2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
4DR4E 1KVKA 2RS6A 2UXBE 4DV1I 2DEJA 4FWGA 3T1HI 2LBSB 1HNWI 3PYFA 2RS7A 1DI2A 2E1RA 1H72C 1ZM9A 4LF6I 1Z5BA 2VF3A 1X48A 2CPNA 3ADGA 1YYWA 1Z59A 1XMOI 4NXNI 4LFCE 3J7Yp 2MDRA 4LFBI 4DR1E 2L2MA 2LUQA 1D6TA 1Z0TA 5LMUI 2DB2A 4LF9I 3PYEA 1UHZA 3T1YI 3HTXA 1N0UA 1NHIA 2UXCE 2KHXA 1S16A 1ZXNA 5FLXQ 4EMDA 4WUCA 5IT9C 4DPXA 4JI0I 1KIJA 2NA2A 2VQEE 4DU8A 2UUCI 4LF5E 1QZRA 2HHHI 2LJHA 2F4VE 2UUAI 1ZM4A 2L2KB 4YY3E 2R3VA 4I3HA 4DR4I 1HR0E 1HNZE 2UXBI 4JG4A 4Z7CA 4UT4A 1N36E 1XNRI 3VYXA 1N0VC 4USKA 4UTGA 2HFSA 3QT5A 3WU5A 4LFAI 4JI7E 1KTVA 4LFCI 2NUEA 4DR1I 4DV4E 4M30A 1UILA 1T4LB 4X64E 2XEXA 4DPTA 2YT4A 1KKHA 1ZM2A 2CZ9A 4DR7E 2B7TA 4USMA 3P1XA 2HFUA 2VQEI 1XNQE 4B3ME 1DARA 4LF5I 1H73A 4LF8E 1XHKA 4DR3E 2L2NA 2BM1A 2AJ4A 2F4VI 4JYAE 4AQYE 4YHHE 4DV0E 5CFFE 4YY3I 4JI6E 2JY9A 2N3GA 1HR0I 1HNZI 2N3HA 4JI2E 3QT8A 2HKJA 4DV5E 1PIEA 2X7IA 3C4TA 4WUDA 1X49A 1N36I 3WU3A 4OX9E 1B63A 3ZKDA 1Z5CA 5BR8E 4DUZE 4JI7I 1PVGA 3C4BA 1HNXE 1Z0CA 4DR6E 5GMEA 4DPWA 4DR5E 2UXDE 1FWLA 3ZM7A 2VQFI 1FWKA 4XTJA 4DV4I 1Z0WA 1O0WA 2B3TB 3ADJA 1H7UA 4FWHA 4ZVIA 1B62A 2Q2EB 4DU7A 3OTOE 4DR7I 3Q1QA 3V2UC 4DR2E 1FI4A 3LTOA 1XNQI 5A2QQ 4B3MI 4GKKE 1FKAE 1N33E 4LF8I 4JI8E 1VISA 4DR3I 3HULA 4JYAI 4R1FA 4AQYI 4YHHI 4DV0I 4JI6I 4WYQB 1J26A 4JI2I 4X62E 4DV5I 2JVAA 3J80C 1RR9A 1X47A 1IBKE 3JAMQ 1WHQA 2HKEA 4DUZI 2WW4A 4MYTA 5IWAE 1HNXI 3M6AA 4DR6I 4KHPE 4DR5I 2V8PA 2UXDI 1Z0VA 1IBLE 2LTRA 1PKPA 2LUPB 4DV6E 4WUBA 1QU6A 3B8HA 3ZZ0A 1ZM3A 2UUBE 2LJPA 2ZBKB 4X65E 1A6FA 2L3CA 3OTOI 1T4NA 4M1KA 4DXLA 1IBME 2HK2A 2EFGA 1Z0GA 4DR2I 4URLA 4RPFA 2DMYA 2UXCI 3T1HE 1MG7A 2V2ZA 2X36A 4GKKI 5LL6R 2L3JA 1YZ9A 1OJ4A 2RTXA 1N33I 4LF6E 4JI8I 2B7VA 4M2ZA 4Z7YA 1STUA 1Z5AA 5FLXC 1GQEA 4LF4E 4GKJE 4JI4E 1FNMA 4X62I 2ZITA 4HYMA 5LMNE 1J5EE 2NPFA 2A2CA 3V5RA 3K1JA 4MYUA 4JI1E 4KQVA 1ELOA 5IWAI 4X8WA 3JAMC 1RQ0A 4KHPI 3WU4A 4DV7E 2LTSA 1IBLI 4K0KE 4DV6I 3VYYA 3J81Q 3ZZUA 4DPYA 1WUUA 3ADLA 2UUBI 1MU5A 4NXME 2GS8A 1RC7A 4X65I 2R42A 4B3TE 4DV2E 3J7AM 5L3JA 1IBMI 4X64I 4DUYE 1S4EA 4JI5E 4HXZA 4DV3E 2E5LE 4HACA 1NHHA 2V34A 1XNRE 1K47A 4X66E 1N34E 1Z0BA 2UU9E 1XMQE 5GMDA 2V2QA 4DPUA 2A2DA 3H4LA 4LF7E 3K17A 4LFAE 4LF4I 4GKJI 3LPSA 4JI4I 5LMNI 1RREA 2J7KA 1J5EI 2DEIA 3D4JA 3J7AG 1I94E 4JI1I 1FJGE 4DKKA 1H74A 4ED4A 4B3SE 4OX9I 1ZXMA 1ZBTA 3QT7A 2ZM6E 3ADIA 4DV7I 5BR8I 3LLHA 1WHNA 1U2RA 4K0KI 2NUGA 4PRXA 4PRVA 1BKNA 1EI1A 4NXMI 2OI2A 4JV5E 4B3TI 3ZKBA 4DV2I 1YYKA 4B3RE 2HK3A 4JI3E 1N32E 4WFTA 3J81C 3CWVA 4DUYI 4PU9A 4JI5I 4HACB 4FN5A 4DV3I 2E5LI 3WU6A 4FW9A 4X66I 1N34I 2EZ6A 2UU9I 1XMQI 4DV1E 3LNUA 3B78A 4LF7I 1HNWE 3GONA 2V2VA 2RSMA 3PYDA 1NHJA 2BM0A 2BV3A 5A2QC 2VQFE 2DIXA 1MX0A 1XMOE 1H7SA 4NXNE 2LRSA 3ZZTA 1I94I 1FJGI 4LFBE 5LMUE 1IBKI 4B3SI 5IT9Q 3B82A 4LF9E 3PYGA 4HY1A 2ZM6I 1EA6A 3T1YE 4OOGC 1UEKA 1NZ0A 1YYOA 4JI0E 2NUFA 1T4OA 4P52A 3J80Q 4JV5I 3QT6A 4B3RI 1EKZA 2UUCE 4JI3I 2IHR1 2HHHE 1N32I 4P7AA 1Z0EA 4FWDA 3F0NA 2L33A 2UUAE
chains in the Genus database with same CATH superfamily
4DR4E 1KVKA 2O1WA 2RS6A 2UXBE 5EL9A 3M7NG 4DV1I 2MC6A 2DEJA 1YUIA 4FWGA 4TUGA 1UDSA 3T1HI 2LBSB 2EM8A 2JOXA 1HNWI 3PYFA 5AE1A 2RS7A 1DI2A 1HK7A 2E1RA 1ZBQA 1UBDC 3NZKA 2VESA 1H72C 4IS9A 1ZM9A 2JE6A 4LF6I 1Z5BA 2EPUA 2VF3A 2JR1A 2YRMA 1X48A 2CPNA 3ADGA 2JT2A 1YYWA 1NCSA 1Z59A 3BIDA 1XMOI 4NXNI 4LFCE 3J7Yp 2MDRA 4LFBI 4BBYA 4DR1E 2L2MA 2WBTA 4NBQA 2LUQA 2EWLA 5K36C 2GO3A 1A1HA 1Z0TA 1D6TA 5LMUI 2PNLA 5C0XD 2PO0A 4RHBB 3PS2A 2HC5A 4ZYGA 2DB2A 4LF9I 5DNLA 3PYEA 1UHZA 3T1YI 4IFDA 3HTXA 1JK2A 4NHRA 2NN6B 2FV4B 1N0UA 1OYSA 3M7ND 4OO1D 5KL7A 1NHIA 2UXCE 2KHXA 1S16A 1ZXNA 5FLXQ 2CTDA 4WUCA 4EMDA 5IT9C 4DPXA 1USUA 4JI0I 4GZNC 2EOXA 2YU8A 1KIJA 3CDJA 4BS9A 2DSYA 2C39B 2EL5A 3BGHA 2N8XA 4FK5C 2NA2A 4R2AA 2IOPA 3QG5C 2LV2A 1MGTA 2VQEE 4DU8A 2EPZA 2UUCI 5JEAC 4LF5E 2EM0A 1QZRA 2HHHI 2L6MA 4BHBA 5F3WA 2LJHA 4R03A 2BBGA 2M9AA 1EH6A 2F4VE 4WSGA 4OZEA 2UUAI 2EM6A 1ZM4A 1YHCA 1OYRA 2L2KB 4YY3E 2R3VA 4I3HA 4LTYA 4DR4I 3PRYA 1HR0E 2IOQA 1HNZE 2UXBI 3IWDA 4JG4A 4Z7CA 2DLQA 2EM7A 4BCAA 5ADZA 4UT4A 4AM3A 1N36E 2NN6E 1XNRI 2V89A 2JE6B 3VYXA 1LLMC 5DNYA 1N0VC 4USKA 4UTGA 4Q35B 3EPJA 2HFSA 1USVA 3QT5A 3WU5A 3M85G 3HPZA 2YTEA 4F9BB 1G2DC 4LFAI 4JI7E 2WBSA 