2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
4DPWA 4DR1I 2V2VA 4DV4I 4JV5E 4JI6I 3QT5A 2B3TB 4WFTA 1HNZE 3T1HE 1GQEA 2HHHI 2IHR1 2LUPB 3JAMQ 4FWHA 4HXZA 2UXCE 1YYOA 4NXME 3T1YE 4DV1E 4DV5E 3T1HI 1NZ0A 2E1RA 5FLXQ 3B8HA 4DPTA 2L2NA 5LL6R 2UXCI 4NXMI 4MYUA 1PVGA 1A6FA 5IT9Q 5CFFE 1J26A 4X8WA 1IBKE 1T4NA 4DUZE 4P7AA 1S16A 1YZ9A 4DU8A 1B63A 4JYAI 4FN5A 1FKAE 4B3TE 3LLHA 4OX9E 4DR4E 4DPYA 2NUFA 1IBKI 2DMYA 4FWDA 2VF3A 4JI3E 4B3TI 1FI4A 2GS8A 4JI5E 4DR5I 3QT7A 4ED4A 3PYEA 4JI3I 3ADIA 3HTXA 1WHQA 1YYKA 2RS7A 1ZBTA 3F0NA 2UU9I 3ZM7A 4GKKE 4DR6E 4LFAE 3GONA 3B78A 1Z5AA 4DR3E 4LF9E 4LF8E 2LBSB 1XMOE 4M2ZA 1N0VC 1X48A 4DR7I 4WUCA 2F4VE 5IWAE 5LMNE 4X64E 1Z0GA 2X36A 4JI0I 4DR6I 4HACB 2OI2A 3D4JA 1XNRI 4DR3I 1J5EE 4LF9I 4LF8I 2EFGA 3LTOA 2HKEA 5IWAI 4X64I 4DUYI 1T4LB 3V2UC 1Z0BA 1NHJA 1QU6A 2UXDE 2VQEE 4Z7YA 3OTOE 3V5RA 2DB2A 4B3ME 3WU4A 3H4LA 1Z5CA 3ZZ0A 1N33E 4LF7E 1HR0E 3ZZTA 2UXDI 2VQEI 4B3SE 2RSMA 4DR2E 2A2DA 1FJGI 4DV3I 4YY3E 4LF7I 4X65E 4FW9A 4DR2I 1ELOA 4JI7E 2CZ9A 1Z0VA 4DXLA 4YY3I 1B62A 2HK2A 2HK3A 4JV5I 1UEKA 4Z7CA 1N32E 2N3HA 1ZXMA 2BM1A 1HNWE 4JI7I 1HNZI 3J80Q 2YT4A 4WYQB 1N0UA 4B3RE 2UXBE 4NXNE 1ZM4A 4GKJE 1Z0CA 4X66E 4HYMA 2E5LE 1HNWI 3T1YI 2L3CA 2N3GA 4DV1I 4DV5I 4DKKA 1X47A 3ZKBA 4B3RI 4LF6E 4NXNI 1XNQE 2ZITA 4GKJI 3PYFA 2LUQA 1MX0A 2ZM6E 2E5LI 1N34E 1KIJA 4AQYE 2JVAA 3J81Q 3C4TA 1X49A 1XNQI 4DUZI 3J7Yp 3P1XA 4USKA 1Z0WA 4AQYI 4OX9I 4DR4I 1FWLA 1ZXNA 2V8PA 1K47A 1S4EA 2NUGA 3ZZUA 5BR8E 1EKZA 1UILA 2L2KB 4JI8E 2LJHA 4JI4E 3M6AA 2UUCE 3JAMC 4JI5I 1STUA 3J7AM 3LNUA 3J80C 4DPXA 1Z5BA 3ADJA 4JI1E 5FLXC 1H73A 1KTVA 4DV7E 4JI4I 4X62E 1UHZA 1NHIA 1VISA 4GKKI 4LFAI 5IT9C 5A2QQ 2B7VA 4K0KE 2V2QA 4DV7I 1XMOI 4RPFA 2F4VI 4DV6E 2RS6A 5LMNI 4DV2E 2KHXA 1WUUA 4PU9A 1ZM2A 3LPSA 4LFCE 2L2MA 1J5EI 2CPNA 4UT4A 2AJ4A 2V2ZA 5GMDA 2BM0A 4LF4E 2R3VA 2B7TA 1BKNA 4I3HA 4P52A 2R42A 2L3JA 1IBME 1KKHA 1RR9A 3J7AG 1FNMA 3WU5A 2WW4A 3OTOI 2LTSA 4LF4I 1HNXE 4B3MI 2DIXA 1N33I 2A2CA 4USMA 2EZ6A 4M30A 3HULA 1HR0I 3QT6A 1XHKA 2VQFE 4MYTA 2J7KA 1MU5A 4B3SI 1O0WA 4DV0E 2Q2EB 3PYGA 3QT8A 3PYDA 1H7SA 1DI2A 3ADLA 4FWGA 2VQFI 4X65I 1DARA 5A2QC 4DV0I 3K17A 4HACA 1MG7A 1ZM3A 4KHPE 5L3JA 2NA2A 3Q1QA 4R1FA 2HHHE 1N32I 1ZM9A 2UUBE 1H74A 3ADGA 4KHPI 4ZVIA 4XTJA 5LMUE 3C4BA 2UXBI 1PKPA 1OJ4A 2MDRA 4LFBE 4X66I 2UUBI 3K1JA 3WU3A 1WHNA 1I94E 3B82A 4DU7A 2NPFA 1EI1A 4WUDA 2NUEA 5LMUI 4LF6I 4JYAE 4LFBI 3WU6A 1Z0TA 2ZM6I 1N34I 1I94I 2UUAE 1H72C 4OOGC 3VYYA 2LRSA 3ZKDA 2JY9A 2XEXA 4YHHE 3VYXA 1Z0EA 2UUAI 4DR5E 2HFSA 2LJPA 2HFUA 4M1KA 2L33A 5BR8I 1XMQE 4YHHI 1T4OA 4DPUA 1YYWA 4JI8I 1QZRA 4JI2E 2X7IA 2UU9E 2UUCI 1RC7A 1RREA 1NHHA 3CWVA 1XMQI 1H7UA 4JI1I 4JI2I 4JG4A 4DR7E 4X62I 2LTRA 5GMEA 4JI0E 2DEIA 1U2RA 4WUBA 3J81C 2RTXA 1XNRE 4K0KI 1FWKA 1EA6A 4DUYE 4DV6I 1D6TA 2DEJA 4DV2I 1IBLE 4HY1A 4KQVA 4LFCI 4EMDA 4PRVA 4URLA 1Z59A 1N36E 2ZBKB 2HKJA 1IBLI 4LF5E 4UTGA 4PRXA 1PIEA 1N36I 1IBMI 1RQ0A 1KVKA 1FJGE 4DV3E 1HNXI 4LF5I 4DR1E 2V34A 4DV4E 4JI6E 2BV3A
chains in the Genus database with same CATH superfamily
4WSGA 4DPWA 3GMEA 2YTFA 4I8OA 2EMIA 4DR1I 2V2VA 4DV4I 2YTNA 2KOUA 2YTIA 4JV5E 2EPMX 4JI6I 2EOEA 3QT5A 2GO4A 5FWKA 1LLMC 5T6JA 1BBOA 2B3TB 4WFTA 4F9CB 1A1KA 2R1FA 1HNZE 2K4VA 3T1HE 1GQEA 2YSPA 3DF6A 1USUA 2EL6A 4IFDF 2HHHI 2IHR1 2LV2A 2LUPB 2H36X 3JAMQ 4FWHA 4WPYA 2M1SA 1Y60A 4FW3A 2UXCE 4HXZA 1YYOA 4NXME 3T1YE 4DV1E 4DV5E 2YTEA 3LMLA 3T1HI 1NZ0A 5EKWA 1HNWI 1UDSA 2LJUA 3VK6A 2E1RA 5FLXQ 4MU3A 3B8HA 5DRRA 2L2NA 5LL6R 2O1TA 4DPTA 5F3WA 2B9DA 1TF3A 3Q6NA 2EOQA 3MHHC 4MU4A 2UXCI 4QNJA 4KWYA 4R03A 4NXMI 4MYUA 1PVGA 1A6FA 5IT9Q 5CFFE 2ENAA 1J26A 4X8WA 1IBKE 1T4NA 3M85D 4DUZE 4P7AA 1S16A 3L7ZA 1YZ9A 4DU8A 4IZJB 1B63A 3F6GA 2WNRA 4JYAI 4IJDA 4MLQA 4FN5A 1FKAE 2PO1B 4B3TE 2EE8A 3LLHA 4OX9E 5JEAA 4DR4E 2E72A 4F6MA 2EOIA 4HEIA 2GO3A 4DPYA 3OMLA 1G2FC 2NUFA 1IBKI 3Q6MA 5KL6A 2DMYA 4FWDA 2VF3A 4JI3E 2F8BA 4B3TI 1FI4A 3U1KA 4NBQA 2E1MA 2V86A 2EOJA 2EQ0A 2JP9A 2L6MA 2NABA 1BB8A 4JI5E 2GS8A 3UHMA 1A1HA 4DR5I 2O1VA 3QT7A 4OO1A 3PYEA 1KYQA 4BA1B 4ED4A 5K36C 1UN6B 4JI3I 3PRYA 3ADIA 3HTXA 2JR1A 2C38B 1E3PA 1WHQA 2L8TA 4R2QA 4M0VA 4P7DA 1UDNA 4GQUA 5DRPA 1YYKA 2RS7A 1IMUA 1ZBTA 3F0NA 2UU9I 3HKMA 2ELYA 4ZYHA 1Y5YA 3ZM7A 3KWRA 4DR6E 4GKKE 4LFAE 3TQMA 