2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
1J26A 1HNXE 1QU6A 5LMUE 1BKNA 4HACB 3OTOI 4GKKE 4B3MI 3PYFA 4JI1E 2E1RA 4RPFA 4WUCA 1YYWA 1N32I 3C4BA 2LJPA 3OTOE 5BR8E 1IBLE 4DR7I 2CZ9A 1XNQI 1HR0E 3T1HI 2Q2EB 4B3SI 1B62A 3K17A 1ZXMA 3V2UC 1N36I 1Z5CA 4DV0I 1XNQE 2HHHI 4KHPI 3Q1QA 2L3CA 2MDRA 4JI2I 4JI8I 1KKHA 2NUGA 3WU5A 4DKKA 4DV2I 1J5EI 2HKEA 4DUZI 1DI2A 3QT8A 4JYAI 2JY9A 3QT6A 2RTXA 1YYOA 4JI5I 2L3JA 1XMOI 4KQVA 3ADIA 4LF9I 1T4NA 4JV5E 4B3RI 3VYXA 2X36A 3J7AG 3ZZUA 4YY3I 2DB2A 4JI7I 1N0UA 4DPTA 2DMYA 2ZITA 1Z5BA 3WU3A 2UXCI 4DV7E 3J80Q 4LF8I 2CPNA 1PVGA 4JI8E 4JI4I 1H74A 4FN5A 4JI7E 1S16A 3ZKBA 4DV3I 4NXME 4MYUA 4JG4A 4B3TE 3F0NA 2R42A 4X65I 1IBME 4JV5I 1GQEA 4LF9E 1NHHA 4UT4A 4DV6E 3PYDA 5FLXC 4JI6I 2NUEA 4LFAE 4DR1I 5IT9Q 2DEJA 2LRSA 2B7TA 1H7UA 4PRVA 4X62I 4NXNE 3CWVA 2JVAA 1VISA 4B3TI 4NXMI 3WU6A 4WUDA 1ZM3A 1D6TA 5LMNE 4X64I 1QZRA 4P7AA 1XMOE 4OX9I 1MG7A 2HKJA 4M1KA 5IT9C 1B63A 3PYGA 3WU4A 4DPWA 3QT7A 2NA2A 1HR0I 2B7VA 2HK3A 2V2ZA 2BM0A 1ZM2A 2VQFE 2E5LI 3GONA 4DPXA 4URLA 1XNRE 1I94I 2UXDI 1YYKA 4HXZA 4DV3E 2LTSA 4JI4E 4Z7YA 4Z7CA 4WYQB 4LFBI 5GMEA 3PYEA 2L2MA 1ELOA 1NZ0A 5LMUI 2X7IA 2RS6A 4DR3I 4X62E 2UU9E 3ADLA 4DPYA 4LF6E 2LBSB 1WHNA 4JI6E 1FI4A 2L2KB 3B8HA 4JI5E 1XNRI 4DV1I 2UXCE 4GKJI 3HTXA 5A2QC 4YHHI 4K0KI 1N34I 4ED4A 2RSMA 1WHQA 2N3GA 1OJ4A 1H7SA 1FKAE 3J81C 4FWDA 3JAMQ 1WUUA 3JAMC 4X66I 2HK2A 2V2QA 4DV2E 1J5EE 2VQEE 2GS8A 5BR8I 1IBLI 4YY3E 1I94E 2UXDE 4FWHA 4JI1I 3LTOA 4XTJA 1X49A 3VYYA 4FWGA 2VQEI 2DIXA 2LUPB 1RQ0A 1EI1A 4DV5I 4LF4I 1NHJA 4KHPE 1PIEA 1T4OA 2UU9I 2V34A 4LF6I 4DU8A 4JI0E 4AQYI 1FWLA 3T1YE 4X65E 1FJGI 3J7Yp 5L3JA 4LF7E 1U2RA 1H73A 4B3ME 2EZ6A 1XHKA 1IBMI 3C4TA 2N3HA 4DV1E 1Z59A 4YHHE 4GKJE 1HNXI 1N34E 4LF5E 2R3VA 1Z0GA 2A2DA 4NXNI 1T4LB 4OOGC 2LTRA 2YT4A 3ZM7A 4I3HA 2F4VE 4AQYE 1UILA 4DR4I 1FJGE 1Z0BA 3D4JA 3HULA 1IBKE 4DR2I 3QT5A 2UXBI 2BV3A 4DV4I 1HNWI 1RC7A 4FW9A 2HFSA 1FWKA 1ZBTA 4DU7A 4WUBA 3ZKDA 2HHHE 4USKA 2B3TB 5A2QQ 3ADJA 3K1JA 3T1YI 1X47A 1N33E 4DR1E 2BM1A 2VQFI 5CFFE 1UEKA 4OX9E 3ZZ0A 4LF4E 4DPUA 4P52A 5IWAI 2UUCI 2KHXA 1DARA 4JI0I 3LPSA 4DXLA 4DUZE 1EA6A 1YZ9A 4JYAE 2L2NA 2HFUA 4DR7E 4DR3E 4USMA 1N32E 4HACA 1H72C 4DR5E 1X48A 1N0VC 1KIJA 5LMNI 4JI2E 4UTGA 2NUFA 4LFCI 2OI2A 4LF8E 4DV7I 1Z5AA 2UXBE 3ADGA 1FNMA 3M6AA 4DV0E 4ZVIA 1XMQI 2UUAI 3V5RA 4DR2E 1PKPA 2AJ4A 1KTVA 4DR4E 2V2VA 1MX0A 1STUA 1Z0EA 1EKZA 1XMQE 2UUAE 2J7KA 1A6FA 3ZZTA 1ZM9A 4LFBE 2UUBE 4DR6E 2WW4A 4JI3E 1Z0VA 3P1XA 4EMDA 3B78A 1KVKA 4M30A 1HNZE 2DEIA 2ZBKB 2ZM6I 1O0WA 5GMDA 4M2ZA 4DUYI 2F4VI 5LL6R 4K0KE 2LJHA 4DV5E 2IHR1 2E5LE 1RREA 4R1FA 4DR5I 3LLHA 4GKKI 1ZM4A 4LFCE 4PRXA 3H4LA 3J80C 1ZXNA 1RR9A 4LFAI 2A2CA 2LUQA 2ZM6E 4X66E 3T1HE 4PU9A 4X64E 1N33I 1NHIA 2EFGA 4DUYE 2XEXA 1N36E 5IWAE 2UUCE 1K47A 2VF3A 4WFTA 1HNZI 2UUBI 4MYTA 4JI3I 4X8WA 1UHZA 4LF5I 4DR6I 2L33A 4DV4E 1HNWE 5FLXQ 3B82A 1IBKI 1MU5A 4DV6I 3LNUA 1Z0WA 4HY1A 2NPFA 4LF7I 3J81Q 4HYMA 2V8PA 4B3RE 2RS7A 1S4EA 3J7AM 1Z0CA 4B3SE 1Z0TA
chains in the Genus database with same CATH superfamily
2V8QB 1AAYA 1GTKA 1J26A 1HNXE 2MKDA 4ZYDA 4R2AA 5C0XF 1QU6A 2EMIA 2RSIA 5LMUE 1BKNA 1QNTA 4HACB 3OTOI 4GKKE 4N3OA 4BCAA 4B3MI 4O5GA 3PYFA 5K36C 4JI1E 5JEAB 2E1RA 2H36X 2L8TA 4RPFA 3IWCA 1Y6ZA 1PJSA 4WUCA 2EMAA 1YYWA 4BA1B 1N32I 3C4BA 2LJPA 2G7HA 2LE2A 5BR8E 3OTOE 1IBLE 2C39A 4DR7I 2CZ9A 3NZKA 5LLQA 1XNQI 3TQMA 1IQOA 3BBGA 2C39B 1HR0E 2CG9A 5IXMB 1BBOA 2Q2EB 3T1HI 4B3SI 1B62A 3K17A 1ZXMA 3V2UC 2NN6F 2WP8A 1N36I 4DMIA 2EN4A 2EOZA 1Z5CA 5AC5A 4DV0I 2YTDA 3EPKA 2EN3A 1XNQE 2HHHI 4IZKA 4M0VA 1EH8A 4KHPI 2WZOA 4BC7A 3Q1QA 2L3CA 5AE2A 2MDRA 4JI2I 2EL4A 3EPJA 4IS9A 3HKMA 3H09A 3MHSC 3DD6A 2EPNA 2JOXA 4LCGA 2EOSA 2EM8A 1B69A 4JI8I 1KKHA 3P3CA 1X6FA 2NUGA 2NN6E 4LU9A 3M99B 4P7DA 2YTNA 2CSHA 2D9HA 3WU5A 5FWKA 2V89A 4DKKA 2EOIA 5T6JA 2GO3A 1KYQA 2HKEA 4DUZI 4DV2I 1J5EI 2I13A 1DI2A 4WSPA 3QT8A 2JE6B 2JR1A 2DMIA 4JYAI 2JY9A 2WBSA 1RHYA 3QT6A 2RTXA 1YYOA 1Z1BA 2L3JA 2BA1D 4JI5I 1XMOI 3U1YA 4OO1B 4KQVA 3ADIA 4LF9I 4FW6A 5IV8B 4R03A 1T4NA 4JV5E 1TN9A 4B3RI 4TUGA 3J7AG 3VYXA 2X36A 2EPAA 3ZZUA 4YY3I 2DB2A 4JI7I 1N0UA 2PO0B 4DPTA 2M4IA 1YH8A 5C0XC 2DMYA 3FIGA 1Z5BA 2ZITA 5KL2A 5DRQA 1E3PA 3WU3A 2EM0A 2UXCI 2EMZA 2LVHA 4DV7E 3J80Q 4LF8I 1PVGA 4JI8E 