1B69A 4BA2A 1DQ3A 1KTVA 4LFCI 2EN7A 2EOEA 5A69A 2EMBA 2NUEA 2EMWA 4BHCA 4DR1I 4ZYHA 1YH8A 2EPOA 2PNZA 4L5NC 2PO0B 2ENHA 1WJPA 4DV4E 4M30A 1UILA 1TN9A 5JEAD 1T4LB 4R2CA 2YTNA 4OO1C 4NZVA 2EOSA 3RMPA 4X64E 4IFDB 2XEXA 4DPTA 3GCMA 5KL5A 2YT4A 1KKHA 1ZM2A 4GEQB 2CZ9A 5K36D 1A1GA 4DR7E 2B7TA 2LMZA 2BB8A 4USMA 3H1CA 2WNRA 3P1XA 4LU9A 1EH7A 2HFUA 4WX9A 2VQEI 1XNQE 4U3BA 4B3ME 2MKNA 2EPRA 1DARA 4LF5I 2H36X 3PS1A 1H73A 3H09A 4LF8E 1XHKA 4DR3E 2F8BA 2L2NA 4MQYA 4QNJA 1PJTA 4P7DA 2BM1A 2AJ4A 2F4VI 4JYAE 1GZ6A 3IWCA 4AQYE 2VRDA 2KONA 4YHHE 1R6MA 4DV0E 5CFFE 4YY3I 2NN6C 4JI6E 4IZJA 2JY9A 2N3GA 1HR0I 1HNZI 2N3HA 4JI2E 5C0XF 2HJJA 2PO2A 2HKJA 4DV5E 1PIEA 2X7IA 3C4TA 3QT8A 4LCGA 4BA1A 2L8TA 4IFDE 3P3GA 2EPNA 4WUDA 1Z1BA 1X49A 4BMJA 1N36I 2EMAA 4F9CB 2MKDA 2EL4A 5EKWA 4O5GA 1WXRA 2EPKX 4OX9E 3WU3A 2EE8A 4OO1F 1B63A 2EMCA 2EN6A 3M99B 3ZKDA 1Z5CA 1AH5A 5BR8E 4DUZE 2LVHA 4BA2B 2Q8UA 2EMZA 4JI7I 2A25A 1PVGA 3C4BA 1HNXE 1Z0CA 2Z5BB 2EMHA 4DR6E 3KRNA 2YPNA 5GMEA 2EMLA 3UHMA 3K6QA 4DPWA 5DNXA 2PNZB 3JTZA 4DR5E 5A6BA 1TF3A 2UXDE 1FWLA 3ZM7A 2VQFI 1FWKA 4XTJA 2JEAA 4DV4I 2PO1A 1Z0WA 1O0WA 2B3TB 3ADJA 3L00A 5KL4A 1H7UA 4DMIA 1YSAC 5DRRA 5ELWA 2ELYA 2M1SA 4FWHA 4L8NA 3U1KA 5AC5A 1SR9A 4ZVIA 1B62A 4WSPA 3GLLA 1P47A 2Q2EB 4DU7A 3OTOE 4DR7I 1DGCA 1X6HA 2WNRB 2EOJA 2R1FA 4AIMA 2I13A 3V2UC 3HJCA 3Q1QA 2G7HA 2B9DA 4DR2E 2YZTA 3BBGA 1FI4A 1Y60A 2V8QB 2JEBB 2Z5CA 4X9JA 3LTOA 5KL3A 4IZKA 5A2QQ 4J3DA 1XNQI 4B3MI 4GKKE 2LO3A 4WPYA 1FKAE 1N33E 4LF8I 2GHFA 4JI8E 4HTGA 1VISA 4DR3I 3KZYA 5A6AA 3JU0A 2EP3A 3HULA 3P3EA 4JYAI 4R1FA 3HKMA 1GTKA 2EM5A 2ELZA 2EOIA 4IZJB 4YHHI 4AQYI 2BA0G 2WP8A 4DV0I 4JI6I 2EM2A 4WYQB 2E1MA 3HPSA 1J26A 4I8OA 2PO2B 4X62E 4JI2I 4DV5I 2JVAA 3MHSC 3J80C 4R2PA 1RR9A 1X47A 1YFHA 2EM4A 1IBKE 3JAMQ 2EQ3A 1A1KA 1WHQA 2EPCA 2NN6D 3DF6A 1X5WA 3THOB 1WRJA 2DGCA 5K36F 2HKEA 4DUZI 4FW6A 1Y6ZA 2WW4A 5IWAE 3PS3A 4MU4A 1X3CA 2C37A 2BR2A 4LCHA 1A1LA 1HNXI 3M6AA 4DR6I 2YTDA 4KHPE 1UN6B 2HGHA 1EH8A 4J8ZA 2ENAA 4DR5I 2EPXA 2V8PA 2UXDI 1IBLE 2NABA 3DJWA 4BC9A 5KL2A 2LTRA 2WBUA 1Z0VA 2JEAB 2PO1B 1PKPA 2LUPB 1UDQA 1UDNA 5TSEA 2LE2A 2K4VA 2R76A 3HXLA 4R2DA 4DV6E 2O1VA 4LPFA 2EPPA 4WUBA 1OYPA 1QU6A 2EPLX 5IXMB 3B8HA 2BA0D 4RH8A 2UUBE 4M9VC 1ZM3A 2O3ZA 4FW4A 2LJPA 3ZZ0A 2ZBKB 4X65E 3THNA 2L3CA 1A6FA 2CG9A 4MLVA 3OTOI 5JEAF 2ENCA 2EN4A 1T4NA 2GPIA 4Q28A 3VHTB 4M1KA 2MDGA 1BBOA 3B4TA 3Q6NA 4LCFA 4DXLA 5C0XA 1IBME 2HK2A 2EFGA 1X6FA 1Z0GA 2FGGA 4DR2I 4URLA 4RPFA 4IZKB 2DMYA 1KYQA 2EMYA 3F6HA 3T1HE 2EMKA 1IMUA 2JOBA 5AE3A 1MG7A 2AE8A 2V2ZA 2X36A 5LL6R 2L3JA 1YZ9A 2V85A 1OJ4A 4FW5A 4OO1A 4GKKI 2RTXA 4BC7A 4R2RA 1N33I 4LF6E 2EMIA 4F9AB 4JI8I 2FTXB 2B7VA 4M2ZA 2K7IA 2E72A 4Z7YA 1STUA 1Z5AA 2J65A 2LT7A 5FLXC 1X6EA 1GQEA 3P3CA 1ZU1A 4LF4E 4GKJE 4M0VA 3L7ZA 4JI4E 5DRPA 4TUIA 2M7QA 1FNMA 3Q6MA 4X62I 2PNMA 2ZITA 4HYMA 3BF2A 4O24A 5LMNE 2LCEA 1J5EE 5T6JA 1MEYC 4MU3A 2A2CA 2NPFA 2JYAA 3V5RA 2UXCI 3K1JA 2Z5EA 4MYUA 2GQ0A 4IFDD 3EPHA 1N3GA 2EN1A 2YTJA 4JI1E 2L92A 4KQVA 4ZYDA 4OKGA 1ELOA 2C37B 2EOOA 4F2JC 2BR2B 5IWAI 3AUZA 4X8WA 1BBGA 3JAMC 1RQ0A 1ZAAC 4KHPI 2EOMA 4MYTA 2CT1A 2EJ4A 3WU4A 4DV7E 2LTSA 1IBLI 2YTOA 4K0KE 4F54A 1T39A 2YSPA 5LLQA 4DV6I 3VYYA 2JP9A 3J81Q 5AE2A 3ZZUA 1WUUA 4DPYA 5A6JA 3ADLA 2YRHA 4F6MA 2UUBI 1P42A 1MU5A 4NXME 2GS8A 2YWQA 1RC7A 1PJSA 4X65I 2R42A 4B3TE 2EPMX 4DV2E 2V87A 5C0XB 3ECRA 3J7AM 5L3JA 5DROA 1IBMI 4X64I 4ISAA 1NEIA 4DUYE 1E3HA 1S4EA 4JI5E 4IS1C 4HXZA 5AASA 4DV3E 4KZSA 2ODRC 5AC4A 2E5LE 2JXPA 4HACA 4OO1B 2JWOA 2O1TA 1NHHA 2EOQA 2V34A 2NN6F 1XNRE 1BB8A 1A1FA 4X66E 1K47A 1N34E 1Z0BA 2UU9E 1XMQE 5GMDA 5K36A 2V2QA 2EPAA 4DPUA 1ZR9A 4IJDA 4N4RB 3EQ1A 5KL6A 2A2DA 4LF7E 3H4LA 3L7ZB 3EPKA 4R2EA 3K17A 5DRQA 4LFAE 4LF4I 4GKJI 3LPSA 4JI4I 3EPLA 5A6KA 2CGEA 3IWBA 2EN2A 4R8OA 4WXDA 4GQUA 1Y4UA 5LMNI 3OMLA 1RREA 2J7KA 1J5EI 4IFDC 2DEIA 5FWKA 2YTGA 3D4JA 4FW7A 1YUJA 3J7AG 5C0XE 2YTFA 2MC5A 2PRTA 1I94E 4BA1B 4JI1I 1FJGE 3K85A 3P76A 4DKKA 1H74A 2GLIA 2EQ0A 1G2FC 2O1UA 4ED4A 3P06A 3C6KA 5JEAA 4F6NA 4B3SE 4OX9I 4OO1E 1ZXMA 1ZBTA 3M85D 3UK3C 3QT7A 4HEIA 2ZM6E 3ADIA 4DV7I 2RSIA 2WCC3 4R2SA 3LLHA 4WXCA 1WHNA 1F2IG 5BR8I 3KZZA 1U2RA 4K0KI 2YU5A 2NUGA 2DMIA 2V86A 1A1IA 3CDIA 4PRXA 4PRVA 4MU1A 1BKNA 1EI1A 2IESA 1E3PA 1L4SA 4NXMI 2OI2A 