2C39A 2YTGA 2ADRA 3GONA 1R6LA 2ODRD 2JXPA 2EQ1A 2JE6B 2WP8B 3B78A 1Z5AA 4DR3E 4LF9E 4LF8E 2LBSB 1XMOE 5AE1A 4M2ZA 1N0VC 3H1CA 1X48A 3AV0A 2MKNA 1MEYC 2F4VE 2EMAA 4WUCA 4DR7I 1X3CA 5IWAE 5LMNE 4X64E 1Z0GA 2X36A 4JI0I 4DR6I 3BIDA 4HACB 2OI2A 2GPIA 5KL7A 5A6JA 3DJWA 4R8OA 2DGCA 3D4JA 1J5EE 4DR3I 2Z5CB 5A6BD 3THNA 2YRMA 4AIMA 4LF8I 1QNTA 1SR9A 4R2RA 2EPUA 1MGTA 4IS1C 4RHBB 2EFGA 3LTOA 2HKEA 2A25A 3UK3C 3DD6A 5C0XF 5IWAI 2VRDA 3EQ1A 1ZBQA 4X64I 4ZYGA 4DUYI 5JEAE 3KZZA 2LVHA 1A1FA 5C0XB 3ECRA 3JU0A 4O4KA 1T4LB 4IFDC 5DNLA 3V2UC 1Z0BA 2BB8A 1VI7A 1NHJA 1WJPA 1QU6A 5KL5A 2O3ZA 2UXDE 2VQEE 4Z7YA 4LF9I 3OTOE 3V5RA 2DB2A 4B3ME 5TSEA 3WU4A 2EOXA 1XXEA 2O1WA 3H4LA 1Z5CA 3CDJA 1N33E 3ZZ0A 2EM7A 4LF7E 4OO1E 1HR0E 3ZZTA 2I9IA 2NN6F 2JEBB 2EMWA 2LE2A 2VQEI 2UXDI 2EPXA 4B3SE 2RSMA 2EMFA 4DR2E 2FGGA 2A2DA 2NN6B 5LLQA 1DQ3A 2LCEA 2JPAA 4IZJD 1FJGI 4FW6A 4DV3I 4IZKB 4YY3E 4LF7I 4GZNC 2PRTA 4R2EA 3PS3A 2EM9A 2JT2A 2KONA 2PNMA 4X65E 5JEAF 4MDTA 4FW9A 4DR2I 2L92A 1ELOA 4JI7E 2Z5EA 2CZ9A 3QG5C 1Z0VA 4DXLA 4YY3I 1B62A 2HK2A 2HK3A 4BBYA 4F54A 1X5WA 2DMIA 5AC4A 1TN9A 1UEKA 2R76A 3KRNA 3IWBA 1N32E 2YTOA 2BR2B 4Z7CA 4JV5I 5ADZA 4IFDB 2N3HA 1ZXMA 2IOPA 2EORA 3M7ND 2BM1A 4N3OA 1HNWE 2PNLA 3PS1A 4JI7I 4OO1F 1HNZI 3J80Q 2YT4A 3M85G 1EH8A 4WYQB 1N0UA 4B3RE 4LOMA 2UXBE 4F6NA 4NXNE 2ENCA 1ZM4A 2PO0B 4GKJE 1Z0CA 4X66E 2V83A 2PO2A 2EM5A 2EN7A 3HQ1A 4R2SA 4HYMA 3BBGA 2PNZB 4R2AA 3EPKA 2E5LE 2L3CA 2N3GA 4DV1I 4DV5I 4DKKA 2K7IA 3T1YI 1X47A 3ZKBA 4R2CA 4B3RI 4LF6E 4NXNI 1XNQE 2EM6A 2ZITA 4GKJI 3PYFA 2LUQA 1MX0A 2YTDA 2CVEA 2ZM6E 3L00A 5AC5A 2E5LI 1N34E 1KIJA 2JEAA 4AQYE 5KL2A 4NHRA 2JVAA 3J81Q 2BBGA 3C4TA 2IERA 1YSAC 2YTJA 1X49A 2EOHA 1TF6A 1X6FA 1ZAAC 2EPAA 2RQLA 1IQSA 1XNQI 4DUZI 4R2PA 3J7Yp 2WBSA 3P1XA 2EMXA 4USKA 2BA0D 2EM2A 1Z0WA 4AQYI 4OX9I 4TUGA 4DR4I 2ELZA 1FWLA 1ZXNA 5K36D 4LU9A 3MSWA 2CT1A 2V8PA 1K47A 1S4EA 2NUGA 3ZZUA 5BR8E 5C0XC 2HGHA 4FW7A 1YUIA 4MU0A 4BA2B 2YPNA 1EKZA 4NZVA 1UILA 5A6BA 2LT7A 4ZYEA 2L2KB 5ELWA 1PJTA 4U3BA 4JI8E 2LJHA 4JI4E 3M6AA 2UUCE 3JAMC 4JI5I 1Y4UA 2ENHA 4DMIA 1STUA 3J7AM 4BMJA 5A6KA 2EPRA 2V85A 3LNUA 4BS9A 2C37B 1GTKA 1NCSA 1G2DC 3J80C 3P76A 5IXMB 4DPXA 1Z5BA 3ADJA 5FLXC 4JI1E 1H73A 1KTVA 3C6KA 4DV7E 2WZOA 1UHZA 4X62E 2NN6C 4JI4I 1NHIA 2EL5A 1P47A 1VISA 3P06A 4LTYA 5DNXA 2I13A 2YRKA 2Z5BB 4WSPA 5K36E 2EMZA 4GKKI 1NEIA 4LFAI 4WXDA 5IT9C 5A2QQ 2CSHA 4O43A 2B7VA 1OYRA 4K0KE 2CG9A 2VESA 2V2QA 4DV7I 1XMOI 3IWCA 4RPFA 2N8XA 2F4VI 4IZJA 4DV6E 4U3DA 2RS6A 2GQ0A 2MC5A 5LMNI 2PO1A 4DV2E 2KHXA 1WUUA 2MC6A 4PU9A 2EMYA 2IOQA 5EL9A 4IFDD 4BCAA 1ZM2A 3LPSA 4LFCE 1KJKA 4OZEA 2L2MA 2YU8A 1YUJA 1P42A 2CPNA 2YTPA 1B69A 1J5EI 4UT4A 2AJ4A 2DLKA 2V2ZA 2JWOA 1YFHA 5GMDA 2BM0A 1YPNA 4LF4E 2EOZA 2R3VA 1EH7A 2B7TA 1BKNA 4I3HA 3K6QA 3GLLA 4P52A 4GEQB 4BHCA 2J7JA 3P3EA 2R42A 2BA1D 2L3JA 1IBME 3J7AG 1KKHA 1EH6A 1RR9A 1FNMA 3WU5A 2WW4A 3OTOI 2LTSA 4LF4I 1GZ6A 2EOFA 5A6AA 1HNXE 4B3MI 1RHYA 2EN3A 2C38A 4OKGA 2DIXA 3P3CA 1ZU1A 1N33I 2A2CA 4USMA 2CGEA 2EN1A 2EZ6A 4ISAA 4M30A 3HULA 1HR0I 3QT6A 4IFDE 1XHKA 3L7ZB 2JOXA 2VQFE 3NZKA 2VE7C 2J7KA 4MYTA 3FIGA 2EPKX 1MU5A 2WNRB 2G7HA 4B3SI 1O0WA 4DV0E 2Q2EB 3PYGA 2EN4A 1X6HA 5JEAB 1RMDA 2JE6A 2WP8A 3QT8A 3PYDA 1H7SA 1DI2A 3ADLA 3GCMA 4FWGA 1AAYA 2VQFI 4X65I 2M9AA 1DARA 5A2QC 1DGCA 4DV0I 3K17A 5DRQA 4HACA 2EPCA 1MG7A 2EPLX 3IWDA 4KHPE 1ZM3A 2IESA 3HJCA 5L3JA 2CTDA 2NA2A 3Q1QA 4R1FA 4Q28A 4F9BB 1AH5A 2Z5CA 2HHHE 2YU5A 3U1YA 2LO3A 2AE8A 4OO1B 5DROA 1YH8A 1JK2A 1N32I 1XNRI 1YHCA 2V87A 1ZM9A 2UUBE 1H74A 2GHFA 5C0XA 2FV4B 2DLQA 2V88A 2YRHA 3ADGA 4KHPI 4R2DA 2EPOA 4ZVIA 1UDOA 4XTJA 5LMUE 3C4BA 4WX9A 2UXBI 1PKPA 5DNYA 1OJ4A 2MDRA 4LFBE 2C39B 4BC9A 2F1DA 2BA0G 4X66I 2UUBI 2MKDA 3K1JA 3WU3A 4FK5C 1WRJA 1WHNA 1I94E 2DSYA 3B82A 4DU7A 1Y4SA 2NPFA 1EI1A 4WUDA 4AM3A 2EM4A 2NUEA 4MU1A 2EOYA 5LMUI 4LF6I 2EN8A 4FW4A 2EPPA 2EM3A 1UBDC 2JEBA 2WBTA 4JYAE 2V8QB 2EM8A 4LFBI 1A1GA 3WU6A 1Z0TA 2NN6A 2ZM6I 2VF1A 1N34I 1I94I 1PJQA 4IZKA 4O24A 2UUAE 4L5NC 1H72C 4OOGC 1R6MA 3P3GA 3HPZA 5C0XD 5KL3A 3VYYA 1PDAA 1JK1A 2EOOA 2LRSA 2EL4A 3ZKDA 2JY9A 2XEXA 4YHHE 3EPJA 2J65A 3BF2A 4J8ZA 1WXRA 2YZTA 1SFEA 3VYXA 1Z0EA 4IS9A 1BBGA 2UUAI 2V89A 4DR5E 1OYPA 2HFSA 2LJPA 2EPZA 4F9AB 4LPFA 3M99B 1T39A 2HFUA 3H09A 5KL4A 2BR2A 