2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
2E5LE 3JAMQ 2L2KB 2UUBI 4JI7E 5IWAE 2OI2A 4JI1E 1EI1A 4DR3I 4DV0I 3WU6A 2HK3A 1ELOA 2V2ZA 2UU9E 5GMEA 1PVGA 1FJGI 3PYDA 3ZKBA 4DV2I 1IBLE 4MYTA 2UXCE 2RS6A 4DR4I 1X49A 2HKJA 1IBMI 1N32I 4X62E 4YHHI 4NXME 4DV6E 5L3JA 4B3RI 2L33A 4LF8I 4KHPI 4WUDA 2NA2A 2L3CA 1OJ4A 1T4LB 2R3VA 1S16A 2XEXA 3CWVA 3GONA 2VQFE 3T1HE 3OTOI 1Z0TA 5IWAI 1H7SA 1T4NA 2B7VA 2RSMA 1UILA 1HR0E 4FWHA 4DKKA 2L2NA 3Q1QA 1S4EA 4DV4I 2HFUA 3B82A 5LMNI 2LUQA 1HNXI 1FKAE 2UUAE 4DR6I 3P1XA 4JI2E 4JI8E 4DUYE 1I94E 1J5EE 4LFAE 2HK2A 2Q2EB 4DPWA 4LF7I 4NXMI 1A6FA 2WW4A 4HY1A 4DUZE 1ZM4A 3F0NA 3J81C 1N33E 1KTVA 1EKZA 3J81Q 4PRXA 3ZZUA 4B3ME 1YZ9A 1KKHA 1NZ0A 3QT8A 4DV1I 4URLA 2DEIA 2UXDI 2UUBE 2CZ9A 1MG7A 4X66E 1ZBTA 3B8HA 4DR3E 4DV5I 1U2RA 2LRSA 1FJGE 4I3HA 4RPFA 4FWGA 4JI4I 4DV2E 1BKNA 1Z5CA 4KQVA 2E1RA 1B63A 1NHIA 4DR4E 5IT9C 1N36I 1IBME 2X7IA 4LF6I 4JG4A 4DUZI 1N32E 4B3TI 2VQEI 3J7AG 4YHHE 4WYQB 4DPXA 1J26A 2N3HA 1XMOI 4B3RE 4LF8E 2LTSA 4KHPE 3ZM7A 3C4BA 4B3MI 3V5RA 2UUCI 3JAMC 4Z7CA 4DU7A 2NUGA 3LTOA 5CFFE 4NXNI 3OTOE 1D6TA 1T4OA 2RTXA 1NHJA 4X66I 4WUCA 1KIJA 2BM0A 4DV4E 1MX0A 4DR1I 5LMNE 3VYXA 1HNXE 1WHNA 4DR6E 4JI6I 2GS8A 3LPSA 4K0KI 1ZM9A 4LF7E 4PRVA 1H7UA 1VISA 2BV3A 4USKA 3ZKDA 2UXBE 1ZM2A 4Z7YA 3HTXA 2LJPA 4X64I 2A2DA 2MDRA 1O0WA 4P52A 5LMUI 4LFBI 1XNQE 2R42A 4LF5I 2KHXA 1ZXMA 3QT6A 4HACA 2ZM6I 4M1KA 4DV1E 4DV3I 1XNRI 1RQ0A 4AQYI 4HACB 2UXDE 1IBKI 2BM1A 3PYGA 4FW9A 2EZ6A 2F4VE 4DR5I 4LFCI 4DV5E 1PKPA 2IHR1 5GMDA 3QT5A 4DPYA 4JI4E 2YT4A 2N3GA 1X48A 1N36E 4LF6E 2HHHI 1Z0CA 3D4JA 1Z0BA 4B3TE 2VQEE 2UXBI 1DI2A 5LL6R 1XMOE 4GKKI 4M30A 1XNQI 1K47A 1Z0EA 1DARA 2UUCE 4DR7I 2AJ4A 2EFGA 4NXNE 2A2CA 3H4LA 4FWDA 2F4VI 2LTRA 1KVKA 3HULA 1FWLA 4DR1E 1HNWI 1RREA 2V8PA 4JYAI 3T1YI 2DEJA 4JI6E 3J80C 4LF9I 4K0KE 4UT4A 3J80Q 2LBSB 1QZRA 5BR8E 4YY3E 4X64E 3ADLA 1QU6A 5LMUE 4LFBE 4MYUA 4DV7E 4LF5E 2JY9A 4USMA 3J7Yp 2ZM6E 2NUEA 1XNRE 4DV3E 5A2QC 1MU5A 4AQYE 4WUBA 1FWKA 2LUPB 4JV5I 1IBKE 2V2VA 5A2QQ 4DR5E 4LFCE 4JI5I 4FN5A 2J7KA 4P7AA 1HNZI 2B3TB 2ZBKB 1GQEA 1STUA 4X65E 3V2UC 1Z0VA 2V34A 3LLHA 1Z5BA 1H74A 2HHHE 1WHQA 4B3SI 5BR8I 1N34E 3J7AM 4YY3I 4UTGA 3WU5A 2JVAA 1ZXNA 4LF4I 3C4TA 1XMQI 2HKEA 4GKKE 3ADGA 4DV7I 4DR2I 2L3JA 3ZZTA 4DR7E 3WU3A 2DB2A 4JI3I 2B7TA 2RS7A 3ZZ0A 3ADJA 3K17A 4JI0I 4R1FA 2CPNA 1HNWE 4OX9I 1YYKA 4JYAE 1FNMA 4DXLA 4DPUA 4X65I 2E5LI 3T1YE 4HXZA 3LNUA 4JI7I 1EA6A 2NPFA 2DIXA 4JI1I 1N0UA 2NUFA 4LF9E 1XHKA 2X36A 3K1JA 4M2ZA 4GKJE 1N34I 2UU9I 4PU9A 4XTJA 2DMYA 4ED4A 1IBLI 1H73A 2UXCI 1UEKA 1YYWA 1RC7A 3QT7A 1FI4A 3PYEA 4X62I 4X8WA 5FLXC 4DV6I 3VYYA 4JV5E 2L2MA 5FLXQ 1Z59A 1Z5AA 3ADIA 1B62A 4DU8A 4EMDA 4JI5E 2VQFI 3T1HI 1HNZE 1HR0I 3B78A 1Z0GA 2LJHA 4ZVIA 4GKJI 4HYMA 1UHZA 1PIEA 4DV0E 4B3SE 2UUAI 2HFSA 4DPTA 1X47A 4JI2I 4JI8I 4DUYI 4LF4E 1WUUA 1I94I 1J5EI 4LFAI 1XMQE 3PYFA 1NHHA 1H72C 4DR2E 1RR9A 1N33I 4JI3E 5IT9Q 1Z0WA 2VF3A 4WFTA 1YYOA 4OOGC 2V2QA 4JI0E 2ZITA 1ZM3A 4OX9E 1N0VC 3M6AA 3WU4A
chains in the Genus database with same CATH superfamily
2E5LE 4IFDB 2AE8A 3JAMQ 2L2KB 2UUBI 4JI7E 5IWAE 2EN7A 3C6MA 2OI2A 1WJPA 4JI1E 2V87A 1EI1A 4DR3I 1X5WA 2EP3A 5K36A 4DV0I 3WU6A 2HK3A 2ADRA 4MLQA 1ELOA 2V2ZA 2UU9E 5DNLA 2EM8A 5GMEA 2PO2A 5K36B 1PVGA 1YSAC 3PYDA 1FJGI 1AAYA 3ZKBA 4RH8A 2PO2B 4DV2I 1IBLE 4MYTA 2UXCE 2RS6A 4DR4I 1X49A 2HKJA 4R03A 2C39A 2Z5BB 1IBMI 3THNA 1TF6A 2PO0B 5C0XD 1N32I 4X62E 5KL7A 2E72A 4IS1C 4YHHI 4NXME 4WSGA 4MU3A 2YTEA 4DV6E 2DRPA 2EPMX 5L3JA 2YTIA 3DF6A 4B3RI 2EM4A 5DROA 2L33A 5IXMB 2DLQA 4LF8I 4KHPI 2LE2A 4WUDA 2EN1A 4R8OA 2NA2A 1XXEA 2L3CA 1OJ4A 1T4LB 3UK3C 2NABA 2R3VA 5C0XA 1S16A 2EN4A 2XEXA 3CWVA 2VQFE 2EMHA 3GONA 3T1HE 2M1SA 4R2RA 2C37B 2IOQA 3OTOI 1Z0TA 1GZ6A 5IWAI 2FV4B 2WZOA 1T4NA 2YTPA 1H7SA 2B7VA 5C0XB 2EWLA 2RSMA 5KL4A 1UILA 1HR0E 4FWHA 4DKKA 2L2NA 3KRNA 2MKDA 1UDOA 3Q1QA 1S4EA 4DV4I 1DGCA 2HFUA 3B82A 3UHMA 5LMNI 2R76A 2EPLX 2LUQA 2EPPA 1A1IA 2BA1D 1HNXI 1FKAE 2UUAE 4DR6I 3P1XA 2EM7A 2JE6B 2BA0D 1QNTA 4I8OA 4JI2E 2FGGA 4JI8E 4DUYE 2EPZA 1R6MA 1I94E 1J5EE 2YZTA 2DSYA 4LFAE 2HK2A 1X6EA 5EKWA 2Q2EB 4DPWA 4MLVA 4ZYDA 4R2EA 1TF3A 4BCAA 1OYPA 4LF7I 4TUGA 4NXMI 5K36F 1A6FA 2WW4A 4HY1A 4DUZE 1ZM4A 3B4TA 2WNRB 3J81C 1N33E 1KTVA 3F0NA 2EOYA 1EKZA 2JEAA 