2UU9E

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule keywords 16S RRNA
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uu9E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uu9E02
4JV5E 4DUZI 4DU8A 4OOGC 2VQFE 1OJ4A 2LTSA 4HXZA 1HR0E 3ZZ0A 1Z0TA 3ZM7A 1N0UA 5LMUI 4YY3I 3WU5A 1HNWI 3JAMC 4DV2E 1RREA 3WU4A 4JI2E 1ZBTA 4LFBI 2UXCE 2LUPB 2JVAA 4DR4E 3PYDA 2RTXA 3C4TA 2LJHA 3P1XA 5GMEA 2DEIA 2ZBKB 2DEJA 1T4NA 1Z5BA 5A2QC 4DPXA 4X64I 4M30A 4WUDA 1Z0EA 3QT5A 4JI8E 1WUUA 1ELOA 2VQFI 4LFCI 4FW9A 2NPFA 3Q1QA 4GKKE 2VF3A 2CPNA 3ZKDA 2JY9A 3WU3A 5CFFE 4DR1I 2N3HA 1EI1A 1H74A 4OX9E 4JI2I 2L2MA 4JI0E 3HTXA 4ED4A 2UXCI 1IBKI 4KHPI 4DR4I 2UUAE 3QT7A 3ADGA 1GQEA 4B3RE 3QT6A 4LF5E 4JI5E 2X36A 5FLXC 1D6TA 1FI4A 2L3JA 4DR3E 3JAMQ 4X66I 4LF9E 1FKAE 4WYQB 2L33A 4UTGA 1FJGI 3J7Yp 1O0WA 1Z59A 1X49A 4X62I 2B3TB 4DV1I 2E5LE 1FNMA 3QT8A 5IWAE 4GKKI 2IHR1 4XTJA 2UU9I 4JI1I 5A2QQ 1EKZA 4B3ME 4JG4A 2BM1A 1YYKA 3ADIA 4B3SI 4JI0I 1IBMI 1MU5A 2KHXA 3PYGA 3V2UC 1UILA 2UUAI 1WHQA 1I94I 4B3RI 4LFBE 1WHNA 5BR8E 2R42A 4LF4E 4DR3I 2L3CA 4DR7I 1YYOA 4PRXA 4LF9I 2DIXA 2VQEE 1XNRI 4JI4E 1KTVA 2EZ6A 4EMDA 5L3JA 4X64E 4YHHE 3V5RA 2E5LI 4NXNE 2R3VA 2EFGA 5IWAI 5FLXQ 1RC7A 4DV5E 2MDRA 4GKJI 2V8PA 3D4JA 4LFCE 1XMQI 1ZM4A 4B3MI 1Z5CA 2HKJA 3LTOA 4P52A 1H7SA 2A2CA 1PIEA 4RPFA 4DR1E 2WW4A 3ZZTA 1IBKE 4HACA 4NXME 3HULA 4LF8E 1XMOE 4KHPE 5BR8I 1PKPA 1ZM3A 4LF4I 1Z5AA 1MX0A 2YT4A 2VQEI 4JI4I 1N32E 1U2RA 3J7AM 4X66E 4FWGA 1N33E 1S4EA 4Z7CA 3VYXA 2NUGA 1FJGE 4YHHI 4NXNI 1FWKA 4X62E 4LF7E 4X8WA 4DV5I 4DV1E 1HNXI 1STUA 2HK3A 5LMNI 2UU9E 1FWLA 2HKEA 4JI1E 4JYAE 3ZKBA 2B7VA 1B62A 4B3SE 1PVGA 3T1HE 1IBME 4NXMI 2A2DA 4LF8I 1XMOI 4FN5A 2UUBE 4MYUA 2UUCE 1I94E 4DUYE 1Z0BA 1N32I 1N36E 4UT4A 3WU6A 4DR7E 