4M1KA 1Y6ZA 2L33A 2O1UA 1E3HA 3EPHA 5BR8I 4IFDA 4BC7A 2WCC3 2EMBA 1XMQE 4YHHI 2EN2A 1T4OA 3HPSA 1L4SA 2RSIA 3CDIA 2EP3A 4P78A 4DPUA 1YYWA 2EQ3A 3BGHA 2NN6D 4FW5A 4JI8I 4WXCA 1QZRA 4JI2E 2X7IA 1UDQA 2UU9E 2UUCI 2YTQA 2PO0A 2DRPA 1T38A 1RC7A 5C0XE 1RREA 2EN6A 5AASA 2EMHA 1NHHA 2PNZA 3CWVA 1XMQI 1H7UA 4M9VC 1Z1BA 4ZYDA 3AUZA 1USVA 1HK7A 4JI1I 5AE3A 5JEAD 4JI2I 4JG4A 4DR7E 4F2JC 3F6HA 4X62I 2EPNA 2LTRA 5GMEA 2EOSA 5JEAC 4N4RB 4JI0E 1PJSA 1U2RA 2DEIA 4AIDA 4WUBA 2HJJA 1IQOA 3J81C 2RTXA 2FTXB 2WBUA 2MDGA 1XNRE 2ODRC 2RPCA 4K0KI 2EJ4A 2BA1G 1FWKA 3PS2A 1EA6A 5K36A 4O5GA 3VHTB 2YSOA 2EWLA 4TUIA 4L8NA 2NN6E 4LCHA 2EMCA 4DUYE 5IV8B 4LCFA 4DV6I 4OO1D 1D6TA 2DEJA 3EPLA 4DV2I 1IBLE 4HY1A 4KQVA 3C6MA 4OO1C 3JTZA 2EMGA 3RMPA 1A1JA 4LFCI 4PRVA 4EMDA 4URLA 2EMKA 1Z59A 1N36E 3K85A 4X9JA 1A1IA 4BA1A 5K36F 4KZSA 2LMZA 4Q35B 1F2IG 2PO2B 2ZBKB 4BA2A 2HKJA 5K36B 1IBLI 1X6EA 5AE2A 2EOMA 4LF5E 4LCGA 3B4TA 1N3GA 4UTGA 3KZYA 4PRXA 2JYAA 2Q8UA 1A1LA 1PIEA 1N36I 4MLVA 2YWQA 4HTGA 1IBMI 1RQ0A 1KVKA 4RH8A 4MQYA 3M7NG 2M4IA 2C37A 4BHBA 3THOB 1FJGE 3HXLA 2D9HA 4DV3E 4QNKA 1HNXI 2JEAB 4LF5I 4DR1E 2V34A 4DV4E 2HC5A 2JOBA 3ZOQB 4JI6E 4J3DA 3MHSC 5A69A 2EM0A 2BV3A 2M7QA 2Z5BA 2GLIA 2EMLA 1OYSA 1ZR9A
chains in the Genus database with same CATH topology
4DPWA 4I8OA 4DR1I 2V2VA 4DV4I 2KOUA 4JV5E 4JI6I 3QT5A 5FWKA 5T6JA 2B3TB 4WFTA 4F9CB 1HNZE 2K4VA 3T1HE 1GQEA 3DF6A 1USUA 2HHHI 2IHR1 2LUPB 2H36X 3JAMQ 4FWHA 4WPYA 2M1SA 4HXZA 2UXCE 1YYOA 4NXME 3T1YE 4DV1E 4DV5E 3LMLA 3T1HI 1NZ0A 3VK6A 2E1RA 5FLXQ 3B8HA 4DPTA 2L2NA 5LL6R 2O1TA 5F3WA 2B9DA 3Q6NA 2UXCI 4NXMI 4R03A 4MYUA 1PVGA 1A6FA 5IT9Q 5CFFE 1J26A 4X8WA 1IBKE 1T4NA 4DUZE 4P7AA 1S16A 1YZ9A 4DU8A 4IZJB 1B63A 3F6GA 4JYAI 4FN5A 1FKAE 4B3TE 3LLHA 4OX9E 4DR4E 4DPYA 3OMLA 2NUFA 1IBKI 3Q6MA 2DMYA 4FWDA 2VF3A 4JI3E 2F8BA 4B3TI 1FI4A 2E1MA 2V86A 2GS8A 2L6MA 4JI5E 4DR5I 2O1VA 3QT7A 4ED4A 3PYEA 4JI3I 3PRYA 3ADIA 3HTXA 2JR1A 1WHQA 2L8TA 4M0VA 4P7DA 1YYKA 2RS7A 1ZBTA 3F0NA 2UU9I 3ZM7A 3KWRA 4DR6E 4GKKE 4LFAE 3GONA 2ODRD 3B78A 1Z5AA 4DR3E 4LF9E 4LF8E 2LBSB 1XMOE 5AE1A 4M2ZA 1N0VC 1X48A 3AV0A 4WUCA 2F4VE 4DR7I 5IWAE 5LMNE 4X64E 1Z0GA 2X36A 4JI0I 4DR6I 4HACB 2OI2A 3D4JA 3DJWA 4R8OA 1XNRI 4DR3I 1J5EE 4LF9I 2Z5CB 4LF8I 1SR9A 2EFGA 3LTOA 2HKEA 5IWAI 4X64I 1ZBQA 4DUYI 1T4LB 3JU0A 3V2UC 1Z0BA 1NHJA 1QU6A 2UXDE 2VQEE 4Z7YA 3OTOE 3V5RA 2DB2A 4B3ME 3WU4A 2O1WA 3H4LA 1Z5CA 3ZZ0A 1N33E 4LF7E 1HR0E 3ZZTA 2LE2A 2VQEI 2UXDI 4B3SE 2RSMA 4DR2E 2FGGA 2A2DA 1DQ3A 4IZJD 1FJGI 4DV3I 4IZKB 4YY3E 4LF7I 2KONA 2PNMA 4X65E 4FW9A 4DR2I 2L92A 1ELOA 4JI7E 2Z5EA 2CZ9A 1Z0VA 4DXLA 4YY3I 1B62A 2HK2A 2HK3A 4BBYA 4F54A 4JV5I 1UEKA 4Z7CA 3IWBA 1N32E 5ADZA 2N3HA 1ZXMA 2IOPA 2BM1A 4N3OA 1HNWE 2PNLA 4JI7I 1HNZI 3J80Q 2YT4A 4WYQB 1N0UA 4B3RE 2UXBE 4NXNE 1ZM4A 4GKJE 1Z0CA 4X66E 2V83A 3HQ1A 4HYMA 2E5LE 1HNWI 3T1YI 2L3CA 2N3GA 4DV1I 4DV5I 4DKKA 1X47A 3ZKBA 4B3RI 4LF6E 4NXNI 1XNQE 2ZITA 4GKJI 3PYFA 2LUQA 1MX0A 2ZM6E 2E5LI 1N34E 1KIJA 4AQYE 2JVAA 3J81Q 3C4TA 1X49A 1XNQI 4DUZI 3J7Yp 3P1XA 4USKA 1Z0WA 4AQYI 4OX9I 4TUGA 4DR4I 1FWLA 1ZXNA 4LU9A 3MSWA 2V8PA 1K47A 1S4EA 2NUGA 3ZZUA 5BR8E 1EKZA 1UILA 2L2KB 4JI8E 2LJHA 4JI4E 3M6AA 2UUCE 3JAMC 4JI5I 1Y4UA 4DMIA 1STUA 3J7AM 4BMJA 2V85A 3LNUA 4BS9A 3J80C 4DPXA 1Z5BA 3ADJA 5FLXC 4JI1E 1H73A 1KTVA 4DV7E 4JI4I 2WZOA 1UHZA 4X62E 1NHIA 1VISA 3P06A 4LTYA 2Z5BB 4WSPA 4GKKI 4LFAI 5IT9C 5A2QQ 2B7VA 4K0KE 2CG9A 2V2QA 4DV7I 1XMOI 3IWCA 4RPFA 2F4VI 4IZJA 4DV6E 2RS6A 2GQ0A 2MC5A 5LMNI 4DV2E 2KHXA 1WUUA 2MC6A 4PU9A 2IOQA 4BCAA 1ZM2A 3LPSA 4LFCE 2L2MA 1J5EI 2CPNA 4UT4A 2AJ4A 2V2ZA 2JWOA 5GMDA 2BM0A 4LF4E 2R3VA 2B7TA 1BKNA 4I3HA 3K6QA 4P52A 4GEQB 2R42A 2L3JA 1IBME 3J7AG 1KKHA 1RR9A 1FNMA 3WU5A 2WW4A 3OTOI 2LTSA 4LF4I 1GZ6A 1HNXE 4B3MI 2DIXA 1N33I 2A2CA 4USMA 2CGEA 2EZ6A 4M30A 3HULA 1HR0I 3QT6A 1XHKA 2JOXA 2VQFE 4MYTA 2VE7C 2J7KA 3FIGA 1MU5A 2G7HA 4B3SI 1O0WA 4DV0E 2Q2EB 3PYGA 3QT8A 3PYDA 1H7SA 1DI2A 3ADLA 4FWGA 2VQFI 4X65I 1DARA 5A2QC 4DV0I 3K17A 4HACA 1MG7A 3IWDA 1ZM3A 4KHPE 3HJCA 5L3JA 2NA2A 3Q1QA 4R1FA 4Q28A 4F9BB 2Z5CA 2HHHE 1N32I 1ZM9A 2V87A 2UUBE 1H74A 2FV4B 3ADGA 2V88A 4KHPI 4ZVIA 4XTJA 5LMUE 3C4BA 2UXBI 1PKPA 5DNYA 1OJ4A 2MDRA 4LFBE 4X66I 4BC9A 2UUBI 3K1JA 3WU3A 1WHNA 1I94E 2DSYA 3B82A 4DU7A 1Y4SA 2NPFA 