2GLIA 2IERA 5EL9A 1WXRA 2JEAB 2BR2A 4JI4I 4Q28A 1H74A 4FN5A 4MLVA 4JI7E 1S16A 3ZKBA 4DV3I 2CVEA 1T39A 4NXME 3GLLA 4MYUA 4JG4A 4B3TE 3F0NA 2R42A 4IJDA 2EN8A 4X65I 2BB8A 1IBME 4JV5I 1GQEA 4LF9E 1NHHA 4UT4A 2R1FA 2V86A 1RMDA 4F2JC 1HK7A 4DV6E 3PYDA 5FLXC 2VESA 2WP8B 4JI6I 2BA0D 4OO1A 3HJCA 5AC4A 2NUEA 3PS1A 4LFAE 4DR1I 3UHMA 5IT9Q 2DEJA 2LRSA 3BGHA 4R2QA 2B7TA 1YPNA 3H1CA 1H7UA 4PRVA 4X62I 4NXNE 3CWVA 2K4VA 2EOOA 4FW5A 4IFDA 3PS2A 3GMEA 4LOMA 2JVAA 1VISA 2EMLA 4HEIA 4RH8A 4BA1A 2J7JA 4B3TI 4GEQB 2V83A 3EPHA 3K85A 4NXMI 3WU6A 1OYRA 4WUDA 2EOYA 2EN6A 4R2DA 1ZM3A 3M85G 2JXPA 5JEAD 5DROA 2ODRC 3JU0A 1D6TA 2M7QA 4OKGA 5LMNE 2BBGA 4X64I 2ADRA 4BHCA 3PRYA 4M9VC 2EM3A 1QZRA 1YUIA 1A1GA 4R2PA 4P7AA 5AE3A 2EOHA 3HPZA 4HTGA 1EH7A 2PO1B 2O1UA 1USUA 1XMOE 5EKWA 1MG7A 2HKJA 2EM4A 4OX9I 5IT9C 4M1KA 2PO1A 1B63A 3PYGA 3Q6NA 3WU4A 2WBUA 4TUIA 4OO1E 4I8OA 4DPWA 3QT7A 2NA2A 4F6NA 1HR0I 4IFDE 2B7VA 2HK3A 4NHRA 2V2ZA 3U1KA 1WJPA 2V85A 1R6LA 2C38A 2BM0A 1ZM2A 2VQFE 5K36F 2E5LI 3GONA 4DPXA 4URLA 1XNRE 3IWBA 1I94I 1L4SA 1UDSA 1YYKA 2UXDI 4HXZA 4DV3E 1USVA 2LMZA 2V87A 1JK1A 2EN2A 1A1KA 2LTSA 4JI4E 4Z7YA 4KZSA 4Z7CA 4WYQB 5DNYA 3B4TA 4F54A 4LFBI 5GMEA 2FTXB 5A6BD 2L2MA 2LT7A 3PYEA 2MC6A 2ENHA 1ELOA 1NZ0A 5LMUI 3MSWA 4B3SE 2X7IA 2EORA 5JEAE 2RS6A 1OYSA 2Z5BA 4DR3I 4X62E 2UU9E 3ADLA 4WXDA 2YSPA 1PJTA 1T38A 2JEBA 2PNLA 4LF6E 4DPYA 2WBTA 1F2IG 2Z5BB 2LBSB 3GCMA 2EJ4A 2EWLA 3BF2A 1WHNA 4OO1F 1X5WA 3THOB 4JI6E 2GQ0A 1FI4A 2EM5A 4F9CB 2L2KB 4FW3A 3B8HA 4BC9A 4JI5E 2PO0A 1XNRI 4IZKB 2F1DA 2HC5A 2EOJA 5TSEA 4DV1I 4BMJA 2PNZB 4BA2A 3THNA 5K36A 2UXCE 4GKJI 3HTXA 2EOMA 4N4RB 5JEAC 5A2QC 4YHHI 4FK5C 2EMGA 4LCHA 4K0KI 1N34I 2JYAA 1SR9A 4IZJA 4QNKA 4ED4A 5A69A 2RSMA 1WHQA 2LJUA 2N3GA 1H7SA 1OJ4A 1YUJA 2YTGA 1FKAE 3J81C 2EPKX 2JP9A 4FWDA 1BB8A 1Z0CA 3JAMQ 5KL7A 4MQYA 2CGEA 3JAMC 1WUUA 4X66I 2HK2A 2IOQA 2EP3A 4ZYGA 2JPAA 1UDQA 2V2QA 4DV2E 1J5EE 4BHBA 2VQEE 4GZNC 2GS8A 1MGTA 5BR8I 1IBLI 4IFDB 4L5NC 2EMBA 4IFDF 2O1TA 1I94E 2UXDE 2BR2B 4FWHA 2EPCA 4JI1I 2HGHA 3LTOA 2EM6A 4XTJA 1X49A 2I9IA 5K36D 3VYYA 2YTJA 3ZOQB 4R2SA 4FWGA 2VQEI 5C0XB 2DIXA 2EOEA 2LUPB 1RQ0A 3RMPA 1DGCA 1EI1A 1Y5YA 1E3HA 3IWDA 4DV5I 4FW7A 4LF4I 1NHJA 4KHPE 1PIEA 3M7ND 1T4OA 3P3GA 2UU9I 1Y60A 2V34A 1G2DC 2NN6A 4GQUA 4WXCA 4LF6I 3VK6A 4JI0E 1A1HA 4DU8A 2ODRD 1JK2A 4AQYI 1FWLA 1WRJA 3T1YE 2N8XA 2DLKA 2LO3A 2YRKA 2C38B 4X65E 2RPCA 1A1IA 4NBQA 4R8OA 4ZYEA 3J7Yp 5L3JA 1FJGI 4LF7E 4QNJA 1U2RA 2DSYA 3KWRA 1H73A 2EMKA 4B3ME 2EZ6A 2DRPA 1XHKA 2YPNA 2YTOA 4O24A 1IBMI 3OMLA 2FV4B 2VF1A 1UDOA 1Y4SA 3C4TA 3ECRA 2N3HA 4DV1E 1Z59A 5C0XE 4YHHE 4GKJE 3CDJA 1HNXI 2YTEA 1N34E 2YTFA 4LF5E 1TF6A 2R3VA 1Z0GA 1ZR9A 3HXLA 1MEYC 1YFHA 2E1MA 2A2DA 4J3DA 4NXNI 2LV2A 3L00A 4U3DA 2EQ1A 2IESA 1T4LB 5K36E 5C0XA 4OOGC 1X6HA 2EM2A 2LTRA 3LMLA 5KL3A 1UBDC 3Q6MA 2YT4A 3K6QA 2EM9A 4F9BB 3ZM7A 4I3HA 2F4VE 4AQYE 1UILA 4DR4I 2YRMA 2PO2A 4Q35B 1FJGE 1Z0BA 2AE8A 3D4JA 3HULA 1IBKE 2BA1G 4DR2I 3QT5A 2UXBI 3DF6A 2BV3A 4DV4I 1HNWI 1YHCA 1NEIA 5AE1A 1RC7A 2EPPA 1R6MA 1IQSA 2YRHA 3UK3C 2LCEA 2J65A 4FW9A 4O43A 2HFSA 5DRRA 2WNRB 1FWKA 2R76A 3HQ1A 2E72A 1ZBTA 2CT1A 2ELYA 4DU7A 2EPRA 4WUBA 2ENCA 5K36B 3ZKDA 1BBGA 2EMCA 2WCC3 4RHBB 2HHHE 4USKA 5C0XD 2ELZA 2EPMX 2B3TB 2NN6D 5A2QQ 3ADJA 3K1JA 1X6EA 3T1YI 1X47A 3C6MA 1N33E 2PNMA 4OO1C 4DR1E 2BM1A 4MU4A 2VQFI 5CFFE 1UEKA 2YWQA 4OX9E 2JEBB 3ZZ0A 5AASA 4LF4E 2DGCA 2V88A 4P52A 2EMHA 4DPUA 5IWAI 2UUCI 2KHXA 1DARA 4JI0I 3LPSA 4DXLA 4DUZE 1EA6A 1YZ9A 2VE7C 4JYAE 2L2NA 2BA0G 3BIDA 4F6MA 4DR7E 2HFUA 5DNXA 4DR3E 2EPOA 4AIMA 4AM3A 4USMA 2GHFA 4R2RA 1N32E 4HACA 3AV0A 1H72C 1NCSA 4MU0A 2EOXA 2ENAA 2EOQA 4KWYA 4DR5E 1X48A 5A6KA 1N0VC 1KIJA 5LMNI 2EN1A 2EQ3A 1TF3A 4JI2E 1UDNA 3C6KA 2M1SA 4UTGA 2GPIA 4LCFA 2NUFA 4BBYA 4LFCI 2EMYA 2OI2A 4MDTA 4LF8E 4DV7I 2YU5A 4L8NA 2RQLA 1Z5AA 2UXBE 3ADGA 1FNMA 3M6AA 4DV0E 1KJKA 4ZVIA 2EL5A 5KL5A 1XMQI 2UUAI 2PO2B 1N3GA 2EPXA 2MDGA 2EMFA 4LPFA 1PJQA 1A1LA 2YU8A 3V5RA 3EPLA 3L7ZA 4DR2E 2Z5CB 1PKPA 2AJ4A 2JOBA 3KZZA 4ZYHA 1KTVA 4DR4E 2V2VA 1MX0A 4OO1D 1STUA 1ZU1A 2PRTA 1Z0EA 1EKZA 2WNRA 1XMQE 2UUAE 3F6HA 5KL4A 2YTIA 2JWOA 2J7KA 1A6FA 2EMWA 2EMXA 3ZZTA 1ZM9A 4LFBE 2A25A 2UUBE 1ZAAC 2KONA 4WX9A 1G2FC 2EN7A 4DR6E 3M85D 4IZJB 3M7NG 2WW4A 4JI3E 1Z0VA 2O3ZA 3P1XA 