA 3LX5A 4G0PA 2P65A 2Y1GA 1IVNA 4MVJF 2PPLA 4LJ6A 4N5MA 1FQWA 1UXJA 2EU8A 2JLCA 1P5HA 5G0TA 3ZJYA 4EHLA 5CB4B 5J2TB 2Y1LA 3CRVA 2GTHA 2WY2D 2WT9A 2H85A 3UYLA 1A9SA 3BMCB 1Y1TA 3Q6IA 1SC3A 3E35A 3OO1A 4ABTA 4G56A 2QS9A 3A9CA 3LY7A 2AHOA 4JGIA 1IN6A 2G6BA 1ADBA 3VZRA 5DYTA 5JJ5A 4CR7A 2C54A 4FB4A 3RR2A 3FDXA 4EZBA 4OTZA 1USGA 3TCNA 1EQ2A 3X0DA 3D6NB 3VA7A 3NDRA 1S5PA 3PXCX 4EX6A 3ISVA 4C06A 4FZJA 3UMBA 1YMUA 5SZHB 5IK2A 1CF9A 4Y6GB 1AS3A 1DARA 2FMHA 5AKJA 4NFLA 1JDJA 1YR6A 3ZV7A 5HWSA 5FOVA 2G9RA 2O2XA 1ZK3A 2OO5C 4U7HA 3CA8A 4RTLA 4DSZA 3A4NA 3KT0A 5KOYA 3KYCA 4FHZA 4RDCA 5DYGA 4CTNA 4DMMA 5HPYB 1RTKA 1P33A 3Q1KA 2JJ8A 1RKVA 3J81k 3GRKA 4TWRA 2XCSB 4J91A 4FILA 5E7MA 3W77A 1RC8A 4KLCA 3TFWA 1L8LA 1E9BA 3MIZA 2ZROA 4J4BA 2W2VA 3BVPA 2C4NA 3L6EA 4WJLA 4WHMA 3OOHA 1A76A 3O8QB 4YP5A 4COOA 1TEXA 1W0JA 3TUIC 1YJCA 3LBYA 3ISTA 1ZUNB 2BF4A 1H6DA 1ISGA 2BFFA 1L7QA 2B99A 2FMFA 2ZTSA 3QVGB 4HYQA 4IQ8A 4MYCA 5FA5A 5FV7A 2Q1XA 3T1NA 2GZ3A 2MYNA 2OM2A 3GGGA 3GXOA 4J0GA 4AMYA 5LP6A 1ZCFA 2ZAMA 1KI1A 2OAGA 4GUDA 4R9UC 3KJNA 1I1QB 3GCWA 3QBJA 1E1CA 1S1CA 1JPUA 2IIQA 4H9GA 5K0FA 1JHDA 3K20A 4EFKA 4DIEA 2GWHA 3A2NA 3FJYA 4U7PB 4ZYYA 1XWIA 5ADHA 3IA7A 2HMAA 5HJEA 3GFPA 4D8UA 4HFNA 2X4DA 1G2PA 3M82A 3RK1A 1Z2DA 3U49A 4AO6A 1LPPA 2YVUA 5H4HA 2QG6A 3F6BX 4QTYA 1ZGHA 3PRYA 5AK6A 4FLEA 4O2BB 3B1YA 1PWYE 2E2WA 3U31A 5CFLA 4HZUA 5GJBA 2EJTA 4LV5B 3SR4A 2X15A 3IDSA 2XGJA 3DHVA 5TIIA 2R6DA 3ZCUA 1VJGA 1J1IA 2XA9A 3BWMA 5AUNB 4HI0E 2QBYA 3OAAD 1GNLA 1L7PA 4LDJA 1UDWA 2QPAA 3QA9A 1ZITA 1TJYA 2HFKA 1VIYA 1OA0A 1Q6YA 3FA2A 3K1ZA 3D5QA 4FKBA 2AT1A 1CRZA 3EA4A 2DPLA 3HBFA 2H18A 3CN7A 4AN4A 3L41A 1GDTA 3ELYA 4F8JA 1N8SA 2IQIA 1ZVVA 2PX8A 2ZUUA 3ZHTA 3HL4A 4RMGA 1KMMA 