1T4OA 1N33I 1IBLE 1XNRE 2HHHE 4DV6I 5GMDA 2UXBI 4LF7I 1YZ9A 2V2QA 4MYTA 1NZ0A 2V34A 1QZRA 2RS7A 1XNQI 1QU6A 4GKJE 1J26A 4JI3E 1XMQE 4FWHA 3ZZUA 1J5EI 4JYAI 4DU7A 2DB2A 3T1YI 1Z0GA 3LPSA 2LJPA 4JI6I 3T1HI 4DV0I 1N34I 2UUBI 1ZXNA 2UUCI 2V2ZA 4K0KI 4DUYI 3ADJA 3LNUA 1A6FA 1N36I 4R1FA 1IBLI 2HHHI 2NUFA 1S16A 1VISA 1KIJA 2DMYA 3CWVA 3J81C 2N3GA 2GS8A 1HNZI 3M6AA 2RSMA 1Z0CA 4DPWA 4USMA 1UHZA 1DARA 1HNXE 4JI3I 4M1KA 1ZM9A 2B7TA 1H73A 5LMNE 2LRSA 2HK2A 1N0VC 4DKKA 3VYYA 5IT9C 2J7KA 3J80C 4B3TE 1NHHA 4DR5E 1T4LB 1KKHA 1Z0VA 2BM0A 3PYEA 4DR2E 4WFTA 4AQYE 1KVKA 5LL6R 2ZM6I 4LFAE 1UEKA 4WUCA 2LUQA 4WUBA 2LBSB 1MG7A 4I3HA 4DV6E 4URLA 3B78A 1XHKA 4DV4I 2UXBE 4Z7YA 4X65I 4DXLA 3K17A 1XNQE 2UXDI 2CZ9A 4DR6E 1NHIA 3J81Q 1J5EE 4JV5I 4B3TI 4JI7E 3T1YE 4USKA 4DR5I 4JI6E 1DI2A 4DV0E 4DR2I 1N34E 3ADLA 4PU9A 2F4VE 4AQYI 4K0KE 1EA6A 1HR0I 4LFAI 1K47A 2LTRA 5IT9Q 2L2KB 4M2ZA 2OI2A 3J80Q 4HY1A 2NA2A 4DV2I 3OTOE 3C4BA 2HFUA 1H72C 4FWDA 1NHJA 2ZITA 2V2VA 1HNZE 4KQVA 3K1JA 4HYMA 1ZXMA 4DV7E 1RR9A 4DR6I 4LF6E 2X7IA 4PRVA 4DV3E 4JI7I 2E1RA 1H7UA 2AJ4A 4ZVIA 1ZM2A 3PYFA 3F0NA 4JI8I 3H4LA 4DPUA 4DUZE 3J7AG 2F4VI 1BKNA 2XEXA 1X48A 1X47A 3LLHA 4DPTA 1RQ0A 3B82A 2ZM6E 3GONA 3OTOI 2NUEA 4OX9I 5LMUE 4YY3E 4DPYA 1HNWE 4HACB 4DV4E 4DV7I 2L2NA 4LF5I 2BV3A 4JI5I 1YYWA 4LF6I 4X65E 1B63A 2UXDE 2Q2EB 4DV3I 2HFSA 3B8HA 4P7AA 1Z0WA 2RS6A
chains in the Genus database with same CATH superfamily
4JV5E 2YTIA 1IQSA 2L8TA 2CGEA 2GHFA 3IWBA 4DUZI 2JOXA 3K6QA 4OO1B 2RPCA 4MU1A 2V8QB 4F9CB 4DU8A 4LCFA 4OOGC 2VQFE 1OJ4A 4X9JA 3M7ND 1RHYA 2LTSA 4HXZA 1HR0E 3ZZ0A 1YPNA 3MSWA 1Z0TA 3MHHC 3ZM7A 3CDIA 5JEAD 2EMKA 2EMIA 1N0UA 2A25A 2F1DA 3DJWA 4QNKA 4YY3I 5LMUI 3WU5A 1XXEA 4LOMA 4OO1C 1HNWI 3JAMC 1PJTA 4DV2E 3HJCA 1RREA 