2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
2N3HA 3D4JA 1XNQI 2X7IA 2ZBKB 4DV1E 2JY9A 2L3CA 4DV7E 1S4EA 4DR2I 1EI1A 2DMYA 2UUAI 3CWVA 2B7VA 4JYAE 4DR2E 1ZXMA 4DV7I 4DV1I 1J5EE 1XNQE 1WHNA 4URLA 2HFUA 1Z0CA 2E5LI 1WHQA 4JI0I 4HY1A 1X49A 3T1HE 1PIEA 1D6TA 1ZBTA 4HACB 4DR5E 4ZVIA 4WUDA 4X66E 4PRXA 4I3HA 4LFBE 2LTSA 2BM1A 2L2NA 2UU9I 4OX9E 4LF6I 4UT4A 3WU4A 2ZM6I 2F4VI 2LTRA 2J7KA 4DV0I 1KVKA 4FN5A 4X8WA 3ZZUA 3K17A 5FLXQ 3T1YE 1PVGA 2CZ9A 4JI1I 1XNRE 4JI5I 4YHHI 5LMUE 4DR4E 2LJHA 4USMA 2UUBI 2L2KB 4HACA 3H4LA 1N32E 4PRVA 4DR6I 1N33I 4EMDA 2V8PA 4JI7I 3QT6A 4FWGA 2DEJA 1U2RA 1H72C 2UXBE 1DARA 1X48A 3LNUA 4DV5E 4HYMA 1IBKE 2BM0A 4DV6E 1IBLI 4NXMI 4K0KE 1XMOI 3ADGA 1HNXI 4X64E 1N36I 4DR1I 3JAMC 2LRSA 4DPXA 1B63A 4DR4I 4LF4E 4GKKE 2RTXA 1BKNA 5LMUI 4X62E 5BR8I 1FJGE 2Q2EB 2V34A 1O0WA 3J81C 2ZM6E 2UU9E 2GS8A 2VF3A 2L3JA 4X66I 4M30A 1OJ4A 4B3SI 2RSMA 1A6FA 3VYXA 3J81Q 3J80C 3T1HI 2E1RA 2NPFA 1Z0EA 4DPTA 2LBSB 3PYFA 3Q1QA 4LF9E 4JYAI 4LF8E 1HNZI 4LFCE 4AQYI 2NA2A 1RREA 2CPNA 4JI6E 2YT4A 1HR0E 2X36A 1XMOE 4K0KI 4DV6I 4LFAE 1IBKI 4DV5I 2VQEE 2HKEA 4KHPE 2HFSA 4M1KA 3C4TA 2IHR1 2HKJA 4DR7I 3ZZ0A 3LTOA 4FWHA 4FW9A 2MDRA 2HK2A 4DV4E 5IWAE 4UTGA 4YY3I 2JVAA 2LUQA 2VQFI 4JI1E 4JI5E 1FWLA 4DU7A 2LUPB 4LF7I 4B3MI 2HK3A 1KKHA 2NUEA 1Z5AA 4PU9A 3ZM7A 4FWDA 1KTVA 4LFBI 1GQEA 1MG7A 2KHXA 4HXZA 4DR5I 1IBMI 2AJ4A 5LL6R 3ADIA 1RC7A 3WU6A 2V2VA 4LF7E 3B78A 2E5LE 1WUUA 4DR3E 3JAMQ 4ED4A 1B62A 1Z0GA 1NHJA 3V2UC 5LMNE 5IWAI 4DV4I 3B82A 4XTJA 4DXLA 2V2QA 2UXCE 1Z0BA 3QT5A 2NUFA 4WYQB 2BV3A 4KHPI 2VQEI 1RR9A 4B3TE 4Z7YA 1ZM2A 2DB2A 5A2QC 3J80Q 3V5RA 3ADLA 4DV2I 4JG4A 4WUBA 2UXDI 4JI3E 1YYKA 1Z0VA 1Z0TA 1H7SA 4JI8I 4B3RI 3VYYA 4LFCI 1HNZE 4M2ZA 4DUZE 2RS7A 4JV5E 2XEXA 4LF9I 4P52A 1N0UA 4Z7CA 3P1XA 1J26A 1DI2A 5CFFE 2HHHE 1EKZA 1IBME 2NUGA 1H74A 3GONA 3HULA 2ZITA 4DPYA 2DIXA 3OTOE 1XMQE 1HNWI 3B8HA 1YYOA 1YZ9A 1X47A 4KQVA 1Z5CA 4GKJI 4JI4I 1FJGI 2R42A 4X62I 4LF4I 4GKKI 3M6AA 1ZM3A 1XHKA 4JI4E 4YY3E 4DR1E 1T4OA 3PYEA 3J7Yp 4WFTA 1EA6A 2R3VA 1HNWE 1IBLE 4NXME 3OTOI 4DR7E 1XMQI 1MX0A 2RS6A 3QT7A 2WW4A 3PYDA 3K1JA 1K47A 3ZZTA 1UEKA 3ADJA 2HHHI 1UHZA 3C4BA 3PYGA 4LFAI 1MU5A 1RQ0A 2UUCI 1ZXNA 4JV5I 4JI6I 4DUYI 2B7TA 2L33A 5FLXC 1FI4A 4X65I 4AQYE 4X65E 4LF8I 1XNRI 3T1YI 4DKKA 4DUYE 1UILA 4JI3I 4DV0E 4P7AA 2UUCE 2A2CA 4LF6E 4OX9I 4DV2E 1FKAE 1T4LB 2N3GA 3WU3A 3F0NA 3LLHA 4MYUA 1N0VC 1Z59A 4B3SE 2DEIA 3ZKBA 3J7AM 4JI0E 1NHHA 1Z5BA 1KIJA 1J5EI 4MYTA 5LMNI 2UUAE 1YYWA 5BR8E 1S16A 2LJPA 4DR3I 1QZRA 4GKJE 3LPSA 5L3JA 1N36E 3J7AG 2EZ6A 4X64I 4LF5I 1HNXE 4DPWA 4NXNI 1FWKA 1STUA 1QU6A 1H7UA 5GMDA 4OOGC 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 4B3ME 1T4NA 2OI2A 2A2DA 4JI7E 4DV3I 1N33E 4JI2E 4DR6E 5IT9Q 4USKA 1I94I 4DPUA 3QT8A 1N32I 2VQFE 2UUBE 4DUZI 5GMEA 1H73A 5A2QQ 4YHHE 2V2ZA 4JI8E 4B3RE 1I94E 1NHIA 1ZM9A 4JI2I 4DU8A 4DV3E 2B3TB 2F4VE 2L2MA 1VISA 2UXDE 1PKPA 4RPFA 1FNMA 1ZM4A 3ZKDA 1N34I 4B3TI 1NZ0A 4WUCA 3WU5A 1ELOA 4NXNE 1Z0WA 2UXCI 3HTXA 1HR0I 4LF5E
chains in the Genus database with same CATH superfamily
2BBGA 2N3HA 4F9BB 1YUJA 3D4JA 2HJJA 2V85A 2X7IA 2ZBKB 1XNQI 2ENCA 2CGEA 4DV1E 2JY9A 2L3CA 4DV7E 1S4EA 3HJCA 4DR2I 2EORA 4BC7A 2DMYA 4P78A 1EI1A 2B7VA 3CWVA 2UUAI 4AM3A 4JYAE 4DR2E 1ZXMA 4DV7I 4DV1I 1J5EE 4LPFA 2MKDA 1XNQE 1WHNA 4BC9A 1BBOA 2Z5CB 2EJ4A 2HFUA 2EMCA 4URLA 4LCFA 1Z0CA 2E5LI 1WHQA 1UDSA 2IOPA 4JI0I 3U1KA 4HY1A 3KWRA 4MU3A 1X49A 3T1HE 1PIEA 5KL7A 2NABA 2WBUA 1Y4UA 1D6TA 2RPCA 1ZBTA 2O3ZA 4HACB 4DR5E 2EMZA 1DQ3A 2JWOA 4WUDA 4U3BA 2EPOA 2V88A 2JEBB 4NBQA 2Q8UA 4X66E 1T39A 2M4IA 4PRXA 5DNXA 4LFBE 4I3HA 4HEIA 2ENAA 2LTSA 3U1YA 3H1CA 2BM1A 4F2JC 3L7ZA 2L2NA 1SFEA 3AUZA 2YU8A 2UU9I 4TUIA 4OX9E 1R6MA 4LF6I 4UT4A 2EMKA 3WU4A 2ZM6I 2C39A 2F4VI 2EMWA 2LTRA 5A6BD 2J7KA 4DV0I 1KVKA 4FN5A 4X8WA 3ZZUA 2ODRD 3K17A 5FLXQ 3T1YE 1PVGA 2CZ9A 5IXMB 1BBGA 2YWQA 1XNRE 4JI1I 2JPAA 4YHHI 4JI5I 5LMUE 4DR4E 2LJHA 2JP9A 4USMA 2UUBI 2YRMA 2L2KB 5A6JA 5DRRA 4HACA 3H4LA 1N32E 5TSEA 2YTDA 4OO1C 3M7NG 4PRVA 3BF2A 2EOXA 4DR6I 2EQ3A 1N33I 4EMDA 2V8PA 1UN6B 5ADZA 4JI7I 4R8OA 4FW7A 4IFDF 3QT6A 4FWGA 2DEJA 1U2RA 2G7HA 4KWYA 4ZYHA 2EN8A 2WBSA 3HPSA 4BHCA 1E3PA 1H72C 2IOQA 4O24A 2UXBE 2JEAB 1DARA 4FW4A 1X48A 1Y4SA 3LNUA 4DV5E 2GQ0A 4HYMA 1ZBQA 3PS2A 1IBKE 