4IFDC 2L6MA 4EMDA 3B78A 5ADZA 4FW4A 3KZYA 1KVKA 2YZTA 4M30A 4IZJD 3KRNA 2O1VA 1HNZE 1LLMC 2DEIA 2EPZA 4NZVA 2FGGA 1IMUA 2JT2A 2YTPA 5A6BA 2ZBKB 3P76A 4P78A 4MLQA 2CTDA 2ZM6I 2NABA 1P42A 1DQ3A 3QG5C 2VRDA 2O1WA 1O0WA 2EPUA 3VHTB 4OZEA 5GMDA 4M2ZA 2GO4A 4DUYI 5F3WA 4AIDA 2F4VI 1X3CA 5LL6R 4BS9A 4IFDD 4K0KE 4J8ZA 2LJHA 4DV5E 2IHR1 2KOUA 2MC5A 2E5LE 1RREA 4R1FA 4DR5I 2EOFA 3LLHA 2YSOA 4R2EA 1AH5A 3F6GA 1ZM4A 3DJWA 4MU3A 2JEAA 5DNLA 4GKKI 4LFCE 4PRXA 2EQ0A 2IOPA 2DLQA 3H4LA 3J80C 1ZXNA 5ELWA 5JEAA 1A1JA 2B9DA 2EE8A 1UN6B 1RR9A 2EPLX 3MHHC 4LFAI 2A2CA 2LUQA 2ZM6E 2NN6B 1ZBQA 4X66E 4ISAA 4X9JA 3T1HE 3L7ZB 5A6AA 2Z5CA 4PU9A 4X64E 4U3BA 1SFEA 2NN6C 1A1FA 4WPYA 1Y4UA 1N33I 5A6JA 1NHIA 3JTZA 2EFGA 2JE6A 4IS1C 2EL6A 5KL6A 2YTQA 4DUYE 2C37B 2XEXA 2Z5EA 4F9AB 1N36E 4WSGA 5IWAE 2UUCE 5DRPA 1K47A 2HJJA 3AUZA 2VF3A 4WFTA 1XXEA 4MU1A 2MKNA 1P47A 2PNZA 5JEAF 1HNZI 4BA2B 2UUBI 1VI7A 1YSAC 3PS3A 4MYTA 4X8WA 4JI3I 1UHZA 4LF5I 3CDIA 4DR6I 2L33A 2M9AA 4DV4E 1HNWE 5FLXQ 3B82A 1IBKI 3EQ1A 3HPSA 2EM7A 2F8BA 2K7IA 1MU5A 1EH6A 1PDAA 4DV6I 2L92A 1Z0WA 3LNUA 4HY1A 2NPFA 1OYPA 4LF7I 4O4KA 3J81Q 1GZ6A 3P3EA 4HYMA 2V8PA 4R2CA 4B3RE 2RS7A 1S4EA 3J7AM 4LTYA 2Q8UA 4YY3E 2CPNA 3P06A 1Z0TA 2C37A
chains in the Genus database with same CATH topology
2V8QB 1J26A 1HNXE 1QU6A 5LMUE 1BKNA 4HACB 3OTOI 4GKKE 4N3OA 4BCAA 4B3MI 3PYFA 4JI1E 2E1RA 2H36X 2L8TA 4RPFA 3IWCA 1Y6ZA 4WUCA 1YYWA 1N32I 3C4BA 2LJPA 2G7HA 2LE2A 5BR8E 3OTOE 1IBLE 4DR7I 2CZ9A 1XNQI 1HR0E 2CG9A 3T1HI 2Q2EB 4B3SI 1B62A 3K17A 1ZXMA 3V2UC 1N36I 4DMIA 1Z5CA 4DV0I 1XNQE 2HHHI 4IZKA 4M0VA 4KHPI 2WZOA 4BC7A 3Q1QA 2L3CA 5AE2A 2MDRA 4JI2I 3H09A 2JOXA 4JI8I 1KKHA 2NUGA 4LU9A 4P7DA 3WU5A 5FWKA 2V89A 4DKKA 5T6JA 4DV2I 2HKEA 4DUZI 1J5EI 1DI2A 4WSPA 3QT8A 2JR1A 4JYAI 2JY9A 3QT6A 2RTXA 1YYOA 4JI5I 2L3JA 1XMOI 4KQVA 3ADIA 4LF9I 4R03A 1T4NA 4JV5E 4B3RI 4TUGA 3J7AG 3VYXA 2X36A 3ZZUA 4YY3I 2DB2A 4JI7I 1N0UA 4DPTA 2M4IA 2DMYA 3FIGA 1Z5BA 2ZITA 3WU3A 2UXCI 4DV7E 3J80Q 4LF8I 2CPNA 1PVGA 4JI8E 1WXRA 4JI4I 4Q28A 1H74A 4FN5A 4JI7E 1S16A 3ZKBA 4DV3I 4NXME 4MYUA 4JG4A 4B3TE 3F0NA 2R42A 4X65I 1IBME 4JV5I 1GQEA 4LF9E 1NHHA 4UT4A 2V86A 1HK7A 4DV6E 3PYDA 5FLXC 4JI6I 3HJCA 2NUEA 4LFAE 4DR1I 5IT9Q 2DEJA 2LRSA 2B7TA 1H7UA 4PRVA 4X62I 4NXNE 3CWVA 2K4VA 2JVAA 1VISA 4B3TI 4GEQB 2V83A 3K85A 4NXMI 3WU6A 4WUDA 1ZM3A 2ODRC 3JU0A 1D6TA 2M7QA 5LMNE 4X64I 3PRYA 1QZRA 4P7AA 5AE3A 3HPZA 2O1UA 1USUA 1XMOE 4OX9I 1MG7A 2HKJA 5IT9C 4M1KA 1B63A 3PYGA 3Q6NA 3WU4A 4TUIA 4I8OA 4DPWA 3QT7A 2NA2A 1HR0I 2B7VA 2HK3A 2V2ZA 2V85A 2BM0A 1ZM2A 2VQFE 2E5LI 3GONA 4DPXA 4URLA 1XNRE 3IWBA 1I94I 2UXDI 1YYKA 4HXZA 4DV3E 1USVA 2LMZA 2V87A 2LTSA 4JI4E 4Z7YA 4KZSA 4Z7CA 4WYQB 5DNYA 4F54A 4LFBI 5GMEA 2FTXB 3PYEA 2L2MA 2MC6A 1NZ0A 1ELOA 5LMUI 3MSWA 2X7IA 2RS6A 2Z5BA 4DR3I 4X62E 2UU9E 3ADLA 2PNLA 4DPYA 4LF6E 2Z5BB 2LBSB 2EWLA 1WHNA 4JI6E 2GQ0A 1FI4A 4F9CB 2L2KB 3B8HA 4BC9A 4JI5E 1XNRI 4IZKB 4DV1I 4BMJA 2UXCE 4GKJI 3HTXA 5A2QC 4YHHI 4K0KI 1N34I 1SR9A 4IZJA 4ED4A 2RSMA 1WHQA 2N3GA 1OJ4A 1H7SA 1FKAE 3J81C 4FWDA 1Z0CA 3JAMQ 2CGEA 3JAMC 1WUUA 4X66I 2HK2A 2IOQA 2V2QA 4DV2E 1J5EE 2VQEE 2GS8A 5BR8I 1IBLI 4L5NC 2O1TA 1I94E 2UXDE 4FWHA 4JI1I 3LTOA 4XTJA 1X49A 3VYYA 3ZOQB 4FWGA 2VQEI 2DIXA 2LUPB 1RQ0A 3RMPA 1EI1A 4DV5I 3IWDA 4LF4I 1NHJA 4KHPE 1PIEA 1T4OA 2UU9I 2V34A 4LF6I 3VK6A 4JI0E 4DU8A 2ODRD 4AQYI 1FWLA 3T1YE 4X65E 1FJGI 4R8OA 3J7Yp 5L3JA 4LF7E 1U2RA 2DSYA 3KWRA 1H73A 4B3ME 2EZ6A 1XHKA 1IBMI 3OMLA 2FV4B 2VF1A 1Y4SA 3C4TA 2N3HA 4DV1E 1Z59A 4YHHE 4GKJE 1HNXI 1N34E 4LF5E 2R3VA 1Z0GA 3HXLA 2E1MA 2A2DA 4NXNI 1T4LB 4OOGC 2LTRA 3LMLA 3Q6MA 2YT4A 3K6QA 4F9BB 3ZM7A 4I3HA 2F4VE 4AQYE 1UILA 4DR4I 1FJGE 1Z0BA 3D4JA 3HULA 1IBKE 4DR2I 3QT5A 2UXBI 3DF6A 2BV3A 4DV4I 1HNWI 5AE1A 1RC7A 4FW9A 2HFSA 1FWKA 3HQ1A 1ZBTA 4DU7A 4WUBA 3ZKDA 2HHHE 4USKA 2B3TB 5A2QQ 3ADJA 3K1JA 3T1YI 1X47A 1N33E 2PNMA 4DR1E 2BM1A 2VQFI 5CFFE 1UEKA 4OX9E 3ZZ0A 5AASA 4LF4E 4DPUA 2V88A 4P52A 5IWAI 2UUCI 2KHXA 1DARA 4JI0I 3LPSA 4DXLA 4DUZE 1EA6A 1YZ9A 2VE7C 4JYAE 2L2NA 2HFUA 4DR7E 4DR3E 4USMA 1N32E 4HACA 3AV0A 1H72C 4DR5E 1X48A 1N0VC 1KIJA 5LMNI 4JI2E 2M1SA 4UTGA 2NUFA 4BBYA 4LFCI 2OI2A 4LF8E 4DV7I 4L8NA 1Z5AA 2UXBE 3ADGA 1FNMA 3M6AA 4DV0E 4ZVIA 1XMQI 2UUAI 3V5RA 4DR2E 2Z5CB 1PKPA 2AJ4A 