1EI1A 4WUDA 2NUEA 5LMUI 4LF6I 4JYAE 2V8QB 4LFBI 3WU6A 1Z0TA 2ZM6I 2VF1A 1N34I 1I94I 4IZKA 2UUAE 4L5NC 1H72C 4OOGC 3HPZA 3VYYA 2LRSA 3ZKDA 2JY9A 2XEXA 4YHHE 3VYXA 4J8ZA 1WXRA 2YZTA 1Z0EA 2UUAI 2V89A 4DR5E 2HFSA 2LJPA 4F9AB 2HFUA 3H09A 4M1KA 1Y6ZA 2L33A 2O1UA 5BR8I 4BC7A 1XMQE 4YHHI 1T4OA 3HPSA 4P78A 4DPUA 1YYWA 4JI8I 1QZRA 4JI2E 2X7IA 2UU9E 2UUCI 1RC7A 1RREA 5AASA 1NHHA 3CWVA 1XMQI 1H7UA 3AUZA 1USVA 1HK7A 4JI1I 5AE3A 4JI2I 4JG4A 4DR7E 3F6HA 4X62I 2LTRA 5GMEA 4JI0E 2DEIA 1U2RA 4WUBA 3J81C 2RTXA 2FTXB 1XNRE 2ODRC 4K0KI 1FWKA 1EA6A 2EWLA 4TUIA 4L8NA 4DUYE 4DV6I 1D6TA 2DEJA 4DV2I 1IBLE 4HY1A 4KQVA 3JTZA 3RMPA 4LFCI 4EMDA 4PRVA 4URLA 1Z59A 1N36E 3K85A 4KZSA 2LMZA 2ZBKB 2HKJA 1IBLI 5AE2A 4LF5E 4UTGA 4PRXA 1PIEA 1N36I 1IBMI 1RQ0A 1KVKA 2M4IA 1FJGE 3HXLA 4DV3E 1HNXI 4LF5I 4DR1E 2V34A 4DV4E 2JOBA 3ZOQB 4JI6E 2BV3A 2M7QA 2Z5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPW A;  4DR1 I;  2V2V A;  4DV4 I;  4JV5 E;  4JI6 I;  3QT5 A;  2B3T B;  4WFT A;  1HNZ E;  3T1H E;  1GQE A;  2HHH I;  2IHR 1;  2LUP B;  3JAM Q;  4FWH A;  4HXZ A;  2UXC E;  1YYO A;  4NXM E;  3T1Y E;  4DV1 E;  4DV5 E;  3T1H I;  1NZ0 A;  2E1R A;  5FLX Q;  3B8H A;  4DPT A;  2L2N A;  5LL6 R;  2UXC I;  4NXM I;  4MYU A;  1PVG A;  1A6F A;  5IT9 Q;  5CFF E;  1J26 A;  4X8W A;  1IBK E;  1T4N A;  4DUZ E;  4P7A A;  1S16 A;  1YZ9 A;  4DU8 A;  1B63 A;  4JYA I;  4FN5 A;  1FKA E;  4B3T E;  3LLH A;  4OX9 E;  4DR4 E;  4DPY A;  2NUF A;  1IBK I;  2DMY A;  4FWD A;  2VF3 A;  4JI3 E;  4B3T I;  1FI4 A;  2GS8 A;  4JI5 E;  4DR5 I;  3QT7 A;  4ED4 A;  3PYE A;  4JI3 I;  3ADI A;  3HTX A;  1WHQ A;  1YYK A;  2RS7 A;  1ZBT A;  3F0N A;  2UU9 I;  3ZM7 A;  4GKK E;  4DR6 E;  4LFA E;  3GON A;  3B78 A;  1Z5A A;  4DR3 E;  4LF9 E;  4LF8 E;  2LBS B;  1XMO E;  4M2Z A;  1N0V C;  1X48 A;  4DR7 I;  4WUC A;  2F4V E;  5IWA E;  5LMN E;  4X64 E;  1Z0G A;  2X36 A;  4JI0 I;  4DR6 I;  4HAC B;  2OI2 A;  3D4J A;  1XNR I;  4DR3 I;  1J5E E;  4LF9 I;  4LF8 I;  2EFG A;  3LTO A;  2HKE A;  5IWA I;  4X64 I;  4DUY I;  1T4L B;  3V2U C;  1Z0B A;  1NHJ A;  1QU6 A;  2UXD E;  2VQE E;  4Z7Y A;  3OTO E;  3V5R A;  2DB2 A;  4B3M E;  3WU4 A;  3H4L A;  1Z5C A;  3ZZ0 A;  1N33 E;  4LF7 E;  1HR0 E;  3ZZT A;  2UXD I;  2VQE I;  4B3S E;  2RSM A;  4DR2 E;  2A2D A;  1FJG I;  4DV3 I;  4YY3 E;  4LF7 I;  4X65 E;  4FW9 A;  4DR2 I;  1ELO A;  4JI7 E;  2CZ9 A;  1Z0V A;  4DXL A;  4YY3 I;  1B62 A;  2HK2 A;  2HK3 A;  4JV5 I;  1UEK A;  4Z7C A;  1N32 E;  2N3H A;  1ZXM A;  2BM1 A;  1HNW E;  4JI7 I;  1HNZ I;  3J80 Q;  2YT4 A;  4WYQ B;  1N0U A;  4B3R E;  2UXB E;  4NXN E;  1ZM4 A;  4GKJ E;  1Z0C A;  4X66 E;  4HYM A;  2E5L E;  1HNW I;  3T1Y I;  2L3C A;  2N3G A;  4DV1 I;  4DV5 I;  4DKK A;  1X47 A;  3ZKB A;  4B3R I;  4LF6 E;  4NXN I;  1XNQ E;  2ZIT A;  4GKJ I;  3PYF A;  2LUQ A;  1MX0 A;  2ZM6 E;  2E5L I;  1N34 E;  1KIJ A;  4AQY E;  2JVA A;  3J81 Q;  3C4T A;  1X49 A;  1XNQ I;  4DUZ I;  3J7Y p;  3P1X A;  4USK A;  1Z0W A;  4AQY I;  4OX9 I;  4DR4 I;  1FWL A;  1ZXN A;  2V8P A;  1K47 A;  1S4E A;  2NUG A;  3ZZU A;  5BR8 E;  1EKZ A;  1UIL A;  2L2K B;  4JI8 E;  2LJH A;  4JI4 E;  3M6A A;  2UUC E;  3JAM C;  4JI5 I;  1STU A;  3J7A M;  3LNU A;  3J80 C;  4DPX A;  1Z5B A;  3ADJ A;  4JI1 E;  5FLX C;  1H73 A;  1KTV A;  4DV7 E;  4JI4 I;  4X62 E;  1UHZ A;  1NHI A;  1VIS A;  4GKK I;  4LFA I;  5IT9 C;  5A2Q Q;  2B7V A;  4K0K E;  2V2Q A;  4DV7 I;  1XMO I;  4RPF A;  2F4V I;  4DV6 E;  2RS6 A;  5LMN I;  4DV2 E;  2KHX A;  1WUU A;  4PU9 A;  1ZM2 A;  3LPS A;  4LFC E;  2L2M A;  1J5E I;  2CPN A;  4UT4 A;  2AJ4 A;  2V2Z A;  5GMD A;  2BM0 A;  4LF4 E;  2R3V A;  2B7T A;  1BKN A;  4I3H A;  4P52 A;  2R42 A;  2L3J A;  1IBM E;  1KKH A;  1RR9 A;  3J7A G;  1FNM A;  3WU5 A;  2WW4 A;  3OTO I;  2LTS A;  4LF4 I;  1HNX E;  4B3M I;  2DIX A;  1N33 I;  2A2C A;  4USM A;  2EZ6 A;  4M30 A;  3HUL A;  1HR0 I;  3QT6 A;  1XHK A;  2VQF E;  4MYT A;  2J7K A;  1MU5 A;  4B3S I;  1O0W A;  4DV0 E;  2Q2E B;  3PYG A;  3QT8 A;  3PYD A;  1H7S A;  1DI2 A;  3ADL A;  4FWG A;  2VQF I;  4X65 I;  1DAR A;  5A2Q C;  4DV0 I;  3K17 A;  4HAC A;  1MG7 A;  1ZM3 A;  4KHP E;  5L3J A;  2NA2 A;  3Q1Q A;  4R1F A;  2HHH E;  1N32 I;  1ZM9 A;  2UUB E;  1H74 A;  3ADG A;  4KHP I;  4ZVI A;  4XTJ A;  5LMU E;  3C4B