2C37A 2BM0A 1NEIA 2M1SA 3BGHA 4DV6E 1IBLI 4K0KE 2JE6A 1XMOI 4NXMI 3ADGA 1X6EA 5AE3A 3EPJA 2JE6B 2EM2A 2ADRA 1KYQA 1HNXI 3Q6NA 4X64E 1N36I 4DR1I 3JAMC 2WZOA 2LRSA 4DPXA 4IZKA 3HXLA 1B63A 4DR4I 1JK2A 3F6HA 4LF4E 4GKKE 2RTXA 1BKNA 5LMUI 4WXDA 4LTYA 4X62E 2N8XA 5BR8I 4OO1F 2CVEA 3THNA 1FJGE 2Q2EB 4LCHA 1USVA 1UDQA 1USUA 4OZEA 1X6HA 2V34A 2PNMA 1O0WA 3DF6A 3J81C 1RHYA 2ZM6E 1TF6A 4IFDC 2BA0D 1VI7A 2UU9E 2GS8A 1AH5A 2VF3A 2L3JA 5KL2A 3M85G 1JK1A 1HK7A 3L7ZB 2PRTA 1QNTA 5KL5A 4X66I 4M30A 1OJ4A 2YU5A 4B3SI 2RSMA 1A6FA 4BA2A 3VYXA 2O1TA 3P3CA 4WSGA 2F1DA 1YSAC 3J80C 3J81Q 3T1HI 2E1RA 1X5WA 2EMGA 2NPFA 1KJKA 1Z0EA 4DPTA 2LBSB 3PYFA 4F54A 3HPZA 1SR9A 3KZZA 1GTKA 5DROA 3Q1QA 2EPLX 4LF9E 2WBTA 2EMFA 4JYAI 3H09A 1A1LA 2EL4A 2GHFA 2A25A 2EM4A 4LF8E 2I9IA 4F9CB 2I13A 4LFCE 1OYRA 2JT2A 2EOOA 3L00A 5KL3A 3GMEA 4AQYI 1N3GA 2K7IA 2NA2A 1RREA 2IERA 4Q35B 2CPNA 5K36C 4R2EA 4FW3A 4JI6E 2EOMA 1R6LA 2YT4A 1HR0E 2X36A 3UK3C 2JEAA 2EPAA 2BB8A 2ELZA 1XMOE 1IQOA 4K0KI 5A6AA 3P06A 4DV6I 4LFAE 4LU9A 1IBKI 1PJSA 2GO4A 2YPNA 2V83A 2MKNA 4M9VC 2VQEE 1OYSA 2HKEA 3GCMA 4DV5I 3M99B 1WJPA 5T6JA 2YTFA 5AE2A 4KHPE 4IZJD 2HFSA 5DNLA 4M1KA 3C4TA 1L4SA 4AIMA 1NCSA 4IZKB 2EPCA 2YTIA 3KZYA 2IHR1 2KONA 2HKJA 4DR7I 2VESA 3ZZ0A 3OMLA 3LTOA 4FWHA 4FW9A 2F8BA 2MDRA 2HK2A 3TQMA 4DV4E 4P7DA 5IWAE 1G2DC 4UTGA 4YY3I 2NN6E 2EOFA 2JVAA 2LUQA 2M7QA 2Z5BB 2VQFI 2EMAA 2JXPA 2BA1G 2EPMX 4JI1E 4JI5E 3Q6MA 4LOMA 1FWLA 4OO1A 2M9AA 4DU7A 4MLQA 2BR2B 4IFDB 2LUPB 2DMIA 2ODRC 2WNRA 4LF7I 2PNLA 3JU0A 5F3WA 2NN6C 2EPZA 2H36X 4B3MI 2HK3A 1PJTA 1KKHA 3EPHA 2NUEA 1Z5AA 4PU9A 3ZM7A 1UDNA 2NN6A 1KTVA 4FWDA 4LFBI 1HNZI 5AASA 1GQEA 1MG7A 2KHXA 3C6MA 1XXEA 1YH8A 4HXZA 4IZJB 4DR5I 1X6FA 2AJ4A 2JR1A 5LL6R 4BCAA 1IBMI 3ADIA 4KZSA 3VK6A 4ZYGA 4HTGA 2CG9A 5K36E 1RC7A 1OYPA 3WU6A 2V2VA 4LF7E 3B78A 5A6BA 2YTPA 3ZOQB 2E5LE 2FTXB 1Y60A 4J8ZA 1WUUA 2EOIA 4FW6A 4DR3E 3JAMQ 2EPPA 3ECRA 1ZAAC 3JTZA 1ZR9A 3K85A 1G2FC 4ED4A 2WNRB 1B62A 1Z0GA 3K6QA 1NHJA 2E72A 3V2UC 2EMLA 1YUIA 5LMNE 2DRPA 3EPLA 3DJWA 5AC5A 5IWAI 2CT1A 2WP8A 3B82A 5EL9A 4DV4I 2NN6F 3EPKA 5JEAD 2AE8A 2YTGA 4XTJA 2YSPA 5A6KA 2O1WA 4LCGA 4BBYA 4DXLA 2VRDA 1YHCA 1A1GA 2V2QA 3M7ND 3IWBA 2WCC3 4L8NA 3QG5C 2UXCE 1Z0BA 3QT5A 5K36F 2E1MA 2NUFA 4WYQB 4ZYEA 2BV3A 4KHPI 2EOHA 2O1UA 2R76A 4NHRA 4BA1B 2VQEI 1LLMC 4B3TE 1RR9A 4Z7YA 1ZM2A 2CTDA 2DB2A 5A2QC 1AAYA 3J80Q 3V5RA 2EL5A 3ADLA 4DV2I 4R2CA 4JG4A 4WUBA 2C38A 2UXDI 4O43A 4BA2B 4JI3E 1YYKA 1Z0VA 2EM9A 1Z0TA 4F6MA 1H7SA 4MU4A 4RHBB 1DGCA 4JI8I 4B3RI 4WSPA 4MQYA 3VYYA 4LFCI 1HNZE 2YRHA 5A69A 4M2ZA 4IFDE 4DUZE 2EM0A 2RS7A 4JV5E 4MDTA 2XEXA 3CDIA 4LF9I 2JYAA 2LCEA 4O5GA 4BA1A 4P52A 1Y5YA 1N0UA 4IS9A 2ENHA 2EOJA 3MSWA 4Z7CA 3P1XA 1J26A 2BA0G 2EQ1A 3VHTB 5CFFE 2HHHE 1DI2A 3PRYA 2LJUA 2EMHA 1EKZA 2LO3A 5C0XC 5IV8B 2MC6A 3UHMA 5K36B 1T38A 1IBME 2NUGA 1H74A 2EPNA 4GEQB 1P42A 3GONA 3HULA 1F2IG 2ZITA 4DPYA 2DIXA 2EPUA 3OTOE 1XMQE 3P3GA 2C38B 2L6MA 1HNWI 3B8HA 1YYOA 2DLQA 1YZ9A 1X47A 2EN4A 3NZKA 4KQVA 5AC4A 1Z5CA 4WX9A 5JEAC 4NZVA 2LT7A 4BS9A 2PO1B 4GKJI 4JI4I 2EN2A 2PO2A 4N3OA 1FJGI 2YTNA 2JOBA 1A1FA 2GO3A 2R42A 5JEAE 4X62I 3CDJA 4OO1E 4LF4I 4GKKI 3M6AA 2EOZA 1ZM3A 1XHKA 3LMLA 4JI4E 2JOXA 4YY3E 4DR1E 1B69A 4RH8A 1T4OA 2LMZA 2HGHA 3PYEA 3J7Yp 4WFTA 1EA6A 2R3VA 1HNWE 1IBLE 4NXME 2NN6B 5C0XF 5FWKA 5DRPA 3OTOI 4DR7E 1XMQI 1E3HA 1MX0A 2J65A 2V86A 2EPXA 3PS1A 5DRQA 2RS6A 1Y6ZA 2EM6A 3IWDA 3QT7A 2DLKA 2WW4A 2C39B 3PYDA 5K36A 3K1JA 1ZU1A 4X9JA 3F6GA 5EKWA 1K47A 3ZZTA 1UEKA 3ADJA 2IESA 2PO0A 2EN1A 2PO2B 3HKMA 2HHHI 1UHZA 3C4BA 2NN6D 5JEAF 3PYGA 2EMYA 4LFAI 4GZNC 1EH8A 1MU5A 2EPKX 2YTQA 1A1HA 1RQ0A 2UUCI 4IZJA 2EMXA 1ZXNA 2J7JA 4JV5I 2EN6A 5AE1A 1UDOA 4DMIA 4L5NC 4JI6I 2EP3A 4DUYI 4ZYDA 3PS3A 2B7TA 2L33A 4FW5A 5FLXC 1A1KA 1FI4A 4X65I 2MC5A 2K4VA 4AQYE 4R2QA 4MU1A 4X65E 1YFHA 4LF8I 1XNRI 2FV4B 4R2AA 3T1YI 2EMIA 4DKKA 4DUYE 1UILA 1YPNA 4JI3I 4DV0E 2GLIA 4P7AA 1PDAA 1BB8A 2PNZB 2UUCE 2A2CA 3EQ1A 4LF6E 2PO0B 3HQ1A 5LLQA 4OX9I 4DV2E 2EOSA 1FKAE 2LE2A 4IFDD 1T4LB 2YTJA 2RSIA 2N3GA 4GQUA 3WU3A 1EH7A 3F0NA 2YSOA 2EM5A 3LLHA 5KL6A 3BIDA 2FGGA 1A1JA 4MYUA 1N0VC 5C0XD 3M85D 1Z59A 4OKGA 2PO1A 2EMBA 4B3SE 2DEIA 4WPYA 2EM3A 2EWLA 3ZKBA 3J7AM 4JI0E 4R2SA 1MGTA 5DNYA 4QNJA 2VE7C 2EPRA 1X3CA 1NHHA 2YZTA 4FK5C 1Z5BA 2O1VA 5JEAB 3DD6A 