2EMFA 4JV5E 4AIDA 4B3TI 2EMGA 1Y5YA 4MDTA 3ZKBA 3U1YA 4DV2I 4IZJD 1YYKA 4B3RE 2HK3A 2EN3A 2C38A 4JI3E 1N32E 4WFTA 3J81C 3CWVA 1XXEA 2VE7C 4DUYI 2CSHA 4PU9A 4JI5I 4HACB 3ZOQB 4FN5A 4DV3I 2E5LI 4IFDF 2V88A 4FW9A 3WU6A 1QNTA 4X66I 1N34I 3LMLA 2EZ6A 1PDAA 1XMQI 2UU9I 5K36B 2CVEA 1RMDA 2ADRA 2LJUA 2M4IA 4O43A 4O4KA 4DV1E 1TF6A 2BA1G 2D9HA 2Z5CB 3B78A 3LNUA 4LF7I 1YPNA 1HNWE 3GONA 2EORA 2V2VA 2EN8A 2ODRD 2RSMA 3PYDA 2J7JA 5A6BD 2EMXA 4R2QA 1NHJA 2YTIA 1Y4SA 2Z5BA 2BM0A 5C0XC 2EM9A 3HQ1A 2YSOA 1VI7A 3VK6A 2BV3A 2WP8B 2EOHA 5A2QC 2VQFE 2YTQA 2DIXA 1MX0A 1IQOA 1XMOE 1H7SA 4NXNE 2LRSA 2JPAA 3ZZTA 2EOZA 1I94I 4FW3A 4KWYA 1FJGI 2EL6A 1AAYA 4LFBE 2EOYA 5JEAB 4QNKA 2DRPA 3FIGA 5LMUE 1IBKI 4B3SI 1JK1A 4N3OA 5IT9Q 3B82A 4LF9E 3PYGA 4HY1A 2KOUA 2ZM6I 1EA6A 3AV0A 3T1YE 3GMEA 4OOGC 1UEKA 1IQSA 5K36E 1UDOA 1SFEA 1KJKA 4U3DA 3KWRA 3TQMA 4MLQA 2NN6A 4MU0A 2BA1D 2JEBA 1NZ0A 3F6GA 3C6MA 2GO4A 1YYOA 2EM3A 2EQ1A 4JI0E 1A1JA 2NUFA 2YRKA 5IV8B 2IERA 1T4OA 4P52A 3J80Q 4JV5I 2C39A 4ZYEA 3MSWA 3QT6A 1T38A 4B3RI 1EKZA 1R6LA 2RQLA 2C38B 2UUCE 4JI3I 2IHR1 2YTPA 2HHHE 1N32I 2DLKA 4P78A 1RHYA 4P7AA 1Z0EA 2RPCA 3MHHC 4FWDA 3DD6A 1PJQA 3F0NA 2I9IA 2L33A 4LOMA 2UUAE 5JEAE 2VF1A 2EOFA 2F1DA 2V83A 2WZOA
chains in the Genus database with same CATH topology
4DR4E 1KVKA 2O1WA 2RS6A 2UXBE 4DV1I 2MC6A 2DEJA 4FWGA 4TUGA 3T1HI 2LBSB 2JOXA 1HNWI 3PYFA 5AE1A 2RS7A 1DI2A 1HK7A 2E1RA 1ZBQA 1H72C 1ZM9A 4LF6I 1Z5BA 2VF3A 2JR1A 1X48A 2CPNA 3ADGA 1YYWA 1Z59A 1XMOI 4NXNI 4LFCE 3J7Yp 2MDRA 4LFBI 4BBYA 4DR1E 2L2MA 2LUQA 2EWLA 1D6TA 1Z0TA 5LMUI 2PNLA 2DB2A 4LF9I 3PYEA 1UHZA 3T1YI 3HTXA 2FV4B 1N0UA 1NHIA 2UXCE 2KHXA 1S16A 1ZXNA 5FLXQ 4EMDA 4WUCA 5IT9C 4DPXA 1USUA 4JI0I 1KIJA 4BS9A 2DSYA 2IOPA 2NA2A 2VQEE 4DU8A 2UUCI 4LF5E 1QZRA 2HHHI 2L6MA 5F3WA 2LJHA 4R03A 2F4VE 2UUAI 1ZM4A 2L2KB 4YY3E 2R3VA 4I3HA 4LTYA 4DR4I 3PRYA 1HR0E 2IOQA 1HNZE 2UXBI 3IWDA 4JG4A 4Z7CA 4BCAA 5ADZA 4UT4A 1N36E 1XNRI 2V89A 3VYXA 5DNYA 1N0VC 4USKA 4UTGA 2HFSA 1USVA 3QT5A 3WU5A 3HPZA 4F9BB 4LFAI 4JI7E 1DQ3A 1KTVA 4LFCI 2NUEA 4DR1I 4L5NC 4DV4E 4M30A 1UILA 1T4LB 3RMPA 4X64E 2XEXA 4DPTA 2YT4A 1KKHA 1ZM2A 4GEQB 2CZ9A 4DR7E 2B7TA 2LMZA 4USMA 3P1XA 4LU9A 2HFUA 2VQEI 1XNQE 4B3ME 1DARA 4LF5I 2H36X 1H73A 3H09A 4LF8E 1XHKA 4DR3E 2F8BA 2L2NA 4P7DA 2BM1A 2AJ4A 2F4VI 4JYAE 1GZ6A 3IWCA 4AQYE 4YHHE 2KONA 4DV0E 5CFFE 4YY3I 4IZJA 4JI6E 2JY9A 2N3GA 1HR0I 1HNZI 2N3HA 4JI2E 3QT8A 2HKJA 4DV5E 1PIEA 2X7IA 3C4TA 2L8TA 4WUDA 1X49A 4BMJA 1N36I 4F9CB 3WU3A 1WXRA 4OX9E 1B63A 3ZKDA 1Z5CA 5BR8E 4DUZE 4JI7I 1PVGA 3C4BA 1HNXE 1Z0CA 2Z5BB 4DR6E 5GMEA 3K6QA 4DPWA 3JTZA 4DR5E 2UXDE 1FWLA 3ZM7A 2VQFI 1FWKA 4XTJA 4DV4I 1Z0WA 1O0WA 2B3TB 3ADJA 1H7UA 4DMIA 2M1SA 4FWHA 4L8NA 1SR9A 4ZVIA 1B62A 4WSPA 2Q2EB 4DU7A 3OTOE 4DR7I 3Q1QA 3V2UC 3HJCA 2G7HA 2B9DA 4DR2E 2YZTA 1FI4A 2V8QB 2Z5CA 3LTOA 5A2QQ 4IZKA 1XNQI 4B3MI 4GKKE 4WPYA 1FKAE 1N33E 4LF8I 4JI8E 1VISA 4DR3I 3JU0A 3HULA 4JYAI 4R1FA 4AQYI 4IZJB 4YHHI 4DV0I 4JI6I 4WYQB 1J26A 2E1MA 3HPSA 4I8OA 4JI2I 4X62E 4DV5I 2JVAA 3J80C 1RR9A 1X47A 1IBKE 3JAMQ 1WHQA 3DF6A 2HKEA 4DUZI 1Y6ZA 2WW4A 5IWAE 4MYTA 1HNXI 3M6AA 4DR6I 4KHPE 4J8ZA 4DR5I 2V8PA 2UXDI 1IBLE 4BC9A 3DJWA 1Z0VA 2LTRA 1PKPA 2LUPB 2LE2A 2K4VA 3HXLA 4DV6E 2O1VA 4WUBA 1QU6A 3B8HA 3ZZ0A 1ZM3A 2UUBE 2LJPA 2ZBKB 4X65E 1A6FA 2L3CA 2CG9A 3OTOI 4Q28A 1T4NA 4M1KA 3Q6NA 4DXLA 1IBME 2HK2A 2EFGA 1Z0GA 2FGGA 4DR2I 4URLA 4RPFA 4IZKB 2DMYA 2UXCI 3F6HA 3T1HE 1MG7A 2JOBA 5AE3A 2V2ZA 2X36A 4GKKI 5LL6R 2L3JA 1YZ9A 2V85A 1OJ4A 2RTXA 4BC7A 1N33I 4LF6E 4JI8I 4F9AB 2FTXB 2B7VA 4M2ZA 4Z7YA 1STUA 1Z5AA 5FLXC 1GQEA 4LF4E 4GKJE 4M0VA 4JI4E 4TUIA 2M7QA 1FNMA 3Q6MA 4X62I 2PNMA 2ZITA 4HYMA 5LMNE 1J5EE 5T6JA 2NPFA 2A2CA 3V5RA 3K1JA 2Z5EA 4MYUA 2GQ0A 4JI1E 2L92A 4KQVA 1ELOA 5IWAI 3AUZA 4X8WA 3JAMC 1RQ0A 4KHPI 3WU4A 4DV7E 2LTSA 1IBLI 4K0KE 4F54A 4DV6I 3VYYA 3J81Q 5AE2A 3ZZUA 1WUUA 4DPYA 3ADLA 2UUBI 1MU5A 4NXME 2GS8A 1RC7A 4X65I 2R42A 4B3TE 4DV2E 2V87A 3J7AM 5L3JA 1IBMI 4X64I 4DUYE 1S4EA 4JI5E 4HXZA 5AASA 4DV3E 4KZSA 2ODRC 2E5LE 4HACA 2JWOA 2O1TA 1NHHA 2V34A 1XNRE 1K47A 4X66E 1N34E 1Z0BA 2UU9E 1XMQE 5GMDA 2V2QA 4DPUA 2A2DA 3H4LA 4LF7E 3K17A 4LFAE 4LF4I 4GKJI 3LPSA 4JI4I 2CGEA 3IWBA 4R8OA 1Y4UA 5LMNI 3OMLA 1RREA 2J7KA 1J5EI 2DEIA 5FWKA 3D4JA 3J7AG 2MC5A 