1IOVA 4AJJA 1ORDA 2ZI6A 3LVFO 1E5LA 1WB4A 5DM60 3LCJA 4HRVA 3FY4A 4P22A 2Z5GA 3PIRA 5DHSA 3MERA 5K0LA 3HKDB 4A6XA 1BFKA 3QJYA 1EK1A 4CZ2A 1CVIA 3OQJA 5IJXA 4B3MB 3CKYA 4PYKA 4AKIA 4FWTA 1PK9A 1PZNA 1TZKA 4K0RA 3VSDA 4L4RA 1M1XB 3EGXB 2GTIA 3EXHB 5I9SA 1XROA 3WSVA 1SRRA 4Q1CA 3ON5A 2FPGA 3E82A 3GLRA 1QF6A 3QUQA 1KL7A 3R6TA 3MOIA 2HWKA 4NMWA 2SNIE 4U6QA 5JNTA 4ZAWA 3EN0A 1SUPA 2ZI5A 3D4PA 4JLWA 3U40A 5A5FA 1CY2A 5DNEA 5LOVF 4DHEA 3PCRB 1G5PA 4WLUA 1M34B 3LFUA 4JJ6A 3A2LA 5KQGA 4S1VA 3JQPA 3S1AA 3U80A 2FEKA 4EOGA 3KSBC 2DBYA 3KPWA 1QOQB 1QX4A 3P2OA 4KR2A 5F98A 3Q2KA 1KGDA 1O94A 3E1KA 1F06A 2IYUA 3FNEA 2XDAA 2J09A 2C4HA 3GK3A 3PI6A 5CPBA 4R7TA 1KDYA 3TD9A 4HB4A 4CKYA 3FCXA 4RVFA 4ZIRA 5C81A 2CJXA 4K1XA 3WWPA 1TZMA 1M83A 3OQPA 4LRSB 2X9NA 3UN1A 4KSYA 3TJRA 2WJYA 4MV8A 3QMPA 4DJAA 1HE3A 3U7JA 4PNEA 1RXUA 1W0JD 4GVLA 2Q6LA 1ZA2A 1LC0A 1RLTA 1VRCA 3KUXA 2K6GA 4ARZA 2JAQA 5KVCA 3HM9A 1ID8A 4BY9E 5F5LA 4Y9SA 1Z6QA 4KUEA 3GJ7A 1HSOA 4MW0A 3R9KA 4PG8A 1JYSA 2Q3EA 4YIHA 1B8UA 2H1LA 1R8XA 2FFQA 3VHXA 5MN5A 4KIGA 4G5HA 2PSHA 4B8WA 4PYNA 5B2FA 4ZV7A 1O4VA 2DUUA 2P3LA 3TO5A 5A7HA 1GA6A 3L1IA 1XDUA 3WYGA 1A8UA 3VVLA 4EJ6A 1FFYA 3M6LA 1WZUA 5K8TA 3S5JA 4UD6A 3DAYA 4H7FA 2FZGA 4HJXA 4RZXA 3BH7A 1DHTA 3MJCA 1QH1B 2D13A 2ZRQA 1FLVA 1PNTA 4FCCA 3CUTA 3FPLA 4RSGA 1YJ5A 1RCTE 5SYMA 2FP4B 3RHSA 5BN3A 2XODA 4M2LA 2SKEA 1FNMA 4OYYA 3NBFA 4WBSA 3UFXB 3LVBA 3V4RA 4MKHA 1B16A 2NZ2A 5ES3A 3UK7A 4CDRA 2ZYIA 3W7BA 1VE1A 1E1DA 1RRMA 3C5HA 3L79A 3AIMA 5C80A 1E3WB 2DVMA 3CVUA 4I8DA 4RHTA 3NIBA 4MVJE 2G07A 5JW6A 2AYYA 5KX5B 3C0KA 3JW8A 3R6WA 4EA8A 2Y2VA 4MB2A 1K88A 1SULA 1TQHA 3P9QA 1W49A 4EYKA 1REQA 1RJFA 2FSGA 2VK1A 4RELA 4YAEA 3VPCA 3D6MA 3AZPA 3ZQ6A 2CWWA 4GOLD 