1KIJA 4OO1D 1GZ6A 4R2DA 1J5EI 4AIDA 3MHSC 3THOB 2L92A 4MYTA 5LMNI 2UUAE 1WXRA 1YYWA 5BR8E 1WRJA 2VF1A 2YRKA 2Z5BA 1MEYC 1S16A 2EQ0A 2LJPA 2V87A 4DR3I 1QZRA 2L8TA 2LV2A 1PJQA 2V89A 4WXCA 4GKJE 2Z5EA 3LPSA 3J7AG 1N36E 2LVHA 2EZ6A 3P3EA 5L3JA 1HNXE 4DPWA 4X64I 4LF5I 2MDGA 2KOUA 4NXNI 3IWCA 2BA1D 1FWKA 1STUA 1P47A 2WP8B 2C37B 1QU6A 2R1FA 4MLVA 5C0XA 1H7UA 4TUGA 5ELWA 5C0XB 5GMDA 2DSYA 1IQSA 4F9AB 4OOGC 1TN9A 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 2EE8A 4N4RB 3P76A 4B3ME 4IJDA 3KRNA 1T4NA 2EM8A 3C6KA 2OI2A 2A2DA 4JI7E 4U3DA 4DV3I 1N33E 2EM7A 1A1IA 4BHBA 4JI2E 4DR6E 5IT9Q 5JEAA 3GLLA 4USKA 2JEBA 4DPUA 1I94I 3QT8A 4I8OA 1N32I 3BBGA 3B4TA 2VQFE 4R2PA 2UUBE 2PNZA 4DUZI 2EOYA 3AV0A 5GMEA 1RMDA 2B9DA 4BMJA 1Z1BA 1H73A 1UBDC 5A2QQ 2DGCA 4QNKA 4YHHE 2V2ZA 4JI8E 4B3RE 4M0VA 2V8QB 1I94E 2YTEA 1NHIA 1ZM9A 2D9HA 5KL4A 4ISAA 4JI2I 4OO1B 4DU8A 4DV3E 2EOEA 2BR2A 2B3TB 4IFDA 2F4VE 2L2MA 3MHHC 1VISA 4R03A 2UXDE 5C0XE 4O4KA 1PKPA 4RPFA 1IMUA 1FNMA 2EN7A 1ZM4A 5K36D 3ZKDA 2Z5CA 4J3DA 1N34I 4B3TI 4R2RA 3FIGA 2GPIA 2EL6A 1EH6A 1NZ0A 4Q28A 4WUCA 2EOQA 4F6NA 2CSHA 2EN3A 2RQLA 2ELYA 1TF3A 1ELOA 2YTOA 4NXNE 1Z0WA 4MU0A 4ZVIA 3WU5A 3HTXA 2UXCI 1HR0I 2HC5A 4LF5E 3RMPA 4IS1C
chains in the Genus database with same CATH topology
2N3HA 4F9BB 3D4JA 2V85A 2X7IA 2ZBKB 1XNQI 2CGEA 3HJCA 4DV1E 2JY9A 2L3CA 4DV7E 1S4EA 4DR2I 4BC7A 1EI1A 2DMYA 4P78A 3CWVA 2B7VA 2UUAI 4JYAE 4DR2E 1ZXMA 4DV7I 4DV1I 1J5EE 1XNQE 1WHNA 4BC9A 2Z5CB 4URLA 2HFUA 1Z0CA 2E5LI 1WHQA 2IOPA 4JI0I 4HY1A 3KWRA 1X49A 3T1HE 1PIEA 1Y4UA 1D6TA 1ZBTA 4HACB 4DR5E 4ZVIA 1DQ3A 2JWOA 4WUDA 2V88A 4X66E 4PRXA 4I3HA 2M4IA 4LFBE 2LTSA 2BM1A 2L2NA 3AUZA 2UU9I 4TUIA 4OX9E 4LF6I 4UT4A 3WU4A 2ZM6I 2F4VI 2LTRA 2J7KA 4DV0I 1KVKA 4FN5A 4X8WA 3ZZUA 2ODRD 3K17A 5FLXQ 3T1YE 1PVGA 2CZ9A 4JI1I 1XNRE 4JI5I 4YHHI 5LMUE 4DR4E 2LJHA 4USMA 2UUBI 2L2KB 4HACA 3H4LA 1N32E 4PRVA 4DR6I 1N33I 4EMDA 2V8PA 5ADZA 4JI7I 4R8OA 3QT6A 4FWGA 2DEJA 1U2RA 2G7HA 2IOQA 1H72C 3HPSA 2UXBE 1DARA 1X48A 1Y4SA 3LNUA 4DV5E 2GQ0A 4HYMA 1ZBQA 1IBKE 2BM0A 2M1SA 4DV6E 1IBLI 4NXMI 4K0KE 1XMOI 3ADGA 5AE3A 1HNXI 3Q6NA 4X64E 1N36I 4DR1I 3JAMC 2WZOA 2LRSA 4DPXA 4IZKA 3HXLA 1B63A 4DR4I 3F6HA 4LF4E 4GKKE 2RTXA 1BKNA 5LMUI 4LTYA 4X62E 5BR8I 1FJGE 2Q2EB 1USVA 1USUA 2V34A 2PNMA 1O0WA 3DF6A 3J81C 2ZM6E 2UU9E 2GS8A 2VF3A 2L3JA 1HK7A 4X66I 4M30A 1OJ4A 4B3SI 2RSMA 1A6FA 3VYXA 2O1TA 3J81Q 3J80C 3T1HI 2E1RA 2NPFA 1Z0EA 4DPTA 2LBSB 3PYFA 4F54A 3HPZA 1SR9A 3Q1QA 4LF9E 4JYAI 3H09A 4LF8E 1HNZI 4F9CB 4LFCE 4AQYI 2NA2A 1RREA 2CPNA 4JI6E 2YT4A 1HR0E 2X36A 1XMOE 4K0KI 3P06A 4DV6I 4LFAE 4LU9A 1IBKI 2V83A 4DV5I 2VQEE 2HKEA 5AE2A 5T6JA 4KHPE 4IZJD 2HFSA 4M1KA 3C4TA 4IZKB 2IHR1 2KONA 2HKJA 4DR7I 3ZZ0A 3OMLA 3LTOA 4FWHA 4FW9A 2F8BA 2MDRA 2HK2A 4DV4E 4P7DA 5IWAE 4UTGA 4YY3I 2JVAA 2LUQA 2M7QA 2Z5BB 2VQFI 4JI1E 4JI5E 3Q6MA 1FWLA 4DU7A 2LUPB 2ODRC 4LF7I 2PNLA 3JU0A 5F3WA 2H36X 4B3MI 2HK3A 1KKHA 2NUEA 1Z5AA 4PU9A 3ZM7A 4FWDA 1KTVA 4LFBI 5AASA 1GQEA 1MG7A 2KHXA 4HXZA 4DR5I 4IZJB 1IBMI 2AJ4A 2JR1A 5LL6R 4BCAA 3ADIA 4KZSA 3VK6A 2CG9A 1RC7A 3WU6A 2V2VA 4LF7E 3B78A 3ZOQB 2E5LE 2FTXB 4J8ZA 1WUUA 4DR3E 3JAMQ 3JTZA 3K85A 4ED4A 1B62A 1Z0GA 3K6QA 1NHJA 3V2UC 5LMNE 3DJWA 5IWAI 4DV4I 3B82A 4XTJA 2O1WA 4BBYA 4DXLA 2V2QA 2UXCE 3IWBA 4L8NA 1Z0BA 3QT5A 2E1MA 2NUFA 4WYQB 2BV3A 4KHPI 2O1UA 2VQEI 1RR9A 4B3TE 4Z7YA 1ZM2A 2DB2A 5A2QC 3J80Q 3V5RA 3ADLA 4DV2I 4JG4A 4WUBA 2UXDI 4JI3E 1YYKA 1Z0VA 1Z0TA 1H7SA 4JI8I 4B3RI 4WSPA 3VYYA 4LFCI 1HNZE 4M2ZA 4DUZE 2RS7A 4JV5E 2XEXA 4LF9I 4P52A 1N0UA 3MSWA 4Z7CA 3P1XA 1J26A 1DI2A 5CFFE 3PRYA 2HHHE 1EKZA 2MC6A 1IBME 2NUGA 1H74A 4GEQB 3GONA 3HULA 2ZITA 4DPYA 2DIXA 3OTOE 1XMQE 2L6MA 1HNWI 3B8HA 1YYOA 1YZ9A 1X47A 4KQVA 1Z5CA 4BS9A 4GKJI 4JI4I 4N3OA 1FJGI 2JOBA 2R42A 4X62I 4LF4I 4GKKI 3M6AA 1ZM3A 1XHKA 3LMLA 4JI4E 2JOXA 4YY3E 4DR1E 1T4OA 2LMZA 3PYEA 3J7Yp 4WFTA 1EA6A 2R3VA 1HNWE 1IBLE 4NXME 5FWKA 3OTOI 4DR7E 1XMQI 1MX0A 2V86A 1Y6ZA 2RS6A 3QT7A 3IWDA 2WW4A 3PYDA 3K1JA 3F6GA 1K47A 3ZZTA 1UEKA 3ADJA 2HHHI 1UHZA 3C4BA 3PYGA 4LFAI 1MU5A 1RQ0A 2UUCI 4IZJA 1ZXNA 4JV5I 4JI6I 5AE1A 4DMIA 4L5NC 4DUYI 2B7TA 2L33A 5FLXC 1FI4A 4X65I 2MC5A 2K4VA 4AQYE 4X65E 4LF8I 1XNRI 2FV4B 3T1YI 4DKKA 4DUYE 1UILA 4JI3I 4DV0E 4P7AA 2UUCE 2A2CA 4LF6E 3HQ1A 4OX9I 4DV2E 1FKAE 