2UU9D

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 61
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 2uu9D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 2uu9D02
2K6PA 1IBKD 1N33D 3KBGA 4LGTA 2UUBD 4NXND 4JI7D 4B3RD 2ISTA 4GKJD 4DV1D 4LFBD 1IBMD 1C06A 1H3EA 4B3TD 4DR7D 5LMND 1XMOD 4DUYD 4NXMD 1XNQD 3HP7A 3T1YD 1JH3A 1J5ED 4JV5D 3OTOD 1HNWD 4JI6D 2E5LD 4JI8D 4DV0D 4DV4D 2UU9D 1FJGD 5BR8D 1XNRD 4LFAD 1DM9A 4DR4D 4JYAD 4JI2D 4JI3D 5IWAD 1KSLA 1KSKA 3T1HD 1I94D 2UUCD 4DV6D 4B3MD 1XMQD 1HR0D 1FKAD 4DV7D 1HNXD 2JANA 4OX9D 1KSVA 4X62D 4DV2D 4DR1D 1N32D 4X65D 1HNZD 4X66D 4KHPD 4JI4D 1C05A 1N34D 1H3FA 4DR6D 4B3SD 4DR3D 4GKKD 2KTLA 4X64D 4LF9D 4LFCD 4YY3D 1N36D 2UXBD 2UXDD 4LF6D 3DH3A 1IBLD 4K0KD 4OUDA 2UUAD 4LF8D 4LF4D 5LMUD 4DUZD 2F4VD 4LF5D 2VQED 4AQYD 4JI1D 2ZM6D 2VQFD 4DV5D 1VIOA 1P9KA 4DR5D 4JI0D 2HHHD 4LF7D 4DV3D 4YHHD 4DR2D 2UXCD 4JI5D
chains in the Genus database with same CATH superfamily
2K6PA 5IT9E 1IBKD 1N33D 3KBGA 4LGTA 2UUBD 4NXND 4JI7D 5FQ2B 4B3RD 2ISTA 4GKJD 4DV1D 3FN1A 5A2QE 4LFBD 1IBMD 1C06A 1H3EA 4B3TD 4DR7D 5LMND 1XMOD 4DUYD 4NXMD 1XNQD 3HP7A 4W5VB 3T1YD 3J80E 2LQ7A 1JH3A 3ONGA 1J5ED 4JV5D 3OTOD 1HNWD 4JI6D 2E5LD 4JI8D 4DV0D 3ONHA 4DV4D 2UU9D 5FLXE 1FJGD 5BR8D 3J81E 1XNRD 4LFAD 4II2A 1DM9A 4DR4D 4JYAD 4JI2D 4JI3D 5IWAD 1KSLA 1KSKA 3T1HD 1I94D 2UUCD 4DV6D 4B3MD 1Y8QB 1XMQD 1HR0D 1FKAD 4DV7D 1HNXD 2JANA 4OX9D 1KSVA 4X62D 4DV2D 4DR1D 1N32D 4X65D 1HNZD 4X66D 4KHPD 2ZTBA 4NNJA 4JI4D 1C05A 1N34D 1H3FA 4DR6D 3J7AF 4B3SD 4DR3D 4GKKD 2KTLA 4II3A 3JAME 5KNLA 4X64D 4LF9D 4LFCD 4YY3D 1N36D 2UXBD 3KYDB 2UXDD 4LF6D 3KYCB 3DH3A 1IBLD 4K0KD 4OUDA 3CMMA 2I1SA 2UUAD 2NVUB 4LF8D 4LF4D 5LMUD 4DUZD 2F4VD 4LF5D 2VQED 4AQYD 4JI1D 2ZM6D 2VQFD 4DV5D 1VIOA 1P9KA 5LL6S 4DR5D 1Y8RB 1Y8XB 4JI0D 2HHHD 4LF7D 2L3NA 4DV3D 4YHHD 4DR2D 2UXCD 4JI5D
chains in the Genus database with same CATH topology