2O1SA 2J5BA 3AR4A 3HVKA 3ZOKA 1GSIA 2XRYA 3I6BA 3USCS 3KKLA 3ELWA 1JFSA 1NP3A 3Q6MA 3BE4A 3RF6A 1PWZA 2FWIA 1D2RA 3MJFA 3T7CA 3T1TA 3LH5A 4TVBA 2IEBA 2P9BA 2QG4A 2IV2X 5B64A 1OWLA 1EFTA 2QYSA 2FWRA 3LPLA 3FWKA 4MR9A 1EHIA 5GVRA 3S2UA 2DTEA 2BGKA 4QTZA 5K6RA 2QM3A 3H5OA 3K92A 3PF8A 1SBCA 1PP4A 5EQDA 1N8KA 1CU1A 4PIVA 4OU5A 2PT6A 4YONB 5C3UA 2WSLA 3PKIA 4NENB 4JQSA 4TZKA 3L06A 4W5TA 3PHIA 1EZ1A 3TLEA 1PJZA 2B1QA 2QRNA 1HMPA 5HTOA 4YHHB 2YS6A 3D8UA 4IJMA 3STHA 3CLHA 2EQ5A 5AVWA 5BV7A 1F0YA 4R8LA 1A8SA 1D2NA 1LS1A 2CKDA 2J87A 3B5JA 4U2FA 3A4MA 5EKXA 2IYXA 2ATIA 1AY0A 2N0SA 3CSDA 3B78A 1L5GB 3S28A 4HMQA 4EJSB 2PWZA 3NTLA 3QU5A 4UQOA 1O94D 1OJLA 3NOQA 1AB6A 2A7XA 4OYLA 2O7RA 2A57A 4GR4A 3VVBA 1TCAA 4EAAA 1NQUA 1LSUA 1C4KA 4OQYA 4TQ9A 1ZSYA 4H27A 2X0DA 3DEAA 4J3FA 5CW1A 4A8TA 1YWGO 2JL1A 4L0QA 1QTQA 1BE0A 4UNSA 3U3XA 3COPA 1CIJA 4R54A 4XWGA 1QGOA 5ALFA 4AAYA 1UOQA 3ICQB 5EJ5A 1P1JA 1G3IA 1E2HA 4X20A 4FXPA 2NQ8A 1RQPA 3U3ZA 1C3OB 3ZVLA 1KQOA 1EJBA 4QOIA 2I87A 4E12A 1TJ5A 1QFXA 1XK7A 4ZREA 1SM4A 1I3MA 2Q3FA 4H7DA 5SY4A 4D9EA 4B84A 1A95A 4WN9A 4QGSA 1JLLA 1ZN2A 2ODPA 3H65A 3DAFA 4UBNA 4QXMA 4LEIA 4MA4A 2BUCA 1OUMA 2VJOA 3WLKX 3ZHYA 4XLZA 1U7UA 1AKEA 2J9RA 1L7XA 4LJSA 3CPHA 5FNVA 2PIAA 5KDDA 1MOQA 1NR1A 3AKYA 3M2PA 3G5MA 3PRHA 4LGYA 3SEZA 2AW3A 3RTGA 5JMOA 5L3VA 2I6XA 5CXUA 1BX3A 2QMHA 1P29A 3AETB 2AOTB 1E6KA 1JIIA 1O5TA 1TYCA 4TM7A 4TL9A 1D03A 4DGQA 4YDHB 3QTBA 3AF2A 3X44A 3PEVA 4O4HF 4U2KA 2NU9A 2R4TA 2WYHA 2XQGA 4JI3B 4F3YA 1N2XA 5DNUA 2EW8A 3VGPA 1SCQA 3R3WA 4Z4HA 3IP3A 3P0EA 2QI9C 3W78A 1U3UA 4WBNF 2J5RA 1SG6A 2RCNA 3H1PA 1T6YA 3U9SA 2IH5A 1USIA 3W5SA 1RQLA 3IMEA 2DSTA 2WILA 2GCNA 3FAZA 3IHLA 3ZV6A 1YRBA 2CMFA 3DLCA 1OPRA 2GJ9A 1ZU4A 1WSAA 