3MHSC 1G2FC 2BR2A 2NN6E 2EMWA 4IZJD 2EPRA 5KL6A 5JEAA 3J81Q 2WBSA 2Z5CB 2LV2A 2V89A 2J7JA 4PRXA 4FW4A 2EPNA 3ZZUA 4R2QA 1PJSA 4RHBB 4B3ME 4FW6A 4R2SA 1BBGA 1YZ9A 2EMKA 1KKHA 1NZ0A 3QT8A 4NBQA 4DV1I 2EOHA 2YU8A 2NN6D 3EPLA 2EMXA 2DEIA 2CT1A 2JYAA 4LTYA 4IZJA 4URLA 2UXDI 2UUBE 2CZ9A 1MG7A 4X66E 1ZBTA 2MDGA 4DR3E 2O1WA 2M4IA 3B8HA 2YTNA 4IZJB 5A6BA 1JK2A 4DV5I 2EORA 1U2RA 2LVHA 2FTXB 1LLMC 3IWDA 1ZAAC 2KONA 5AASA 2LRSA 4O4KA 5C0XF 1FJGE 3CDIA 4I3HA 3OMLA 1Y6ZA 4FWGA 1NCSA 4RPFA 4JI4I 4DV2E 1BKNA 1OYSA 1Z5CA 2V8QB 2ELYA 4KQVA 2E1RA 1B63A 1NHIA 2WCC3 3M6AA 5IT9C 4DR4E 2K4VA 2RPCA 1N36I 3TQMA 1IBME 2X7IA 2G7HA 3PS3A 5A6JA 4LF6I 4JG4A 4DUZI 4ZYEA 1N32E 4B3TI 2VQEI 4ISAA 3J7AG 2LCEA 4YHHE 4WYQB 1MEYC 4DPXA 1J26A 2N3HA 1XMOI 2YTQA 4B3RE 3K85A 2RQLA 2YSOA 4FK5C 4LF8E 2LTSA 4OO1E 4KHPE 3ZM7A 2EL5A 3C4BA 4O24A 4B3MI 4IFDA 3V5RA 2UUCI 3JAMC 3PS1A 4Z7CA 4WPYA 4J3DA 2EMFA 4GZNC 2NUGA 3LTOA 4DU7A 2EPUA 5CFFE 4NXNI 3OTOE 2PNMA 1T4OA 1D6TA 2EMAA 2RTXA 1ZR9A 1NHJA 1ZU1A 4X66I 2O3ZA 4WUCA 1KIJA 3Q6MA 2BM0A 4OO1D 1EH8A 5JEAF 4DV4E 5ADZA 1MX0A 1R6LA 2BA1G 4DR1I 5LMNE 2VESA 3DD6A 3VYXA 1HNXE 2BA0G 1WHNA 1RHYA 4DR6E 4MQYA 2Z5BA 2VE7C 4Q35B 4JI6I 3IWCA 2PO0A 2ELZA 2EOXA 2GS8A 2HJJA 1IQSA 2IESA 3LPSA 2V85A 1PJTA 1E3HA 4QNKA 4K0KI 2EPCA 2L6MA 2EMBA 1ZM9A 1UDQA 1Y5YA 4LF7E 4PRVA 3JU0A 1H7UA 4IS9A 1VISA 2BV3A 4USKA 2K7IA 3KWRA 1SR9A 4GEQB 3ZKDA 4X9JA 2UXBE 2F8BA 1X6FA 3C6KA 1ZM2A 4Z7YA 3HTXA 2LJPA 4X64I 2A2DA 2MDRA 1O0WA 5T6JA 2C37A 4P52A 3M85D 3LMLA 5LMUI 2EPOA 1XNQE 4LFBI 2R42A 4LF5I 3FIGA 2EE8A 2KHXA 2YRKA 2WBUA 1ZXMA 3QT6A 1IQOA 4WXDA 1EH6A 1USUA 2JT2A 4HACA 4DV1E 4M1KA 4DV3I 1XNRI 2EMIA 1RQ0A 4AQYI 2JOXA 4LOMA 4HACB 2UXDE 1UDSA 1IBKI 2IOPA 3QG5C 3L7ZB 3AV0A 2RSIA 3K6QA 2BM1A 2JE6A 3PYGA 4FW9A 4LCHA 2EZ6A 1YFHA 2F4VE 4LFCI 4DV5E 4DR5I 2EM5A 2VF1A 2JP9A 4P7DA 1PKPA 4IFDF 3MHHC 2YTDA 2IHR1 2EPKX 2GO4A 2MC6A 4BS9A 2ENHA 5GMDA 3QT5A 2CVEA 2LJUA 1BBOA 4J8ZA 4JI4E 4M9VC 2EN3A 2NN6C 4DPYA 4R2CA 2JEBB 5JEAE 2YT4A 2WNRA 2N3GA 1X48A 2EPXA 1N36E 4KZSA 2LMZA 5AC5A 2JPAA 4LF6E 4ZYHA 3F6HA 1Z0CA 2HHHI 3D4JA 1Z0BA 4B3TE 2Z5CA 2VQEE 2UXBI 5LLQA 1Z1BA 1DI2A 5LL6R 2JOBA 1XMOE 4AM3A 1VI7A 4ZYGA 2GO3A 4M30A 3P3EA 1XNQI 1E3PA 1K47A 4R2DA 1Z0EA 4GKKI 5EL9A 2YU5A 4WXCA 1GTKA 2D9HA 2MKNA 1DARA 5KL3A 2UUCE 4DR7I 2AJ4A 1A1LA 2WP8B 2DGCA 5A69A 2EFGA 4NXNE 2A2CA 1A1FA 5DRPA 3KZYA 4O43A 3H4LA 2ODRC 3HPSA 2HGHA 2BB8A 4FWDA 4U3DA 2ZM6I 2F4VI 2LTRA 1KVKA 3HULA 3P3CA 4QNJA 1FWLA 4DR1E 3CDJA 1HNWI 1Y4UA 2ENCA 4TUIA 1RREA 2V8PA 1KYQA 2EQ1A 4JYAI 1P47A 3T1YI 2EMCA 2DEJA 2NN6A 4JI6E 2PNZB 2EMGA 3P76A 4NZVA 4F6NA 2EOJA 3J80C 1T39A 2NN6B 2YRMA 4MU4A 4LF9I 1HK7A 3ZOQB 4K0KE 2LO3A 4UT4A 4OO1C 2EOOA 4F6MA 4BA1A 4IFDE 3J80Q 2LBSB 2EQ3A 4MU0A 5DNXA 2ODRD 1QZRA 5K36E 3JTZA 2EMZA 4WX9A 2EM3A 2EM6A 2H36X 2M7QA 5BR8E 4BC7A 4YY3E 4BA1B 2E1MA 3L00A 3M85G 1X6HA 2GQ0A 1UBDC 2PO1A 2M9AA 4X64E 3P06A 3P3GA 4AIDA 2EQ0A 3HPZA 4MU1A 3ADLA 1QU6A 3BF2A 2B9DA 3EPKA 5LMUE 4LFBE 4MYUA 2PO1B 1WRJA 2YTJA 2EM0A 1JK1A 3EPJA 2EMYA 4DV7E 2JY9A 4LF5E 4USMA 4IZKA 4MDTA 3J7Yp 2ZM6E 2NUEA 1YPNA 1XNRE 2EN8A 2YRHA 2EM2A 5A2QC 4DV3E 1MU5A 4AQYE 4IZKB 1FWKA 2PNLA 3BIDA 2LUPB 3EPHA 2YTFA 4WUBA 4JV5I 2GPIA 1IBKE 1YUIA 4LCGA 4AIMA 2V2VA 1NEIA 4F9CB 5A2QQ 5K36D 2CG9A 4KWYA 4DR5E 4LFCE 1N3GA 3PRYA 4JI5I 3VHTB 2ENAA 4FN5A 2HC5A 2J7KA 4HTGA 4BMJA 2PRTA 4P7AA 3GMEA 1HNZI 1UDNA 2F1DA 2B3TB 2LT7A 2ZBKB 2EOMA 1GQEA 1STUA 4X65E 2YSPA 2EN2A 3V2UC 1Z0VA 4P78A 5F3WA 2V34A 3LLHA 1Y60A 4OO1A 3EQ1A 1Z5BA 2EOZA 4HEIA 2EL6A 1H74A 2HHHE 1WHQA 5C0XE 4B3SI 5BR8I 4OO1B 1N34E 3J7AM 4YY3I 5AE1A 1MGTA 4DMIA 1WXRA 2I13A 4FW7A 4UTGA 2EM9A 1EH7A 3WU5A 2JVAA 1ZXNA 4LF4I 4OZEA 3ECRA 3C4TA 4F54A 2NN6F 1XMQI 4GKKE 2HKEA 3ADGA 4L5NC 2WBTA 4L8NA 4OKGA 4DV7I 1AH5A 4DR2I 2V83A 2L3JA 3M7ND 2EJ4A 3ZZTA 4DR7E 2CGEA 2EMLA 3WU3A 5KL5A 1PJQA 2DB2A 5FWKA 2B7TA 4JI3I 4FW5A 2RS7A 2C39B 3HKMA 2CTDA 3L7ZA 3DJWA 1A1GA 1Y4SA 3ZZ0A 4F2JC 5IV8B 1BB8A 4BA2A 5AE2A 3ADJA 2EOIA 2N8XA 2R1FA 2EOQA 1F2IG 2V88A 3K17A 1T38A 1G2DC 5DNYA 2GHFA 3U1KA 4JI0I 4BA2B 2JWOA 4R1FA 4LPFA 5JEAC 2CPNA 1HNWE 1YHCA 4OX9I 2MC5A 1YYKA 2JEBA 2EOSA 2GLIA 4JYAE 1FNMA 3GLLA 5AE3A 3AUZA 4DPUA 4DXLA 4X65I 2E5LI 3T1YE 5DRQA 4HXZA 2I9IA 3HQ1A 3BBGA 3M99B 3LNUA 4JI7I 