A;  2UXB I;  1PKP A;  1OJ4 A;  2MDR A;  4LFB E;  4X66 I;  2UUB I;  3K1J A;  3WU3 A;  1WHN A;  1I94 E;  3B82 A;  4DU7 A;  2NPF A;  1EI1 A;  4WUD A;  2NUE A;  5LMU I;  4LF6 I;  4JYA E;  4LFB I;  3WU6 A;  1Z0T A;  2ZM6 I;  1N34 I;  1I94 I;  2UUA E;  1H72 C;  4OOG C;  3VYY A;  2LRS A;  3ZKD A;  2JY9 A;  2XEX A;  4YHH E;  3VYX A;  1Z0E A;  2UUA I;  4DR5 E;  2HFS A;  2LJP A;  2HFU A;  4M1K A;  2L33 A;  5BR8 I;  1XMQ E;  4YHH I;  1T4O A;  4DPU A;  1YYW A;  4JI8 I;  1QZR A;  4JI2 E;  2X7I A;  2UU9 E;  2UUC I;  1RC7 A;  1RRE A;  1NHH A;  3CWV A;  1XMQ I;  1H7U A;  4JI1 I;  4JI2 I;  4JG4 A;  4DR7 E;  4X62 I;  2LTR A;  5GME A;  4JI0 E;  2DEI A;  1U2R A;  4WUB A;  3J81 C;  2RTX A;  1XNR E;  4K0K I;  1FWK A;  1EA6 A;  4DUY E;  4DV6 I;  1D6T A;  2DEJ A;  4DV2 I;  1IBL E;  4HY1 A;  4KQV A;  4LFC I;  4EMD A;  4PRV A;  4URL A;  1Z59 A;  1N36 E;  2ZBK B;  2HKJ A;  1IBL I;  4LF5 E;  4UTG A;  4PRX A;  1PIE A;  1N36 I;  1IBM I;  1RQ0 A;  1KVK A;  1FJG E;  4DV3 E;  1HNX I;  4LF5 I;  4DR1 E;  2V34 A;  4DV4 E;  4JI6 E;  2BV3 A; 
#chains in the Genus database with same CATH topology
 4WSG A;  4DPW A;  3GME A;  2YTF A;  4I8O A;  2EMI A;  4DR1 I;  2V2V A;  4DV4 I;  2YTN A;  2KOU A;  2YTI A;  4JV5 E;  2EPM X;  4JI6 I;  2EOE A;  3QT5 A;  2GO4 A;  5FWK A;  1LLM C;  5T6J A;  1BBO A;  2B3T B;  4WFT A;  4F9C B;  1A1K A;  2R1F A;  1HNZ E;  2K4V A;  3T1H E;  1GQE A;  2YSP A;  3DF6 A;  1USU A;  2EL6 A;  4IFD F;  2HHH I;  2IHR 1;  2LV2 A;  2LUP B;  2H36 X;  3JAM Q;  4FWH A;  4WPY A;  2M1S A;  1Y60 A;  4FW3 A;  2UXC E;  4HXZ A;  1YYO A;  4NXM E;  3T1Y E;  4DV1 E;  4DV5 E;  2YTE A;  3LML A;  3T1H I;  1NZ0 A;  5EKW A;  1HNW I;  1UDS A;  2LJU A;  3VK6 A;  2E1R A;  5FLX Q;  4MU3 A;  3B8H A;  5DRR A;  2L2N A;  5LL6 R;  2O1T A;  4DPT A;  5F3W A;  2B9D A;  1TF3 A;  3Q6N A;  2EOQ A;  3MHH C;  4MU4 A;  2UXC I;  4QNJ A;  4KWY A;  4R03 A;  4NXM I;  4MYU A;  1PVG A;  1A6F A;  5IT9 Q;  5CFF E;  2ENA A;  1J26 A;  4X8W A;  1IBK E;  1T4N A;  3M85 D;  4DUZ E;  4P7A A;  1S16 A;  3L7Z A;  1YZ9 A;  4DU8 A;  4IZJ B;  1B63 A;  3F6G A;  2WNR A;  4JYA I;  4IJD A;  4MLQ A;  4FN5 A;  1FKA E;  2PO1 B;  4B3T E;  2EE8 A;  3LLH A;  4OX9 E;  5JEA A;  4DR4 E;  2E72 A;  4F6M A;  2EOI A;  4HEI A;  2GO3 A;  4DPY A;  3OML A;  1G2F C;  2NUF A;  1IBK I;  3Q6M A;  5KL6 A;  2DMY A;  4FWD A;  2VF3 A;  4JI3 E;  2F8B A;  4B3T I;  1FI4 A;  3U1K A;  4NBQ A;  2E1M A;  2V86 A;  2EOJ A;  2EQ0 A;  2JP9 A;  2L6M A;  2NAB A;  1BB8 A;  4JI5 E;  2GS8 A;  3UHM A;  1A1H A;  4DR5 I;  2O1V A;  3QT7 A;  4OO1 A;  3PYE A;  1KYQ A;  4BA1 B;  4ED4 A;  5K36 C;  1UN6 B;  4JI3 I;  3PRY A;  3ADI A;  3HTX A;  2JR1 A;  2C38 B;  1E3P A;  1WHQ A;  2L8T A;  4R2Q A;  4M0V A;  4P7D A;  1UDN A;  4GQU A;  5DRP A;  1YYK A;  2RS7 A;  1IMU A;  1ZBT A;  3F0N A;  2UU9 I;  3HKM A;  2ELY A;  4ZYH A;  1Y5Y A;  3ZM7 A;  3KWR A;  4DR6 E;  4GKK E;  4LFA E;  3TQM A;  2C39 A;  2YTG A;  2ADR A;  3GON A;  1R6L A;  2ODR D;  2JXP A;  2EQ1 A;  2JE6 B;  2WP8 B;  3B78 A;  1Z5A A;  4DR3 E;  4LF9 E;  4LF8 E;  2LBS B;  1XMO E;  5AE1 A;  4M2Z A;  1N0V C;  3H1C A;  1X48 A;  3AV0 A;  2MKN A;  1MEY C;  2F4V E;  2EMA A;  4WUC A;  4DR7 I;  1X3C A;  5IWA E;  5LMN E;  4X64 E;  1Z0G A;  2X36 A;  4JI0 I;  4DR6 I;  3BID A;  4HAC B;  2OI2 A;  2GPI A;  5KL7 A;  5A6J A;  3DJW A;  4R8O A;  2DGC A;  3D4J A;  1J5E E;  4DR3 I;  2Z5C B;  5A6B D;  3THN A;  2YRM A;  4AIM A;  4LF8 I;  1QNT A;  1SR9 A;  4R2R A;  2EPU A;  1MGT A;  4IS1 C;  4RHB B;  2EFG A;  3LTO A;  2HKE A;  2A25 A;  3UK3 C;  3DD6 A;  5C0X F;  5IWA I;  2VRD A;  3EQ1 A;  1ZBQ A;  4X64 I;  4ZYG A;  4DUY I;  5JEA E;  3KZZ A;  2LVH A;  1A1F A;  5C0X B;  3ECR A;  3JU0 A;  4O4K A;  1T4L B;  4IFD C;  5DNL A;  3V2U C;  1Z0B A;  2BB8 A;  1VI7 A;  1NHJ A;  1WJP A;  1QU6 A;  5KL5 A;  2O3Z A;  2UXD E;  2VQE E;  4Z7Y A;  4LF9 I;  3OTO E;  3V5R A;  2DB2 A;  4B3M E;  5TSE A;  3WU4 A;  2EOX A;  1XXE A;  2O1W A;  3H4L A;  1Z5C A;  3CDJ A;  1N33 E;  3ZZ0 A;  2EM7 A;  4LF7 E;  4OO1 E;  1HR0 E;  3ZZT A;  2I9I A;  2NN6 F;  2JEB B;  2EMW A;  2LE2 A;  2VQE I;  2UXD I;  2EPX A;  4B3S E;  2RSM A;  2EMF A;  4DR2 E;  2FGG A;  2A2D A;  2NN6 B;  5LLQ A;  1DQ3 A;  2LCE A;  2JPA A;  4IZJ D;  1FJG I;  4FW6 