2ORVA 2B7LA 2ZUBA 4HLCA 4MVYA 4CMCA 1CUIA 4OHUA 1XMQB 4QOGA 1DL5A 2PRJA 1QBGA 3T0IA 2XLCA 2GM3A 3NHUA 5CJJA 1DAGA 3N0TA 3SXUA 1B0ZA 4BMDA 4D4KA 2DHDA 1MJHA 1V47A 3FMPB 3C3MA 1WKVA 4N18A 3TMYA 4K6HA 4BNWA 4EGQA 3MGBA 5E6UB 3UWPA 4MJ7A 5EJ4A 2WG0A 4KHPB 1DOZA 2YMQA 1XVIA 3FPAA 1GGJA 1SCBA 5CEFA 4MRMB 2H0RA 5KTSA 1Q91A 1KDRA 1UBMS 2YWRA 3DNFA 4RH1A 4F60A 3GI1A 4QM6A 4Q4JA 1Q7EA 3ZU6A 4JASB 4M36A 2P9GA 1Z0ZA 4ND8A 1VHJA 2ZIXB 1JPVA 4PCAA 3ZDXB 1UBOS 5B3AA 3WK6A 1NUQA 2KLBA 2YV2A 3UXYA 3T5BA 2BGWA 3NVAA 2P0YA 4UM9D 3VU1A 4QFBA 4EQ6A 3MS4A 1UEXC 4E30A 1Z47A 2YHSA 3GNQA 2BFEB 5L45A 3QHPA 3DW3X 3H5RA 2ZE6A 1Z8NA 4J0QA 4MW7A 2ZBPA 2XB4A 3ICCA 3LF2A 4ENPA 5DWDA 1XD2A 3BE6A 1E4EA 3FHOA 2C5BA 2CHUA 2QAGC 2ZJYA 1CUAA 3CMCO 4YACA 3HVRA 3ECSA 1DQNA 3X1ZA 1A8PA 3LG2A 4YPFA 4BGEA 4NKRA 1H2WA 4CVNA 3ITDA 4ML3A 4RF5A 1KRHA 3IE2A 2Q1TA 1R8QA 4QU0A 2GCPA 1U7TA 4R9RA 2H4JA 2ACVA 2ZYTX 6GPBA 3LDUA 1ATZA 1II0A 4Y1RB 4KK4A 4ZO8A 1C9NA 1PQWA 1ZOPA 5HSGA 1E2LA 3SWWA 1JIXA 1VKHA 4NK5A 3DTYA 1XEFA 3NHJA 1Z5UA 4P53A 4GICA 4RABA 1IN8A 4B2IA 2DB3A 4FEEA 2O8VA 1Q3HA 5KPDA 1IOLA 1I2AA 1XZMA 2VAMA 4GE0A 2CK3A 1FMCA 3DVAB 4UARA 5F2NA 4ALLA 1QV6A 2IZ6A 1LPBB 1MQSA 3CH4B 4QDKA 5AK5A 3DCIA 4MUEA 2CNNA 2LRHA 3GC6A 2CF6A 1VBNA 1ODIA 3KHTA 3C1OA 3NWJA 3KTDA 2QWXA 4GC5A 3RUPA 3KOOA 4BO5A 4BFUA 3JYLA 3ZHXA 1VJCA 5B2ZA 3A6HA 4YVFA 5TVKA 2BZ0A 3W6ZA 4HUTA 3MS7A 1M2FA 1QAOA 5FLXA 1K5DA 3PCTA 4HNGA 1SVMA 5A9RA 2O2SA 1K3UB 3NHKA 5AOCA 2Q7DA 1K5HA 5IHXA 2YFKA 1TRKA 3QPVA 3P2KA 5DX1A 2MSNA 1SXHA 2OLKA 2VYFA 3TRKA 3TXYA 3I4FA 2PJRA 4IDEA 2X58A 1PL0A 4P5DA 3ZHBA 1T15A 4WVFA 5HS4A 1E5TA 3FSGA 5JT1A 4EA6A 3HEAA 2CXPA 4PSKA 3U4QA 3N53A 3RIYA 4D6XA 4KO2S 1YUBA 4FBGA 3PFCA 4Y8VA 2DCUA 