3MHSC 4ZYDA 3UK3C 3WU4A 4BA2A 2V85A 2YTGA 4JI2E 1ZBTA 4F9BB 5EKWA 2DLQA 4IFDF 4LFBI 2UXCE 2LUPB 2JVAA 4MU4A 4DR4E 3H1CA 2PNZB 2EORA 4WX9A 3PYDA 5IXMB 2RTXA 3C4TA 2LJHA 3P1XA 5GMEA 4R2QA 2DEIA 2ODRD 2M9AA 2GO4A 2O1TA 2J65A 2EPAA 2ZBKB 1BBGA 2MDGA 4GEQB 2M7QA 2DEJA 1T4NA 1R6LA 4BCAA 1Z5BA 2EOJA 1TN9A 5A2QC 4DPXA 4X64I 1UDNA 1USVA 4AIMA 1UDOA 4M30A 1EH8A 4WUDA 1Z0EA 3QT5A 4JI8E 1WUUA 1ELOA 1ZR9A 2VQFI 3P3GA 4LFCI 4FW9A 2NPFA 2EOOA 3JTZA 4OO1F 3Q1QA 2BA0G 4GKKE 3HQ1A 4R2AA 2VF3A 1SFEA 3FIGA 2CPNA 4RHBB 5DNLA 4P78A 1F2IG 3ZKDA 2JY9A 3M85D 3WU3A 4WSGA 5CFFE 4DR1I 2EM9A 2EOEA 4O4KA 2N3HA 1EI1A 1H74A 4BBYA 4TUIA 4OX9E 2I9IA 4JI2I 2C37A 2L2MA 5IV8B 4JI0E 1UN6B 3HTXA 4LCGA 4ED4A 3IWCA 1IBKI 2UXCI 4KHPI 2DMIA 4DR4I 2UUAE 1A1GA 1UDQA 2EMCA 2EOQA 3ADGA 4WXDA 1GQEA 5AC4A 4B3RE 3QT6A 4LF5E 2O1UA 4JI5E 5FLXC 2X36A 1D6TA 4FW6A 2CVEA 2J7JA 4O24A 2L3JA 1FI4A 4DR3E 1T39A 2ADRA 3M99B 4WSPA 3JAMQ 4X66I 4LF9E 1FKAE 5JEAC 4WYQB 2L33A 4UTGA 1FJGI 1E3HA 4WXCA 3EPLA 2YTJA 2IOPA 4IZKA 3J7Yp 1O0WA 1Z59A 1X49A 4X62I 4R2RA 3Q6MA 2B3TB 1Y6ZA 4DV1I 2E5LE 3EPJA 2JWOA 1FNMA 3QT8A 2BR2A 4BMJA 3M7NG 2HJJA 2PO0A 5IWAE 2WBSA 2EOIA 1NEIA 5A69A 1UBDC 4GKKI 2EPKX 2IHR1 4F2JC 1USUA 4XTJA 2UU9I 2ODRC 1IQOA 4JI1I 5A2QQ 3L00A 1EKZA 4B3ME 4JG4A 4O5GA 2BM1A 3TQMA 2EPZA 1YYKA 1A1KA 1AAYA 1VI7A 2JXPA 3ADIA 2EPRA 4B3SI 2EPNA 2GLIA 2GO3A 4JI0I 1IBMI 1MU5A 2MC6A 2KHXA 2Z5CB 2EPOA 3PYGA 3V2UC 1UILA 2YTQA 2KOUA 2UUAI 3UHMA 2VF1A 2EN6A 1WHQA 2IESA 5DRPA 1I94I 4B3RI 4LFBE 1WHNA 5C0XA 5JEAF 5K36D 4O43A 5KL2A 2PRTA 5A6JA 2JEAB 5BR8E 4BS9A 2L6MA 2V86A 1TF6A 2R42A 4LF4E 4DR3I 2PO1A 2L3CA 4DR7I 1YYOA 4PRXA 4LF9I 5KL6A 2DIXA 2B9DA 4J8ZA 2VQEE 4JI4E 1KTVA 1XNRI 2YSOA 2K4VA 2Z5BA 1DGCA 2LT7A 1JK2A 2DGCA 2EMBA 2EZ6A 4EMDA 