2YTOA 2BBGA 1EA6A 2NPFA 2DIXA 5ELWA 3F6GA 4JI1I 2YPNA 1N0UA 2EL4A 1P42A 2NUFA 4LF9E 1UN6B 1XHKA 4FW3A 2X36A 4WSPA 3K1JA 4M2ZA 4GKJE 1N34I 2UU9I 4BHCA 4U3BA 4PU9A 4R2AA 2YWQA 5A6KA 2C38A 2L8TA 2Z5EA 4XTJA 2DMYA 4ED4A 4F9BB 1A1KA 1OYRA 5JEAD 1IBLI 1A1HA 1H73A 2C38B 4Q28A 2UXCI 2WP8A 1UEKA 1YYWA 4N3OA 1RMDA 1RC7A 3QT7A 2IERA 1L4SA 1SFEA 1FI4A 3PYEA 4OO1F 4X62I 2V86A 2JXPA 4X8WA 1ZBQA 4BHBA 5FLXC 4DV6I 4M0VA 3VYYA 5TSEA 1TN9A 2YTGA 1YUJA 2L2MA 2JR1A 4JV5E 5FLXQ 1Z59A 1Z5AA 2JEAB 2EPAA 2BR2B 4F9AB 3ADIA 5A6BD 1B62A 4DU8A 2PNZA 4EMDA 4JI5E 5JEAB 2VQFI 3T1HI 4IFDC 3H09A 3BGHA 1HNZE 1KJKA 4GQUA 4IJDA 1HR0I 3B78A 1Z0GA 2LJHA 3KZZA 4ZVIA 2Q8UA 5AC4A 3U1YA 4GKJI 4HYMA 5DRRA 1UHZA 2EOEA 1PIEA 2O1TA 1B69A 5K36C 3THOB 3VK6A 4DV0E 4B3SE 3RMPA 2UUAI 2HFSA 4DPTA 2KOUA 3HJCA 2O1UA 1X47A 2DMIA 3GCMA 4JI2I 1USVA 4JI8I 4DUYI 4N4RB 4LF4E 1WUUA 1I94I 4LCFA 2VRDA 1J5EI 3NZKA 4NHRA 1XMQE 4LFAI 1A1JA 1NHHA 3PYFA 4O5GA 3M7NG 3MSWA 4IFDD 4BC9A 5KL2A 1H72C 4DR2E 1RR9A 3IWBA 2EN6A 2O1VA 4LU9A 1N33I 4JI3E 5IT9Q 3PS2A 1DQ3A 1PDAA 5A6AA 2J65A 1Z0WA 2VF3A 4WFTA 1YYOA 2L92A 3H1CA 1YH8A 4OOGC 2V2QA 4BBYA 2CSHA 4R2PA 4JI0E 2ZITA 2EOFA 1ZM3A 2DLKA 4OX9E 1N0VC 2A25A 3Q6NA 1IMUA 1X3CA 3HXLA 3WU4A 5C0XC
chains in the Genus database with same CATH topology
2E5LE 3JAMQ 2L2KB 2UUBI 4JI7E 5IWAE 2OI2A 4JI1E 2V87A 1EI1A 4DR3I 4DV0I 3WU6A 2HK3A 1ELOA 2V2ZA 2UU9E 5GMEA 1PVGA 1FJGI 3PYDA 3ZKBA 4DV2I 1IBLE 4MYTA 2UXCE 2RS6A 4DR4I 1X49A 2HKJA 4R03A 2Z5BB 1IBMI 1N32I 4X62E 4YHHI 4NXME 4DV6E 5L3JA 3DF6A 4B3RI 2L33A 4LF8I 4KHPI 2LE2A 4WUDA 4R8OA 2NA2A 2L3CA 1OJ4A 1T4LB 2R3VA 1S16A 2XEXA 3CWVA 3GONA 2VQFE 3T1HE 2M1SA 2IOQA 3OTOI 1Z0TA 1GZ6A 5IWAI 2FV4B 1H7SA 2WZOA 1T4NA 2B7VA 2EWLA 2RSMA 1UILA 1HR0E 4FWHA 4DKKA 2L2NA 3Q1QA 1S4EA 4DV4I 2HFUA 3B82A 5LMNI 2LUQA 1HNXI 1FKAE 2UUAE 4DR6I 3P1XA 4I8OA 4JI2E 2FGGA 4JI8E 4DUYE 1I94E 1J5EE 2YZTA 2DSYA 4LFAE 2HK2A 2Q2EB 4DPWA 4BCAA 4LF7I 4TUGA 4NXMI 1A6FA 2WW4A 4HY1A 4DUZE 1ZM4A 3F0NA 3J81C 1N33E 1KTVA 1EKZA 4IZJD 3J81Q 2Z5CB 2V89A 4PRXA 3ZZUA 4B3ME 1YZ9A 1KKHA 1NZ0A 3QT8A 4DV1I 4URLA 2DEIA 4LTYA 4IZJA 2UXDI 2UUBE 2CZ9A 1MG7A 4X66E 1ZBTA 3B8HA 4DR3E 2O1WA 2M4IA 4IZJB 4DV5I 1U2RA 2FTXB 3IWDA 5AASA 2KONA 2LRSA 1FJGE 4I3HA 3OMLA 1Y6ZA 4FWGA 4RPFA 4JI4I 4DV2E 1BKNA 1Z5CA 2V8QB 4KQVA 2E1RA 1B63A 1NHIA 5IT9C 4DR4E 2K4VA 1N36I 1IBME 2X7IA 2G7HA 4LF6I 4JG4A 4DUZI 1N32E 4B3TI 2VQEI 3J7AG 4YHHE 4WYQB 4DPXA 1J26A 2N3HA 1XMOI 4B3RE 3K85A 4LF8E 2LTSA 4KHPE 3ZM7A 3C4BA 4B3MI 3V5RA 2UUCI 3JAMC 4Z7CA 4WPYA 4DU7A 2NUGA 3LTOA 5CFFE 4NXNI 3OTOE 2PNMA 1T4OA 1D6TA 2RTXA 1NHJA 4X66I 4WUCA 1KIJA 3Q6MA 2BM0A 4DV4E 5ADZA 1MX0A 4DR1I 5LMNE 3VYXA 1HNXE 1WHNA 4DR6E 2Z5BA 2VE7C 4JI6I 3IWCA 2GS8A 3LPSA 2V85A 4K0KI 2L6MA 1ZM9A 4LF7E 4PRVA 3JU0A 1H7UA 1VISA 2BV3A 4USKA 3KWRA 1SR9A 4GEQB 3ZKDA 2UXBE 2F8BA 1ZM2A 4Z7YA 3HTXA 2LJPA 4X64I 2A2DA 2MDRA 1O0WA 5T6JA 4P52A 3LMLA 5LMUI 4LFBI 1XNQE 2R42A 4LF5I 3FIGA 2KHXA 1ZXMA 3QT6A 4HACA 2ZM6I 1USUA 4M1KA 4DV1E 4DV3I 1XNRI 1RQ0A 4AQYI 2JOXA 4HACB 2UXDE 1IBKI 2IOPA 3AV0A 3K6QA 2BM1A 3PYGA 4FW9A 2EZ6A 2F4VE 4DR5I 4LFCI 4DV5E 2VF1A 4P7DA 1PKPA 2IHR1 2MC6A 4BS9A 5GMDA 3QT5A 4DPYA 4J8ZA 4JI4E 2YT4A 2N3GA 1X48A 1N36E 4KZSA 2LMZA 4LF6E 2HHHI 3F6HA 1Z0CA 3D4JA 1Z0BA 4B3TE 2Z5CA 2VQEE 2UXBI 1DI2A 5LL6R 2JOBA 1XMOE 4GKKI 4M30A 1XNQI 1K47A 1Z0EA 1DARA 2UUCE 4DR7I 2AJ4A 2EFGA 4NXNE 2A2CA 3H4LA 2ODRC 3HPSA 4FWDA 2F4VI 2LTRA 1KVKA 3HULA 1FWLA 4DR1E 1HNWI 1Y4UA 4TUIA 1RREA 2V8PA 4JYAI 3T1YI 2DEJA 4JI6E 3J80C 4LF9I 1HK7A 3ZOQB 4K0KE 4UT4A 3J80Q 2LBSB 2ODRD 1QZRA 3JTZA 5BR8E 2H36X 2M7QA 4BC7A 4YY3E 2E1MA 2GQ0A 4X64E 3P06A 3HPZA 3ADLA 1QU6A 2B9DA 5LMUE 4LFBE 4MYUA 4DV7E 4LF5E 2JY9A 4USMA 4IZKA 3J7Yp 2ZM6E 2NUEA 1XNRE 4DV3E 5A2QC 1MU5A 4AQYE 4IZKB 1FWKA 2PNLA 4WUBA 2LUPB 4JV5I 1IBKE 2V2VA 4F9CB 5A2QQ 2CG9A 4DR5E 4LFCE 3PRYA 4JI5I 4FN5A 2J7KA 4BMJA 4P7AA 1HNZI 2B3TB 2ZBKB 1GQEA 1STUA 4X65E 3V2UC 1Z0VA 4P78A 5F3WA 2V34A 3LLHA 1Z5BA 1H74A 2HHHE 1WHQA 4B3SI 5BR8I 1N34E 3J7AM 4YY3I 5AE1A 4DMIA 1WXRA 4UTGA 3WU5A 2JVAA 1ZXNA 4LF4I 3C4TA 4F54A 1XMQI 4GKKE 2HKEA 3ADGA 4L5NC 4L8NA 4DV7I 4DR2I 2V83A 2L3JA 3ZZTA 4DR7E 2CGEA 3WU3A 2DB2A 5FWKA 2B7TA 4JI3I 2RS7A 3DJWA 3ZZ0A 1Y4SA 5AE2A 3ADJA 2V88A 3K17A 5DNYA 4JI0I 2JWOA 4R1FA 