4B3TB 1Y8RA 3GGJA 4H7HA 4ND5A 5EQJB 3P2EA 3PJFA 3QU9A 1H85A 3I34X 3R7FA 1X1BA 1BRTA 3TSZA 1DT3A 1T4BA 3H3FA 5KQPA 1BXRB 1CNEA 2O2GA 4HVAA 4R1LA 1BXGA 1RJ9A 1Y1LA 4ZA2A 3QOYA 1IVSA 3EFBA 3AZQA 3MTEA 3TINA 4UVDA 3UAXA 2VSYA 2N75A 1YTUA 3OCUA 1FYFA 4MX8A 2ZTHA 4WZBA 3U0VA 1IFXA 1W76A 2ODWA 1YVPA 1EX1A 2NSLA 4CM9A 1FDOA 1RD4A 5CH5A 4E5VA 3QNWA 2GNOA 5EN4A 4RPIA 1GOTA 3FMGA 1YZUA 2B6NA 3NALA 4R1SA 3K9FC 3ZTTA 4L72A 5BMVA 1OROA 3SVLA 1TKRA 1YQGA 2XMZA 3MF4A 4DWVA 5JRZA 1U1CA 3AVOA 3GJ0A 3OEHA 4W99A 2EFHB 2P2NA 1SA0A 3T9FA 3TCKA 5GPBA 4FU0A 1YKSA 1PR0A 2OCGA 4LE1A 4ZEVA 1PG2A 5C1IA 4AIIA 4IO0A 4BNMA 4BV2A 5K8JB 5H1YA 3VPBA 4RWEA 1LI5A 3N2NA 5EJEA 2R9VA 3EGEA 5IBCA 3GJRA 4PFQA 1MPXA 2YOGA 1E1CB 2RMKA 4AJOA 2MHCA 2H1OA 1F9EA 1NJ6A 1ZIYA 2H1RA 5A4IS 1M66A 2BFBA 4BNTA 3O90A 3N5KA 5AI5A 3GLFB 4BO0A 2HPHA 3FTEA 1Y5LA 1PR5A 1O0SA 5FDFA 2EWWA 2PQMA 4U8HA 2WKPA 3HKBA 3FTFA 1M7BA 4BLWA 3O2JA 3FTPA 3MAJA 5KTYA 3WHPA 5IF3A 1KP9A 2DUMA 1YZTA 5DBHX 4HZUB 3JQ8B 5JDIC 1PT9A 1CQIA 3AWIA 3FJOA 4IDNA 3GDWA 3PQ4A 1EAMA 1MLDA 4KSCA 5GV7A 3SMQA 4ETNA 3IH5A 1K5PA 2ZJAA 3DMHA 4YO7A 2QBYB 1WUYA 1NVKA 4KBYA 2CK3D 3AONB 3LCCA 4BN5A 4YRGA 3EVTA 3QP9A 2W9XA 4AF6A 4CIDA 4N47A 5HJ5A 5JROA 2DJ5A 4DJDC 2C9ZA 2BM8A 4RORA 5I5EA 1RLJA 4U3JA 5IM4A 2UZ4A 3RDPA 2VYNA 1T5LA 3BKXA 3FE2A 4X6XA 3GGCA 4MV9A 1M0TA 4MEBA 4AJ9A 1DAOA 1IY1A 3AL2A 2A0WA 3LHSA 3UGKA 3Q7SA 1G9TA 2XWJI 1AZTA 4HNAA 1SB8A 3B5IA 2PMCA 3OD1A 2VF5X 1WMSA 4ZGBA 5TB5A 3ETLA 4RTSA 1AQUA 1ZM4A 1SWWA 3DUFA 2ZSEA 3JASA 1AS2A 2ZGVA 3HUEA 1ZK2A 2FUEA 3OTWA 4P6VF 3VFDA 1OAOA 2YC4C 1F7VA 4BEJA 4Z4FA 2ONCA 4OXIA 2D5LA 1P6UA 3GZ4A 3U1BA 3ZDCA 2BTQA 2OGUA 1Y6GA 4Q3KA 2X0RA 3EAGA 5C1DA 3SQNA 4RGYA 2HJSA 2PBFA 3FKJA 4FHFA 2YDXA 