2JOBA 1KTVA 4DR4E 2V2VA 1MX0A 1STUA 1Z0EA 1EKZA 1XMQE 2UUAE 3F6HA 2JWOA 2J7KA 1A6FA 3ZZTA 1ZM9A 4LFBE 2UUBE 2KONA 4DR6E 4IZJB 2WW4A 4JI3E 1Z0VA 3P1XA 2L6MA 4EMDA 3B78A 5ADZA 1KVKA 2YZTA 4M30A 4IZJD 2O1VA 1HNZE 2DEIA 2FGGA 2ZBKB 4P78A 2ZM6I 1DQ3A 2O1WA 1O0WA 5GMDA 4M2ZA 4DUYI 2F4VI 5F3WA 5LL6R 4BS9A 4K0KE 4J8ZA 2LJHA 4DV5E 2IHR1 2KOUA 2MC5A 2E5LE 1RREA 4R1FA 4DR5I 3LLHA 3F6GA 4GKKI 1ZM4A 3DJWA 4LFCE 4PRXA 2IOPA 3H4LA 3J80C 1ZXNA 2B9DA 1RR9A 4LFAI 2A2CA 2LUQA 2ZM6E 1ZBQA 4X66E 3T1HE 4PU9A 2Z5CA 4X64E 4WPYA 1Y4UA 1N33I 1NHIA 2EFGA 3JTZA 2Z5EA 4DUYE 2XEXA 4F9AB 1N36E 5IWAE 2UUCE 1K47A 3AUZA 2VF3A 4WFTA 1HNZI 2UUBI 4MYTA 4JI3I 4X8WA 1UHZA 4LF5I 4DR6I 2L33A 4DV4E 1HNWE 5FLXQ 3B82A 1IBKI 3HPSA 2F8BA 1MU5A 4DV6I 2L92A 1Z0WA 3LNUA 4HY1A 2NPFA 4LF7I 3J81Q 1GZ6A 4HYMA 2V8PA 4B3RE 2RS7A 1S4EA 3J7AM 4LTYA 4YY3E 4B3SE 3P06A 1Z0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J26 A;  1HNX E;  1QU6 A;  5LMU E;  1BKN A;  4HAC B;  3OTO I;  4GKK E;  4B3M I;  3PYF A;  4JI1 E;  2E1R A;  4RPF A;  4WUC A;  1YYW A;  1N32 I;  3C4B A;  2LJP A;  3OTO E;  5BR8 E;  1IBL E;  4DR7 I;  2CZ9 A;  1XNQ I;  1HR0 E;  3T1H I;  2Q2E B;  4B3S I;  1B62 A;  3K17 A;  1ZXM A;  3V2U C;  1N36 I;  1Z5C A;  4DV0 I;  1XNQ E;  2HHH I;  4KHP I;  3Q1Q A;  2L3C A;  2MDR A;  4JI2 I;  4JI8 I;  1KKH A;  2NUG A;  3WU5 A;  4DKK A;  4DV2 I;  1J5E I;  2HKE A;  4DUZ I;  1DI2 A;  3QT8 A;  4JYA I;  2JY9 A;  3QT6 A;  2RTX A;  1YYO A;  4JI5 I;  2L3J A;  1XMO I;  4KQV A;  3ADI A;  4LF9 I;  1T4N A;  4JV5 E;  4B3R I;  3VYX A;  2X36 A;  3J7A G;  3ZZU A;  4YY3 I;  2DB2 A;  4JI7 I;  1N0U A;  4DPT A;  2DMY A;  2ZIT A;  1Z5B A;  3WU3 A;  2UXC I;  4DV7 E;  3J80 Q;  4LF8 I;  2CPN A;  1PVG A;  4JI8 E;  4JI4 I;  1H74 A;  4FN5 A;  4JI7 E;  1S16 A;  3ZKB A;  4DV3 I;  4NXM E;  4MYU A;  4JG4 A;  4B3T E;  3F0N A;  2R42 A;  4X65 I;  1IBM E;  4JV5 I;  1GQE A;  4LF9 E;  1NHH A;  4UT4 A;  4DV6 E;  3PYD A;  5FLX C;  4JI6 I;  2NUE A;  4LFA E;  4DR1 I;  5IT9 Q;  2DEJ A;  2LRS A;  2B7T A;  1H7U A;  4PRV A;  4X62 I;  4NXN E;  3CWV A;  2JVA A;  1VIS A;  4B3T I;  4NXM I;  3WU6 A;  4WUD A;  1ZM3 A;  1D6T A;  5LMN E;  4X64 I;  1QZR A;  4P7A A;  1XMO E;  4OX9 I;  1MG7 A;  2HKJ A;  4M1K A;  5IT9 C;  1B63 A;  3PYG A;  3WU4 A;  4DPW A;  3QT7 A;  2NA2 A;  1HR0 I;  2B7V A;  2HK3 A;  2V2Z A;  2BM0 A;  1ZM2 A;  2VQF E;  2E5L I;  3GON A;  4DPX A;  4URL A;  1XNR E;  1I94 I;  2UXD I;  1YYK A;  4HXZ A;  4DV3 E;  2LTS A;  4JI4 E;  4Z7Y A;  4Z7C A;  4WYQ B;  4LFB I;  5GME A;  3PYE A;  2L2M A;  1ELO A;  1NZ0 A;  5LMU I;  2X7I A;  2RS6 A;  4DR3 I;  4X62 E;  2UU9 E;  3ADL A;  4DPY A;  4LF6 E;  2LBS B;  1WHN A;  4JI6 E;  1FI4 A;  2L2K B;  3B8H A;  4JI5 E;  1XNR I;  4DV1 I;  2UXC E;  4GKJ I;  3HTX A;  5A2Q C;  4YHH I;  4K0K I;  1N34 I;  4ED4 A;  2RSM A;  1WHQ A;  2N3G A;  1OJ4 A;  1H7S A;  1FKA E;  3J81 C;  4FWD A;  3JAM Q;  1WUU A;  3JAM C;  4X66 I;  2HK2 A;  2V2Q A;  4DV2 E;  1J5E E;  2VQE E;  2GS8 A;  5BR8 I;  1IBL I;  4YY3 E;  1I94 E;  2UXD E;  4FWH A;  4JI1 I;  3LTO A;  4XTJ A;  1X49 A;  3VYY A;  4FWG A;  2VQE I;  2DIX A;  2LUP B;  1RQ0 A;  1EI1 A;  4DV5 I;  4LF4 I;  1NHJ A;  4KHP E;  1PIE A;  1T4O A;  2UU9 I;  2V34 A;  4LF6 I;  4DU8 A;  4JI0 E;  4AQY I;  1FWL A;  3T1Y E;  4X65 E;  1FJG I;  3J7Y p;  5L3J A;  4LF7 E;  1U2R A;  1H73 A;  4B3M E;  2EZ6 A;  1XHK A;  1IBM I;  3C4T A;  2N3H A;  4DV1 E;  1Z59 A;  4YHH E;  4GKJ E;  1HNX I;  1N34 E;  4LF5 E;  2R3V A;  1Z0G A;  2A2D A;  4NXN I;  1T4L B;  4OOG C;  2LTR A;  2YT4 A;  3ZM7 A;  4I3H A;  2F4V E;  4AQY E;  1UIL A;  4DR4 I;  1FJG E;  1Z0B A;  3D4J A;  3HUL A;  1IBK E;  4DR2 I;  3QT5 A;  2UXB I;  2BV3 A;  4DV4 I;  1HNW I;  1RC7 A;  4FW9 A;  2HFS A;  1FWK A;  1ZBT A;  4DU7 A;  4WUB A;  3ZKD A;  2HHH E;  4USK A;  2B3T B;  5A2Q Q;  3ADJ A;  3K1J A;  3T1Y I;  1X47 A;  1N33 E;  4DR1 E;  2BM1 A;  2VQF I;  5CFF E;  1UEK A;  4OX9 E;  3ZZ0 A;  4LF4 E;  4DPU A;  4P52 A;  5IWA I;  2UUC I;  2KHX A;  1DAR A;  4JI0 I;  3LPS A;  4DXL A;  4DUZ E;  1EA6 A;  1YZ9 A;  4JYA E;  2L2N A;  2HFU A;  4DR7 E;  4DR3 E;  4USM A;  1N32 E;  4HAC A;  1H72 C;  4DR5 E;  1X48 A;  1N0V C;  1KIJ A;  5LMN I;  4JI2 E;  4UTG A;  2NUF A;  4LFC I;  2OI2 A;  4LF8 E;  4DV7 I;  1Z5A