1I94E 4JI1I 1FJGE 3K85A 4DKKA 1H74A 2O1UA 4ED4A 3P06A 4B3SE 4OX9I 1ZXMA 1ZBTA 3QT7A 2ZM6E 3ADIA 4DV7I 5BR8I 3LLHA 1WHNA 1U2RA 4K0KI 2NUGA 2V86A 4PRXA 4PRVA 1BKNA 1EI1A 4NXMI 2OI2A 4JV5E 4B3TI 3ZKBA 4DV2I 4IZJD 1YYKA 4B3RE 2HK3A 4JI3E 1N32E 4WFTA 3J81C 3CWVA 2VE7C 4DUYI 4PU9A 4JI5I 4HACB 3ZOQB 4FN5A 4DV3I 2E5LI 2V88A 4FW9A 3WU6A 4X66I 1N34I 3LMLA 2EZ6A 2UU9I 1XMQI 4DV1E 2M4IA 3LNUA 2Z5CB 3B78A 4LF7I 1HNWE 3GONA 2V2VA 2RSMA 2ODRD 3PYDA 1NHJA 1Y4SA 2Z5BA 2BM0A 3HQ1A 3VK6A 2BV3A 5A2QC 2VQFE 2DIXA 1MX0A 1XMOE 1H7SA 4NXNE 2LRSA 3ZZTA 1I94I 1FJGI 4LFBE 3FIGA 5LMUE 1IBKI 4B3SI 4N3OA 5IT9Q 3B82A 4LF9E 3PYGA 4HY1A 2KOUA 2ZM6I 1EA6A 3AV0A 3T1YE 4OOGC 1UEKA 3KWRA 1NZ0A 3F6GA 1YYOA 4JI0E 2NUFA 1T4OA 4P52A 3J80Q 4JV5I 3MSWA 3QT6A 4B3RI 1EKZA 2UUCE 4JI3I 2IHR1 2HHHE 1N32I 4P78A 4P7AA 1Z0EA 4FWDA 3F0NA 2L33A 2UUAE 2VF1A 2V83A 2WZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 E;  1KVK A;  2RS6 A;  2UXB E;  4DV1 I;  2DEJ A;  4FWG A;  3T1H I;  2LBS B;  1HNW I;  3PYF A;  2RS7 A;  1DI2 A;  2E1R A;  1H72 C;  1ZM9 A;  4LF6 I;  1Z5B A;  2VF3 A;  1X48 A;  2CPN A;  3ADG A;  1YYW A;  1Z59 A;  1XMO I;  4NXN I;  4LFC E;  3J7Y p;  2MDR A;  4LFB I;  4DR1 E;  2L2M A;  2LUQ A;  1D6T A;  1Z0T A;  5LMU I;  2DB2 A;  4LF9 I;  3PYE A;  1UHZ A;  3T1Y I;  3HTX A;  1N0U A;  1NHI A;  2UXC E;  2KHX A;  1S16 A;  1ZXN A;  5FLX Q;  4EMD A;  4WUC A;  5IT9 C;  4DPX A;  4JI0 I;  1KIJ A;  2NA2 A;  2VQE E;  4DU8 A;  2UUC I;  4LF5 E;  1QZR A;  2HHH I;  2LJH A;  2F4V E;  2UUA I;  1ZM4 A;  2L2K B;  4YY3 E;  2R3V A;  4I3H A;  4DR4 I;  1HR0 E;  1HNZ E;  2UXB I;  4JG4 A;  4Z7C A;  4UT4 A;  1N36 E;  1XNR I;  3VYX A;  1N0V C;  4USK A;  4UTG A;  2HFS A;  3QT5 A;  3WU5 A;  4LFA I;  4JI7 E;  1KTV A;  4LFC I;  2NUE A;  4DR1 I;  4DV4 E;  4M30 A;  1UIL A;  1T4L B;  4X64 E;  2XEX A;  4DPT A;  2YT4 A;  1KKH A;  1ZM2 A;  2CZ9 A;  4DR7 E;  2B7T A;  4USM A;  3P1X A;  2HFU A;  2VQE I;  1XNQ E;  4B3M E;  1DAR A;  4LF5 I;  1H73 A;  4LF8 E;  1XHK A;  4DR3 E;  2L2N A;  2BM1 A;  2AJ4 A;  2F4V I;  4JYA E;  4AQY E;  4YHH E;  4DV0 E;  5CFF E;  4YY3 I;  4JI6 E;  2JY9 A;  2N3G A;  1HR0 I;  1HNZ I;  2N3H A;  4JI2 E;  3QT8 A;  2HKJ A;  4DV5 E;  1PIE A;  2X7I A;  3C4T A;  4WUD A;  1X49 A;  1N36 I;  3WU3 A;  4OX9 E;  1B63 A;  3ZKD A;  1Z5C A;  5BR8 E;  4DUZ E;  4JI7 I;  1PVG A;  3C4B A;  1HNX E;  1Z0C A;  4DR6 E;  5GME A;  4DPW A;  4DR5 E;  2UXD E;  1FWL A;  3ZM7 A;  2VQF I;  1FWK A;  4XTJ A;  4DV4 I;  1Z0W A;  1O0W A;  2B3T B;  3ADJ A;  1H7U A;  4FWH A;  4ZVI A;  1B62 A;  2Q2E B;  4DU7 A;  3OTO E;  4DR7 I;  3Q1Q A;  3V2U C;  4DR2 E;  1FI4 A;  3LTO A;  1XNQ I;  5A2Q Q;  4B3M I;  4GKK E;  1FKA E;  1N33 E;  4LF8 I;  4JI8 E;  1VIS A;  4DR3 I;  3HUL A;  4JYA I;  4R1F A;  4AQY I;  4YHH I;  4DV0 I;  4JI6 I;  4WYQ B;  1J26 A;  4JI2 I;  4X62 E;  4DV5 I;  2JVA A;  3J80 C;  1RR9 A;  1X47 A;  1IBK E;  3JAM Q;  1WHQ A;  2HKE A;  4DUZ I;  2WW4 A;  4MYT A;  5IWA E;  1HNX I;  3M6A A;  4DR6 I;  4KHP E;  4DR5 I;  2V8P A;  2UXD I;  1Z0V A;  1IBL E;  2LTR A;  1PKP A;  2LUP B;  4DV6 E;  4WUB A;  1QU6 A;  3B8H A;  3ZZ0 A;  1ZM3 A;  2UUB E;  2LJP A;  2ZBK B;  4X65 E;  1A6F A;  2L3C A;  3OTO I;  1T4N A;  4M1K A;  4DXL A;  1IBM E;  2HK2 A;  2EFG A;  1Z0G A;  4DR2 I;  4URL A;  4RPF A;  2DMY A;  2UXC I;  3T1H E;  1MG7 A;  2V2Z A;  2X36 A;  4GKK I;  5LL6 R;  2L3J A;  1YZ9 A;  1OJ4 A;  2RTX A;  1N33 I;  4LF6 E;  4JI8 I;  2B7V A;  4M2Z A;  4Z7Y A;  1STU A;  1Z5A A;  5FLX C;  1GQE A;  4LF4 E;  4GKJ E;  4JI4 E;  1FNM A;  4X62 I;  2ZIT A;  4HYM A;  5LMN E;  1J5E E;  2NPF A;  2A2C A;  3V5R A;  3K1J A;  4MYU A;  4JI1 E;  4KQV A;  1ELO A;  5IWA I;  4X8W A;  3JAM C;  1RQ0 A;  4KHP I;  3WU4 A;  4DV7 E;  2LTS A;  1IBL I;  4K0K E;  4DV6 I;  3VYY A;  3J81 Q;  3ZZU A;  4DPY A;  1WUU A;  3ADL A;  2UUB I;  1MU5 A;  4NXM E;  2GS8 A;  1RC7 A;  4X65 I;  2R42 A;  4B3T E;  4DV2 E;  3J7A M;  5L3J A;  1IBM I;  4X64 I;  4DUY E;  1S4E A;  4JI5 E;  4HXZ A;  4DV3 E;  2E5L E;  4HAC A;  1NHH A;  2V34 A;  1XNR E;  1K47 A;  4X66 E;  1N34 E;  1Z0B A;  2UU9 E;  1XMQ E;  5GMD A;  2V2Q A;  4DPU A;  2A2D A;  3H4L A;  4LF7 E;  3K17 A;  4LFA E;  4LF4 I;  4GKJ I;  3LPS A;  4JI4 I;  5LMN I;  1RRE A;  2J7K A;  1J5E I;  2DEI A;  