2CXNA 3FSGD 1AK1A 2Z95A 4FKMA 3K9NA 3GUHA 4I6EA 5HQJA 3NC4A 4M7PA 1YR7A 4NZZA 3RAJA 1BS2A 3RS9A 4O4IA 3RQIA 1R8SA 2Z6AA 1H5UA 1BGVA 3ETGA 4PLHA 3KSMA 2P5TB 5BSEA 2D00A 1KMNA 2YJTD 4N6NA 4KQGA 3TIXB 4M53A 4OIFA 1XP5A 3IEMA 3N05A 3GOHA 1XJWA 2O2HA 1P9LA 2OQ2A 3KKPA 1QORA 3I42A 4O4JF 2QZZA 2EJWA 3D6VA 2I4OA 4IG9A 3CMMA 3NEAA 3BMQB 4MYUA 2C57A 2EV9A 2OHXA 2XUFA 4OMUA 5JEEA 4PLGA 1VLMA 2XA1A 3A3OA 3FVQA 3L43A 2YS7A 3R5FA 2GKOA 2H2IA 1ECBA 3N07A 3PDCA 5D1HA 3V2UA 1MIHA 4PYIA 3VR3A 4B9AA 4F5DA 2PKQP 1WV1A 4GEGA 3KYDB 4PBTA 3UJ7A 5M29A 4CM9D 1UEIA 3DW1X 5CCXA 3BF7A 3F6EX 2I4MA 5FPHA 4IBOA 4ZYTA 1KS2A 1DOAA 2DE0X 5F5XA 1R8YA 3G68A 1UEJA 3KJFA 4L4SA 5K99A 2LDXA 5HNKA 2C9DA 3X1YA 4KWCA 1E94E 1WXIA 4RYLA 4JR2A 4HDNA 1GAEO 2BMVA 4IPTA 1JWLA 4ARZB 1LW7A 1RXYA 4Q48A 3VBEA 2JCXA 3F7MA 3H4MA 3TSWA 3VR2A 4EF5A 3E7DA 3WWCA 3ZCRA 4DREA 4PZZA 5T6MA 3P9NA 1U65A 2QE6A 1EINA 1IMJA 3GVHA 1NN1A 2C9YA 2FUKA 5E38A 2AQIA 2QVLA 5G3YA 3TQSA 4PHGA 2Z56A 2BEVB 3DVRX 2AXPA 4KDCA 1BO6A 5DM0A 4DG8A 1JFRA 1R8JA 3T3NA 4OQ4A 4PYLA 4ESOA 3V7FA 3RABA 1E9AA 3I92A 3OQ6A 1NOJA 5ITVA 4X91A 2DOKA 3K32A 1RM4A 2N1BA 1AO3A 1UZAA 4L8FA 2DFTA 1G5IA 2BGJA 2PKRA 1MO6A 2L0XA 2OCXA 4GX1A 2F55A 2R62A 3NC0C 5HEKA 5G4LA 4V1CI 4KVZA 1E96A 1EI9A 1SC4A 4EPXA 5I3CA 3EF3A 2EL9A 5GJWC 1PQPA 4Y2JA 1NJ2A 3E9NA 3MMSA 4GYYA 1PUIA 1YS4A 3J7TA 5L4NA 3HU1A 3PNOA 3ESBA 4XUDA 2EQAA 2EWVA 2GZMA 3ROMA 1SXGA 5IC4A 1Z5PA 1Y3FE 2VYND 3NBKA 3OM8A 3TLGA 4CKWB 4ZHSA 5TEWA 4FR0A 1V7ZA 2QRUA 1DPFA 1L6RA 3T7IA 1RM0A 4D97A 4UCXA 3LAWA 1P72A 2R8EA 1AE1A 2X2EA 3OX4A 4CDNA 4HD8A 3ZS9A 4RDIA 3KTOA 4BN0A 4DPMA 3I4CA 2PUTA 1SUEA 1H1LA 4YLEA 3K6SA 4QU9A 1L4BA 1NNI1 2ECKA 5EFOA 4ETIA 3QIVA 2YH2A 2JKZA 3QKSA 5E9JA 2JK0A 