2YTOA 5L3JA 2EN3A 2JT2A 5DROA 4X64E 4YHHE 1DQ3A 1MEYC 3V5RA 1RMDA 1X6FA 1P42A 2E5LI 2EMLA 4GZNC 4NXNE 2R3VA 1Z1BA 2EFGA 2WP8B 5IWAI 5FLXQ 1RC7A 4L5NC 2VRDA 4DV5E 5F3WA 2YRKA 2MDRA 4GKJI 1A1FA 2V8PA 3D4JA 5DNXA 4LFCE 3M85G 1ZM4A 1XMQI 3OMLA 4B3MI 1Z5CA 3GMEA 2NN6E 2JE6B 4AIDA 2HKJA 3LTOA 4P52A 4N4RB 4I8OA 1WXRA 3K85A 2O3ZA 1H7SA 3EQ1A 1PIEA 2A2CA 2RQLA 4RPFA 4DR1E 2YU8A 2EOXA 2JR1A 3BF2A 2PO2B 4MLVA 4IZJD 1G2FC 2WW4A 3ZZTA 4IFDA 4F9AB 4BHCA 1IBKE 4NXME 4HACA 3HULA 2YTDA 4Q35B 4LF8E 1XMOE 4KHPE 2PNMA 5C0XE 5BR8I 2EL5A 1PKPA 1ZM3A 1WRJA 4LF4I 3EPKA 2C38A 1Z5AA 3NZKA 3P06A 5DRQA 1MX0A 3VHTB 2YT4A 2VQEI 4JI4I 2D9HA 1N32E 3U1YA 5A6AA 2Q8UA 5K36B 2EPUA 1U2RA 1A1LA 3J7AM 2CSHA 3DD6A 4X66E 3RMPA 4FWGA 4FW7A 3ZOQB 1N33E 1S4EA 4Z7CA 3VYXA 2NUGA 1FJGE 4YHHI 5AE3A 4NXNI 3GCMA 1FWKA 2BB8A 4ZYHA 3L7ZB 1HK7A 4X62E 4LF7E 4X8WA 4MU0A 1BBOA 4DV5I 4ZYEA 4U3BA 2YSPA 4DV1E 2O1WA 1HNXI 4OO1A 1X5WA 5K36C 2DRPA 5A6BA 4MDTA 1STUA 4ISAA 2HK3A 5LMNI 4GQUA 2FTXB 2UU9E 1FWLA 3QT7A 2G7HA 2HKEA 4MU3A 4JI1E 4ZYGA 2EN2A 4FK5C 4IZKB 4LTYA 2JP9A 4JYAE 3ZKBA 2ENAA 2B7VA 2LJUA 2EM8A 1X6HA 2LMZA 2LV2A 2WCC3 1B62A 4B3SE 1PVGA 5AE2A 2M1SA 3T1HE 2V83A 1IBME 1OYPA 4NXMI 4IFDE 2A2DA 4LF8I 3H09A 1OYSA 1XMOI 1MGTA 4FN5A 2UUBE 3Q6NA 1SR9A 4MYUA 2UUCE 1I94E 2EPLX 2C39B 1Y60A 2NN6B 4IZJB 4DUYE 1Z0BA 2PNZA 1N32I 2F8BA 1N36E 4UT4A 3WU6A 4DR7E 5DNYA 1T4OA 2YZTA 1KYQA 1IBLE 1XNRE 1N33I 3P3CA 2EE8A 2HHHE 4R2PA 2CG9A 3B4TA 3P3EA 5EL9A 4DV6I 3F6HA 5K36F 5KL4A 5GMDA 2UXBI 2EOYA 4LF7I 1AH5A 2YTPA 1YZ9A 5C0XB 2EOMA 5LLQA 2V2QA 5AE1A 1NZ0A 2V34A 4MYTA 1X6EA 3KWRA 1QZRA 2RS7A 4OO1E 2LCEA 1XNQI 2EM7A 3AV0A 1EH6A 1QU6A 3P76A 1T38A 3BIDA 4GKJE 1J26A 1PJQA 2BA1D 4HEIA 2ELYA 2EPXA 4BA1B 1B69A 4JI3E 2JYAA 1XMQE 4FWHA 3ZZUA 