2CPNA 1HNWE 4OX9I 2MC5A 1YYKA 4JYAE 1FNMA 4DXLA 5AE3A 3AUZA 4DPUA 4X65I 2E5LI 3T1YE 4HXZA 3HQ1A 3LNUA 4JI7I 1EA6A 2NPFA 2DIXA 3F6GA 4JI1I 1N0UA 2NUFA 4LF9E 1XHKA 2X36A 4WSPA 3K1JA 4M2ZA 4GKJE 1N34I 2UU9I 4PU9A 2L8TA 2Z5EA 4XTJA 2DMYA 4ED4A 4F9BB 1IBLI 1H73A 2UXCI 4Q28A 1UEKA 1YYWA 4N3OA 1RC7A 3QT7A 1FI4A 3PYEA 4X62I 2V86A 4X8WA 1ZBQA 5FLXC 4DV6I 4M0VA 3VYYA 4JV5E 2L2MA 2JR1A 5FLXQ 1Z59A 1Z5AA 4F9AB 3ADIA 1B62A 4DU8A 4EMDA 4JI5E 2VQFI 3T1HI 3H09A 1HNZE 1HR0I 3B78A 1Z0GA 2LJHA 4ZVIA 4GKJI 4HYMA 1UHZA 2O1TA 1PIEA 3VK6A 4DV0E 4B3SE 3RMPA 2UUAI 2HFSA 4DPTA 2KOUA 3HJCA 2O1UA 1X47A 4JI2I 1USVA 4JI8I 4DUYI 4LF4E 1WUUA 1I94I 1J5EI 4LFAI 1XMQE 3PYFA 1NHHA 3MSWA 4BC9A 1H72C 4DR2E 1RR9A 3IWBA 2O1VA 4LU9A 1N33I 4JI3E 5IT9Q 1DQ3A 1Z0WA 2VF3A 1YYOA 4WFTA 2L92A 4OOGC 2V2QA 4BBYA 4JI0E 2ZITA 1ZM3A 4OX9E 1N0VC 3Q6NA 3M6AA 3HXLA 3WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L E;  3JAM Q;  2L2K B;  2UUB I;  4JI7 E;  5IWA E;  2OI2 A;  4JI1 E;  1EI1 A;  4DR3 I;  4DV0 I;  3WU6 A;  2HK3 A;  1ELO A;  2V2Z A;  2UU9 E;  5GME A;  1PVG A;  1FJG I;  3PYD A;  3ZKB A;  4DV2 I;  1IBL E;  4MYT A;  2UXC E;  2RS6 A;  4DR4 I;  1X49 A;  2HKJ A;  1IBM I;  1N32 I;  4X62 E;  4YHH I;  4NXM E;  4DV6 E;  5L3J A;  4B3R I;  2L33 A;  4LF8 I;  4KHP I;  4WUD A;  2NA2 A;  2L3C A;  1OJ4 A;  1T4L B;  2R3V A;  1S16 A;  2XEX A;  3CWV A;  3GON A;  2VQF E;  3T1H E;  3OTO I;  1Z0T A;  5IWA I;  1H7S A;  1T4N A;  2B7V A;  2RSM A;  1UIL A;  1HR0 E;  4FWH A;  4DKK A;  2L2N A;  3Q1Q A;  1S4E A;  4DV4 I;  2HFU A;  3B82 A;  5LMN I;  2LUQ A;  1HNX I;  1FKA E;  2UUA E;  4DR6 I;  3P1X A;  4JI2 E;  4JI8 E;  4DUY E;  1I94 E;  1J5E E;  4LFA E;  2HK2 A;  2Q2E B;  4DPW A;  4LF7 I;  4NXM I;  1A6F A;  2WW4 A;  4HY1 A;  4DUZ E;  1ZM4 A;  3F0N A;  3J81 C;  1N33 E;  1KTV A;  1EKZ A;  3J81 Q;  4PRX A;  3ZZU A;  4B3M E;  1YZ9 A;  1KKH A;  1NZ0 A;  3QT8 A;  4DV1 I;  4URL A;  2DEI A;  2UXD I;  2UUB E;  2CZ9 A;  1MG7 A;  4X66 E;  1ZBT A;  3B8H A;  4DR3 E;  4DV5 I;  1U2R A;  2LRS A;  1FJG E;  4I3H A;  4RPF A;  4FWG A;  4JI4 I;  4DV2 E;  1BKN A;  1Z5C A;  4KQV A;  2E1R A;  1B63 A;  1NHI A;  4DR4 E;  5IT9 C;  1N36 I;  1IBM E;  2X7I A;  4LF6 I;  4JG4 A;  4DUZ I;  1N32 E;  4B3T I;  2VQE I;  3J7A G;  4YHH E;  4WYQ B;  4DPX A;  1J26 A;  2N3H A;  1XMO I;  4B3R E;  4LF8 E;  2LTS A;  4KHP E;  3ZM7 A;  3C4B A;  4B3M I;  3V5R A;  2UUC I;  3JAM C;  4Z7C A;  4DU7 A;  2NUG A;  3LTO A;  5CFF E;  4NXN I;  3OTO E;  1D6T A;  1T4O A;  2RTX A;  1NHJ A;  4X66 I;  4WUC A;  1KIJ A;  2BM0 A;  4DV4 E;  1MX0 A;  4DR1 I;  5LMN E;  3VYX A;  1HNX E;  1WHN A;  4DR6 E;  4JI6 I;  2GS8 A;  3LPS A;  4K0K I;  1ZM9 A;  4LF7 E;  4PRV A;  1H7U A;  1VIS A;  2BV3 A;  4USK A;  3ZKD A;  2UXB E;  1ZM2 A;  4Z7Y A;  3HTX A;  2LJP A;  4X64 I;  2A2D A;  2MDR A;  1O0W A;  4P52 A;  5LMU I;  4LFB I;  1XNQ E;  2R42 A;  4LF5 I;  2KHX A;  1ZXM A;  3QT6 A;  4HAC A;  2ZM6 I;  4M1K A;  4DV1 E;  4DV3 I;  1XNR I;  1RQ0 A;  4AQY I;  4HAC B;  2UXD E;  1IBK I;  2BM1 A;  3PYG A;  4FW9 A;  2EZ6 A;  2F4V E;  4DR5 I;  4LFC I;  4DV5 E;  1PKP A;  2IHR 1;  5GMD A;  3QT5 A;  4DPY A;  4JI4 E;  2YT4 A;  2N3G A;  1X48 A;  1N36 E;  4LF6 E;  2HHH I;  1Z0C A;  3D4J A;  1Z0B A;  4B3T E;  2VQE E;  2UXB I;  1DI2 A;  5LL6 R;  1XMO E;  4GKK I;  4M30 A;  1XNQ I;  1K47 A;  1Z0E A;  1DAR A;  2UUC E;  4DR7 I;  2AJ4 A;  2EFG A;  4NXN E;  2A2C A;  3H4L A;  4FWD A;  2F4V I;  2LTR A;  1KVK A;  3HUL A;  1FWL A;  4DR1 E;  1HNW I;  1RRE A;  2V8P A;  4JYA I;  3T1Y I;  2DEJ A;  4JI6 E;  3J80 C;  4LF9 I;  4K0K E;  4UT4 A;  3J80 Q;  2LBS B;  1QZR A;  5BR8 E;  4YY3 E;  4X64 E;  3ADL A;  1QU6 A;  5LMU E;  4LFB E;  4MYU A;  4DV7 E;  4LF5 E;  2JY9 A;  4USM A;  3J7Y p;  2ZM6 E;  2NUE A;  1XNR E;  4DV3 E;  5A2Q C;  1MU5 A;  4AQY E;  4WUB A;  1FWK A;  2LUP B;  4JV5 I;  1IBK E;  2V2V A;  5A2Q Q;  4DR5 E;  4LFC E;  4JI5 I;  4FN5 A;  2J7K A;  4P7A A;  1HNZ I;  2B3T B;  2ZBK B;  1GQE A;  1STU A;  4X65 E;  3V2U C;  1Z0V A;  2V34 A;  3LLH A;  1Z5B A;  1H74 A;  2HHH E;  1WHQ A;  4B3S I;  5BR8 I;  1N34 E;  3J7A M;  4YY3 I;  4UTG A;  3WU5 A;  2JVA A;  1ZXN A;  4LF4 I;  3C4T A;  1XMQ I;  2HKE A;  4GKK E;  3ADG A;  4DV7 I;  4DR2 I;  2L3J A;  3ZZT A;  4DR7 E;  3WU3 A;  