5AO9A 2VLBA 3V4LA 5M04A 2QXTA 2GTPA 5AK0A 5KJ1A 4B45A 2ORWA 5FBWB 4MR9B 2CV0A 2HSWA 2AXQA 2UZ1A 4K9MA 1T0JB 2Q3LA 1XKQA 3B7GA 3ESRA 4PM4A 2BKUA 5KSYA 2PZGA 1UJ5A 3HJUA 4G97A 4RZUA 4ZQHA 3LCVB 3FHJA 3QSGA 2HH9A 4ZMRA 2A67A 1QCCA 2JIDA 1NF2A 2LZ0A 3BILA 3CF4G 3MCTA 5AW0A 1FQJA 1UBFA 1DAKA 3KD3A 5D5QA 2X8WA 2DWUA 3CX7A 3W6UA 5KSWB 4HDQB 2YJ3A 1MA3A 2X8LA 3FR8A 2Y9MB 5I8PA 5ENVA 1IUOA 1OYWA 3GEBA 1G4HA 3IB6A 1NTOA 4JJGA 3G9QA 4TT3D 5KAMA 3RSHA 4C03A 2IPMA 5JMTA 1NVGA 3ZYCA 3VR3D 4G01B 3Q2OA 3T4UA 3QUTA 3MOGA 3GCZA 4G5GA 4LXGA 5ICGA 4YP7A 4IUCS 4E1VA 4D9JA 3QLJA 1V71A 3KB6A 5ITSA 1G8FA 4WCFC 4D9MA 3PE3A 3ROQA 4C6SA 3CFYA 3IEPA 4D56A 5MDHA 2IGTA 3AYXB 3A1NA 4MW4A 3QBDA 1RM5A 4NWIA 4QYXA 4YC7A 5J59A 2WB2A 4RQTA 1UODA 3C6QA 1KQ3A 3FAKA 3FDJA 3C87A 1QGED 2D54A 4X20B 1YR1A 4D9FA 1IEQA 4FYPA 4KBGA 1JKJB 1WVIA 2GPSA 3HI4A 4IGKA 4ZHQF 4J3JA 1XLTA 3JQFC 4ZVVA 5EZYB 1KR2A 4M76B 4RHCA 3VR2D 1DIRA 1GZSA 1OBVA 3DNPA 4DF3A 4OA5A 2HK8A 1ZYUA 2CVPA 5ADUS 5AVUA 5CB0A 3KTAA 4CE6A 1JLLB 5ESDA 3NV9A 1OY1A 1BD4A 4ERNA 3IPLA 2PX3A 2E4XA 1GPDG 3QLVA 1Z7BA 4DNXA 5FNVB 3U5TA 1N2GA 1E7MA 4FJ2A 3BJRA 2QR2A 1RPNA 3RQSA 3DDNA 3U37A 2C31A 2FLVA 2I2BA 3PNPA 4CU2A 5FWDA 1CYEA 3USZA 3G82C 5FTJA 3P0IA 4BP8A 2BTOA 4EZIA 5T5QA 2NU9B 3L5OA 3WGTA 2ZJ7A 4TLDA 2XRFA 4OGFA 3K53A 1GDDA 9LDTA 4WJKB 1CHDA 1T3LA 3D4BA 2PRSA 3O9MA 4Y2RA 4RV4A 3OIGA 4HVTA 4O59O 1B6GA 1HG1A 1EDDA 1YR9A 4MVJP 3I9JA 1QCDA 4L8LA 3MOSA 4L4UA 5DLDA 5F9MA 5HIJA 4MIKA 4RWZA 4JJFA 4RAQA 3EB9A 4DLVA 3UMGA 3LDFA 1PNOA 1QR6A 3TNYA 1W93A 2CE2X 3D3EA 4ZCTA 2ZWVA 1JILA 4B5KA 2JKYA 4ZI7F 8OHMA 3DR5A 2VJPA 3R3VA 2L17A 4EB6A 3O91A 2H52A 1LJLA 2MR6A 3FWPA 1NUPA 3U39A 3W6OA 2XCTB 1Z6PA 3BC1A 5DMHA 2VHXA 1ACJA 3H19A 