A;  2UXB E;  3ADG A;  1FNM A;  3M6A A;  4DV0 E;  4ZVI A;  1XMQ I;  2UUA I;  3V5R A;  4DR2 E;  1PKP A;  2AJ4 A;  1KTV A;  4DR4 E;  2V2V A;  1MX0 A;  1STU A;  1Z0E A;  1EKZ A;  1XMQ E;  2UUA E;  2J7K A;  1A6F A;  3ZZT A;  1ZM9 A;  4LFB E;  2UUB E;  4DR6 E;  2WW4 A;  4JI3 E;  1Z0V A;  3P1X A;  4EMD A;  3B78 A;  1KVK A;  4M30 A;  1HNZ E;  2DEI A;  2ZBK B;  2ZM6 I;  1O0W A;  5GMD A;  4M2Z A;  4DUY I;  2F4V I;  5LL6 R;  4K0K E;  2LJH A;  4DV5 E;  2IHR 1;  2E5L E;  1RRE A;  4R1F A;  4DR5 I;  3LLH A;  4GKK I;  1ZM4 A;  4LFC E;  4PRX A;  3H4L A;  3J80 C;  1ZXN A;  1RR9 A;  4LFA I;  2A2C A;  2LUQ A;  2ZM6 E;  4X66 E;  3T1H E;  4PU9 A;  4X64 E;  1N33 I;  1NHI A;  2EFG A;  4DUY E;  2XEX A;  1N36 E;  5IWA E;  2UUC E;  1K47 A;  2VF3 A;  4WFT A;  1HNZ I;  2UUB I;  4MYT A;  4JI3 I;  4X8W A;  1UHZ A;  4LF5 I;  4DR6 I;  2L33 A;  4DV4 E;  1HNW E;  5FLX Q;  3B82 A;  1IBK I;  1MU5 A;  4DV6 I;  3LNU A;  1Z0W A;  4HY1 A;  2NPF A;  4LF7 I;  3J81 Q;  4HYM A;  2V8P A;  4B3R E;  2RS7 A;  1S4E A;  3J7A M;  1Z0C A;  4B3S E;  1Z0T A; 
#chains in the Genus database with same CATH topology
 2V8Q B;  1AAY A;  1GTK A;  1J26 A;  1HNX E;  2MKD A;  4ZYD A;  4R2A A;  5C0X F;  1QU6 A;  2EMI A;  2RSI A;  5LMU E;  1BKN A;  1QNT A;  4HAC B;  3OTO I;  4GKK E;  4N3O A;  4BCA A;  4B3M I;  4O5G A;  3PYF A;  5K36 C;  4JI1 E;  5JEA B;  2E1R A;  2H36 X;  2L8T A;  4RPF A;  3IWC A;  1Y6Z A;  1PJS A;  4WUC A;  2EMA A;  1YYW A;  4BA1 B;  1N32 I;  3C4B A;  2LJP A;  2G7H A;  2LE2 A;  5BR8 E;  3OTO E;  1IBL E;  2C39 A;  4DR7 I;  2CZ9 A;  3NZK A;  5LLQ A;  1XNQ I;  3TQM A;  1IQO A;  3BBG A;  2C39 B;  1HR0 E;  2CG9 A;  5IXM B;  1BBO A;  2Q2E B;  3T1H I;  4B3S I;  1B62 A;  3K17 A;  1ZXM A;  3V2U C;  2NN6 F;  2WP8 A;  1N36 I;  4DMI A;  2EN4 A;  2EOZ A;  1Z5C A;  5AC5 A;  4DV0 I;  2YTD A;  3EPK A;  2EN3 A;  1XNQ E;  2HHH I;  4IZK A;  4M0V A;  1EH8 A;  4KHP I;  2WZO A;  4BC7 A;  3Q1Q A;  2L3C A;  5AE2 A;  2MDR A;  4JI2 I;  2EL4 A;  3EPJ A;  4IS9 A;  3HKM A;  3H09 A;  3MHS C;  3DD6 A;  2EPN A;  2JOX A;  4LCG A;  2EOS A;  2EM8 A;  1B69 A;  4JI8 I;  1KKH A;  3P3C A;  1X6F A;  2NUG A;  2NN6 E;  4LU9 A;  3M99 B;  4P7D A;  2YTN A;  2CSH A;  2D9H A;  3WU5 A;  5FWK A;  2V89 A;  4DKK A;  2EOI A;  5T6J A;  2GO3 A;  1KYQ A;  2HKE A;  4DUZ I;  4DV2 I;  1J5E I;  2I13 A;  1DI2 A;  4WSP A;  3QT8 A;  2JE6 B;  2JR1 A;  2DMI A;  4JYA I;  2JY9 A;  2WBS A;  1RHY A;  3QT6 A;  2RTX A;  1YYO A;  1Z1B A;  2L3J A;  2BA1 D;  4JI5 I;  1XMO I;  3U1Y A;  4OO1 B;  4KQV A;  3ADI A;  4LF9 I;  4FW6 A;  5IV8 B;  4R03 A;  1T4N A;  4JV5 E;  1TN9 A;  4B3R I;  4TUG A;  3J7A G;  3VYX A;  2X36 A;  2EPA A;  3ZZU A;  4YY3 I;  2DB2 A;  4JI7 I;  1N0U A;  2PO0 B;  4DPT A;  2M4I A;  1YH8 A;  5C0X C;  2DMY A;  3FIG A;  1Z5B A;  2ZIT A;  5KL2 A;  5DRQ A;  1E3P A;  3WU3 A;  2EM0 A;  2UXC I;  2EMZ A;  2LVH A;  4DV7 E;  3J80 Q;  4LF8 I;  1PVG A;  4JI8 E;  2GLI A;  2IER A;  5EL9 A;  1WXR A;  2JEA B;  2BR2 A;  4JI4 I;  4Q28 A;  1H74 A;  4FN5 A;  4MLV A;  4JI7 E;  1S16 A;  3ZKB A;  4DV3 I;  2CVE A;  1T39 A;  4NXM E;  3GLL A;  4MYU A;  4JG4 A;  4B3T E;  3F0N A;  2R42 A;  4IJD A;  2EN8 A;  4X65 I;  2BB8 A;  1IBM E;  4JV5 I;  1GQE A;  4LF9 E;  1NHH A;  4UT4 A;  2R1F A;  2V86 A;  1RMD A;  4F2J C;  1HK7 A;  4DV6 E;  3PYD A;  5FLX C;  2VES A;  2WP8 B;  4JI6 I;  2BA0 D;  4OO1 A;  3HJC A;  5AC4 A;  2NUE A;  3PS1 A;  4LFA E;  4DR1 I;  3UHM A;  5IT9 Q;  2DEJ A;  2LRS A;  3BGH A;  4R2Q A;  2B7T A;  1YPN A;  3H1C A;  1H7U A;  4PRV A;  4X62 I;  4NXN E;  3CWV A;  2K4V A;  2EOO A;  4FW5 A;  4IFD A;  3PS2 A;  3GME A;  4LOM A;  2JVA A;  1VIS A;  2EML A;  4HEI A;  4RH8 A;  4BA1 A;  2J7J A;  4B3T I;  4GEQ B;  2V83 A;  3EPH A;  3K85 A;  4NXM I;  3WU6 A;  1OYR A;  4WUD A;  2EOY A;  2EN6 A;  4R2D A;  1ZM3 A;  3M85 G;  2JXP A;  5JEA D;  5DRO A;  2ODR C;  3JU0 A;  1D6T A;  2M7Q A;  4OKG A;  5LMN E;  2BBG A;  4X64 I;  2ADR A;  4BHC A;  3PRY A;  4M9V C;  2EM3 A;  1QZR A;  1YUI A;  1A1G A;  4R2P A;  4P7A A;  5AE3 A;  2EOH A;  3HPZ A;  4HTG A;  1EH7 A;  2PO1 B;  2O1U A;  1USU A;  1XMO E;  5EKW A;  1MG7 A;  2HKJ A;  2EM4 A;  4OX9 I;  5IT9 C;  4M1K A;  2PO1 A;  1B63 A;  3PYG A;  3Q6N A;  3WU4 A;  2WBU A;  4TUI A;  4OO1 E;  4I8O