2DB2 A;  4JI3 I;  2B7T A;  2RS7 A;  3ZZ0 A;  3ADJ A;  3K17 A;  4JI0 I;  4R1F A;  2CPN A;  1HNW E;  4OX9 I;  1YYK A;  4JYA E;  1FNM A;  4DXL A;  4DPU A;  4X65 I;  2E5L I;  3T1Y E;  4HXZ A;  3LNU A;  4JI7 I;  1EA6 A;  2NPF A;  2DIX A;  4JI1 I;  1N0U A;  2NUF A;  4LF9 E;  1XHK A;  2X36 A;  3K1J A;  4M2Z A;  4GKJ E;  1N34 I;  2UU9 I;  4PU9 A;  4XTJ A;  2DMY A;  4ED4 A;  1IBL I;  1H73 A;  2UXC I;  1UEK A;  1YYW A;  1RC7 A;  3QT7 A;  1FI4 A;  3PYE A;  4X62 I;  4X8W A;  5FLX C;  4DV6 I;  3VYY A;  4JV5 E;  2L2M A;  5FLX Q;  1Z59 A;  1Z5A A;  3ADI A;  1B62 A;  4DU8 A;  4EMD A;  4JI5 E;  2VQF I;  3T1H I;  1HNZ E;  1HR0 I;  3B78 A;  1Z0G A;  2LJH A;  4ZVI A;  4GKJ I;  4HYM A;  1UHZ A;  1PIE A;  4DV0 E;  4B3S E;  2UUA I;  2HFS A;  4DPT A;  1X47 A;  4JI2 I;  4JI8 I;  4DUY I;  4LF4 E;  1WUU A;  1I94 I;  1J5E I;  4LFA I;  1XMQ E;  3PYF A;  1NHH A;  1H72 C;  4DR2 E;  1RR9 A;  1N33 I;  4JI3 E;  5IT9 Q;  1Z0W A;  2VF3 A;  4WFT A;  1YYO A;  4OOG C;  2V2Q A;  4JI0 E;  2ZIT A;  1ZM3 A;  4OX9 E;  1N0V C;  3M6A A;  3WU4 A; 
#chains in the Genus database with same CATH topology
 2E5L E;  4IFD B;  2AE8 A;  3JAM Q;  2L2K B;  2UUB I;  4JI7 E;  5IWA E;  2EN7 A;  3C6M A;  2OI2 A;  1WJP A;  4JI1 E;  2V87 A;  1EI1 A;  4DR3 I;  1X5W A;  2EP3 A;  5K36 A;  4DV0 I;  3WU6 A;  2HK3 A;  2ADR A;  4MLQ A;  1ELO A;  2V2Z A;  2UU9 E;  5DNL A;  2EM8 A;  5GME A;  2PO2 A;  5K36 B;  1PVG A;  1YSA C;  3PYD A;  1FJG I;  1AAY A;  3ZKB A;  4RH8 A;  2PO2 B;  4DV2 I;  1IBL E;  4MYT A;  2UXC E;  2RS6 A;  4DR4 I;  1X49 A;  2HKJ A;  4R03 A;  2C39 A;  2Z5B B;  1IBM I;  3THN A;  1TF6 A;  2PO0 B;  5C0X D;  1N32 I;  4X62 E;  5KL7 A;  2E72 A;  4IS1 C;  4YHH I;  4NXM E;  4WSG A;  4MU3 A;  2YTE A;  4DV6 E;  2DRP A;  2EPM X;  5L3J A;  2YTI A;  3DF6 A;  4B3R I;  2EM4 A;  5DRO A;  2L33 A;  5IXM B;  2DLQ A;  4LF8 I;  4KHP I;  2LE2 A;  4WUD A;  2EN1 A;  4R8O A;  2NA2 A;  1XXE A;  2L3C A;  1OJ4 A;  1T4L B;  3UK3 C;  2NAB A;  2R3V A;  5C0X A;  1S16 A;  2EN4 A;  2XEX A;  3CWV A;  2VQF E;  2EMH A;  3GON A;  3T1H E;  2M1S A;  4R2R A;  2C37 B;  2IOQ A;  3OTO I;  1Z0T A;  1GZ6 A;  5IWA I;  2FV4 B;  2WZO A;  1T4N A;  2YTP A;  1H7S A;  2B7V A;  5C0X B;  2EWL A;  2RSM A;  5KL4 A;  1UIL A;  1HR0 E;  4FWH A;  4DKK A;  2L2N A;  3KRN A;  2MKD A;  1UDO A;  3Q1Q A;  1S4E A;  4DV4 I;  1DGC A;  2HFU A;  3B82 A;  3UHM A;  5LMN I;  2R76 A;  2EPL X;  2LUQ A;  2EPP A;  1A1I A;  2BA1 D;  1HNX I;  1FKA E;  2UUA E;  4DR6 I;  3P1X A;  2EM7 A;  2JE6 B;  2BA0 D;  1QNT A;  4I8O A;  4JI2 E;  2FGG A;  4JI8 E;  4DUY E;  2EPZ A;  1R6M A;  1I94 E;  1J5E E;  2YZT A;  2DSY A;  4LFA E;  2HK2 A;  1X6E A;  5EKW A;  2Q2E B;  4DPW A;  4MLV A;  4ZYD A;  4R2E A;  1TF3 A;  4BCA A;  1OYP A;  4LF7 I;  4TUG A;  4NXM I;  5K36 F;  1A6F A;  2WW4 A;  4HY1 A;  4DUZ E;  1ZM4 A;  3B4T A;  2WNR B;  3J81 C;  1N33 E;  1KTV A;  3F0N A;  2EOY A;  1EKZ A;  2JEA A;  3MHS C;  1G2F C;  2BR2 A;  2NN6 E;  2EMW A;  4IZJ D;  2EPR A;  5KL6 A;  5JEA A;  3J81 Q;  2WBS A;  2Z5C B;  2LV2 A;  2V89 A;  2J7J A;  4PRX A;  4FW4 A;  2EPN A;  3ZZU A;  4R2Q A;  1PJS A;  4RHB B;  4B3M E;  4FW6 A;  4R2S A;  1BBG A;  1YZ9 A;  2EMK A;  1KKH A;  1NZ0 A;  3QT8 A;  4NBQ A;  4DV1 I;  2EOH A;  2YU8 A;  2NN6 D;  3EPL A;  2EMX A;  2DEI A;  2CT1 A;  2JYA A;  4LTY A;  4IZJ A;  4URL A;  2UXD I;  2UUB E;  2CZ9 A;  1MG7 A;  4X66 E;  1ZBT A;  2MDG A;  4DR3 E;  2O1W A;  2M4I A;  3B8H A;  2YTN A;  4IZJ B;  5A6B A;  1JK2 A;  4DV5 I;  2EOR A;  1U2R A;  2LVH A;  2FTX B;  1LLM C;  3IWD A;  1ZAA C;  2KON A;  5AAS A;  2LRS A;  4O4K A;  5C0X F;  1FJG E;  3CDI A;  4I3H A;  3OML A;  1Y6Z A;  4FWG A;  1NCS A;  4RPF A;  4JI4 I;  4DV2 E;  1BKN A;  1OYS A;  1Z5C A;  2V8Q B;  2ELY A;  4KQV A;  2E1R A;  1B63 A;  1NHI A;  2WCC 3;  3M6A A;  5IT9 C;  4DR4 E;  2K4V A;  2RPC A;  1N36 I;  3TQM A;  1IBM E;  2X7I A;  2G7H A;  3PS3 A;  5A6J A;  4LF6 I;  4JG4 A;  4DUZ I;  4ZYE A;  1N32 E;  4B3T I;  2VQE I;  4ISA A;  3J7A G;  2LCE A;  4YHH E;  4WYQ B;  1MEY C;  4DPX A;  1J26 A;  2N3H A;  1XMO I;  2YTQ A;  4B3R E;  3K85 A;  2RQL A;  2YSO A;  4FK5 C;  4LF8 E;  2LTS A;  4OO1 E;  4KHP E;  3ZM7 A;  2EL5 A;  3C4B A;  4O24 A;  4B3M I;  4IFD A;  3V5R A;  2UUC I;  3JAM C;  3PS1 