1J5EI 4JYAI 4DU7A 2WNRB 2EP3A 2DB2A 3T1YI 1Z0GA 4L8NA 3LPSA 2LJPA 4JI6I 3T1HI 4DV0I 3BGHA 2EM0A 2EN8A 4KZSA 3HPZA 3EPHA 4N3OA 1N34I 2UUBI 1ZXNA 2UUCI 2EM3A 5JEAA 2V2ZA 4K0KI 2YPNA 4J3DA 4DUYI 2IERA 2N8XA 3ADJA 3LNUA 3VK6A 2ELZA 1YSAC 1A6FA 1N36I 4BC9A 4R1FA 2JEBA 1YFHA 2YTNA 2NN6F 1IBLI 2HHHI 4NZVA 2NUFA 3ECRA 1S16A 1TF3A 4BA2B 1VISA 1KIJA 2Z5EA 2DMYA 4IFDB 2EMGA 2MKDA 3J81C 3CWVA 2N3GA 2GS8A 3HPSA 1HNZI 2R76A 3M6AA 2RSMA 2YTEA 4AM3A 1Z0CA 5A6KA 2YWQA 2WBUA 4DPWA 4USMA 5AC5A 1PDAA 5KL7A 1UHZA 1DARA 1A1IA 1E3PA 2EPMX 2AE8A 1HNXE 4JI3I 4M1KA 1ZM9A 2B7TA 1H73A 1ZAAC 1PJSA 5LMNE 2LRSA 2HK2A 1N0VC 2R1FA 1JK1A 1KJKA 5KL5A 4DKKA 1NCSA 3C6MA 3VYYA 5IT9C 2J7KA 3J80C 2EM5A 2YRHA 5FWKA 4B3TE 1Y4SA 1NHHA 4OKGA 4IJDA 2NN6D 2FV4B 4DR5E 1T4LB 2V88A 2JOBA 2Z5CA 1KKHA 2EQ0A 3BBGA 3F6GA 1Z0VA 2BM0A 3PYEA 5JEAE 1L4SA 4DR2E 2EOHA 2PNLA 4P7DA 2EOZA 1UDSA 4WFTA 2EWLA 4AQYE 1KVKA 5LL6R 4R03A 4MLQA 2O1VA 4BHBA 2JEAA 2ZM6I 4QNJA 2CT1A 2EJ4A 4LFAE 1UEKA 4WUCA 2LUQA 5C0XD 4Q28A 3IWDA 2H36X 1GZ6A 3PS1A 2C37B 4WUBA 2LBSB 1G2DC 3KZZA 1MG7A 2LO3A 3KZYA 4DV6E 5TSEA 4I3HA 4URLA 3B78A 1XHKA 4FW3A 4MQYA 4DV4I 2UXBE 2EOFA 1YH8A 1EH7A 2EPPA 4Z7YA 2KONA 2BA1G 2IOQA 3HKMA 4X65I 4DXLA 2EMZA 2WP8A 3K17A 3PS3A 2NABA 1XNQE 2UXDI 1A1HA 3U1KA 2CZ9A 4DR6E 2M4IA 2GQ0A 4F54A 2WBTA 2VESA 4TUGA 5T6JA 1NHIA 2L92A 3J81Q 1J5EE 4NHRA 4U3DA 2JE6A 4JV5I 4B3TI 4JI7E 3THOB 4DMIA 3T1YE 4KWYA 4IS1C 4USKA 4RH8A 1Y4UA 4JI6E 2BR2B 2LVHA 4DR5I 1DI2A 3QG5C 2PO0B 4DV0E 5JEAB 2EL4A 2EQ1A 2PO2A 4FW4A 4DR2I 2CTDA 1N34E 3AUZA 3ADLA 2K7IA 4PU9A 2F4VE 2ENCA 4R2EA 2EMFA 4AQYI 4K0KE 1EA6A 1HR0I 4FW5A 4LFAI 2E72A 1K47A 2LTRA 4IFDD 2EMYA 2EQ3A 3CDJA 5IT9Q 2L2KB 4M9VC 4M2ZA 2OI2A 3J80Q 4HY1A 2NA2A 4DV2I 2DSYA 5K36A 4R2DA 3OTOE 3PS2A 