A;  4DPW A;  3QT7 A;  2NA2 A;  4F6N A;  1HR0 I;  4IFD E;  2B7V A;  2HK3 A;  4NHR A;  2V2Z A;  3U1K A;  1WJP A;  2V85 A;  1R6L A;  2C38 A;  2BM0 A;  1ZM2 A;  2VQF E;  5K36 F;  2E5L I;  3GON A;  4DPX A;  4URL A;  1XNR E;  3IWB A;  1I94 I;  1L4S A;  1UDS A;  1YYK A;  2UXD I;  4HXZ A;  4DV3 E;  1USV A;  2LMZ A;  2V87 A;  1JK1 A;  2EN2 A;  1A1K A;  2LTS A;  4JI4 E;  4Z7Y A;  4KZS A;  4Z7C A;  4WYQ B;  5DNY A;  3B4T A;  4F54 A;  4LFB I;  5GME A;  2FTX B;  5A6B D;  2L2M A;  2LT7 A;  3PYE A;  2MC6 A;  2ENH A;  1ELO A;  1NZ0 A;  5LMU I;  3MSW A;  4B3S E;  2X7I A;  2EOR A;  5JEA E;  2RS6 A;  1OYS A;  2Z5B A;  4DR3 I;  4X62 E;  2UU9 E;  3ADL A;  4WXD A;  2YSP A;  1PJT A;  1T38 A;  2JEB A;  2PNL A;  4LF6 E;  4DPY A;  2WBT A;  1F2I G;  2Z5B B;  2LBS B;  3GCM A;  2EJ4 A;  2EWL A;  3BF2 A;  1WHN A;  4OO1 F;  1X5W A;  3THO B;  4JI6 E;  2GQ0 A;  1FI4 A;  2EM5 A;  4F9C B;  2L2K B;  4FW3 A;  3B8H A;  4BC9 A;  4JI5 E;  2PO0 A;  1XNR I;  4IZK B;  2F1D A;  2HC5 A;  2EOJ A;  5TSE A;  4DV1 I;  4BMJ A;  2PNZ B;  4BA2 A;  3THN A;  5K36 A;  2UXC E;  4GKJ I;  3HTX A;  2EOM A;  4N4R B;  5JEA C;  5A2Q C;  4YHH I;  4FK5 C;  2EMG A;  4LCH A;  4K0K I;  1N34 I;  2JYA A;  1SR9 A;  4IZJ A;  4QNK A;  4ED4 A;  5A69 A;  2RSM A;  1WHQ A;  2LJU A;  2N3G A;  1H7S A;  1OJ4 A;  1YUJ A;  2YTG A;  1FKA E;  3J81 C;  2EPK X;  2JP9 A;  4FWD A;  1BB8 A;  1Z0C A;  3JAM Q;  5KL7 A;  4MQY A;  2CGE A;  3JAM C;  1WUU A;  4X66 I;  2HK2 A;  2IOQ A;  2EP3 A;  4ZYG A;  2JPA A;  1UDQ A;  2V2Q A;  4DV2 E;  1J5E E;  4BHB A;  2VQE E;  4GZN C;  2GS8 A;  1MGT A;  5BR8 I;  1IBL I;  4IFD B;  4L5N C;  2EMB A;  4IFD F;  2O1T A;  1I94 E;  2UXD E;  2BR2 B;  4FWH A;  2EPC A;  4JI1 I;  2HGH A;  3LTO A;  2EM6 A;  4XTJ A;  1X49 A;  2I9I A;  5K36 D;  3VYY A;  2YTJ A;  3ZOQ B;  4R2S A;  4FWG A;  2VQE I;  5C0X B;  2DIX A;  2EOE A;  2LUP B;  1RQ0 A;  3RMP A;  1DGC A;  1EI1 A;  1Y5Y A;  1E3H A;  3IWD A;  4DV5 I;  4FW7 A;  4LF4 I;  1NHJ A;  4KHP E;  1PIE A;  3M7N D;  1T4O A;  3P3G A;  2UU9 I;  1Y60 A;  2V34 A;  1G2D C;  2NN6 A;  4GQU A;  4WXC A;  4LF6 I;  3VK6 A;  4JI0 E;  1A1H A;  4DU8 A;  2ODR D;  1JK2 A;  4AQY I;  1FWL A;  1WRJ A;  3T1Y E;  2N8X A;  2DLK A;  2LO3 A;  2YRK A;  2C38 B;  4X65 E;  2RPC A;  1A1I A;  4NBQ A;  4R8O A;  4ZYE A;  3J7Y p;  5L3J A;  1FJG I;  4LF7 E;  4QNJ A;  1U2R A;  2DSY A;  3KWR A;  1H73 A;  2EMK A;  4B3M E;  2EZ6 A;  2DRP A;  1XHK A;  2YPN A;  2YTO A;  4O24 A;  1IBM I;  3OML A;  2FV4 B;  2VF1 A;  1UDO A;  1Y4S A;  3C4T A;  3ECR A;  2N3H A;  4DV1 E;  1Z59 A;  5C0X E;  4YHH E;  4GKJ E;  3CDJ A;  1HNX I;  2YTE A;  1N34 E;  2YTF A;  4LF5 E;  1TF6 A;  2R3V A;  1Z0G A;  1ZR9 A;  3HXL A;  1MEY C;  1YFH A;  2E1M A;  2A2D A;  4J3D A;  4NXN I;  2LV2 A;  3L00 A;  4U3D A;  2EQ1 A;  2IES A;  1T4L B;  5K36 E;  5C0X A;  4OOG C;  1X6H A;  2EM2 A;  2LTR A;  3LML A;  5KL3 A;  1UBD C;  3Q6M A;  2YT4 A;  3K6Q A;  2EM9 A;  4F9B B;  3ZM7 A;  4I3H A;  2F4V E;  4AQY E;  1UIL A;  4DR4 I;  2YRM A;  2PO2 A;  4Q35 B;  1FJG E;  1Z0B A;  2AE8 A;  3D4J A;  3HUL A;  1IBK E;  2BA1 G;  4DR2 I;  3QT5 A;  2UXB I;  3DF6 A;  2BV3 A;  4DV4 I;  1HNW I;  1YHC A;  1NEI A;  5AE1 A;  1RC7 A;  2EPP A;  1R6M A;  1IQS A;  2YRH A;  3UK3 C;  2LCE A;  2J65 A;  4FW9 A;  4O43 A;  2HFS A;  5DRR A;  2WNR B;  1FWK A;  2R76 A;  3HQ1 A;  2E72 A;  1ZBT A;  2CT1 A;  2ELY A;  4DU7 A;  2EPR A;  4WUB A;  2ENC A;  5K36 B;  3ZKD A;  1BBG A;  2EMC A;  2WCC 3;  4RHB B;  2HHH E;  4USK A;  5C0X D;  2ELZ A;  2EPM X;  2B3T B;  2NN6 D;  5A2Q Q;  3ADJ A;  3K1J A;  1X6E A;  3T1Y I;  1X47 A;  3C6M A;  1N33 E;  2PNM A;  4OO1 C;  4DR1 E;  2BM1 A;  4MU4 A;  2VQF I;  5CFF E;  1UEK A;  2YWQ A;  4OX9 E;  2JEB B;  3ZZ0 A;  5AAS A;  4LF4 E;  2DGC A;  2V88 A;  4P52 A;  2EMH A;  4DPU A;  5IWA I;  2UUC I;  2KHX A;  1DAR A;  4JI0 I;  3LPS A;  4DXL A;  4DUZ E;  1EA6 A;  1YZ9 A;  2VE7 C;  4JYA E;  2L2N A;  2BA0 G;  3BID A;  4F6M A;  4DR7 E;  2HFU A;  5DNX A;  4DR3 E;  2EPO A;  4AIM A;  4AM3 A;  4USM A;  2GHF A;  4R2R A;  1N32 E;  4HAC A;  3AV0 A;  1H72 C;  1NCS A;  4MU0 A;  2EOX A;  2ENA A;  2EOQ A;  4KWY A;  4DR5 E;  1X48 A;  5A6K A;  1N0V C;  1KIJ A;  5LMN I;  2EN1 A;  2EQ3 A;  1TF3 A;  4JI2 E;  1UDN A;  3C6K A;  2M1S