A;  4Z7C A;  4WPY A;  4J3D A;  2EMF A;  4GZN C;  2NUG A;  3LTO A;  4DU7 A;  2EPU A;  5CFF E;  4NXN I;  3OTO E;  2PNM A;  1T4O A;  1D6T A;  2EMA A;  2RTX A;  1ZR9 A;  1NHJ A;  1ZU1 A;  4X66 I;  2O3Z A;  4WUC A;  1KIJ A;  3Q6M A;  2BM0 A;  4OO1 D;  1EH8 A;  5JEA F;  4DV4 E;  5ADZ A;  1MX0 A;  1R6L A;  2BA1 G;  4DR1 I;  5LMN E;  2VES A;  3DD6 A;  3VYX A;  1HNX E;  2BA0 G;  1WHN A;  1RHY A;  4DR6 E;  4MQY A;  2Z5B A;  2VE7 C;  4Q35 B;  4JI6 I;  3IWC A;  2PO0 A;  2ELZ A;  2EOX A;  2GS8 A;  2HJJ A;  1IQS A;  2IES A;  3LPS A;  2V85 A;  1PJT A;  1E3H A;  4QNK A;  4K0K I;  2EPC A;  2L6M A;  2EMB A;  1ZM9 A;  1UDQ A;  1Y5Y A;  4LF7 E;  4PRV A;  3JU0 A;  1H7U A;  4IS9 A;  1VIS A;  2BV3 A;  4USK A;  2K7I A;  3KWR A;  1SR9 A;  4GEQ B;  3ZKD A;  4X9J A;  2UXB E;  2F8B A;  1X6F A;  3C6K A;  1ZM2 A;  4Z7Y A;  3HTX A;  2LJP A;  4X64 I;  2A2D A;  2MDR A;  1O0W A;  5T6J A;  2C37 A;  4P52 A;  3M85 D;  3LML A;  5LMU I;  2EPO A;  1XNQ E;  4LFB I;  2R42 A;  4LF5 I;  3FIG A;  2EE8 A;  2KHX A;  2YRK A;  2WBU A;  1ZXM A;  3QT6 A;  1IQO A;  4WXD A;  1EH6 A;  1USU A;  2JT2 A;  4HAC A;  4DV1 E;  4M1K A;  4DV3 I;  1XNR I;  2EMI A;  1RQ0 A;  4AQY I;  2JOX A;  4LOM A;  4HAC B;  2UXD E;  1UDS A;  1IBK I;  2IOP A;  3QG5 C;  3L7Z B;  3AV0 A;  2RSI A;  3K6Q A;  2BM1 A;  2JE6 A;  3PYG A;  4FW9 A;  4LCH A;  2EZ6 A;  1YFH A;  2F4V E;  4LFC I;  4DV5 E;  4DR5 I;  2EM5 A;  2VF1 A;  2JP9 A;  4P7D A;  1PKP A;  4IFD F;  3MHH C;  2YTD A;  2IHR 1;  2EPK X;  2GO4 A;  2MC6 A;  4BS9 A;  2ENH A;  5GMD A;  3QT5 A;  2CVE A;  2LJU A;  1BBO A;  4J8Z A;  4JI4 E;  4M9V C;  2EN3 A;  2NN6 C;  4DPY A;  4R2C A;  2JEB B;  5JEA E;  2YT4 A;  2WNR A;  2N3G A;  1X48 A;  2EPX A;  1N36 E;  4KZS A;  2LMZ A;  5AC5 A;  2JPA A;  4LF6 E;  4ZYH A;  3F6H A;  1Z0C A;  2HHH I;  3D4J A;  1Z0B A;  4B3T E;  2Z5C A;  2VQE E;  2UXB I;  5LLQ A;  1Z1B A;  1DI2 A;  5LL6 R;  2JOB A;  1XMO E;  4AM3 A;  1VI7 A;  4ZYG A;  2GO3 A;  4M30 A;  3P3E A;  1XNQ I;  1E3P A;  1K47 A;  4R2D A;  1Z0E A;  4GKK I;  5EL9 A;  2YU5 A;  4WXC A;  1GTK A;  2D9H A;  2MKN A;  1DAR A;  5KL3 A;  2UUC E;  4DR7 I;  2AJ4 A;  1A1L A;  2WP8 B;  2DGC A;  5A69 A;  2EFG A;  4NXN E;  2A2C A;  1A1F A;  5DRP A;  3KZY A;  4O43 A;  3H4L A;  2ODR C;  3HPS A;  2HGH A;  2BB8 A;  4FWD A;  4U3D A;  2ZM6 I;  2F4V I;  2LTR A;  1KVK A;  3HUL A;  3P3C A;  4QNJ A;  1FWL A;  4DR1 E;  3CDJ A;  1HNW I;  1Y4U A;  2ENC A;  4TUI A;  1RRE A;  2V8P A;  1KYQ A;  2EQ1 A;  4JYA I;  1P47 A;  3T1Y I;  2EMC A;  2DEJ A;  2NN6 A;  4JI6 E;  2PNZ B;  2EMG A;  3P76 A;  4NZV A;  4F6N A;  2EOJ A;  3J80 C;  1T39 A;  2NN6 B;  2YRM A;  4MU4 A;  4LF9 I;  1HK7 A;  3ZOQ B;  4K0K E;  2LO3 A;  4UT4 A;  4OO1 C;  2EOO A;  4F6M A;  4BA1 A;  4IFD E;  3J80 Q;  2LBS B;  2EQ3 A;  4MU0 A;  5DNX A;  2ODR D;  1QZR A;  5K36 E;  3JTZ A;  2EMZ A;  4WX9 A;  2EM3 A;  2EM6 A;  2H36 X;  2M7Q A;  5BR8 E;  4BC7 A;  4YY3 E;  4BA1 B;  2E1M A;  3L00 A;  3M85 G;  1X6H A;  2GQ0 A;  1UBD C;  2PO1 A;  2M9A A;  4X64 E;  3P06 A;  3P3G A;  4AID A;  2EQ0 A;  3HPZ A;  4MU1 A;  3ADL A;  1QU6 A;  3BF2 A;  2B9D A;  3EPK A;  5LMU E;  4LFB E;  4MYU A;  2PO1 B;  1WRJ A;  2YTJ A;  2EM0 A;  1JK1 A;  3EPJ A;  2EMY A;  4DV7 E;  2JY9 A;  4LF5 E;  4USM A;  4IZK A;  4MDT A;  3J7Y p;  2ZM6 E;  2NUE A;  1YPN A;  1XNR E;  2EN8 A;  2YRH A;  2EM2 A;  5A2Q C;  4DV3 E;  1MU5 A;  4AQY E;  4IZK B;  1FWK A;  2PNL A;  3BID A;  2LUP B;  3EPH A;  2YTF A;  4WUB A;  4JV5 I;  2GPI A;  1IBK E;  1YUI A;  4LCG A;  4AIM A;  2V2V A;  1NEI A;  4F9C B;  5A2Q Q;  5K36 D;  2CG9 A;  4KWY A;  4DR5 E;  4LFC E;  1N3G A;  3PRY A;  4JI5 I;  3VHT B;  2ENA A;  4FN5 A;  2HC5 A;  2J7K A;  4HTG A;  4BMJ A;  2PRT A;  4P7A A;  3GME A;  1HNZ I;  1UDN A;  2F1D A;  2B3T B;  2LT7 A;  2ZBK B;  2EOM A;  1GQE A;  1STU A;  4X65 E;  2YSP A;  2EN2 A;  3V2U C;  1Z0V A;  4P78 A;  5F3W A;  2V34 A;  3LLH A;  1Y60 A;  4OO1 A;  3EQ1 A;  1Z5B A;  2EOZ A;  4HEI A;  2EL6 A;  1H74 A;  2HHH E;  1WHQ A;  5C0X E;  4B3S I;  5BR8 I;  4OO1 B;  1N34 E;  3J7A M;  4YY3 I;  5AE1 A;  1MGT A;  4DMI A;  1WXR A;  2I13 A;  4FW7 A;  4UTG A;  2EM9 A;  1EH7 A;  3WU5 A;  2JVA A;  1ZXN A;  4LF4 I;  4OZE A;  3ECR A;  3C4T A;  4F54 A;  2NN6 F;  1XMQ I;  4GKK E;  2HKE