2K6PA 1IBKD 1N33D 3KBGA 4LGTA 2UUBD 4NXND 4JI7D 4B3RD 2ISTA 4GKJD 4DV1D 4LFBD 1IBMD 1C06A 1H3EA 4B3TD 4DR7D 5LMND 1XMOD 4DUYD 4NXMD 1XNQD 3HP7A 3T1YD 1JH3A 1J5ED 4JV5D 3OTOD 1HNWD 4JI6D 2E5LD 4JI8D 4DV0D 4DV4D 2UU9D 1FJGD 5BR8D 1XNRD 4LFAD 1DM9A 4DR4D 4JYAD 4JI2D 4JI3D 5IWAD 1KSLA 1KSKA 3T1HD 1I94D 2UUCD 4DV6D 4B3MD 1XMQD 1HR0D 1FKAD 4DV7D 1HNXD 2JANA 4OX9D 1KSVA 4X62D 4DV2D 4DR1D 1N32D 4X65D 1HNZD 4X66D 4KHPD 4JI4D 1C05A 1N34D 1H3FA 4DR6D 4B3SD 4DR3D 4GKKD 2KTLA 4X64D 4LF9D 4LFCD 4YY3D 1N36D 2UXBD 2UXDD 4LF6D 3DH3A 1IBLD 4K0KD 4OUDA 2UUAD 4LF8D 4LF4D 5LMUD 4DUZD 2F4VD 4LF5D 2VQED 4AQYD 4JI1D 2ZM6D 2VQFD 4DV5D 1VIOA 1P9KA 4DR5D 4JI0D 2HHHD 4LF7D 2L3NA 4DV3D 4YHHD 4DR2D 2UXCD 4JI5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6P A;  1IBK D;  1N33 D;  3KBG A;  4LGT A;  2UUB D;  4NXN D;  4JI7 D;  4B3R D;  2IST A;  4GKJ D;  4DV1 D;  4LFB D;  1IBM D;  1C06 A;  1H3E A;  4B3T D;  4DR7 D;  5LMN D;  1XMO D;  4DUY D;  4NXM D;  1XNQ D;  3HP7 A;  3T1Y D;  1JH3 A;  1J5E D;  4JV5 D;  3OTO D;  1HNW D;  4JI6 D;  2E5L D;  4JI8 D;  4DV0 D;  4DV4 D;  2UU9 D;  1FJG D;  5BR8 D;  1XNR D;  4LFA D;  1DM9 A;  4DR4 D;  4JYA D;  4JI2 D;  4JI3 D;  5IWA D;  1KSL A;  1KSK A;  3T1H D;  1I94 D;  2UUC D;  4DV6 D;  4B3M D;  1XMQ D;  1HR0 D;  1FKA D;  4DV7 D;  1HNX D;  2JAN A;  4OX9 D;  1KSV A;  4X62 D;  4DV2 D;  4DR1 D;  1N32 D;  4X65 D;  1HNZ D;  4X66 D;  4KHP D;  4JI4 D;  1C05 A;  1N34 D;  1H3F A;  4DR6 D;  4B3S D;  4DR3 D;  4GKK D;  2KTL A;  4X64 D;  4LF9 D;  4LFC D;  4YY3 D;  1N36 D;  2UXB D;  2UXD D;  4LF6 D;  3DH3 A;  1IBL D;  4K0K D;  4OUD A;  2UUA D;  4LF8 D;  4LF4 D;  5LMU D;  4DUZ D;  2F4V D;  4LF5 D;  2VQE D;  4AQY D;  4JI1 D;  2ZM6 D;  2VQF D;  4DV5 D;  1VIO A;  1P9K A;  4DR5 D;  4JI0 D;  2HHH D;  4LF7 D;  4DV3 D;  4YHH D;  4DR2 D;  2UXC D;  4JI5 D; 
#chains in the Genus database with same CATH topology
 2K6P A;  5IT9 E;  1IBK D;  1N33 D;  3KBG A;  4LGT A;  2UUB D;  4NXN D;  4JI7 D;  5FQ2 B;  4B3R D;  2IST A;  4GKJ D;  4DV1 D;  3FN1 A;  5A2Q E;  4LFB D;  1IBM D;  1C06 A;  1H3E A;  4B3T D;  4DR7 D;  5LMN D;  1XMO D;  4DUY D;  4NXM D;  1XNQ D;  3HP7 A;  4W5V B;  3T1Y D;  3J80 E;  2LQ7 A;  1JH3 A;  3ONG A;  1J5E D;  4JV5 D;  3OTO D;  1HNW D;  4JI6 D;  2E5L D;  4JI8 D;  4DV0 D;  3ONH A;  4DV4 D;  