4NBQA 2EL6A 3PRYA 2MKNA 3C4BA 2HFUA 3LMLA 2HC5A 1H72C 4R8OA 1NHJA 4FWDA 2V87A 1R6MA 2GPIA 2NN6C 1HNZE 2V2VA 2ZITA 4KQVA 4R2CA 1A1JA 2EM4A 2HGHA 3K1JA 2FGGA 4HYMA 2VE7C 2EPCA 3L7ZA 3C6KA 1ZXMA 4DV7E 2PO1B 2JEBB 1YHCA 3KRNA 1RR9A 4DR6I 4LF6E 1ZU1A 1LLMC 2X7IA 2Z5BB 4PRVA 3JU0A 2EN7A 4DV3E 4F6MA 4JI7I 2E1RA 1H7UA 4OO1D 2AJ4A 5C0XC 4ZVIA 5A6BD 1ZM2A 3PYFA 2V89A 2ENHA 3F0NA 4JI8I 3H4LA 2EMXA 4DPUA 4F6NA 4HTGA 3DF6A 4DUZE 1IMUA 4LPFA 3J7AG 2F4VI 3GLLA 1BKNA 1QNTA 3THNA 2XEXA 1X48A 2YTFA 4OZEA 5ELWA 2DLKA 1WJPA 1X47A 2EM2A 3LLHA 4LCHA 4DPTA 2C39A 1RQ0A 2I13A 2NN6A 4IZJA 2RSIA 2YRMA 3B82A 2BA0D 2ZM6E 3GONA 2EN4A 3OTOI 2EOSA 5K36E 2NUEA 4OX9I 5LMUE 4YY3E 2EM6A 4IS9A 4DPYA 2YU5A 1HNWE 4HACB 4LU9A 1N3GA 2BBGA 2EMAA 4DV4E 5DRRA 2L2NA 2C38B 4DV7I 4LF5I 2BV3A 4JI5I 2E1MA 5C0XF 5AASA 1GTKA 2EMHA 4WPYA 1P47A 1YYWA 1OYRA 5KL3A 1Y5YA 4LF6I 4BC7A 4M0VA 4X65E 2LE2A 4R2SA 1B63A 1ZBQA 2MC5A 1YUJA 2UXDE 5ADZA 2Q2EB 2WZOA 1YUIA 4DV3I 4IFDC 1BB8A 2HFSA 4BA1A 2JPAA 1X3CA 3B8HA 2EMWA 4P7AA 1Z0WA 2WNRA 2EN1A 2RS6A 3HXLA
chains in the Genus database with same CATH topology
4JV5E 2L8TA 2CGEA 3IWBA 4DUZI 2JOXA 3K6QA 2V8QB 4F9CB 4DU8A 4OOGC 2VQFE 1OJ4A 2LTSA 4HXZA 1HR0E 3ZZ0A 3MSWA 1Z0TA 3ZM7A 1N0UA 5LMUI 4YY3I 3DJWA 3WU5A 1HNWI 3JAMC 4DV2E 3HJCA 1RREA 3WU4A 2V85A 4JI2E 1ZBTA 4F9BB 4LFBI 2UXCE 2LUPB 2JVAA 4DR4E 3PYDA 2RTXA 3C4TA 2LJHA 3P1XA 5GMEA 2DEIA 2ODRD 2O1TA 2ZBKB 4GEQB 2DEJA 2M7QA 1T4NA 4BCAA 1Z5BA 5A2QC 4DPXA 4X64I 1USVA 4M30A 4WUDA 1Z0EA 3QT5A 4JI8E 1WUUA 1ELOA 2VQFI 4LFCI 4FW9A 2NPFA 3JTZA 3Q1QA 4GKKE 3HQ1A 2VF3A 3FIGA 2CPNA 4P78A 3ZKDA 2JY9A 3WU3A 5CFFE 4DR1I 2N3HA 1EI1A 1H74A 4BBYA 4TUIA 4OX9E 4JI2I 2L2MA 4JI0E 3HTXA 4ED4A 2UXCI 1IBKI 3IWCA 4KHPI 4DR4I 2UUAE 3QT7A 3ADGA 1GQEA 4B3RE 