A;  4UTG A;  2GPI A;  4LCF A;  2NUF A;  4BBY A;  4LFC I;  2EMY A;  2OI2 A;  4MDT A;  4LF8 E;  4DV7 I;  2YU5 A;  4L8N A;  2RQL A;  1Z5A A;  2UXB E;  3ADG A;  1FNM A;  3M6A A;  4DV0 E;  1KJK A;  4ZVI A;  2EL5 A;  5KL5 A;  1XMQ I;  2UUA I;  2PO2 B;  1N3G A;  2EPX A;  2MDG A;  2EMF A;  4LPF A;  1PJQ A;  1A1L A;  2YU8 A;  3V5R A;  3EPL A;  3L7Z A;  4DR2 E;  2Z5C B;  1PKP A;  2AJ4 A;  2JOB A;  3KZZ A;  4ZYH A;  1KTV A;  4DR4 E;  2V2V A;  1MX0 A;  4OO1 D;  1STU A;  1ZU1 A;  2PRT A;  1Z0E A;  1EKZ A;  2WNR A;  1XMQ E;  2UUA E;  3F6H A;  5KL4 A;  2YTI A;  2JWO A;  2J7K A;  1A6F A;  2EMW A;  2EMX A;  3ZZT A;  1ZM9 A;  4LFB E;  2A25 A;  2UUB E;  1ZAA C;  2KON A;  4WX9 A;  1G2F C;  2EN7 A;  4DR6 E;  3M85 D;  4IZJ B;  3M7N G;  2WW4 A;  4JI3 E;  1Z0V A;  2O3Z A;  3P1X A;  4IFD C;  2L6M A;  4EMD A;  3B78 A;  5ADZ A;  4FW4 A;  3KZY A;  1KVK A;  2YZT A;  4M30 A;  4IZJ D;  3KRN A;  2O1V A;  1HNZ E;  1LLM C;  2DEI A;  2EPZ A;  4NZV A;  2FGG A;  1IMU A;  2JT2 A;  2YTP A;  5A6B A;  2ZBK B;  3P76 A;  4P78 A;  4MLQ A;  2CTD A;  2ZM6 I;  2NAB A;  1P42 A;  1DQ3 A;  3QG5 C;  2VRD A;  2O1W A;  1O0W A;  2EPU A;  3VHT B;  4OZE A;  5GMD A;  4M2Z A;  2GO4 A;  4DUY I;  5F3W A;  4AID A;  2F4V I;  1X3C A;  5LL6 R;  4BS9 A;  4IFD D;  4K0K E;  4J8Z A;  2LJH A;  4DV5 E;  2IHR 1;  2KOU A;  2MC5 A;  2E5L E;  1RRE A;  4R1F A;  4DR5 I;  2EOF A;  3LLH A;  2YSO A;  4R2E A;  1AH5 A;  3F6G A;  1ZM4 A;  3DJW A;  4MU3 A;  2JEA A;  5DNL A;  4GKK I;  4LFC E;  4PRX A;  2EQ0 A;  2IOP A;  2DLQ A;  3H4L A;  3J80 C;  1ZXN A;  5ELW A;  5JEA A;  1A1J A;  2B9D A;  2EE8 A;  1UN6 B;  1RR9 A;  2EPL X;  3MHH C;  4LFA I;  2A2C A;  2LUQ A;  2ZM6 E;  2NN6 B;  1ZBQ A;  4X66 E;  4ISA A;  4X9J A;  3T1H E;  3L7Z B;  5A6A A;  2Z5C A;  4PU9 A;  4X64 E;  4U3B A;  1SFE A;  2NN6 C;  1A1F A;  4WPY A;  1Y4U A;  1N33 I;  5A6J A;  1NHI A;  3JTZ A;  2EFG A;  2JE6 A;  4IS1 C;  2EL6 A;  5KL6 A;  2YTQ A;  4DUY E;  2C37 B;  2XEX A;  2Z5E A;  4F9A B;  1N36 E;  4WSG A;  5IWA E;  2UUC E;  5DRP A;  1K47 A;  2HJJ A;  3AUZ A;  2VF3 A;  4WFT A;  1XXE A;  4MU1 A;  2MKN A;  1P47 A;  2PNZ A;  5JEA F;  1HNZ I;  4BA2 B;  2UUB I;  1VI7 A;  1YSA C;  3PS3 A;  4MYT A;  4X8W A;  4JI3 I;  1UHZ A;  4LF5 I;  3CDI A;  4DR6 I;  2L33 A;  2M9A A;  4DV4 E;  1HNW E;  5FLX Q;  3B82 A;  1IBK I;  3EQ1 A;  3HPS A;  2EM7 A;  2F8B A;  2K7I A;  1MU5 A;  1EH6 A;  1PDA A;  4DV6 I;  2L92 A;  1Z0W A;  3LNU A;  4HY1 A;  2NPF A;  1OYP A;  4LF7 I;  4O4K A;  3J81 Q;  1GZ6 A;  3P3E A;  4HYM A;  2V8P A;  4R2C A;  4B3R E;  2RS7 A;  1S4E A;  3J7A M;  4LTY A;  2Q8U A;  4YY3 E;  2CPN A;  3P06 A;  1Z0T A;  2C37 A; 
#chains in the Genus database with same CATH homology
 2V8Q B;  1J26 A;  1HNX E;  1QU6 A;  5LMU E;  1BKN A;  4HAC B;  3OTO I;  4GKK E;  4N3O A;  4BCA A;  4B3M I;  3PYF A;  4JI1 E;  2E1R A;  2H36 X;  2L8T A;  4RPF A;  3IWC A;  1Y6Z A;  4WUC A;  1YYW A;  1N32 I;  3C4B A;  2LJP A;  2G7H A;  2LE2 A;  5BR8 E;  3OTO E;  1IBL E;  4DR7 I;  2CZ9 A;  1XNQ I;  1HR0 E;  2CG9 A;  3T1H I;  2Q2E B;  4B3S I;  1B62 A;  3K17 A;  1ZXM A;  3V2U C;  1N36 I;  4DMI A;  1Z5C A;  4DV0 I;  1XNQ E;  2HHH I;  4IZK A;  4M0V A;  4KHP I;  2WZO A;  4BC7 A;  3Q1Q A;  2L3C A;  5AE2 A;  2MDR A;  4JI2 I;  3H09 A;  2JOX A;  4JI8 I;  1KKH A;  2NUG A;  4LU9 A;  4P7D A;  3WU5 A;  5FWK A;  2V89 A;  4DKK A;  5T6J A;  4DV2 I;  2HKE A;  4DUZ I;  1J5E I;  1DI2 A;  4WSP A;  3QT8 A;  2JR1 A;  4JYA I;  2JY9 A;  3QT6 A;  2RTX A;  1YYO A;  4JI5 I;  2L3J A;  1XMO I;  4KQV A;  3ADI A;  4LF9 I;  4R03 A;  1T4N A;  4JV5 E;  4B3R I;  4TUG A;  3J7A G;  3VYX A;  2X36 A;  3ZZU A;  4YY3 I;  2DB2 A;  4JI7 I;  1N0U A;  4DPT A;  2M4I A;  2DMY A;  3FIG A;  1Z5B A;  2ZIT A;  3WU3 A;  2UXC I;  4DV7 E;  3J80 Q;  4LF8 I;  2CPN A;  1PVG A;  4JI8 E;  1WXR A;  4JI4 I;  4Q28 A;  1H74 A;  4FN5 A;  4JI7 E;  1S16 A;  3ZKB A;  4DV3 I;  4NXM E;  4MYU A;  4JG4 A;  4B3T E;  3F0N A;  2R42 A;  4X65 I;  1IBM E;  4JV5 I;  1GQE A;  4LF9 E;  1NHH A;  4UT4 A;  2V86 A;  1HK7 A;  4DV6 E;  3PYD A;  5FLX C;  4JI6 I;  3HJC A;  2NUE A;  4LFA E;  4DR1 I;  5IT9 Q;  2DEJ A;  2LRS A;  2B7T A;  1H7U A;  4PRV A;  4X62 I;  4NXN E;  3CWV A;  2K4V A;  2JVA A;  1VIS A;  4B3T I;  4GEQ B;  2V83 A;  3K85 