A;  4DV3 I;  4IZK B;  4YY3 E;  4LF7 I;  4GZN C;  2PRT A;  4R2E A;  3PS3 A;  2EM9 A;  2JT2 A;  2KON A;  2PNM A;  4X65 E;  5JEA F;  4MDT A;  4FW9 A;  4DR2 I;  2L92 A;  1ELO A;  4JI7 E;  2Z5E A;  2CZ9 A;  3QG5 C;  1Z0V A;  4DXL A;  4YY3 I;  1B62 A;  2HK2 A;  2HK3 A;  4BBY A;  4F54 A;  1X5W A;  2DMI A;  5AC4 A;  1TN9 A;  1UEK A;  2R76 A;  3KRN A;  3IWB A;  1N32 E;  2YTO A;  2BR2 B;  4Z7C A;  4JV5 I;  5ADZ A;  4IFD B;  2N3H A;  1ZXM A;  2IOP A;  2EOR A;  3M7N D;  2BM1 A;  4N3O A;  1HNW E;  2PNL A;  3PS1 A;  4JI7 I;  4OO1 F;  1HNZ I;  3J80 Q;  2YT4 A;  3M85 G;  1EH8 A;  4WYQ B;  1N0U A;  4B3R E;  4LOM A;  2UXB E;  4F6N A;  4NXN E;  2ENC A;  1ZM4 A;  2PO0 B;  4GKJ E;  1Z0C A;  4X66 E;  2V83 A;  2PO2 A;  2EM5 A;  2EN7 A;  3HQ1 A;  4R2S A;  4HYM A;  3BBG A;  2PNZ B;  4R2A A;  3EPK A;  2E5L E;  2L3C A;  2N3G A;  4DV1 I;  4DV5 I;  4DKK A;  2K7I A;  3T1Y I;  1X47 A;  3ZKB A;  4R2C A;  4B3R I;  4LF6 E;  4NXN I;  1XNQ E;  2EM6 A;  2ZIT A;  4GKJ I;  3PYF A;  2LUQ A;  1MX0 A;  2YTD A;  2CVE A;  2ZM6 E;  3L00 A;  5AC5 A;  2E5L I;  1N34 E;  1KIJ A;  2JEA A;  4AQY E;  5KL2 A;  4NHR A;  2JVA A;  3J81 Q;  2BBG A;  3C4T A;  2IER A;  1YSA C;  2YTJ A;  1X49 A;  2EOH A;  1TF6 A;  1X6F A;  1ZAA C;  2EPA A;  2RQL A;  1IQS A;  1XNQ I;  4DUZ I;  4R2P A;  3J7Y p;  2WBS A;  3P1X A;  2EMX A;  4USK A;  2BA0 D;  2EM2 A;  1Z0W A;  4AQY I;  4OX9 I;  4TUG A;  4DR4 I;  2ELZ A;  1FWL A;  1ZXN A;  5K36 D;  4LU9 A;  3MSW A;  2CT1 A;  2V8P A;  1K47 A;  1S4E A;  2NUG A;  3ZZU A;  5BR8 E;  5C0X C;  2HGH A;  4FW7 A;  1YUI A;  4MU0 A;  4BA2 B;  2YPN A;  1EKZ A;  4NZV A;  1UIL A;  5A6B A;  2LT7 A;  4ZYE A;  2L2K B;  5ELW A;  1PJT A;  4U3B A;  4JI8 E;  2LJH A;  4JI4 E;  3M6A A;  2UUC E;  3JAM C;  4JI5 I;  1Y4U A;  2ENH A;  4DMI A;  1STU A;  3J7A M;  4BMJ A;  5A6K A;  2EPR A;  2V85 A;  3LNU A;  4BS9 A;  2C37 B;  1GTK A;  1NCS A;  1G2D C;  3J80 C;  3P76 A;  5IXM B;  4DPX A;  1Z5B A;  3ADJ A;  5FLX C;  4JI1 E;  1H73 A;  1KTV A;  3C6K A;  4DV7 E;  2WZO A;  1UHZ A;  4X62 E;  2NN6 C;  4JI4 I;  1NHI A;  2EL5 A;  1P47 A;  1VIS A;  3P06 A;  4LTY A;  5DNX A;  2I13 A;  2YRK A;  2Z5B B;  4WSP A;  5K36 E;  2EMZ A;  4GKK I;  1NEI A;  4LFA I;  4WXD A;  5IT9 C;  5A2Q Q;  2CSH A;  4O43 A;  2B7V A;  1OYR A;  4K0K E;  2CG9 A;  2VES A;  2V2Q A;  4DV7 I;  1XMO I;  3IWC A;  4RPF A;  2N8X A;  2F4V I;  4IZJ A;  4DV6 E;  4U3D A;  2RS6 A;  2GQ0 A;  2MC5 A;  5LMN I;  2PO1 A;  4DV2 E;  2KHX A;  1WUU A;  2MC6 A;  4PU9 A;  2EMY A;  2IOQ A;  5EL9 A;  4IFD D;  4BCA A;  1ZM2 A;  3LPS A;  4LFC E;  1KJK A;  4OZE A;  2L2M A;  2YU8 A;  1YUJ A;  1P42 A;  2CPN A;  2YTP A;  1B69 A;  1J5E I;  4UT4 A;  2AJ4 A;  2DLK A;  2V2Z A;  2JWO A;  1YFH A;  5GMD A;  2BM0 A;  1YPN A;  4LF4 E;  2EOZ A;  2R3V A;  1EH7 A;  2B7T A;  1BKN A;  4I3H A;  3K6Q A;  3GLL A;  4P52 A;  4GEQ B;  4BHC A;  2J7J A;  3P3E A;  2R42 A;  2BA1 D;  2L3J A;  1IBM E;  3J7A G;  1KKH A;  1EH6 A;  1RR9 A;  1FNM A;  3WU5 A;  2WW4 A;  3OTO I;  2LTS A;  4LF4 I;  1GZ6 A;  2EOF A;  5A6A A;  1HNX E;  4B3M I;  1RHY A;  2EN3 A;  2C38 A;  4OKG A;  2DIX A;  3P3C A;  1ZU1 A;  1N33 I;  2A2C A;  4USM A;  2CGE A;  2EN1 A;  2EZ6 A;  4ISA A;  4M30 A;  3HUL A;  1HR0 I;  3QT6 A;  4IFD E;  1XHK A;  3L7Z B;  2JOX A;  2VQF E;  3NZK A;  2VE7 C;  2J7K A;  4MYT A;  3FIG A;  2EPK X;  1MU5 A;  2WNR B;  2G7H A;  4B3S I;  1O0W A;  4DV0 E;  2Q2E B;  3PYG A;  2EN4 A;  1X6H A;  5JEA B;  1RMD A;  2JE6 A;  2WP8 A;  3QT8 A;  3PYD A;  1H7S A;  1DI2 A;  3ADL A;  3GCM A;  4FWG A;  1AAY A;  2VQF I;  4X65 I;  2M9A A;  1DAR A;  5A2Q C;  1DGC A;  4DV0 I;  3K17 A;  5DRQ A;  4HAC A;  2EPC A;  1MG7 A;  2EPL X;  3IWD A;  4KHP E;  1ZM3 A;  2IES A;  3HJC A;  5L3J A;  2CTD A;  2NA2 A;  3Q1Q A;  4R1F A;  4Q28 A;  4F9B B;  1AH5 A;  2Z5C A;  2HHH E;  2YU5 A;  3U1Y A;  2LO3 A;  2AE8 A;  4OO1 B;  5DRO A;  1YH8 A;  1JK2 A;  1N32 I;  1XNR I;  1YHC A;  2V87 A;  1ZM9 A;  2UUB E;  1H74 A;  2GHF A;  5C0X A;  2FV4 B;  2DLQ A;  2V88 A;  2YRH A;  3ADG A;  4KHP I;  4R2D A;  2EPO A;  4ZVI A;  1UDO A;  4XTJ A;  5LMU E;  3C4B A;  4WX9 A;  2UXB I;  1PKP A;  5DNY A;  1OJ4 A;  2MDR A;  4LFB E;  2C39 B;  4BC9 A;  2F1D A;  2BA0 G;  4X66 I;  2UUB I;  2MKD A;  3K1J A;  3WU3 A;  4FK5 