3QT6A 4LF5E 2O1UA 4JI5E 5FLXC 2X36A 1D6TA 1FI4A 2L3JA 4DR3E 4WSPA 3JAMQ 4X66I 4LF9E 1FKAE 4WYQB 2L33A 4UTGA 1FJGI 2IOPA 4IZKA 3J7Yp 1O0WA 1Z59A 1X49A 4X62I 3Q6MA 2B3TB 1Y6ZA 4DV1I 2E5LE 1FNMA 2JWOA 3QT8A 4BMJA 5IWAE 4GKKI 2IHR1 1USUA 4XTJA 2UU9I 2ODRC 4JI1I 5A2QQ 1EKZA 4B3ME 4JG4A 2BM1A 1YYKA 3ADIA 4B3SI 4JI0I 1IBMI 1MU5A 2MC6A 2KHXA 2Z5CB 3PYGA 3V2UC 1UILA 2UUAI 2KOUA 2VF1A 1WHQA 1I94I 4B3RI 4LFBE 1WHNA 5BR8E 4BS9A 2L6MA 2V86A 2R42A 4LF4E 4DR3I 2L3CA 4DR7I 1YYOA 4PRXA 4LF9I 2DIXA 2B9DA 4J8ZA 2VQEE 4JI4E 1KTVA 1XNRI 2K4VA 2Z5BA 2EZ6A 4EMDA 5L3JA 4X64E 4YHHE 1DQ3A 3V5RA 2E5LI 4NXNE 2R3VA 2EFGA 5IWAI 5FLXQ 1RC7A 4L5NC 4DV5E 5F3WA 2MDRA 4GKJI 2V8PA 3D4JA 4LFCE 1XMQI 1ZM4A 3OMLA 4B3MI 1Z5CA 2HKJA 3LTOA 4P52A 4I8OA 1WXRA 3K85A 1H7SA 2A2CA 1PIEA 4RPFA 4DR1E 2JR1A 4IZJD 2WW4A 3ZZTA 4F9AB 1IBKE 4NXME 4HACA 3HULA 4LF8E 2PNMA 1XMOE 4KHPE 5BR8I 1PKPA 1ZM3A 4LF4I 3P06A 1Z5AA 1MX0A 2YT4A 2VQEI 4JI4I 1N32E 1U2RA 3J7AM 4X66E 3RMPA 4FWGA 3ZOQB 1N33E 1S4EA 4Z7CA 3VYXA 2NUGA 1FJGE 4YHHI 5AE3A 4NXNI 1FWKA 1HK7A 4X62E 4LF7E 4X8WA 4DV5I 4DV1E 2O1WA 1HNXI 1STUA 2HK3A 5LMNI 2FTXB 2UU9E 1FWLA 2G7HA 2HKEA 4JI1E 4IZKB 4LTYA 4JYAE 3ZKBA 2B7VA 2LMZA 1B62A 4B3SE 1PVGA 5AE2A 1IBME 2M1SA 2V83A 3T1HE 4NXMI 2A2DA 4LF8I 3H09A 1XMOI 4FN5A 2UUBE 3Q6NA 1SR9A 4MYUA 2UUCE 1I94E 4IZJB 4DUYE 1Z0BA 1N32I 2F8BA 1N36E 4UT4A 3WU6A 4DR7E 5DNYA 1T4OA 2YZTA 1IBLE 1XNRE 1N33I 2HHHE 4DV6I 2CG9A 3F6HA 5GMDA 2UXBI 4LF7I 1YZ9A 2V2QA 5AE1A 1NZ0A 2V34A 4MYTA 3KWRA 1QZRA 2RS7A 1XNQI 3AV0A 1QU6A 4GKJE 1J26A 4JI3E 1XMQE 4FWHA 3ZZUA 1J5EI 4JYAI 4DU7A 2DB2A 3T1YI 1Z0GA 4L8NA 3LPSA 2LJPA 4JI6I 3T1HI 4DV0I 4KZSA 3HPZA 4N3OA 1N34I 2UUBI 1ZXNA 2UUCI 2V2ZA 4K0KI 4DUYI 3ADJA 3LNUA 3VK6A 1A6FA 1N36I 4BC9A 4R1FA 1IBLI 2HHHI 