A;  4NXM I;  3WU6 A;  4WUD A;  1ZM3 A;  2ODR C;  3JU0 A;  1D6T A;  2M7Q A;  5LMN E;  4X64 I;  3PRY A;  1QZR A;  4P7A A;  5AE3 A;  3HPZ A;  2O1U A;  1USU A;  1XMO E;  4OX9 I;  1MG7 A;  2HKJ A;  5IT9 C;  4M1K A;  1B63 A;  3PYG A;  3Q6N A;  3WU4 A;  4TUI A;  4I8O A;  4DPW A;  3QT7 A;  2NA2 A;  1HR0 I;  2B7V A;  2HK3 A;  2V2Z A;  2V85 A;  2BM0 A;  1ZM2 A;  2VQF E;  2E5L I;  3GON A;  4DPX A;  4URL A;  1XNR E;  3IWB A;  1I94 I;  2UXD I;  1YYK A;  4HXZ A;  4DV3 E;  1USV A;  2LMZ A;  2V87 A;  2LTS A;  4JI4 E;  4Z7Y A;  4KZS A;  4Z7C A;  4WYQ B;  5DNY A;  4F54 A;  4LFB I;  5GME A;  2FTX B;  3PYE A;  2L2M A;  2MC6 A;  1NZ0 A;  1ELO A;  5LMU I;  3MSW A;  2X7I A;  2RS6 A;  2Z5B A;  4DR3 I;  4X62 E;  2UU9 E;  3ADL A;  2PNL A;  4DPY A;  4LF6 E;  2Z5B B;  2LBS B;  2EWL A;  1WHN A;  4JI6 E;  2GQ0 A;  1FI4 A;  4F9C B;  2L2K B;  3B8H A;  4BC9 A;  4JI5 E;  1XNR I;  4IZK B;  4DV1 I;  4BMJ A;  2UXC E;  4GKJ I;  3HTX A;  5A2Q C;  4YHH I;  4K0K I;  1N34 I;  1SR9 A;  4IZJ A;  4ED4 A;  2RSM A;  1WHQ A;  2N3G A;  1OJ4 A;  1H7S A;  1FKA E;  3J81 C;  4FWD A;  1Z0C A;  3JAM Q;  2CGE A;  3JAM C;  1WUU A;  4X66 I;  2HK2 A;  2IOQ A;  2V2Q A;  4DV2 E;  1J5E E;  2VQE E;  2GS8 A;  5BR8 I;  1IBL I;  4L5N C;  2O1T A;  1I94 E;  2UXD E;  4FWH A;  4JI1 I;  3LTO A;  4XTJ A;  1X49 A;  3VYY A;  3ZOQ B;  4FWG A;  2VQE I;  2DIX A;  2LUP B;  1RQ0 A;  3RMP A;  1EI1 A;  4DV5 I;  3IWD A;  4LF4 I;  1NHJ A;  4KHP E;  1PIE A;  1T4O A;  2UU9 I;  2V34 A;  4LF6 I;  3VK6 A;  4JI0 E;  4DU8 A;  2ODR D;  4AQY I;  1FWL A;  3T1Y E;  4X65 E;  1FJG I;  4R8O A;  3J7Y p;  5L3J A;  4LF7 E;  1U2R A;  2DSY A;  3KWR A;  1H73 A;  4B3M E;  2EZ6 A;  1XHK A;  1IBM I;  3OML A;  2FV4 B;  2VF1 A;  1Y4S A;  3C4T A;  2N3H A;  4DV1 E;  1Z59 A;  4YHH E;  4GKJ E;  1HNX I;  1N34 E;  4LF5 E;  2R3V A;  1Z0G A;  3HXL A;  2E1M A;  2A2D A;  4NXN I;  1T4L B;  4OOG C;  2LTR A;  3LML A;  3Q6M A;  2YT4 A;  3K6Q A;  4F9B B;  3ZM7 A;  4I3H A;  2F4V E;  4AQY E;  1UIL A;  4DR4 I;  1FJG E;  1Z0B A;  3D4J A;  3HUL A;  1IBK E;  4DR2 I;  3QT5 A;  2UXB I;  3DF6 A;  2BV3 A;  4DV4 I;  1HNW I;  5AE1 A;  1RC7 A;  4FW9 A;  2HFS A;  1FWK A;  3HQ1 A;  1ZBT A;  4DU7 A;  4WUB A;  3ZKD A;  2HHH E;  4USK A;  2B3T B;  5A2Q Q;  3ADJ A;  3K1J A;  3T1Y I;  1X47 A;  1N33 E;  2PNM A;  4DR1 E;  2BM1 A;  2VQF I;  5CFF E;  1UEK A;  4OX9 E;  3ZZ0 A;  5AAS A;  4LF4 E;  4DPU A;  2V88 A;  4P52 A;  5IWA I;  2UUC I;  2KHX A;  1DAR A;  4JI0 I;  3LPS A;  4DXL A;  4DUZ E;  1EA6 A;  1YZ9 A;  2VE7 C;  4JYA E;  2L2N A;  2HFU A;  4DR7 E;  4DR3 E;  4USM A;  1N32 E;  4HAC A;  3AV0 A;  1H72 C;  4DR5 E;  1X48 A;  1N0V C;  1KIJ A;  5LMN I;  4JI2 E;  2M1S A;  4UTG A;  2NUF A;  4BBY A;  4LFC I;  2OI2 A;  4LF8 E;  4DV7 I;  4L8N A;  1Z5A A;  2UXB E;  3ADG A;  1FNM A;  3M6A A;  4DV0 E;  4ZVI A;  1XMQ I;  2UUA I;  3V5R A;  4DR2 E;  2Z5C B;  1PKP A;  2AJ4 A;  2JOB A;  1KTV A;  4DR4 E;  2V2V A;  1MX0 A;  1STU A;  1Z0E A;  1EKZ A;  1XMQ E;  2UUA E;  3F6H A;  2JWO A;  2J7K A;  1A6F A;  3ZZT A;  1ZM9 A;  4LFB E;  2UUB E;  2KON A;  4DR6 E;  4IZJ B;  2WW4 A;  4JI3 E;  1Z0V A;  3P1X A;  2L6M A;  4EMD A;  3B78 A;  5ADZ A;  1KVK A;  2YZT A;  4M30 A;  4IZJ D;  2O1V A;  1HNZ E;  2DEI A;  2FGG A;  2ZBK B;  4P78 A;  2ZM6 I;  1DQ3 A;  2O1W A;  1O0W A;  5GMD A;  4M2Z A;  4DUY I;  2F4V I;  5F3W A;  5LL6 R;  4BS9 A;  4K0K E;  4J8Z A;  2LJH A;  4DV5 E;  2IHR 1;  2KOU A;  2MC5 A;  2E5L E;  1RRE A;  4R1F A;  4DR5 I;  3LLH A;  3F6G A;  4GKK I;  1ZM4 A;  3DJW A;  4LFC E;  4PRX A;  2IOP A;  3H4L A;  3J80 C;  1ZXN A;  2B9D A;  1RR9 A;  4LFA I;  2A2C A;  2LUQ A;  2ZM6 E;  1ZBQ A;  4X66 E;  3T1H E;  4PU9 A;  2Z5C A;  4X64 E;  4WPY A;  1Y4U A;  1N33 I;  1NHI A;  2EFG A;  3JTZ A;  2Z5E A;  4DUY E;  2XEX A;  4F9A B;  1N36 E;  5IWA E;  2UUC E;  1K47 A;  3AUZ A;  2VF3 A;  4WFT A;  1HNZ I;  2UUB I;  4MYT A;  4JI3 I;  4X8W A;  1UHZ A;  4LF5 I;  4DR6 I;  2L33 A;  4DV4 E;  1HNW E;  5FLX Q;  3B82 A;  1IBK I;  3HPS A;  2F8B A;  1MU5 A;  4DV6 I;  2L92 A;  1Z0W A;  3LNU A;  4HY1 A;  2NPF A;  4LF7 I;  3J81 Q;  1GZ6 A;  4HYM A;  2V8P A;  4B3R E;  2RS7 A;  1S4E A;  3J7A M;  4LTY A;  4YY3 E;  4B3S E;  3P06 A;  1Z0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...