C;  1WRJ A;  1WHN A;  1I94 E;  2DSY A;  3B82 A;  4DU7 A;  1Y4S A;  2NPF A;  1EI1 A;  4WUD A;  4AM3 A;  2EM4 A;  2NUE A;  4MU1 A;  2EOY A;  5LMU I;  4LF6 I;  2EN8 A;  4FW4 A;  2EPP A;  2EM3 A;  1UBD C;  2JEB A;  2WBT A;  4JYA E;  2V8Q B;  2EM8 A;  4LFB I;  1A1G A;  3WU6 A;  1Z0T A;  2NN6 A;  2ZM6 I;  2VF1 A;  1N34 I;  1I94 I;  1PJQ A;  4IZK A;  4O24 A;  2UUA E;  4L5N C;  1H72 C;  4OOG C;  1R6M A;  3P3G A;  3HPZ A;  5C0X D;  5KL3 A;  3VYY A;  1PDA A;  1JK1 A;  2EOO A;  2LRS A;  2EL4 A;  3ZKD A;  2JY9 A;  2XEX A;  4YHH E;  3EPJ A;  2J65 A;  3BF2 A;  4J8Z A;  1WXR A;  2YZT A;  1SFE A;  3VYX A;  1Z0E A;  4IS9 A;  1BBG A;  2UUA I;  2V89 A;  4DR5 E;  1OYP A;  2HFS A;  2LJP A;  2EPZ A;  4F9A B;  4LPF A;  3M99 B;  1T39 A;  2HFU A;  3H09 A;  5KL4 A;  2BR2 A;  4M1K A;  1Y6Z A;  2L33 A;  2O1U A;  1E3H A;  3EPH A;  5BR8 I;  4IFD A;  4BC7 A;  2WCC 3;  2EMB A;  1XMQ E;  4YHH I;  2EN2 A;  1T4O A;  3HPS A;  1L4S A;  2RSI A;  3CDI A;  2EP3 A;  4P78 A;  4DPU A;  1YYW A;  2EQ3 A;  3BGH A;  2NN6 D;  4FW5 A;  4JI8 I;  4WXC A;  1QZR A;  4JI2 E;  2X7I A;  1UDQ A;  2UU9 E;  2UUC I;  2YTQ A;  2PO0 A;  2DRP A;  1T38 A;  1RC7 A;  5C0X E;  1RRE A;  2EN6 A;  5AAS A;  2EMH A;  1NHH A;  2PNZ A;  3CWV A;  1XMQ I;  1H7U A;  4M9V C;  1Z1B A;  4ZYD A;  3AUZ A;  1USV A;  1HK7 A;  4JI1 I;  5AE3 A;  5JEA D;  4JI2 I;  4JG4 A;  4DR7 E;  4F2J C;  3F6H A;  4X62 I;  2EPN A;  2LTR A;  5GME A;  2EOS A;  5JEA C;  4N4R B;  4JI0 E;  1PJS A;  1U2R A;  2DEI A;  4AID A;  4WUB A;  2HJJ A;  1IQO A;  3J81 C;  2RTX A;  2FTX B;  2WBU A;  2MDG A;  1XNR E;  2ODR C;  2RPC A;  4K0K I;  2EJ4 A;  2BA1 G;  1FWK A;  3PS2 A;  1EA6 A;  5K36 A;  4O5G A;  3VHT B;  2YSO A;  2EWL A;  4TUI A;  4L8N A;  2NN6 E;  4LCH A;  2EMC A;  4DUY E;  5IV8 B;  4LCF A;  4DV6 I;  4OO1 D;  1D6T A;  2DEJ A;  3EPL A;  4DV2 I;  1IBL E;  4HY1 A;  4KQV A;  3C6M A;  4OO1 C;  3JTZ A;  2EMG A;  3RMP A;  1A1J A;  4LFC I;  4PRV A;  4EMD A;  4URL A;  2EMK A;  1Z59 A;  1N36 E;  3K85 A;  4X9J A;  1A1I A;  4BA1 A;  5K36 F;  4KZS A;  2LMZ A;  4Q35 B;  1F2I G;  2PO2 B;  2ZBK B;  4BA2 A;  2HKJ A;  5K36 B;  1IBL I;  1X6E A;  5AE2 A;  2EOM A;  4LF5 E;  4LCG A;  3B4T A;  1N3G A;  4UTG A;  3KZY A;  4PRX A;  2JYA A;  2Q8U A;  1A1L A;  1PIE A;  1N36 I;  4MLV A;  2YWQ A;  4HTG A;  1IBM I;  1RQ0 A;  1KVK A;  4RH8 A;  4MQY A;  3M7N G;  2M4I A;  2C37 A;  4BHB A;  3THO B;  1FJG E;  3HXL A;  2D9H A;  4DV3 E;  4QNK A;  1HNX I;  2JEA B;  4LF5 I;  4DR1 E;  2V34 A;  4DV4 E;  2HC5 A;  2JOB A;  3ZOQ B;  4JI6 E;  4J3D A;  3MHS C;  5A69 A;  2EM0 A;  2BV3 A;  2M7Q A;  2Z5B A;  2GLI A;  2EML A;  1OYS A;  1ZR9 A; 
#chains in the Genus database with same CATH homology
 4DPW A;  4I8O A;  4DR1 I;  2V2V A;  4DV4 I;  2KOU A;  4JV5 E;  4JI6 I;  3QT5 A;  5FWK A;  5T6J A;  2B3T B;  4WFT A;  4F9C B;  1HNZ E;  2K4V A;  3T1H E;  1GQE A;  3DF6 A;  1USU A;  2HHH I;  2IHR 1;  2LUP B;  2H36 X;  3JAM Q;  4FWH A;  4WPY A;  2M1S A;  4HXZ A;  2UXC E;  1YYO A;  4NXM E;  3T1Y E;  4DV1 E;  4DV5 E;  3LML A;  3T1H I;  1NZ0 A;  3VK6 A;  2E1R A;  5FLX Q;  3B8H A;  4DPT A;  2L2N A;  5LL6 R;  2O1T A;  5F3W A;  2B9D A;  3Q6N A;  2UXC I;  4NXM I;  4R03 A;  4MYU A;  1PVG A;  1A6F A;  5IT9 Q;  5CFF E;  1J26 A;  4X8W A;  1IBK E;  1T4N A;  4DUZ E;  4P7A A;  1S16 A;  1YZ9 A;  4DU8 A;  4IZJ B;  1B63 A;  3F6G A;  4JYA I;  4FN5 A;  1FKA E;  4B3T E;  3LLH A;  4OX9 E;  4DR4 E;  4DPY A;  3OML A;  2NUF A;  1IBK I;  3Q6M A;  2DMY A;  4FWD A;  2VF3 A;  4JI3 E;  2F8B A;  4B3T I;  1FI4 A;  2E1M A;  2V86 A;  2GS8 A;  2L6M A;  4JI5 E;  4DR5 I;  2O1V A;  3QT7 A;  4ED4 A;  3PYE A;  4JI3 I;  3PRY A;  3ADI A;  3HTX A;  2JR1 A;  1WHQ A;  2L8T A;  4M0V A;  4P7D A;  1YYK A;  2RS7 A;  1ZBT A;  3F0N A;  2UU9 I;  3ZM7 A;  3KWR A;  4DR6 E;  4GKK E;  4LFA E;  3GON A;  2ODR D;  3B78 A;  1Z5A A;  4DR3 E;  4LF9 E;  4LF8 E;  2LBS B;  1XMO E;  5AE1 A;  4M2Z A;  1N0V C;  1X48 A;  3AV0 A;  4WUC A;  2F4V E;  4DR7 I;  5IWA E;  5LMN E;  4X64 E;  1Z0G A;  2X36 A;  4JI0 I;  4DR6 I;  4HAC B;  2OI2 A;  3D4J A;  3DJW A;  4R8O A;  1XNR I;  4DR3 I;  1J5E E;  4LF9 I;  2Z5C B;  4LF8 I;  1SR9 A;  2EFG A;  3LTO A;  2HKE A;  5IWA I;  4X64 I;  1ZBQ A;  4DUY I;  1T4L B;  3JU0 A;  3V2U C;  1Z0B