2LE2A 1T4LB 2N3GA 3WU3A 3F0NA 3LLHA 2FGGA 4MYUA 1N0VC 1Z59A 4B3SE 2DEIA 4WPYA 2EWLA 3ZKBA 3J7AM 4JI0E 5DNYA 2VE7C 2O1VA 1NHHA 2YZTA 1Z5BA 1KIJA 1GZ6A 1J5EI 2L92A 4MYTA 5LMNI 2UUAE 1WXRA 1YYWA 5BR8E 2VF1A 2Z5BA 1S16A 2LJPA 2V87A 4DR3I 1QZRA 2L8TA 2V89A 4GKJE 2Z5EA 3LPSA 3J7AG 1N36E 5L3JA 2EZ6A 4X64I 4LF5I 1HNXE 4DPWA 2KOUA 4NXNI 3IWCA 1FWKA 1STUA 1QU6A 1H7UA 4TUGA 5GMDA 2DSYA 4F9AB 4OOGC 1N34E 2UXBI 5IT9C 2EFGA 4R1FA 4B3ME 1T4NA 2OI2A 2A2DA 4JI7E 4DV3I 1N33E 4JI2E 4DR6E 5IT9Q 4USKA 1I94I 4DPUA 3QT8A 4I8OA 1N32I 2VQFE 2UUBE 4DUZI 3AV0A 5GMEA 2B9DA 4BMJA 1H73A 5A2QQ 4YHHE 2V2ZA 4JI8E 4B3RE 4M0VA 2V8QB 1I94E 1NHIA 1ZM9A 4JI2I 4DU8A 4DV3E 2B3TB 2F4VE 2L2MA 1VISA 4R03A 2UXDE 1PKPA 4RPFA 1FNMA 1ZM4A 3ZKDA 2Z5CA 1N34I 4B3TI 3FIGA 1NZ0A 4Q28A 4WUCA 3WU5A 1ELOA 4NXNE 1Z0WA 2UXCI 3HTXA 1HR0I 4LF5E 3RMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  3D4J A;  1XNQ I;  2X7I A;  2ZBK B;  4DV1 E;  2JY9 A;  2L3C A;  4DV7 E;  1S4E A;  4DR2 I;  1EI1 A;  2DMY A;  2UUA I;  3CWV A;  2B7V A;  4JYA E;  4DR2 E;  1ZXM A;  4DV7 I;  4DV1 I;  1J5E E;  1XNQ E;  1WHN A;  4URL A;  2HFU A;  1Z0C A;  2E5L I;  1WHQ A;  4JI0 I;  4HY1 A;  1X49 A;  3T1H E;  1PIE A;  1D6T A;  1ZBT A;  4HAC B;  4DR5 E;  4ZVI A;  4WUD A;  4X66 E;  4PRX A;  4I3H A;  4LFB E;  2LTS A;  2BM1 A;  2L2N A;  2UU9 I;  4OX9 E;  4LF6 I;  4UT4 A;  3WU4 A;  2ZM6 I;  2F4V I;  2LTR A;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  4X8W A;  3ZZU A;  3K17 A;  5FLX Q;  3T1Y E;  1PVG A;  2CZ9 A;  4JI1 I;  1XNR E;  4JI5 I;  4YHH I;  5LMU E;  4DR4 E;  2LJH A;  4USM A;  2UUB I;  2L2K B;  4HAC A;  3H4L A;  1N32 E;  4PRV A;  4DR6 I;  1N33 I;  4EMD A;  2V8P A;  4JI7 I;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  1H72 C;  2UXB E;  1DAR A;  1X48 A;  3LNU A;  4DV5 E;  4HYM A;  1IBK E;  2BM0 A;  4DV6 E;  1IBL I;  4NXM I;  4K0K E;  1XMO I;  3ADG A;  1HNX I;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  2LRS A;  4DPX A;  1B63 A;  4DR4 I;  4LF4 E;  4GKK E;  2RTX A;  1BKN A;  5LMU I;  4X62 E;  5BR8 I;  1FJG E;  2Q2E B;  2V34 A;  1O0W A;  3J81 C;  2ZM6 E;  2UU9 E;  2GS8 A;  2VF3 A;  2L3J A;  4X66 I;  4M30 A;  1OJ4 A;  4B3S I;  2RSM A;  1A6F A;  3VYX A;  3J81 Q;  3J80 C;  3T1H I;  2E1R A;  2NPF A;  1Z0E A;  4DPT A;  2LBS B;  3PYF A;  3Q1Q A;  4LF9 E;  4JYA I;  4LF8 E;  1HNZ I;  4LFC E;  4AQY I;  2NA2 A;  1RRE A;  2CPN A;  4JI6 E;  2YT4 A;  1HR0 E;  2X36 A;  1XMO E;  4K0K I;  4DV6 I;  4LFA E;  1IBK I;  4DV5 I;  2VQE E;  2HKE A;  4KHP E;  2HFS A;  4M1K A;  3C4T A;  2IHR 1;  2HKJ A;  4DR7 I;  3ZZ0 A;  3LTO A;  4FWH A;  4FW9 A;  2MDR A;  2HK2 A;  4DV4 E;  5IWA E;  4UTG A;  4YY3 I;  2JVA A;  2LUQ A;  2VQF I;  4JI1 E;  4JI5 E;  1FWL A;  4DU7 A;  2LUP B;  4LF7 I;  4B3M I;  2HK3 A;  1KKH A;  2NUE A;  1Z5A A;  4PU9 A;  3ZM7 A;  4FWD A;  1KTV A;  4LFB I;  1GQE A;  1MG7 A;  2KHX A;  4HXZ A;  4DR5 I;  1IBM I;  2AJ4 A;  5LL6 R;  3ADI A;  1RC7 A;  3WU6 A;  2V2V A;  4LF7 E;  3B78 A;  2E5L E;  1WUU A;  4DR3 E;  3JAM Q;  4ED4 A;  1B62 A;  1Z0G A;  1NHJ A;  3V2U C;  5LMN E;  5IWA I;  4DV4 I;  3B82 A;  4XTJ A;  4DXL A;  2V2Q A;  2UXC E;  1Z0B A;  3QT5 A;  2NUF A;  4WYQ B;  2BV3 A;  4KHP I;  2VQE I;  1RR9 A;  4B3T E;  4Z7Y A;  1ZM2 A;  2DB2 A;  5A2Q C;  3J80 Q;  3V5R A;  3ADL A;  4DV2 I;  4JG4 A;  4WUB A;  2UXD I;  4JI3 E;  1YYK A;  1Z0V A;  1Z0T A;  1H7S A;  4JI8 I;  4B3R I;  3VYY A;  4LFC I;  1HNZ E;  4M2Z A;  4DUZ E;  2RS7 A;  4JV5 E;  2XEX A;  4LF9 I;  4P52 A;  1N0U A;  4Z7C A;  3P1X A;  1J26 A;  1DI2 A;  5CFF E;  2HHH E;  1EKZ A;  1IBM E;  2NUG A;  1H74 A;  3GON A;  3HUL A;  2ZIT A;  4DPY A;  2DIX A;  3OTO E;  1XMQ E;  1HNW I;  3B8H A;  1YYO A;  1YZ9 A;  1X47 A;  4KQV A;  1Z5C A;  4GKJ I;  4JI4 I;  1FJG I;  2R42 A;  4X62 I;  4LF4 I;  4GKK I;  3M6A A;  1ZM3 A;  1XHK A;  4JI4 E;  4YY3 E;  4DR1 E;  1T4O A;  3PYE A;  3J7Y p;  4WFT A;  1EA6 A;  2R3V A;  1HNW E;  1IBL E;  4NXM E;  3OTO I;  4DR7 E;  1XMQ I;  1MX0 A;  2RS6 A;  3QT7 A;  2WW4 A;  3PYD A;  3K1J A;  1K47 A;  3ZZT A;  1UEK A;  3ADJ A;  2HHH I;  1UHZ A;  3C4B A;  3PYG A;  4LFA I;  1MU5 A;  1RQ0 A;  2UUC I;  1ZXN A;  4JV5 I;  4JI6 I;  4DUY I;  2B7T A;  2L33 A;  5FLX C;  1FI4 A;  4X65 I;  4AQY E;  4X65 E;  4LF8 I;  1XNR I;  3T1Y I;  4DKK A;  4DUY E;  1UIL A;  4JI3 I;  4DV0 E;  4P7A A;  2UUC E;  2A2C A;  4LF6 E;  4OX9 I;  4DV2 E;  1FKA E;  1T4L B;  2N3G A;  3WU3 A;  3F0N A;  3LLH A;  4MYU A;  1N0V C;  1Z59 A;  4B3S E;  2DEI A;  3ZKB A;  3J7A M;  4JI0 E;  1NHH A;  1Z5B A;  1KIJ A;  1J5E I;  4MYT A;  5LMN I;  2UUA E;  1YYW A;  5BR8 E;  1S16 A;  2LJP A;  4DR3 I;  1QZR A;  4GKJ E;  3LPS A;  5L3J A;  1N36 E;  3J7A G;  2EZ6 A;  4X64 I;  4LF5 I;  1HNX E;  4DPW A;  4NXN I;  1FWK A;  1STU A;  1QU6 A;  1H7U A;  5GMD A;  4OOG C;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  4B3M E;  1T4N A;  2OI2 A;  2A2D A;  4JI7 E;  4DV3 I;  1N33 E;  4JI2 E;  4DR6 E;  5IT9 Q;  4USK A;  1I94 I;  4DPU A;  3QT8 A;  1N32 I;  2VQF E;  2UUB E;  4DUZ I;  5GME A;  1H73 A;  5A2Q Q;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  1I94 E;  1NHI A;  1ZM9 A;  4JI2 I;  4DU8 A;  4DV3 E;  2B3T B;  2F4V E;  2L2M A;  1VIS A;  2UXD E;  1PKP A;  4RPF A;  1FNM A;  1ZM4 A;  3ZKD A;  1N34 I;  4B3T I;  1NZ0 A;  4WUC A;  3WU5 A;  1ELO A;  4NXN E;  1Z0W A;  2UXC I;  3HTX A;  1HR0 I;  4LF5 E; 
#chains in the Genus database with same CATH topology
 2BBG A;  2N3H A;  4F9B B;  1YUJ A;  3D4J A;  2HJJ A;  2V85 A;  2X7I A;  2ZBK B;  1XNQ I;  2ENC A;  2CGE A;  4DV1 E;  2JY9 A;  2L3C A;  4DV7 E;  1S4E A;  3HJC A;  4DR2 I;  2EOR A;  4BC7 A;  2DMY A;  4P78 A;  1EI1 A;  2B7V A;  3CWV A;  2UUA I;  4AM3 A;  4JYA E;  4DR2 E;  1ZXM A;  4DV7 I;  4DV1 I;  1J5E E;  4LPF A;  2MKD A;  1XNQ E;  1WHN A;  4BC9 A;  1BBO A;  2Z5C B;  2EJ4 A;  2HFU A;  2EMC A;  4URL A;  4LCF A;  1Z0C A;  2E5L I;  1WHQ A;  1UDS A;  2IOP A;  4JI0 I;  3U1K A;  4HY1 A;  3KWR A;  4MU3 A;  1X49 A;  3T1H E;  1PIE A;  5KL7 A;  2NAB A;  2WBU A;  1Y4U A;  1D6T A;  2RPC A;  1ZBT A;  2O3Z A;  4HAC B;  4DR5 E;  2EMZ A;  1DQ3 A;  2JWO A;  4WUD A;  4U3B A;  2EPO A;  2V88 A;  2JEB B;  4NBQ A;  2Q8U A;  4X66 E;  1T39 A;  2M4I A;  4PRX A;  5DNX A;  4LFB E;  4I3H A;  4HEI A;  2ENA A;  2LTS A;  3U1Y A;  3H1C A;  2BM1 A;  4F2J C;  3L7Z A;  2L2N A;  1SFE A;  3AUZ A;  2YU8 A;  2UU9 I;  4TUI A;  4OX9 E;  1R6M A;  4LF6 I;  4UT4 A;  2EMK A;  3WU4 A;  2ZM6 I;  2C39 A;  2F4V I;  2EMW A;  2LTR A;  5A6B D;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  4X8W A;  3ZZU A;  2ODR D;  3K17 A;  5FLX Q;  3T1Y E;  1PVG A;  2CZ9 A;  5IXM B;  1BBG A;  2YWQ A;  1XNR E;  4JI1 I;  2JPA A;  4YHH I;  4JI5 I;  5LMU E;  4DR4 E;  2LJH A;  2JP9 A;  4USM A;  2UUB I;  2YRM A;  2L2K B;  5A6J A;  5DRR A;  4HAC A;  3H4L A;  1N32 E;  5TSE A;  2YTD A;  4OO1 C;  3M7N G;  4PRV A;  3BF2 A;  2EOX A;  4DR6 I;  2EQ3 A;  1N33 I;  4EMD A;  2V8P A;  1UN6 B;  5ADZ A;  4JI7 I;  4R8O A;  4FW7 A;  4IFD F;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  2G7H A;  4KWY A;  4ZYH A;  2EN8 A;  2WBS A;  3HPS A;  4BHC A;  1E3P A;  1H72 C;  2IOQ A;  4O24 A;  2UXB E;  2JEA B;  1DAR A;  4FW4 A;  1X48 A;  1Y4S A;  3LNU A;  4DV5 E;  2GQ0 A;  4HYM A;  1ZBQ A;  3PS2 A;  1IBK E;  2C37 A;  2BM0 A;  1NEI A;  2M1S A;  3BGH A;  4DV6 E;  1IBL I;  4K0K E;  2JE6 A;  1XMO I;  4NXM I;  3ADG A;  1X6E A;  5AE3 A;  3EPJ A;  2JE6 B;  2EM2 A;  2ADR A;  1KYQ A;  1HNX I;  3Q6N A;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  2WZO A;  2LRS A;  4DPX A;  4IZK A;  3HXL A;  1B63 A;  4DR4 I;  1JK2 A;  3F6H A;  4LF4 E;  4GKK E;  2RTX A;  1BKN A;  5LMU I;  4WXD A;  4LTY A;  4X62 E;  2N8X A;  5BR8 I;  4OO1 F;  2CVE A;  3THN A;  1FJG E;  2Q2E B;  4LCH A;  1USV A;  1UDQ A;  1USU A;  4OZE A;  1X6H A;  2V34 A;  2PNM A;  1O0W A;  3DF6 A;  3J81 C;  1RHY A;  2ZM6 E;  1TF6 A;  4IFD C;  2BA0 D;  1VI7 A;  2UU9 E;  2GS8 A;  1AH5 A;  2VF3 A;  2L3J A;  5KL2 A;  3M85 G;  1JK1 A;  1HK7 A;  3L7Z B;  2PRT A;  1QNT A;  5KL5 A;  4X66 I;  4M30 A;  1OJ4 A;  2YU5 A;  4B3S I;  2RSM A;  1A6F A;  4BA2 A;  3VYX A;  2O1T A;  3P3C A;  4WSG A;  2F1D A;  1YSA C;  3J80 C;  3J81 Q;  3T1H I;  2E1R A;  1X5W A;  2EMG A;  2NPF A;  1KJK A;  1Z0E A;  4DPT A;  2LBS B;  3PYF A;  4F54 A;  3HPZ A;  1SR9 A;  3KZZ A;  1GTK A;  5DRO A;  3Q1Q A;  2EPL X;  4LF9 E;  2WBT A;  2EMF A;  4JYA I;  3H09 A;  1A1L A;  2EL4 A;  2GHF A;  2A25 A;  2EM4 A;  4LF8 E;  2I9I A;  4F9C B;  2I13 A;  4LFC E;  1OYR A;  2JT2 A;  2EOO A;  3L00 A;  5KL3 A;  3GME A;  4AQY I;  1N3G