A;  3ADG A;  4L5N C;  2WBT A;  4L8N A;  4OKG A;  4DV7 I;  1AH5 A;  4DR2 I;  2V83 A;  2L3J A;  3M7N D;  2EJ4 A;  3ZZT A;  4DR7 E;  2CGE A;  2EML A;  3WU3 A;  5KL5 A;  1PJQ A;  2DB2 A;  5FWK A;  2B7T A;  4JI3 I;  4FW5 A;  2RS7 A;  2C39 B;  3HKM A;  2CTD A;  3L7Z A;  3DJW A;  1A1G A;  1Y4S A;  3ZZ0 A;  4F2J C;  5IV8 B;  1BB8 A;  4BA2 A;  5AE2 A;  3ADJ A;  2EOI A;  2N8X A;  2R1F A;  2EOQ A;  1F2I G;  2V88 A;  3K17 A;  1T38 A;  1G2D C;  5DNY A;  2GHF A;  3U1K A;  4JI0 I;  4BA2 B;  2JWO A;  4R1F A;  4LPF A;  5JEA C;  2CPN A;  1HNW E;  1YHC A;  4OX9 I;  2MC5 A;  1YYK A;  2JEB A;  2EOS A;  2GLI A;  4JYA E;  1FNM A;  3GLL A;  5AE3 A;  3AUZ A;  4DPU A;  4DXL A;  4X65 I;  2E5L I;  3T1Y E;  5DRQ A;  4HXZ A;  2I9I A;  3HQ1 A;  3BBG A;  3M99 B;  3LNU A;  4JI7 I;  2YTO A;  2BBG A;  1EA6 A;  2NPF A;  2DIX A;  5ELW A;  3F6G A;  4JI1 I;  2YPN A;  1N0U A;  2EL4 A;  1P42 A;  2NUF A;  4LF9 E;  1UN6 B;  1XHK A;  4FW3 A;  2X36 A;  4WSP A;  3K1J A;  4M2Z A;  4GKJ E;  1N34 I;  2UU9 I;  4BHC A;  4U3B A;  4PU9 A;  4R2A A;  2YWQ A;  5A6K A;  2C38 A;  2L8T A;  2Z5E A;  4XTJ A;  2DMY A;  4ED4 A;  4F9B B;  1A1K A;  1OYR A;  5JEA D;  1IBL I;  1A1H A;  1H73 A;  2C38 B;  4Q28 A;  2UXC I;  2WP8 A;  1UEK A;  1YYW A;  4N3O A;  1RMD A;  1RC7 A;  3QT7 A;  2IER A;  1L4S A;  1SFE A;  1FI4 A;  3PYE A;  4OO1 F;  4X62 I;  2V86 A;  2JXP A;  4X8W A;  1ZBQ A;  4BHB A;  5FLX C;  4DV6 I;  4M0V A;  3VYY A;  5TSE A;  1TN9 A;  2YTG A;  1YUJ A;  2L2M A;  2JR1 A;  4JV5 E;  5FLX Q;  1Z59 A;  1Z5A A;  2JEA B;  2EPA A;  2BR2 B;  4F9A B;  3ADI A;  5A6B D;  1B62 A;  4DU8 A;  2PNZ A;  4EMD A;  4JI5 E;  5JEA B;  2VQF I;  3T1H I;  4IFD C;  3H09 A;  3BGH A;  1HNZ E;  1KJK A;  4GQU A;  4IJD A;  1HR0 I;  3B78 A;  1Z0G A;  2LJH A;  3KZZ A;  4ZVI A;  2Q8U A;  5AC4 A;  3U1Y A;  4GKJ I;  4HYM A;  5DRR A;  1UHZ A;  2EOE A;  1PIE A;  2O1T A;  1B69 A;  5K36 C;  3THO B;  3VK6 A;  4DV0 E;  4B3S E;  3RMP A;  2UUA I;  2HFS A;  4DPT A;  2KOU A;  3HJC A;  2O1U A;  1X47 A;  2DMI A;  3GCM A;  4JI2 I;  1USV A;  4JI8 I;  4DUY I;  4N4R B;  4LF4 E;  1WUU A;  1I94 I;  4LCF A;  2VRD A;  1J5E I;  3NZK A;  4NHR A;  1XMQ E;  4LFA I;  1A1J A;  1NHH A;  3PYF A;  4O5G A;  3M7N G;  3MSW A;  4IFD D;  4BC9 A;  5KL2 A;  1H72 C;  4DR2 E;  1RR9 A;  3IWB A;  2EN6 A;  2O1V A;  4LU9 A;  1N33 I;  4JI3 E;  5IT9 Q;  3PS2 A;  1DQ3 A;  1PDA A;  5A6A A;  2J65 A;  1Z0W A;  2VF3 A;  4WFT A;  1YYO A;  2L92 A;  3H1C A;  1YH8 A;  4OOG C;  2V2Q A;  4BBY A;  2CSH A;  4R2P A;  4JI0 E;  2ZIT A;  2EOF A;  1ZM3 A;  2DLK A;  4OX9 E;  1N0V C;  2A25 A;  3Q6N A;  1IMU A;  1X3C A;  3HXL A;  3WU4 A;  5C0X C; 
#chains in the Genus database with same CATH homology
 2E5L E;  3JAM Q;  2L2K B;  2UUB I;  4JI7 E;  5IWA E;  2OI2 A;  4JI1 E;  2V87 A;  1EI1 A;  4DR3 I;  4DV0 I;  3WU6 A;  2HK3 A;  1ELO A;  2V2Z A;  2UU9 E;  5GME A;  1PVG A;  1FJG I;  3PYD A;  3ZKB A;  4DV2 I;  1IBL E;  4MYT A;  2UXC E;  2RS6 A;  4DR4 I;  1X49 A;  2HKJ A;  4R03 A;  2Z5B B;  1IBM I;  1N32 I;  4X62 E;  4YHH I;  4NXM E;  4DV6 E;  5L3J A;  3DF6 A;  4B3R I;  2L33 A;  4LF8 I;  4KHP I;  2LE2 A;  4WUD A;  4R8O A;  2NA2 A;  2L3C A;  1OJ4 A;  1T4L B;  2R3V A;  1S16 A;  2XEX A;  3CWV A;  3GON A;  2VQF E;  3T1H E;  2M1S A;  2IOQ A;  3OTO I;  1Z0T A;  1GZ6 A;  5IWA I;  2FV4 B;  1H7S A;  2WZO A;  1T4N A;  2B7V A;  2EWL A;  2RSM A;  1UIL A;  1HR0 E;  4FWH A;  4DKK A;  2L2N A;  3Q1Q A;  1S4E A;  4DV4 I;  2HFU A;  3B82 A;  5LMN I;  2LUQ A;  1HNX I;  1FKA E;  2UUA E;  4DR6 I;  3P1X A;  4I8O A;  4JI2 E;  2FGG A;  4JI8 E;  4DUY E;  1I94 E;  1J5E E;  2YZT A;  2DSY A;  4LFA E;  2HK2 A;  2Q2E B;  4DPW A;  4BCA A;  4LF7 I;  4TUG A;  4NXM I;  1A6F A;  2WW4 A;  4HY1 A;  4DUZ E;  1ZM4 A;  3F0N A;  3J81 C;  1N33 E;  1KTV A;  1EKZ A;  4IZJ D;  3J81 Q;  2Z5C B;  2V89 A;  4PRX A;  3ZZU A;  4B3M E;  1YZ9 A;  1KKH A;  1NZ0 A;  3QT8 A;  4DV1 I;  4URL A;  2DEI A;  4LTY A;  4IZJ A;  2UXD I;  2UUB E;  2CZ9 A;  1MG7 A;  4X66 E;  1ZBT A;  3B8H A;  4DR3 E;  2O1W A;  2M4I A;  4IZJ B;  4DV5 I;  1U2R A;  2FTX B;  3IWD A;  5AAS A;  2KON A;  2LRS A;  1FJG E;  4I3H A;  3OML A;  1Y6Z A;  4FWG A;  4RPF A;  4JI4 I;  4DV2 E;  1BKN A;  1Z5C A;  2V8Q B;  4KQV A;  2E1R A;  1B63 A;  1NHI