3D4J A;  3J7A G;  1I94 E;  4JI1 I;  1FJG E;  4DKK A;  1H74 A;  4ED4 A;  4B3S E;  4OX9 I;  1ZXM A;  1ZBT A;  3QT7 A;  2ZM6 E;  3ADI A;  4DV7 I;  5BR8 I;  3LLH A;  1WHN A;  1U2R A;  4K0K I;  2NUG A;  4PRX A;  4PRV A;  1BKN A;  1EI1 A;  4NXM I;  2OI2 A;  4JV5 E;  4B3T I;  3ZKB A;  4DV2 I;  1YYK A;  4B3R E;  2HK3 A;  4JI3 E;  1N32 E;  4WFT A;  3J81 C;  3CWV A;  4DUY I;  4PU9 A;  4JI5 I;  4HAC B;  4FN5 A;  4DV3 I;  2E5L I;  3WU6 A;  4FW9 A;  4X66 I;  1N34 I;  2EZ6 A;  2UU9 I;  1XMQ I;  4DV1 E;  3LNU A;  3B78 A;  4LF7 I;  1HNW E;  3GON A;  2V2V A;  2RSM A;  3PYD A;  1NHJ A;  2BM0 A;  2BV3 A;  5A2Q C;  2VQF E;  2DIX A;  1MX0 A;  1XMO E;  1H7S A;  4NXN E;  2LRS A;  3ZZT A;  1I94 I;  1FJG I;  4LFB E;  5LMU E;  1IBK I;  4B3S I;  5IT9 Q;  3B82 A;  4LF9 E;  3PYG A;  4HY1 A;  2ZM6 I;  1EA6 A;  3T1Y E;  4OOG C;  1UEK A;  1NZ0 A;  1YYO A;  4JI0 E;  2NUF A;  1T4O A;  4P52 A;  3J80 Q;  4JV5 I;  3QT6 A;  4B3R I;  1EKZ A;  2UUC E;  4JI3 I;  2IHR 1;  2HHH E;  1N32 I;  4P7A A;  1Z0E A;  4FWD A;  3F0N A;  2L33 A;  2UUA E; 
#chains in the Genus database with same CATH topology
 4DR4 E;  1KVK A;  2O1W A;  2RS6 A;  2UXB E;  5EL9 A;  3M7N G;  4DV1 I;  2MC6 A;  2DEJ A;  1YUI A;  4FWG A;  4TUG A;  1UDS A;  3T1H I;  2LBS B;  2EM8 A;  2JOX A;  1HNW I;  3PYF A;  5AE1 A;  2RS7 A;  1DI2 A;  1HK7 A;  2E1R A;  1ZBQ A;  1UBD C;  3NZK A;  2VES A;  1H72 C;  4IS9 A;  1ZM9 A;  2JE6 A;  4LF6 I;  1Z5B A;  2EPU A;  2VF3 A;  2JR1 A;  2YRM A;  1X48 A;  2CPN A;  3ADG A;  2JT2 A;  1YYW A;  1NCS A;  1Z59 A;  3BID A;  1XMO I;  4NXN I;  4LFC E;  3J7Y p;  2MDR A;  4LFB I;  4BBY A;  4DR1 E;  2L2M A;  2WBT A;  4NBQ A;  2LUQ A;  2EWL A;  5K36 C;  2GO3 A;  1A1H A;  1Z0T A;  1D6T A;  5LMU I;  2PNL A;  5C0X D;  2PO0 A;  4RHB B;  3PS2 A;  2HC5 A;  4ZYG A;  2DB2 A;  4LF9 I;  5DNL A;  3PYE A;  1UHZ A;  3T1Y I;  4IFD A;  3HTX A;  1JK2 A;  4NHR A;  2NN6 B;  2FV4 B;  1N0U A;  1OYS A;  3M7N D;  4OO1 D;  5KL7 A;  1NHI A;  2UXC E;  2KHX A;  1S16 A;  1ZXN A;  5FLX Q;  2CTD A;  4WUC A;  4EMD A;  5IT9 C;  4DPX A;  1USU A;  4JI0 I;  4GZN C;  2EOX A;  2YU8 A;  1KIJ A;  3CDJ A;  4BS9 A;  2DSY A;  2C39 B;  2EL5 A;  3BGH A;  2N8X A;  4FK5 C;  2NA2 A;  4R2A A;  2IOP A;  3QG5 C;  2LV2 A;  1MGT A;  2VQE E;  4DU8 A;  2EPZ A;  2UUC I;  5JEA C;  4LF5 E;  2EM0 A;  1QZR A;  2HHH I;  2L6M A;  4BHB A;  5F3W A;  2LJH A;  4R03 A;  2BBG A;  2M9A A;  1EH6 A;  2F4V E;  4WSG A;  4OZE A;  2UUA I;  2EM6 A;  1ZM4 A;  1YHC A;  1OYR A;  2L2K B;  4YY3 E;  2R3V A;  4I3H A;  4LTY A;  4DR4 I;  3PRY A;  1HR0 E;  2IOQ A;  1HNZ E;  2UXB I;  3IWD A;  4JG4 A;  4Z7C A;  2DLQ A;  2EM7 A;  4BCA A;  5ADZ A;  4UT4 A;  4AM3 A;  1N36 E;  2NN6 E;  1XNR I;  2V89 A;  2JE6 B;  3VYX A;  1LLM C;  5DNY A;  1N0V C;  4USK A;  4UTG A;  4Q35 B;  3EPJ A;  2HFS A;  1USV A;  3QT5 A;  3WU5 A;  3M85 G;  3HPZ A;  2YTE A;  4F9B B;  1G2D C;  4LFA I;  4JI7 E;  2WBS A;  1B69 A;  4BA2 A;  1DQ3 A;  1KTV A;  4LFC I;  2EN7 A;  2EOE A;  5A69 A;  2EMB A;  2NUE A;  2EMW A;  4BHC A;  4DR1 I;  4ZYH A;  1YH8 A;  2EPO A;  2PNZ A;  4L5N C;  2PO0 B;  2ENH A;  1WJP A;  4DV4 E;  4M30 A;  1UIL A;  1TN9 A;  5JEA D;  1T4L B;  4R2C A;  2YTN A;  4OO1 C;  4NZV A;  2EOS A;  3RMP A;  4X64 E;  4IFD B;  2XEX A;  4DPT A;  3GCM A;  5KL5 A;  2YT4 A;  1KKH A;  1ZM2 A;  4GEQ B;  2CZ9 A;  5K36 D;  1A1G A;  4DR7 E;  2B7T A;  2LMZ A;  2BB8 A;  4USM A;  3H1C A;  2WNR A;  3P1X A;  4LU9 A;  1EH7 A;  2HFU A;  4WX9 A;  2VQE I;  1XNQ E;  4U3B A;  4B3M E;  2MKN A;  2EPR A;  1DAR A;  4LF5 I;  2H36 X;  3PS1 A;  1H73 A;  3H09 A;  4LF8 E;  1XHK A;  4DR3 E;  2F8B A;  2L2N A;  4MQY A;  4QNJ A;  1PJT A;  4P7D A;  2BM1 A;  2AJ4 A;  2F4V I;  4JYA E;  1GZ6 A;  3IWC A;  4AQY E;  2VRD A;  2KON A;  4YHH E;  1R6M A;  4DV0 E;  5CFF E;  4YY3 I;  2NN6 C;  4JI6 E;  4IZJ A;  2JY9 A;  2N3G A;  1HR0 I;  1HNZ I;  2N3H A;  4JI2 E;  5C0X F;  2HJJ A;  2PO2 A;  2HKJ A;  4DV5 E;  1PIE A;  2X7I A;  3C4T A;  3QT8 A;  4LCG A;  4BA1 A;  2L8T A;  4IFD E;  3P3G A;  2EPN A;  4WUD A;  1Z1B A;  1X49 A;  4BMJ A;  1N36 I;  2EMA A;  4F9C B;  2MKD A;  2EL4 A;  5EKW A;  4O5G A;  1WXR A;  2EPK X;  4OX9 E;  3WU3 A;  2EE8 A;  4OO1 F;  1B63 A;  2EMC A;  2EN6 A;  3M99 B;  3ZKD A;  1Z5C A;  1AH5 