A;  2K7I A;  2NA2 A;  1RRE A;  2IER A;  4Q35 B;  2CPN A;  5K36 C;  4R2E A;  4FW3 A;  4JI6 E;  2EOM A;  1R6L A;  2YT4 A;  1HR0 E;  2X36 A;  3UK3 C;  2JEA A;  2EPA A;  2BB8 A;  2ELZ A;  1XMO E;  1IQO A;  4K0K I;  5A6A A;  3P06 A;  4DV6 I;  4LFA E;  4LU9 A;  1IBK I;  1PJS A;  2GO4 A;  2YPN A;  2V83 A;  2MKN A;  4M9V C;  2VQE E;  1OYS A;  2HKE A;  3GCM A;  4DV5 I;  3M99 B;  1WJP A;  5T6J A;  2YTF A;  5AE2 A;  4KHP E;  4IZJ D;  2HFS A;  5DNL A;  4M1K A;  3C4T A;  1L4S A;  4AIM A;  1NCS A;  4IZK B;  2EPC A;  2YTI A;  3KZY A;  2IHR 1;  2KON A;  2HKJ A;  4DR7 I;  2VES A;  3ZZ0 A;  3OML A;  3LTO A;  4FWH A;  4FW9 A;  2F8B A;  2MDR A;  2HK2 A;  3TQM A;  4DV4 E;  4P7D A;  5IWA E;  1G2D C;  4UTG A;  4YY3 I;  2NN6 E;  2EOF A;  2JVA A;  2LUQ A;  2M7Q A;  2Z5B B;  2VQF I;  2EMA A;  2JXP A;  2BA1 G;  2EPM X;  4JI1 E;  4JI5 E;  3Q6M A;  4LOM A;  1FWL A;  4OO1 A;  2M9A A;  4DU7 A;  4MLQ A;  2BR2 B;  4IFD B;  2LUP B;  2DMI A;  2ODR C;  2WNR A;  4LF7 I;  2PNL A;  3JU0 A;  5F3W A;  2NN6 C;  2EPZ A;  2H36 X;  4B3M I;  2HK3 A;  1PJT A;  1KKH A;  3EPH A;  2NUE A;  1Z5A A;  4PU9 A;  3ZM7 A;  1UDN A;  2NN6 A;  1KTV A;  4FWD A;  4LFB I;  1HNZ I;  5AAS A;  1GQE A;  1MG7 A;  2KHX A;  3C6M A;  1XXE A;  1YH8 A;  4HXZ A;  4IZJ B;  4DR5 I;  1X6F A;  2AJ4 A;  2JR1 A;  5LL6 R;  4BCA A;  1IBM I;  3ADI A;  4KZS A;  3VK6 A;  4ZYG A;  4HTG A;  2CG9 A;  5K36 E;  1RC7 A;  1OYP A;  3WU6 A;  2V2V A;  4LF7 E;  3B78 A;  5A6B A;  2YTP A;  3ZOQ B;  2E5L E;  2FTX B;  1Y60 A;  4J8Z A;  1WUU A;  2EOI A;  4FW6 A;  4DR3 E;  3JAM Q;  2EPP A;  3ECR A;  1ZAA C;  3JTZ A;  1ZR9 A;  3K85 A;  1G2F C;  4ED4 A;  2WNR B;  1B62 A;  1Z0G A;  3K6Q A;  1NHJ A;  2E72 A;  3V2U C;  2EML A;  1YUI A;  5LMN E;  2DRP A;  3EPL A;  3DJW A;  5AC5 A;  5IWA I;  2CT1 A;  2WP8 A;  3B82 A;  5EL9 A;  4DV4 I;  2NN6 F;  3EPK A;  5JEA D;  2AE8 A;  2YTG A;  4XTJ A;  2YSP A;  5A6K A;  2O1W A;  4LCG A;  4BBY A;  4DXL A;  2VRD A;  1YHC A;  1A1G A;  2V2Q A;  3M7N D;  3IWB A;  2WCC 3;  4L8N A;  3QG5 C;  2UXC E;  1Z0B A;  3QT5 A;  5K36 F;  2E1M A;  2NUF A;  4WYQ B;  4ZYE A;  2BV3 A;  4KHP I;  2EOH A;  2O1U A;  2R76 A;  4NHR A;  4BA1 B;  2VQE I;  1LLM C;  4B3T E;  1RR9 A;  4Z7Y A;  1ZM2 A;  2CTD A;  2DB2 A;  5A2Q C;  1AAY A;  3J80 Q;  3V5R A;  2EL5 A;  3ADL A;  4DV2 I;  4R2C A;  4JG4 A;  4WUB A;  2C38 A;  2UXD I;  4O43 A;  4BA2 B;  4JI3 E;  1YYK A;  1Z0V A;  2EM9 A;  1Z0T A;  4F6M A;  1H7S A;  4MU4 A;  4RHB B;  1DGC A;  4JI8 I;  4B3R I;  4WSP A;  4MQY A;  3VYY A;  4LFC I;  1HNZ E;  2YRH A;  5A69 A;  4M2Z A;  4IFD E;  4DUZ E;  2EM0 A;  2RS7 A;  4JV5 E;  4MDT A;  2XEX A;  3CDI A;  4LF9 I;  2JYA A;  2LCE A;  4O5G A;  4BA1 A;  4P52 A;  1Y5Y A;  1N0U A;  4IS9 A;  2ENH A;  2EOJ A;  3MSW A;  4Z7C A;  3P1X A;  1J26 A;  2BA0 G;  2EQ1 A;  3VHT B;  5CFF E;  2HHH E;  1DI2 A;  3PRY A;  2LJU A;  2EMH A;  1EKZ A;  2LO3 A;  5C0X C;  5IV8 B;  2MC6 A;  3UHM A;  5K36 B;  1T38 A;  1IBM E;  2NUG A;  1H74 A;  2EPN A;  4GEQ B;  1P42 A;  3GON A;  3HUL A;  1F2I G;  2ZIT A;  4DPY A;  2DIX A;  2EPU A;  3OTO E;  1XMQ E;  3P3G A;  2C38 B;  2L6M A;  1HNW I;  3B8H A;  1YYO A;  2DLQ A;  1YZ9 A;  1X47 A;  2EN4 A;  3NZK A;  4KQV A;  5AC4 A;  1Z5C A;  4WX9 A;  5JEA C;  4NZV A;  2LT7 A;  4BS9 A;  2PO1 B;  4GKJ I;  4JI4 I;  2EN2 A;  2PO2 A;  4N3O A;  1FJG I;  2YTN A;  2JOB A;  1A1F A;  2GO3 A;  2R42 A;  5JEA E;  4X62 I;  3CDJ A;  4OO1 E;  4LF4 I;  4GKK I;  3M6A A;  2EOZ A;  1ZM3 A;  1XHK A;  3LML A;  4JI4 E;  2JOX A;  4YY3 E;  4DR1 E;  1B69 A;  4RH8 A;  1T4O A;  2LMZ A;  2HGH A;  3PYE A;  3J7Y p;  4WFT A;  1EA6 A;  2R3V A;  1HNW E;  1IBL E;  4NXM E;  2NN6 B;  5C0X F;  5FWK A;  5DRP A;  3OTO I;  4DR7 E;  1XMQ I;  1E3H A;  1MX0 A;  2J65 A;  2V86 A;  2EPX A;  3PS1 A;  5DRQ A;  2RS6 A;  1Y6Z A;  2EM6 A;  3IWD A;  3QT7 A;  2DLK A;  2WW4 A;  2C39 B;  3PYD A;  5K36 A;  3K1J A;  1ZU1 A;  4X9J A;  3F6G A;  5EKW A;  1K47 A;  3ZZT A;  1UEK A;  3ADJ A;  2IES A;  2PO0 A;  2EN1 A;  2PO2 B;  3HKM A;  2HHH I;  1UHZ A;  3C4B A;  2NN6 D;  5JEA F;  3PYG A;  2EMY A;  4LFA I;  4GZN C;  1EH8 A;  1MU5 A;  2EPK X;  2YTQ A;  1A1H A;  1RQ0 A;  2UUC I;  4IZJ A;  2EMX A;  1ZXN A;  2J7J A;  4JV5 I;  2EN6 A;  5AE1 A;  1UDO A;  4DMI A;  4L5N C;  4JI6 I;  2EP3 A;  