A;  5IT9 C;  4DR4 E;  2K4V A;  1N36 I;  1IBM E;  2X7I A;  2G7H A;  4LF6 I;  4JG4 A;  4DUZ I;  1N32 E;  4B3T I;  2VQE I;  3J7A G;  4YHH E;  4WYQ B;  4DPX A;  1J26 A;  2N3H A;  1XMO I;  4B3R E;  3K85 A;  4LF8 E;  2LTS A;  4KHP E;  3ZM7 A;  3C4B A;  4B3M I;  3V5R A;  2UUC I;  3JAM C;  4Z7C A;  4WPY A;  4DU7 A;  2NUG A;  3LTO A;  5CFF E;  4NXN I;  3OTO E;  2PNM A;  1T4O A;  1D6T A;  2RTX A;  1NHJ A;  4X66 I;  4WUC A;  1KIJ A;  3Q6M A;  2BM0 A;  4DV4 E;  5ADZ A;  1MX0 A;  4DR1 I;  5LMN E;  3VYX A;  1HNX E;  1WHN A;  4DR6 E;  2Z5B A;  2VE7 C;  4JI6 I;  3IWC A;  2GS8 A;  3LPS A;  2V85 A;  4K0K I;  2L6M A;  1ZM9 A;  4LF7 E;  4PRV A;  3JU0 A;  1H7U A;  1VIS A;  2BV3 A;  4USK A;  3KWR A;  1SR9 A;  4GEQ B;  3ZKD A;  2UXB E;  2F8B A;  1ZM2 A;  4Z7Y A;  3HTX A;  2LJP A;  4X64 I;  2A2D A;  2MDR A;  1O0W A;  5T6J A;  4P52 A;  3LML A;  5LMU I;  4LFB I;  1XNQ E;  2R42 A;  4LF5 I;  3FIG A;  2KHX A;  1ZXM A;  3QT6 A;  4HAC A;  2ZM6 I;  1USU A;  4M1K A;  4DV1 E;  4DV3 I;  1XNR I;  1RQ0 A;  4AQY I;  2JOX A;  4HAC B;  2UXD E;  1IBK I;  2IOP A;  3AV0 A;  3K6Q A;  2BM1 A;  3PYG A;  4FW9 A;  2EZ6 A;  2F4V E;  4DR5 I;  4LFC I;  4DV5 E;  2VF1 A;  4P7D A;  1PKP A;  2IHR 1;  2MC6 A;  4BS9 A;  5GMD A;  3QT5 A;  4DPY A;  4J8Z A;  4JI4 E;  2YT4 A;  2N3G A;  1X48 A;  1N36 E;  4KZS A;  2LMZ A;  4LF6 E;  2HHH I;  3F6H A;  1Z0C A;  3D4J A;  1Z0B A;  4B3T E;  2Z5C A;  2VQE E;  2UXB I;  1DI2 A;  5LL6 R;  2JOB A;  1XMO E;  4GKK I;  4M30 A;  1XNQ I;  1K47 A;  1Z0E A;  1DAR A;  2UUC E;  4DR7 I;  2AJ4 A;  2EFG A;  4NXN E;  2A2C A;  3H4L A;  2ODR C;  3HPS A;  4FWD A;  2F4V I;  2LTR A;  1KVK A;  3HUL A;  1FWL A;  4DR1 E;  1HNW I;  1Y4U A;  4TUI A;  1RRE A;  2V8P A;  4JYA I;  3T1Y I;  2DEJ A;  4JI6 E;  3J80 C;  4LF9 I;  1HK7 A;  3ZOQ B;  4K0K E;  4UT4 A;  3J80 Q;  2LBS B;  2ODR D;  1QZR A;  3JTZ A;  5BR8 E;  2H36 X;  2M7Q A;  4BC7 A;  4YY3 E;  2E1M A;  2GQ0 A;  4X64 E;  3P06 A;  3HPZ A;  3ADL A;  1QU6 A;  2B9D A;  5LMU E;  4LFB E;  4MYU A;  4DV7 E;  4LF5 E;  2JY9 A;  4USM A;  4IZK A;  3J7Y p;  2ZM6 E;  2NUE A;  1XNR E;  4DV3 E;  5A2Q C;  1MU5 A;  4AQY E;  4IZK B;  1FWK A;  2PNL A;  4WUB A;  2LUP B;  4JV5 I;  1IBK E;  2V2V A;  4F9C B;  5A2Q Q;  2CG9 A;  4DR5 E;  4LFC E;  3PRY A;  4JI5 I;  4FN5 A;  2J7K A;  4BMJ A;  4P7A A;  1HNZ I;  2B3T B;  2ZBK B;  1GQE A;  1STU A;  4X65 E;  3V2U C;  1Z0V A;  4P78 A;  5F3W A;  2V34 A;  3LLH A;  1Z5B A;  1H74 A;  2HHH E;  1WHQ A;  4B3S I;  5BR8 I;  1N34 E;  3J7A M;  4YY3 I;  5AE1 A;  4DMI A;  1WXR A;  4UTG A;  3WU5 A;  2JVA A;  1ZXN A;  4LF4 I;  3C4T A;  4F54 A;  1XMQ I;  4GKK E;  2HKE A;  3ADG A;  4L5N C;  4L8N A;  4DV7 I;  4DR2 I;  2V83 A;  2L3J A;  3ZZT A;  4DR7 E;  2CGE A;  3WU3 A;  2DB2 A;  5FWK A;  2B7T A;  4JI3 I;  2RS7 A;  3DJW A;  3ZZ0 A;  1Y4S A;  5AE2 A;  3ADJ A;  2V88 A;  3K17 A;  5DNY A;  4JI0 I;  2JWO A;  4R1F A;  2CPN A;  1HNW E;  4OX9 I;  2MC5 A;  1YYK A;  4JYA E;  1FNM A;  4DXL A;  5AE3 A;  3AUZ A;  4DPU A;  4X65 I;  2E5L I;  3T1Y E;  4HXZ A;  3HQ1 A;  3LNU A;  4JI7 I;  1EA6 A;  2NPF A;  2DIX A;  3F6G A;  4JI1 I;  1N0U A;  2NUF A;  4LF9 E;  1XHK A;  2X36 A;  4WSP A;  3K1J A;  4M2Z A;  4GKJ E;  1N34 I;  2UU9 I;  4PU9 A;  2L8T A;  2Z5E A;  4XTJ A;  2DMY A;  4ED4 A;  4F9B B;  1IBL I;  1H73 A;  2UXC I;  4Q28 A;  1UEK A;  1YYW A;  4N3O A;  1RC7 A;  3QT7 A;  1FI4 A;  3PYE A;  4X62 I;  2V86 A;  4X8W A;  1ZBQ A;  5FLX C;  4DV6 I;  4M0V A;  3VYY A;  4JV5 E;  2L2M A;  2JR1 A;  5FLX Q;  1Z59 A;  1Z5A A;  4F9A B;  3ADI A;  1B62 A;  4DU8 A;  4EMD A;  4JI5 E;  2VQF I;  3T1H I;  3H09 A;  1HNZ E;  1HR0 I;  3B78 A;  1Z0G A;  2LJH A;  4ZVI A;  4GKJ I;  4HYM A;  1UHZ A;  2O1T A;  1PIE A;  3VK6 A;  4DV0 E;  4B3S E;  3RMP A;  2UUA I;  2HFS A;  4DPT A;  2KOU A;  3HJC A;  2O1U A;  1X47 A;  4JI2 I;  1USV A;  4JI8 I;  4DUY I;  4LF4 E;  1WUU A;  1I94 I;  1J5E I;  4LFA I;  1XMQ E;  3PYF A;  1NHH A;  3MSW A;  4BC9 A;  1H72 C;  4DR2 E;  1RR9 A;  3IWB A;  2O1V A;  4LU9 A;  1N33 I;  4JI3 E;  5IT9 Q;  1DQ3 A;  1Z0W A;  2VF3 A;  1YYO A;  4WFT A;  2L92 A;  4OOG C;  2V2Q A;  4BBY A;  4JI0 E;  2ZIT A;  1ZM3 A;  4OX9 E;  1N0V C;  3Q6N A;  3M6A A;  3HXL A;  3WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...