A;  5BR8 E;  4DUZ E;  2LVH A;  4BA2 B;  2Q8U A;  2EMZ A;  4JI7 I;  2A25 A;  1PVG A;  3C4B A;  1HNX E;  1Z0C A;  2Z5B B;  2EMH A;  4DR6 E;  3KRN A;  2YPN A;  5GME A;  2EML A;  3UHM A;  3K6Q A;  4DPW A;  5DNX A;  2PNZ B;  3JTZ A;  4DR5 E;  5A6B A;  1TF3 A;  2UXD E;  1FWL A;  3ZM7 A;  2VQF I;  1FWK A;  4XTJ A;  2JEA A;  4DV4 I;  2PO1 A;  1Z0W A;  1O0W A;  2B3T B;  3ADJ A;  3L00 A;  5KL4 A;  1H7U A;  4DMI A;  1YSA C;  5DRR A;  5ELW A;  2ELY A;  2M1S A;  4FWH A;  4L8N A;  3U1K A;  5AC5 A;  1SR9 A;  4ZVI A;  1B62 A;  4WSP A;  3GLL A;  1P47 A;  2Q2E B;  4DU7 A;  3OTO E;  4DR7 I;  1DGC A;  1X6H A;  2WNR B;  2EOJ A;  2R1F A;  4AIM A;  2I13 A;  3V2U C;  3HJC A;  3Q1Q A;  2G7H A;  2B9D A;  4DR2 E;  2YZT A;  3BBG A;  1FI4 A;  1Y60 A;  2V8Q B;  2JEB B;  2Z5C A;  4X9J A;  3LTO A;  5KL3 A;  4IZK A;  5A2Q Q;  4J3D A;  1XNQ I;  4B3M I;  4GKK E;  2LO3 A;  4WPY A;  1FKA E;  1N33 E;  4LF8 I;  2GHF A;  4JI8 E;  4HTG A;  1VIS A;  4DR3 I;  3KZY A;  5A6A A;  3JU0 A;  2EP3 A;  3HUL A;  3P3E A;  4JYA I;  4R1F A;  3HKM A;  1GTK A;  2EM5 A;  2ELZ A;  2EOI A;  4IZJ B;  4YHH I;  4AQY I;  2BA0 G;  2WP8 A;  4DV0 I;  4JI6 I;  2EM2 A;  4WYQ B;  2E1M A;  3HPS A;  1J26 A;  4I8O A;  2PO2 B;  4X62 E;  4JI2 I;  4DV5 I;  2JVA A;  3MHS C;  3J80 C;  4R2P A;  1RR9 A;  1X47 A;  1YFH A;  2EM4 A;  1IBK E;  3JAM Q;  2EQ3 A;  1A1K A;  1WHQ A;  2EPC A;  2NN6 D;  3DF6 A;  1X5W A;  3THO B;  1WRJ A;  2DGC A;  5K36 F;  2HKE A;  4DUZ I;  4FW6 A;  1Y6Z A;  2WW4 A;  5IWA E;  3PS3 A;  4MU4 A;  1X3C A;  2C37 A;  2BR2 A;  4LCH A;  1A1L A;  1HNX I;  3M6A A;  4DR6 I;  2YTD A;  4KHP E;  1UN6 B;  2HGH A;  1EH8 A;  4J8Z A;  2ENA A;  4DR5 I;  2EPX A;  2V8P A;  2UXD I;  1IBL E;  2NAB A;  3DJW A;  4BC9 A;  5KL2 A;  2LTR A;  2WBU A;  1Z0V A;  2JEA B;  2PO1 B;  1PKP A;  2LUP B;  1UDQ A;  1UDN A;  5TSE A;  2LE2 A;  2K4V A;  2R76 A;  3HXL A;  4R2D A;  4DV6 E;  2O1V A;  4LPF A;  2EPP A;  4WUB A;  1OYP A;  1QU6 A;  2EPL X;  5IXM B;  3B8H A;  2BA0 D;  4RH8 A;  2UUB E;  4M9V C;  1ZM3 A;  2O3Z A;  4FW4 A;  2LJP A;  3ZZ0 A;  2ZBK B;  4X65 E;  3THN A;  2L3C A;  1A6F A;  2CG9 A;  4MLV A;  3OTO I;  5JEA F;  2ENC A;  2EN4 A;  1T4N A;  2GPI A;  4Q28 A;  3VHT B;  4M1K A;  2MDG A;  1BBO A;  3B4T A;  3Q6N A;  4LCF A;  4DXL A;  5C0X A;  1IBM E;  2HK2 A;  2EFG A;  1X6F A;  1Z0G A;  2FGG A;  4DR2 I;  4URL A;  4RPF A;  4IZK B;  2DMY A;  1KYQ A;  2EMY A;  3F6H A;  3T1H E;  2EMK A;  1IMU A;  2JOB A;  5AE3 A;  1MG7 A;  2AE8 A;  2V2Z A;  2X36 A;  5LL6 R;  2L3J A;  1YZ9 A;  2V85 A;  1OJ4 A;  4FW5 A;  4OO1 A;  4GKK I;  2RTX A;  4BC7 A;  4R2R A;  1N33 I;  4LF6 E;  2EMI A;  4F9A B;  4JI8 I;  2FTX B;  2B7V A;  4M2Z A;  2K7I A;  2E72 A;  4Z7Y A;  1STU A;  1Z5A A;  2J65 A;  2LT7 A;  5FLX C;  1X6E A;  1GQE A;  3P3C A;  1ZU1 A;  4LF4 E;  4GKJ E;  4M0V A;  3L7Z A;  4JI4 E;  5DRP A;  4TUI A;  2M7Q A;  1FNM A;  3Q6M A;  4X62 I;  2PNM A;  2ZIT A;  4HYM A;  3BF2 A;  4O24 A;  5LMN E;  2LCE A;  1J5E E;  5T6J A;  1MEY C;  4MU3 A;  2A2C A;  2NPF A;  2JYA A;  3V5R A;  2UXC I;  3K1J A;  2Z5E A;  4MYU A;  2GQ0 A;  4IFD D;  3EPH A;  1N3G A;  2EN1 A;  2YTJ A;  4JI1 E;  2L92 A;  4KQV A;  4ZYD A;  4OKG A;  1ELO A;  2C37 B;  2EOO A;  4F2J C;  2BR2 B;  5IWA I;  3AUZ A;  4X8W A;  1BBG A;  3JAM C;  1RQ0 A;  1ZAA C;  4KHP I;  2EOM A;  4MYT A;  2CT1 A;  2EJ4 A;  3WU4 A;  4DV7 E;  2LTS A;  1IBL I;  2YTO A;  4K0K E;  4F54 A;  1T39 A;  2YSP A;  5LLQ A;  4DV6 I;  3VYY A;  2JP9 A;  3J81 Q;  5AE2 A;  3ZZU A;  1WUU A;  4DPY A;  5A6J A;  3ADL A;  2YRH A;  4F6M A;  2UUB I;  1P42 A;  1MU5 A;  4NXM E;  2GS8 A;  2YWQ A;  1RC7 A;  1PJS A;  4X65 I;  2R42 A;  4B3T E;  2EPM X;  4DV2 E;  2V87 A;  5C0X B;  3ECR A;  3J7A M;  5L3J A;  5DRO A;  1IBM I;  4X64 I;  4ISA A;  1NEI A;  4DUY E;  1E3H A;  1S4E A;  4JI5 E;  4IS1 C;  4HXZ A;  5AAS A;  4DV3 E;  4KZS A;  2ODR C;  5AC4 A;  2E5L E;  2JXP A;  4HAC A;  4OO1 B;  2JWO A;  2O1T A;  1NHH A;  2EOQ A;  2V34 A;  2NN6 F;  1XNR E;  1BB8 A;  1A1F A;  4X66 E;  1K47 A;  1N34 E;  1Z0B A;  2UU9 E;  1XMQ E;  5GMD A;  5K36 A;  2V2Q A;  2EPA A;  4DPU A;  1ZR9 A;  4IJD A;  4N4R B;  3EQ1 A;  5KL6 A;  2A2D A;  4LF7 E;  3H4L A;  3L7Z B;  3EPK A;  4R2E A;  3K17 A;  5DRQ A;  4LFA E;  4LF4 I;  4GKJ I;  3LPS A;  4JI4 I;  3EPL A;  5A6K A;  2CGE A;  3IWB A;  2EN2 A;  4R8O A;  4WXD A;  4GQU A;  1Y4U A;  5LMN I;  3OML A;  1RRE A;  2J7K A;  1J5E I;  4IFD C;  2DEI A;  5FWK A;  2YTG A;  3D4J A;  4FW7 A;  1YUJ A;  3J7A G;  5C0X E;  2YTF A;  2MC5 A;  2PRT A;  1I94 E;  4BA1 B;  4JI1 I;  1FJG E;  3K85 A;  3P76 A;  4DKK A;  1H74 A;  2GLI A;  2EQ0 A;  1G2F C;  2O1U A;  4ED4 A;  3P06 A;  3C6K A;  5JEA A;  4F6N A;  4B3S E;  4OX9 I;  4OO1 E;  1ZXM A;  1ZBT A;  3M85 D;  3UK3 C;  3QT7 A;  4HEI A;  2ZM6 E;  3ADI A;  4DV7 I;  2RSI A;  2WCC 3;  4R2S A;  3LLH A;  4WXC A;  1WHN A;  1F2I G;  5BR8 I;  3KZZ A;  1U2R A;  4K0K I;  2YU5 A;  2NUG A;  2DMI A;  2V86 A;  1A1I A;  3CDI A;  4PRX A;  4PRV A;  4MU1 A;  1BKN A;  1EI1 A;  2IES A;  1E3P A;  1L4S A;  4NXM I;  2OI2 A;  2EMF A;  4JV5 E;  4AID A;  4B3T I;  2EMG A;  1Y5Y A;  4MDT A;  3ZKB A;  3U1Y A;  4DV2 I;  4IZJ D;  1YYK A;  4B3R E;  2HK3 A;  2EN3 A;  2C38 A;  4JI3 E;  1N32 E;  4WFT A;  3J81 C;  3CWV A;  1XXE A;  2VE7 C;  4DUY I;  2CSH A;  4PU9 A;  4JI5 I;  4HAC B;  3ZOQ B;  4FN5 A;  4DV3 I;  2E5L I;  4IFD F;  2V88 A;  4FW9 A;  3WU6 A;  1QNT A;  4X66 I;  1N34 I;  3LML A;  2EZ6 A;  1PDA A;  1XMQ I;  2UU9 I;  5K36 B;  2CVE A;  1RMD A;  2ADR A;  2LJU A;  2M4I A;  4O43 A;  4O4K A;  4DV1 E;  1TF6 A;  2BA1 G;  2D9H A;  2Z5C B;  3B78 A;  3LNU A;  4LF7 I;  1YPN A;  1HNW E;  3GON A;  2EOR A;  2V2V A;  2EN8 A;  2ODR D;  2RSM A;  3PYD A;  2J7J A;  5A6B D;  2EMX A;  4R2Q A;  1NHJ A;  2YTI A;  1Y4S A;  2Z5B A;  2BM0 A;  5C0X C;  2EM9 A;  3HQ1 A;  2YSO A;  1VI7 A;  3VK6 A;  2BV3 A;  2WP8 B;  2EOH A;  5A2Q C;  2VQF E;  2YTQ A;  2DIX A;  1MX0 A;  1IQO A;  1XMO E;  1H7S A;  4NXN E;  2LRS A;  2JPA A;  3ZZT A;  2EOZ A;  1I94 I;  4FW3 A;  4KWY A;  1FJG I;  2EL6 A;  1AAY A;  4LFB E;  2EOY A;  5JEA B;  4QNK A;  2DRP A;  3FIG A;  5LMU E;  1IBK I;  4B3S I;  1JK1 A;  4N3O A;  5IT9 Q;  3B82 A;  4LF9 E;  3PYG A;  4HY1 A;  2KOU A;  2ZM6 I;  1EA6 A;  3AV0 A;  3T1Y E;  3GME A;  4OOG C;  1UEK A;  1IQS A;  5K36 E;  1UDO A;  1SFE A;  1KJK A;  4U3D A;  3KWR A;  3TQM A;  4MLQ A;  2NN6 A;  4MU0 A;  2BA1 D;  2JEB A;  1NZ0 A;  3F6G A;  3C6M A;  2GO4 A;  1YYO A;  2EM3 A;  2EQ1 A;  4JI0 E;  1A1J A;  2NUF A;  2YRK A;  5IV8 B;  2IER A;  1T4O A;  4P52 A;  3J80 Q;  4JV5 I;  2C39 A;  4ZYE A;  3MSW A;  3QT6 A;  1T38 A;  4B3R I;  1EKZ A;  1R6L A;  2RQL A;  2C38 B;  2UUC E;  4JI3 I;  2IHR 1;  2YTP A;  2HHH E;  1N32 I;  2DLK A;  4P78 A;  1RHY A;  4P7A A;  1Z0E A;  2RPC A;  3MHH C;  4FWD A;  3DD6 A;  1PJQ A;  3F0N A;  2I9I A;  2L33 A;  4LOM A;  2UUA E;  5JEA E;  2VF1 A;  2EOF A;  2F1D A;  2V83 A;  2WZO A; 
#chains in the Genus database with same CATH homology
 4DR4 E;  1KVK A;  2O1W A;  2RS6 A;  2UXB E;  4DV1 I;  2MC6 A;  2DEJ A;  4FWG A;  4TUG A;  3T1H I;  2LBS B;  2JOX A;  1HNW I;  3PYF A;  5AE1 A;  2RS7 A;  1DI2 A;  1HK7 A;  2E1R A;  1ZBQ A;  1H72 C;  1ZM9 A;  4LF6 I;  1Z5B A;  2VF3 A;  2JR1 A;  1X48 A;  2CPN A;  3ADG A;  1YYW A;  1Z59 A;  1XMO I;  4NXN I;  4LFC E;  3J7Y p;  2MDR A;  4LFB I;  4BBY A;  4DR1 E;  2L2M A;  2LUQ A;  2EWL A;  1D6T A;  1Z0T A;  5LMU I;  2PNL A;  2DB2 A;  4LF9 I;  3PYE A;  1UHZ A;  3T1Y I;  3HTX A;  2FV4 B;  1N0U A;  1NHI A;  2UXC E;  2KHX A;  1S16 A;  1ZXN A;  5FLX Q;  4EMD A;  4WUC A;  5IT9 C;  4DPX A;  1USU A;  4JI0 I;  1KIJ A;  4BS9 A;  2DSY A;  2IOP A;  2NA2 A;  2VQE E;  4DU8 A;  2UUC I;  4LF5 E;  1QZR A;  2HHH I;  2L6M A;  5F3W A;  2LJH A;  4R03 A;  2F4V E;  2UUA I;  1ZM4 A;  2L2K B;  4YY3 E;  2R3V A;  4I3H A;  4LTY A;  4DR4 I;  3PRY A;  1HR0 E;  2IOQ A;  1HNZ E;  2UXB I;  3IWD A;  4JG4 A;  4Z7C A;  4BCA A;  5ADZ A;  4UT4 A;  1N36 E;  1XNR I;  2V89 A;  3VYX A;  5DNY A;  1N0V C;  4USK A;  4UTG A;  2HFS A;  1USV A;  3QT5 A;  3WU5 A;  3HPZ A;  4F9B B;  4LFA I;  4JI7 E;  1DQ3 A;  1KTV A;  4LFC I;  2NUE A;  4DR1 I;  4L5N C;  4DV4 E;  4M30 A;  1UIL A;  1T4L B;  3RMP A;  4X64 E;  2XEX A;  4DPT A;  2YT4 A;  1KKH A;  1ZM2 A;  4GEQ B;  2CZ9 A;  4DR7 E;  2B7T A;  2LMZ A;  4USM A;  3P1X A;  4LU9 A;  2HFU A;  2VQE I;  1XNQ E;  4B3M E;  1DAR A;  4LF5 I;  2H36 X;  1H73 A;  3H09 A;  4LF8 E;  1XHK A;  4DR3 E;  2F8B A;  2L2N A;  4P7D A;  2BM1 A;  2AJ4 A;  2F4V I;  4JYA E;  1GZ6 A;  3IWC