4DUY I;  4ZYD A;  3PS3 A;  2B7T A;  2L33 A;  4FW5 A;  5FLX C;  1A1K A;  1FI4 A;  4X65 I;  2MC5 A;  2K4V A;  4AQY E;  4R2Q A;  4MU1 A;  4X65 E;  1YFH A;  4LF8 I;  1XNR I;  2FV4 B;  4R2A A;  3T1Y I;  2EMI A;  4DKK A;  4DUY E;  1UIL A;  1YPN A;  4JI3 I;  4DV0 E;  2GLI A;  4P7A A;  1PDA A;  1BB8 A;  2PNZ B;  2UUC E;  2A2C A;  3EQ1 A;  4LF6 E;  2PO0 B;  3HQ1 A;  5LLQ A;  4OX9 I;  4DV2 E;  2EOS A;  1FKA E;  2LE2 A;  4IFD D;  1T4L B;  2YTJ A;  2RSI A;  2N3G A;  4GQU A;  3WU3 A;  1EH7 A;  3F0N A;  2YSO A;  2EM5 A;  3LLH A;  5KL6 A;  3BID A;  2FGG A;  1A1J A;  4MYU A;  1N0V C;  5C0X D;  3M85 D;  1Z59 A;  4OKG A;  2PO1 A;  2EMB A;  4B3S E;  2DEI A;  4WPY A;  2EM3 A;  2EWL A;  3ZKB A;  3J7A M;  4JI0 E;  4R2S A;  1MGT A;  5DNY A;  4QNJ A;  2VE7 C;  2EPR A;  1X3C A;  1NHH A;  2YZT A;  4FK5 C;  1Z5B A;  2O1V A;  5JEA B;  3DD6 A;  1KIJ A;  4OO1 D;  1GZ6 A;  4R2D A;  1J5E I;  4AID A;  3MHS C;  3THO B;  2L92 A;  4MYT A;  5LMN I;  2UUA E;  1WXR A;  1YYW A;  5BR8 E;  1WRJ A;  2VF1 A;  2YRK A;  2Z5B A;  1MEY C;  1S16 A;  2EQ0 A;  2LJP A;  2V87 A;  4DR3 I;  1QZR A;  2L8T A;  2LV2 A;  1PJQ A;  2V89 A;  4WXC A;  4GKJ E;  2Z5E A;  3LPS A;  3J7A G;  1N36 E;  2LVH A;  2EZ6 A;  3P3E A;  5L3J A;  1HNX E;  4DPW A;  4X64 I;  4LF5 I;  2MDG A;  2KOU A;  4NXN I;  3IWC A;  2BA1 D;  1FWK A;  1STU A;  1P47 A;  2WP8 B;  2C37 B;  1QU6 A;  2R1F A;  4MLV A;  5C0X A;  1H7U A;  4TUG A;  5ELW A;  5C0X B;  5GMD A;  2DSY A;  1IQS A;  4F9A B;  4OOG C;  1TN9 A;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  2EE8 A;  4N4R B;  3P76 A;  4B3M E;  4IJD A;  3KRN A;  1T4N A;  2EM8 A;  3C6K A;  2OI2 A;  2A2D A;  4JI7 E;  4U3D A;  4DV3 I;  1N33 E;  2EM7 A;  1A1I A;  4BHB A;  4JI2 E;  4DR6 E;  5IT9 Q;  5JEA A;  3GLL A;  4USK A;  2JEB A;  4DPU A;  1I94 I;  3QT8 A;  4I8O A;  1N32 I;  3BBG A;  3B4T A;  2VQF E;  4R2P A;  2UUB E;  2PNZ A;  4DUZ I;  2EOY A;  3AV0 A;  5GME A;  1RMD A;  2B9D A;  4BMJ A;  1Z1B A;  1H73 A;  1UBD C;  5A2Q Q;  2DGC A;  4QNK A;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  4M0V A;  2V8Q B;  1I94 E;  2YTE A;  1NHI A;  1ZM9 A;  2D9H A;  5KL4 A;  4ISA A;  4JI2 I;  4OO1 B;  4DU8 A;  4DV3 E;  2EOE A;  2BR2 A;  2B3T B;  4IFD A;  2F4V E;  2L2M A;  3MHH C;  1VIS A;  4R03 A;  2UXD E;  5C0X E;  4O4K A;  1PKP A;  4RPF A;  1IMU A;  1FNM A;  2EN7 A;  1ZM4 A;  5K36 D;  3ZKD A;  2Z5C A;  4J3D A;  1N34 I;  4B3T I;  4R2R A;  3FIG A;  2GPI A;  2EL6 A;  1EH6 A;  1NZ0 A;  4Q28 A;  4WUC A;  2EOQ A;  4F6N A;  2CSH A;  2EN3 A;  2RQL A;  2ELY A;  1TF3 A;  1ELO A;  2YTO A;  4NXN E;  1Z0W A;  4MU0 A;  4ZVI A;  3WU5 A;  3HTX A;  2UXC I;  1HR0 I;  2HC5 A;  4LF5 E;  3RMP A;  4IS1 C; 
#chains in the Genus database with same CATH homology
 2N3H A;  4F9B B;  3D4J A;  2V85 A;  2X7I A;  2ZBK B;  1XNQ I;  2CGE A;  3HJC A;  4DV1 E;  2JY9 A;  2L3C A;  4DV7 E;  1S4E A;  4DR2 I;  4BC7 A;  1EI1 A;  2DMY A;  4P78 A;  3CWV A;  2B7V A;  2UUA I;  4JYA E;  4DR2 E;  1ZXM A;  4DV7 I;  4DV1 I;  1J5E E;  1XNQ E;  1WHN A;  4BC9 A;  2Z5C B;  4URL A;  2HFU A;  1Z0C A;  2E5L I;  1WHQ A;  2IOP A;  4JI0 I;  4HY1 A;  3KWR A;  1X49 A;  3T1H E;  1PIE A;  1Y4U A;  1D6T A;  1ZBT A;  4HAC B;  4DR5 E;  4ZVI A;  1DQ3 A;  2JWO A;  4WUD A;  2V88 A;  4X66 E;  4PRX A;  4I3H A;  2M4I A;  4LFB E;  2LTS A;  2BM1 A;  2L2N A;  3AUZ A;  2UU9 I;  4TUI A;  4OX9 E;  4LF6 I;  4UT4 A;  3WU4 A;  2ZM6 I;  2F4V I;  2LTR A;  2J7K A;  4DV0 I;  1KVK A;  4FN5 A;  4X8W A;  3ZZU A;  2ODR D;  3K17 A;  5FLX Q;  3T1Y E;  1PVG A;  2CZ9 A;  4JI1 I;  1XNR E;  4JI5 I;  4YHH I;  5LMU E;  4DR4 E;  2LJH A;  4USM A;  2UUB I;  2L2K B;  4HAC A;  3H4L A;  1N32 E;  4PRV A;  4DR6 I;  1N33 I;  4EMD A;  2V8P A;  5ADZ A;  4JI7 I;  4R8O A;  3QT6 A;  4FWG A;  2DEJ A;  1U2R A;  2G7H A;  2IOQ A;  1H72 C;  3HPS A;  2UXB E;  1DAR A;  1X48 A;  1Y4S A;  3LNU A;  4DV5 E;  2GQ0 A;  4HYM A;  1ZBQ A;  1IBK E;  2BM0 A;  2M1S A;  4DV6 E;  1IBL I;  4NXM I;  4K0K E;  1XMO I;  3ADG A;  5AE3 A;  1HNX I;  3Q6N A;  4X64 E;  1N36 I;  4DR1 I;  3JAM C;  2WZO A;  2LRS A;  4DPX A;  4IZK A;  3HXL A;  1B63 A;  4DR4 I;  3F6H A;  4LF4 E;  4GKK E;  2RTX A;  1BKN A;  5LMU I;  4LTY A;  4X62 E;  5BR8 I;  1FJG E;  2Q2E B;  1USV A;  1USU A;  2V34 A;  2PNM A;  1O0W A;  