2UU9 D;  5FLX E;  1FJG D;  5BR8 D;  3J81 E;  1XNR D;  4LFA D;  4II2 A;  1DM9 A;  4DR4 D;  4JYA D;  4JI2 D;  4JI3 D;  5IWA D;  1KSL A;  1KSK A;  3T1H D;  1I94 D;  2UUC D;  4DV6 D;  4B3M D;  1Y8Q B;  1XMQ D;  1HR0 D;  1FKA D;  4DV7 D;  1HNX D;  2JAN A;  4OX9 D;  1KSV A;  4X62 D;  4DV2 D;  4DR1 D;  1N32 D;  4X65 D;  1HNZ D;  4X66 D;  4KHP D;  2ZTB A;  4NNJ A;  4JI4 D;  1C05 A;  1N34 D;  1H3F A;  4DR6 D;  3J7A F;  4B3S D;  4DR3 D;  4GKK D;  2KTL A;  4II3 A;  3JAM E;  5KNL A;  4X64 D;  4LF9 D;  4LFC D;  4YY3 D;  1N36 D;  2UXB D;  3KYD B;  2UXD D;  4LF6 D;  3KYC B;  3DH3 A;  1IBL D;  4K0K D;  4OUD A;  3CMM A;  2I1S A;  2UUA D;  2NVU B;  4LF8 D;  4LF4 D;  5LMU D;  4DUZ D;  2F4V D;  4LF5 D;  2VQE D;  4AQY D;  4JI1 D;  2ZM6 D;  2VQF D;  4DV5 D;  1VIO A;  1P9K A;  5LL6 S;  4DR5 D;  1Y8R B;  1Y8X B;  4JI0 D;  2HHH D;  4LF7 D;  2L3N A;  4DV3 D;  4YHH D;  4DR2 D;  2UXC D;  4JI5 D; 
#chains in the Genus database with same CATH homology
 2K6P A;  1IBK D;  1N33 D;  3KBG A;  4LGT A;  2UUB D;  4NXN D;  4JI7 D;  4B3R D;  2IST A;  4GKJ D;  4DV1 D;  4LFB D;  1IBM D;  1C06 A;  1H3E A;  4B3T D;  4DR7 D;  5LMN D;  1XMO D;  4DUY D;  4NXM D;  1XNQ D;  3HP7 A;  3T1Y D;  1JH3 A;  1J5E D;  4JV5 D;  3OTO D;  1HNW D;  4JI6 D;  2E5L D;  4JI8 D;  4DV0 D;  4DV4 D;  2UU9 D;  1FJG D;  5BR8 D;  1XNR D;  4LFA D;  1DM9 A;  4DR4 D;  4JYA D;  4JI2 D;  4JI3 D;  5IWA D;  1KSL A;  1KSK A;  3T1H D;  1I94 D;  2UUC D;  4DV6 D;  4B3M D;  1XMQ D;  1HR0 D;  1FKA D;  4DV7 D;  1HNX D;  2JAN A;  4OX9 D;  1KSV A;  4X62 D;  4DV2 D;  4DR1 D;  1N32 D;  4X65 D;  1HNZ D;  4X66 D;  4KHP D;  4JI4 D;  1C05 A;  1N34 D;  1H3F A;  4DR6 D;  4B3S D;  4DR3 D;  4GKK D;  2KTL A;  4X64 D;  4LF9 D;  4LFC D;  4YY3 D;  1N36 D;  2UXB D;  2UXD D;  4LF6 D;  3DH3 A;  1IBL D;  4K0K D;  4OUD A;  2UUA D;  4LF8 D;  4LF4 D;  5LMU D;  4DUZ D;  2F4V D;  4LF5 D;  2VQE D;  4AQY D;  4JI1 D;  2ZM6 D;  2VQF D;  4DV5 D;  1VIO A;  1P9K A;  4DR5 D;  4JI0 D;  2HHH D;  4LF7 D;  2L3N A;  4DV3 D;  4YHH D;  4DR2 D;  2UXC D;  4JI5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...