A;  4AQY E;  4YHH E;  2KON A;  4DV0 E;  5CFF E;  4YY3 I;  4IZJ A;  4JI6 E;  2JY9 A;  2N3G A;  1HR0 I;  1HNZ I;  2N3H A;  4JI2 E;  3QT8 A;  2HKJ A;  4DV5 E;  1PIE A;  2X7I A;  3C4T A;  2L8T A;  4WUD A;  1X49 A;  4BMJ A;  1N36 I;  4F9C B;  3WU3 A;  1WXR A;  4OX9 E;  1B63 A;  3ZKD A;  1Z5C A;  5BR8 E;  4DUZ E;  4JI7 I;  1PVG A;  3C4B A;  1HNX E;  1Z0C A;  2Z5B B;  4DR6 E;  5GME A;  3K6Q A;  4DPW A;  3JTZ A;  4DR5 E;  2UXD E;  1FWL A;  3ZM7 A;  2VQF I;  1FWK A;  4XTJ A;  4DV4 I;  1Z0W A;  1O0W A;  2B3T B;  3ADJ A;  1H7U A;  4DMI A;  2M1S A;  4FWH A;  4L8N A;  1SR9 A;  4ZVI A;  1B62 A;  4WSP A;  2Q2E B;  4DU7 A;  3OTO E;  4DR7 I;  3Q1Q A;  3V2U C;  3HJC A;  2G7H A;  2B9D A;  4DR2 E;  2YZT A;  1FI4 A;  2V8Q B;  2Z5C A;  3LTO A;  5A2Q Q;  4IZK A;  1XNQ I;  4B3M I;  4GKK E;  4WPY A;  1FKA E;  1N33 E;  4LF8 I;  4JI8 E;  1VIS A;  4DR3 I;  3JU0 A;  3HUL A;  4JYA I;  4R1F A;  4AQY I;  4IZJ B;  4YHH I;  4DV0 I;  4JI6 I;  4WYQ B;  1J26 A;  2E1M A;  3HPS A;  4I8O A;  4JI2 I;  4X62 E;  4DV5 I;  2JVA A;  3J80 C;  1RR9 A;  1X47 A;  1IBK E;  3JAM Q;  1WHQ A;  3DF6 A;  2HKE A;  4DUZ I;  1Y6Z A;  2WW4 A;  5IWA E;  4MYT A;  1HNX I;  3M6A A;  4DR6 I;  4KHP E;  4J8Z A;  4DR5 I;  2V8P A;  2UXD I;  1IBL E;  4BC9 A;  3DJW A;  1Z0V A;  2LTR A;  1PKP A;  2LUP B;  2LE2 A;  2K4V A;  3HXL A;  4DV6 E;  2O1V A;  4WUB A;  1QU6 A;  3B8H A;  3ZZ0 A;  1ZM3 A;  2UUB E;  2LJP A;  2ZBK B;  4X65 E;  1A6F A;  2L3C A;  2CG9 A;  3OTO I;  4Q28 A;  1T4N A;  4M1K A;  3Q6N A;  4DXL A;  1IBM E;  2HK2 A;  2EFG A;  1Z0G A;  2FGG A;  4DR2 I;  4URL A;  4RPF A;  4IZK B;  2DMY A;  2UXC I;  3F6H A;  3T1H E;  1MG7 A;  2JOB A;  5AE3 A;  2V2Z A;  2X36 A;  4GKK I;  5LL6 R;  2L3J A;  1YZ9 A;  2V85 A;  1OJ4 A;  2RTX A;  4BC7 A;  1N33 I;  4LF6 E;  4JI8 I;  4F9A B;  2FTX B;  2B7V A;  4M2Z A;  4Z7Y A;  1STU A;  1Z5A A;  5FLX C;  1GQE A;  4LF4 E;  4GKJ E;  4M0V A;  4JI4 E;  4TUI A;  2M7Q A;  1FNM A;  3Q6M A;  4X62 I;  2PNM A;  2ZIT A;  4HYM A;  5LMN E;  1J5E E;  5T6J A;  2NPF A;  2A2C A;  3V5R A;  3K1J A;  2Z5E A;  4MYU A;  2GQ0 A;  4JI1 E;  2L92 A;  4KQV A;  1ELO A;  5IWA I;  3AUZ A;  4X8W A;  3JAM C;  1RQ0 A;  4KHP I;  3WU4 A;  4DV7 E;  2LTS A;  1IBL I;  4K0K E;  4F54 A;  4DV6 I;  3VYY A;  3J81 Q;  5AE2 A;  3ZZU A;  1WUU A;  4DPY A;  3ADL A;  2UUB I;  1MU5 A;  4NXM E;  2GS8 A;  1RC7 A;  4X65 I;  2R42 A;  4B3T E;  4DV2 E;  2V87 A;  3J7A M;  5L3J A;  1IBM I;  4X64 I;  4DUY E;  1S4E A;  4JI5 E;  4HXZ A;  5AAS A;  4DV3 E;  4KZS A;  2ODR C;  2E5L E;  4HAC A;  2JWO A;  2O1T A;  1NHH A;  2V34 A;  1XNR E;  1K47 A;  4X66 E;  1N34 E;  1Z0B A;  2UU9 E;  1XMQ E;  5GMD A;  2V2Q A;  4DPU A;  2A2D A;  3H4L A;  4LF7 E;  3K17 A;  4LFA E;  4LF4 I;  4GKJ I;  3LPS A;  4JI4 I;  2CGE A;  3IWB A;  4R8O A;  1Y4U A;  5LMN I;  3OML A;  1RRE A;  2J7K A;  1J5E I;  2DEI A;  5FWK A;  3D4J A;  3J7A G;  2MC5 A;  1I94 E;  4JI1 I;  1FJG E;  3K85 A;  4DKK A;  1H74 A;  2O1U A;  4ED4 A;  3P06 A;  4B3S E;  4OX9 I;  1ZXM A;  1ZBT A;  3QT7 A;  2ZM6 E;  3ADI A;  4DV7 I;  5BR8 I;  3LLH A;  1WHN A;  1U2R A;  4K0K I;  2NUG A;  2V86 A;  4PRX A;  4PRV A;  1BKN A;  1EI1 A;  4NXM I;  2OI2 A;  4JV5 E;  4B3T I;  3ZKB A;  4DV2 I;  4IZJ D;  1YYK A;  4B3R E;  2HK3 A;  4JI3 E;  1N32 E;  4WFT A;  3J81 C;  3CWV A;  2VE7 C;  4DUY I;  4PU9 A;  4JI5 I;  4HAC B;  3ZOQ B;  4FN5 A;  4DV3 I;  2E5L I;  2V88 A;  4FW9 A;  3WU6 A;  4X66 I;  1N34 I;  3LML A;  2EZ6 A;  2UU9 I;  1XMQ I;  4DV1 E;  2M4I A;  3LNU A;  2Z5C B;  3B78 A;  4LF7 I;  1HNW E;  3GON A;  2V2V A;  2RSM A;  2ODR D;  3PYD A;  1NHJ A;  1Y4S A;  2Z5B A;  2BM0 A;  3HQ1 A;  3VK6 A;  2BV3 A;  5A2Q C;  2VQF E;  2DIX A;  1MX0 A;  1XMO E;  1H7S A;  4NXN E;  2LRS A;  3ZZT A;  1I94 I;  1FJG I;  4LFB E;  3FIG A;  5LMU E;  1IBK I;  4B3S I;  4N3O A;  5IT9 Q;  3B82 A;  4LF9 E;  3PYG A;  4HY1 A;  2KOU A;  2ZM6 I;  1EA6 A;  3AV0 A;  3T1Y E;  4OOG C;  1UEK A;  3KWR A;  1NZ0 A;  3F6G A;  1YYO A;  4JI0 E;  2NUF A;  1T4O A;  4P52 A;  3J80 Q;  4JV5 I;  3MSW A;  3QT6 A;  4B3R I;  1EKZ A;  2UUC E;  4JI3 I;  2IHR 1;  2HHH E;  1N32 I;  4P78 A;  4P7A A;  1Z0E A;  4FWD A;  3F0N A;  2L33 A;  2UUA E;  2VF1 A;  2V83 A;  2WZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...