3DF6 A;  3J81 C;  2ZM6 E;  2UU9 E;  2GS8 A;  2VF3 A;  2L3J A;  1HK7 A;  4X66 I;  4M30 A;  1OJ4 A;  4B3S I;  2RSM A;  1A6F A;  3VYX A;  2O1T A;  3J81 Q;  3J80 C;  3T1H I;  2E1R A;  2NPF A;  1Z0E A;  4DPT A;  2LBS B;  3PYF A;  4F54 A;  3HPZ A;  1SR9 A;  3Q1Q A;  4LF9 E;  4JYA I;  3H09 A;  4LF8 E;  1HNZ I;  4F9C B;  4LFC E;  4AQY I;  2NA2 A;  1RRE A;  2CPN A;  4JI6 E;  2YT4 A;  1HR0 E;  2X36 A;  1XMO E;  4K0K I;  3P06 A;  4DV6 I;  4LFA E;  4LU9 A;  1IBK I;  2V83 A;  4DV5 I;  2VQE E;  2HKE A;  5AE2 A;  5T6J A;  4KHP E;  4IZJ D;  2HFS A;  4M1K A;  3C4T A;  4IZK B;  2IHR 1;  2KON A;  2HKJ A;  4DR7 I;  3ZZ0 A;  3OML A;  3LTO A;  4FWH A;  4FW9 A;  2F8B A;  2MDR A;  2HK2 A;  4DV4 E;  4P7D A;  5IWA E;  4UTG A;  4YY3 I;  2JVA A;  2LUQ A;  2M7Q A;  2Z5B B;  2VQF I;  4JI1 E;  4JI5 E;  3Q6M A;  1FWL A;  4DU7 A;  2LUP B;  2ODR C;  4LF7 I;  2PNL A;  3JU0 A;  5F3W A;  2H36 X;  4B3M I;  2HK3 A;  1KKH A;  2NUE A;  1Z5A A;  4PU9 A;  3ZM7 A;  4FWD A;  1KTV A;  4LFB I;  5AAS A;  1GQE A;  1MG7 A;  2KHX A;  4HXZ A;  4DR5 I;  4IZJ B;  1IBM I;  2AJ4 A;  2JR1 A;  5LL6 R;  4BCA A;  3ADI A;  4KZS A;  3VK6 A;  2CG9 A;  1RC7 A;  3WU6 A;  2V2V A;  4LF7 E;  3B78 A;  3ZOQ B;  2E5L E;  2FTX B;  4J8Z A;  1WUU A;  4DR3 E;  3JAM Q;  3JTZ A;  3K85 A;  4ED4 A;  1B62 A;  1Z0G A;  3K6Q A;  1NHJ A;  3V2U C;  5LMN E;  3DJW A;  5IWA I;  4DV4 I;  3B82 A;  4XTJ A;  2O1W A;  4BBY A;  4DXL A;  2V2Q A;  2UXC E;  3IWB A;  4L8N A;  1Z0B A;  3QT5 A;  2E1M A;  2NUF A;  4WYQ B;  2BV3 A;  4KHP I;  2O1U A;  2VQE I;  1RR9 A;  4B3T E;  4Z7Y A;  1ZM2 A;  2DB2 A;  5A2Q C;  3J80 Q;  3V5R A;  3ADL A;  4DV2 I;  4JG4 A;  4WUB A;  2UXD I;  4JI3 E;  1YYK A;  1Z0V A;  1Z0T A;  1H7S A;  4JI8 I;  4B3R I;  4WSP A;  3VYY A;  4LFC I;  1HNZ E;  4M2Z A;  4DUZ E;  2RS7 A;  4JV5 E;  2XEX A;  4LF9 I;  4P52 A;  1N0U A;  3MSW A;  4Z7C A;  3P1X A;  1J26 A;  1DI2 A;  5CFF E;  3PRY A;  2HHH E;  1EKZ A;  2MC6 A;  1IBM E;  2NUG A;  1H74 A;  4GEQ B;  3GON A;  3HUL A;  2ZIT A;  4DPY A;  2DIX A;  3OTO E;  1XMQ E;  2L6M A;  1HNW I;  3B8H A;  1YYO A;  1YZ9 A;  1X47 A;  4KQV A;  1Z5C A;  4BS9 A;  4GKJ I;  4JI4 I;  4N3O A;  1FJG I;  2JOB A;  2R42 A;  4X62 I;  4LF4 I;  4GKK I;  3M6A A;  1ZM3 A;  1XHK A;  3LML A;  4JI4 E;  2JOX A;  4YY3 E;  4DR1 E;  1T4O A;  2LMZ A;  3PYE A;  3J7Y p;  4WFT A;  1EA6 A;  2R3V A;  1HNW E;  1IBL E;  4NXM E;  5FWK A;  3OTO I;  4DR7 E;  1XMQ I;  1MX0 A;  2V86 A;  1Y6Z A;  2RS6 A;  3QT7 A;  3IWD A;  2WW4 A;  3PYD A;  3K1J A;  3F6G A;  1K47 A;  3ZZT A;  1UEK A;  3ADJ A;  2HHH I;  1UHZ A;  3C4B A;  3PYG A;  4LFA I;  1MU5 A;  1RQ0 A;  2UUC I;  4IZJ A;  1ZXN A;  4JV5 I;  4JI6 I;  5AE1 A;  4DMI A;  4L5N C;  4DUY I;  2B7T A;  2L33 A;  5FLX C;  1FI4 A;  4X65 I;  2MC5 A;  2K4V A;  4AQY E;  4X65 E;  4LF8 I;  1XNR I;  2FV4 B;  3T1Y I;  4DKK A;  4DUY E;  1UIL A;  4JI3 I;  4DV0 E;  4P7A A;  2UUC E;  2A2C A;  4LF6 E;  3HQ1 A;  4OX9 I;  4DV2 E;  1FKA E;  2LE2 A;  1T4L B;  2N3G A;  3WU3 A;  3F0N A;  3LLH A;  2FGG A;  4MYU A;  1N0V C;  1Z59 A;  4B3S E;  2DEI A;  4WPY A;  2EWL A;  3ZKB A;  3J7A M;  4JI0 E;  5DNY A;  2VE7 C;  2O1V A;  1NHH A;  2YZT A;  1Z5B A;  1KIJ A;  1GZ6 A;  1J5E I;  2L92 A;  4MYT A;  5LMN I;  2UUA E;  1WXR A;  1YYW A;  5BR8 E;  2VF1 A;  2Z5B A;  1S16 A;  2LJP A;  2V87 A;  4DR3 I;  1QZR A;  2L8T A;  2V89 A;  4GKJ E;  2Z5E A;  3LPS A;  3J7A G;  1N36 E;  5L3J A;  2EZ6 A;  4X64 I;  4LF5 I;  1HNX E;  4DPW A;  2KOU A;  4NXN I;  3IWC A;  1FWK A;  1STU A;  1QU6 A;  1H7U A;  4TUG A;  5GMD A;  2DSY A;  4F9A B;  4OOG C;  1N34 E;  2UXB I;  5IT9 C;  2EFG A;  4R1F A;  4B3M E;  1T4N A;  2OI2 A;  2A2D A;  4JI7 E;  4DV3 I;  1N33 E;  4JI2 E;  4DR6 E;  5IT9 Q;  4USK A;  1I94 I;  4DPU A;  3QT8 A;  4I8O A;  1N32 I;  2VQF E;  2UUB E;  4DUZ I;  3AV0 A;  5GME A;  2B9D A;  4BMJ A;  1H73 A;  5A2Q Q;  4YHH E;  2V2Z A;  4JI8 E;  4B3R E;  4M0V A;  2V8Q B;  1I94 E;  1NHI A;  1ZM9 A;  4JI2 I;  4DU8 A;  4DV3 E;  2B3T B;  2F4V E;  2L2M A;  1VIS A;  4R03 A;  2UXD E;  1PKP A;  4RPF A;  1FNM A;  1ZM4 A;  3ZKD A;  2Z5C A;  1N34 I;  4B3T I;  3FIG A;  1NZ0 A;  4Q28 A;  4WUC A;  3WU5 A;  1ELO A;  4NXN E;  1Z0W A;  2UXC I;  3HTX A;  1HR0 I;  4LF5 E;  3RMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...