A;  1NHJ A;  1QU6 A;  2UXD E;  2VQE E;  4Z7Y A;  3OTO E;  3V5R A;  2DB2 A;  4B3M E;  3WU4 A;  2O1W A;  3H4L A;  1Z5C A;  3ZZ0 A;  1N33 E;  4LF7 E;  1HR0 E;  3ZZT A;  2LE2 A;  2VQE I;  2UXD I;  4B3S E;  2RSM A;  4DR2 E;  2FGG A;  2A2D A;  1DQ3 A;  4IZJ D;  1FJG I;  4DV3 I;  4IZK B;  4YY3 E;  4LF7 I;  2KON A;  2PNM A;  4X65 E;  4FW9 A;  4DR2 I;  2L92 A;  1ELO A;  4JI7 E;  2Z5E A;  2CZ9 A;  1Z0V A;  4DXL A;  4YY3 I;  1B62 A;  2HK2 A;  2HK3 A;  4BBY A;  4F54 A;  4JV5 I;  1UEK A;  4Z7C A;  3IWB A;  1N32 E;  5ADZ A;  2N3H A;  1ZXM A;  2IOP A;  2BM1 A;  4N3O A;  1HNW E;  2PNL A;  4JI7 I;  1HNZ I;  3J80 Q;  2YT4 A;  4WYQ B;  1N0U A;  4B3R E;  2UXB E;  4NXN E;  1ZM4 A;  4GKJ E;  1Z0C A;  4X66 E;  2V83 A;  3HQ1 A;  4HYM A;  2E5L E;  1HNW I;  3T1Y I;  2L3C A;  2N3G A;  4DV1 I;  4DV5 I;  4DKK A;  1X47 A;  3ZKB A;  4B3R I;  4LF6 E;  4NXN I;  1XNQ E;  2ZIT A;  4GKJ I;  3PYF A;  2LUQ A;  1MX0 A;  2ZM6 E;  2E5L I;  1N34 E;  1KIJ A;  4AQY E;  2JVA A;  3J81 Q;  3C4T A;  1X49 A;  1XNQ I;  4DUZ I;  3J7Y p;  3P1X A;  4USK A;  1Z0W A;  4AQY I;  4OX9 I;  4TUG A;  4DR4 I;  1FWL A;  1ZXN A;  4LU9 A;  3MSW A;  2V8P A;  1K47 A;  1S4E A;  2NUG A;  3ZZU A;  5BR8 E;  1EKZ A;  1UIL A;  2L2K B;  4JI8 E;  2LJH A;  4JI4 E;  3M6A A;  2UUC E;  3JAM C;  4JI5 I;  1Y4U A;  4DMI A;  1STU A;  3J7A M;  4BMJ A;  2V85 A;  3LNU A;  4BS9 A;  3J80 C;  4DPX A;  1Z5B A;  3ADJ A;  5FLX C;  4JI1 E;  1H73 A;  1KTV A;  4DV7 E;  4JI4 I;  2WZO A;  1UHZ A;  4X62 E;  1NHI A;  1VIS A;  3P06 A;  4LTY A;  2Z5B B;  4WSP A;  4GKK I;  4LFA I;  5IT9 C;  5A2Q Q;  2B7V A;  4K0K E;  2CG9 A;  2V2Q A;  4DV7 I;  1XMO I;  3IWC A;  4RPF A;  2F4V I;  4IZJ A;  4DV6 E;  2RS6 A;  2GQ0 A;  2MC5 A;  5LMN I;  4DV2 E;  2KHX A;  1WUU A;  2MC6 A;  4PU9 A;  2IOQ A;  4BCA A;  1ZM2 A;  3LPS A;  4LFC E;  2L2M A;  1J5E I;  2CPN A;  4UT4 A;  2AJ4 A;  2V2Z A;  2JWO A;  5GMD A;  2BM0 A;  4LF4 E;  2R3V A;  2B7T A;  1BKN A;  4I3H A;  3K6Q A;  4P52 A;  4GEQ B;  2R42 A;  2L3J A;  1IBM E;  3J7A G;  1KKH A;  1RR9 A;  1FNM A;  3WU5 A;  2WW4 A;  3OTO I;  2LTS A;  4LF4 I;  1GZ6 A;  1HNX E;  4B3M I;  2DIX A;  1N33 I;  2A2C A;  4USM A;  2CGE A;  2EZ6 A;  4M30 A;  3HUL A;  1HR0 I;  3QT6 A;  1XHK A;  2JOX A;  2VQF E;  4MYT A;  2VE7 C;  2J7K A;  3FIG A;  1MU5 A;  2G7H A;  4B3S I;  1O0W A;  4DV0 E;  2Q2E B;  3PYG A;  3QT8 A;  3PYD A;  1H7S A;  1DI2 A;  3ADL A;  4FWG A;  2VQF I;  4X65 I;  1DAR A;  5A2Q C;  4DV0 I;  3K17 A;  4HAC A;  1MG7 A;  3IWD A;  1ZM3 A;  4KHP E;  3HJC A;  5L3J A;  2NA2 A;  3Q1Q A;  4R1F A;  4Q28 A;  4F9B B;  2Z5C A;  2HHH E;  1N32 I;  1ZM9 A;  2V87 A;  2UUB E;  1H74 A;  2FV4 B;  3ADG A;  2V88 A;  4KHP I;  4ZVI A;  4XTJ A;  5LMU E;  3C4B A;  2UXB I;  1PKP A;  5DNY A;  1OJ4 A;  2MDR A;  4LFB E;  4X66 I;  4BC9 A;  2UUB I;  3K1J A;  3WU3 A;  1WHN A;  1I94 E;  2DSY A;  3B82 A;  4DU7 A;  1Y4S A;  2NPF A;  1EI1 A;  4WUD A;  2NUE A;  5LMU I;  4LF6 I;  4JYA E;  2V8Q B;  4LFB I;  3WU6 A;  1Z0T A;  2ZM6 I;  2VF1 A;  1N34 I;  1I94 I;  4IZK A;  2UUA E;  4L5N C;  1H72 C;  4OOG C;  3HPZ A;  3VYY A;  2LRS A;  3ZKD A;  2JY9 A;  2XEX A;  4YHH E;  3VYX A;  4J8Z A;  1WXR A;  2YZT A;  1Z0E A;  2UUA I;  2V89 A;  4DR5 E;  2HFS A;  2LJP A;  4F9A B;  2HFU A;  3H09 A;  4M1K A;  1Y6Z A;  2L33 A;  2O1U A;  5BR8 I;  4BC7 A;  1XMQ E;  4YHH I;  1T4O A;  3HPS A;  4P78 A;  4DPU A;  1YYW A;  4JI8 I;  1QZR A;  4JI2 E;  2X7I A;  2UU9 E;  2UUC I;  1RC7 A;  1RRE A;  5AAS A;  1NHH A;  3CWV A;  1XMQ I;  1H7U A;  3AUZ A;  1USV A;  1HK7 A;  4JI1 I;  5AE3 A;  4JI2 I;  4JG4 A;  4DR7 E;  3F6H A;  4X62 I;  2LTR A;  5GME A;  4JI0 E;  2DEI A;  1U2R A;  4WUB A;  3J81 C;  2RTX A;  2FTX B;  1XNR E;  2ODR C;  4K0K I;  1FWK A;  1EA6 A;  2EWL A;  4TUI A;  4L8N A;  4DUY E;  4DV6 I;  1D6T A;  2DEJ A;  4DV2 I;  1IBL E;  4HY1 A;  4KQV A;  3JTZ A;  3RMP A;  4LFC I;  4EMD A;  4PRV A;  4URL A;  1Z59 A;  1N36 E;  3K85 A;  4KZS A;  2LMZ A;  2ZBK B;  2HKJ A;  1IBL I;  5AE2 A;  4LF5 E;  4UTG A;  4PRX A;  1PIE A;  1N36 I;  1IBM I;  1RQ0 A;  1KVK A;  2M4I A;  1FJG E;  3HXL A;  4DV3 E;  1HNX I;  4LF5 I;  4DR1 E;  2V34 A;  4DV4 E;  2JOB A;  3ZOQ B;  4JI6 E;  2BV3 A;  2M7Q A;  2Z5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...