2O1XA 1RC1A 4A0QA 3HCDA 3QPDA 1JEDA 2PVPA 2ZRJA 1QOPB 1SRQA 5DHTA 4GL4A 3RIXA 3MTGA 3LTEA 4PRKA 7GPBA 1XYYA 1B93A 4Q4JB 4EVQA 3JAWA 3G1TA 4FD3A 3TRFA 4C1BA 3M5WA 3Q5GA 3OFSA 4N7JA 1MB4A 1NFRA 1NRJB 2D1YA 2O23A 4Z1MA 2FSVC 2D3TA 3R9XA 4F4FA 1AKRA 4EQ6B 1A77A 1QDEA 5FR1A 2HRZA 1HUQA 5UKDA 4IMPA 2WWVD 4BRZA 1RZVA 2IU6A 3KRTA 1G8JA 3TQOA 3GNTA 1I32A 2YFYA 4EENA 1UWKA 2YHUA 2HJVA 4M86A 2IY9A 3IOCA 5IABA 1WKCA 2XAAA 2YY5A 3DYVA 3IBYA 3IAFA 3RSZA 4HF7A 4LHXA 5I9BA 1CEXA 2YJZA 3TL3A 2X76A 4M1MA 1SBNE 4ABYA 3AGPA 3CVXA 2W2MA 3AC0A 2NT4A 2R7MA 2YNMA 3NYRA 5AHKA 4UW9A 2V5VA 1T4MA 1W48A 2BBSA 3CF4A 2V96A 3KYBA 1UT8A 4BEVA 3GRYA 2C4KA 5GADl 2G0AA 1K4YA 2GPWA 4GBMA 5DGCA 1UQUA 4B6QA 3PC8A 3WMGA 2PUDA 1S2OA 1A71A 1JAXA 1JJBA 1SQSA 4Q4LA 4RPLA 3V1UA 2X23A 3K9HA 2UYHA 1GFSA 3K0CC 5FHRA 1Q15A 2NU6B 4GMGA 2J9ZB 1HQYE 1J0XO 5E0KB 5H0IA 3VPDA 1T9ZA 4O33A 4N76A 1DG3A 3P26A 1TOAA 1U8AA 2ZWPA 2IYVA 2QVYX 5AI6A 4TTAA 1DEAA 4YYEA 1T3ZA 5B58T 5EUMA 2RI6A 3SBOA 3FBWA 3Q3JB 5ECGC 5JXWA 1N2CB 5P21A 3KVVA 4GD3Q 4IHJB 4JI6B 1R6BX 1XVAA 4WY8A 4B80A 3RM3A 1ILEA 3UFBA 1YD7A 2YC2C 1YZGA 1R0YA 3B3GA 1FP1D 4LDRA 3WC4A 4AICA 5I8WA 1ZAKA 2FGJA 1H2YA 2Q2VA 5ESWA 5AOVA 2ZVJA 3N9IA 2Q29A 4DR6B 4U2DA 3AB7A 4ZPXA 3OP1A 2FUG1 2PH1A 1RAIA 3H1EA 4FZ3A 4TTIA 1UJMA 2OFOA 2QM0A 3H05A 4I1IA 4AZ3A 5JXJA 3THOA 1LDEA 2OYSA 3IESA 3G8YA 3QV1A 2H08A 2W2XA 4QGHA 4QJ4A 3TH5A 4UTRA 2I8LA 1DQPA 4DJJA 4B8YA 3BL8A 5K3SA 4EVSA 3HJHA 1QS0A 2X6QA 2WQ6A 1ZZEA 1IQUA 1NPDA 5IJ0A 3U4HA 5BQPA 1QCYA 5GONF 4C7BA 2B35A 2XTAA 1Y82A 4EIWA 1MOZA 1RFGE 2JVKA 2WP0A 4I4IA 3ZS8A 1ZOSA 3FB4A 2BFWA 1Y9DA 1PE0A 4BB6A 1L4MA 2BWJA 2Q5EA 3AUUA 3LUGA 2I6GA 2R60A 4GWLA 3ZWPA 7YASA 1BXGB 2QD2A 4J0KA 4RD3A 5K2OA 2C5GA 5DHAA