2NUFA 1S16A 1VISA 1KIJA 2Z5EA 2DMYA 3J81C 3CWVA 2N3GA 2GS8A 3HPSA 1HNZI 3M6AA 2RSMA 1Z0CA 4DPWA 4USMA 1UHZA 1DARA 1HNXE 4JI3I 4M1KA 1ZM9A 2B7TA 1H73A 5LMNE 2LRSA 2HK2A 1N0VC 4DKKA 3VYYA 5IT9C 2J7KA 3J80C 5FWKA 4B3TE 1Y4SA 1NHHA 2FV4B 4DR5E 1T4LB 2V88A 2JOBA 2Z5CA 1KKHA 1Z0VA 2BM0A 3F6GA 3PYEA 4DR2E 2PNLA 4P7DA 4WFTA 2EWLA 4AQYE 1KVKA 5LL6R 4R03A 2O1VA 2ZM6I 4LFAE 1UEKA 4WUCA 2LUQA 4Q28A 3IWDA 2H36X 1GZ6A 4WUBA 2LBSB 1MG7A 4I3HA 4DV6E 4URLA 3B78A 1XHKA 4DV4I 2UXBE 4Z7YA 2KONA 2IOQA 4X65I 4DXLA 3K17A 1XNQE 2UXDI 2CZ9A 4DR6E 2M4IA 2GQ0A 4F54A 4TUGA 5T6JA 1NHIA 2L92A 3J81Q 1J5EE 4JV5I 4B3TI 4JI7E 4DMIA 3T1YE 4USKA 1Y4UA 4JI6E 4DR5I 1DI2A 4DV0E 4DR2I 1N34E 3AUZA 3ADLA 4PU9A 2F4VE 4AQYI 4K0KE 1EA6A 1HR0I 4LFAI 1K47A 2LTRA 5IT9Q 2L2KB 4M2ZA 2OI2A 3J80Q 4HY1A 2NA2A 4DV2I 2DSYA 3OTOE 3PRYA 3C4BA 2HFUA 3LMLA 1H72C 4R8OA 1NHJA 4FWDA 2V87A 2ZITA 2V2VA 1HNZE 4KQVA 3K1JA 2FGGA 4HYMA 2VE7C 1ZXMA 4DV7E 1RR9A 4DR6I 4LF6E 2X7IA 2Z5BB 4PRVA 3JU0A 4DV3E 4JI7I 2E1RA 1H7UA 2AJ4A 4ZVIA 1ZM2A 3PYFA 2V89A 3F0NA 4JI8I 3H4LA 4DPUA 3DF6A 4DUZE 3J7AG 2F4VI 1BKNA 2XEXA 1X48A 1X47A 3LLHA 4DPTA 1RQ0A 4IZJA 3B82A 2ZM6E 3GONA 3OTOI 2NUEA 4OX9I 5LMUE 4YY3E 4DPYA 1HNWE 4HACB 4LU9A 4DV4E 4DV7I 2L2NA 4LF5I 2BV3A 4JI5I 2E1MA 5AASA 4WPYA 1YYWA 4LF6I 4BC7A 4M0VA 1B63A 2LE2A 4X65E 1ZBQA 2MC5A 2UXDE 2Q2EB 5ADZA 4DV3I 2WZOA 2HFSA 3B8HA 4P7AA 1Z0WA 2RS6A 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  4DUZ I;  4DU8 A;  4OOG C;  2VQF E;  1OJ4 A;  2LTS A;  4HXZ A;  1HR0 E;  3ZZ0 A;  1Z0T A;  3ZM7 A;  1N0U A;  5LMU I;  4YY3 I;  3WU5 A;  1HNW I;  3JAM C;  4DV2 E;  1RRE A;  3WU4 A;  4JI2 E;  1ZBT A;  4LFB I;  2UXC E;  2LUP B;  2JVA A;  4DR4 E;  3PYD A;  2RTX A;  3C4T A;  2LJH A;  3P1X A;  5GME A;  2DEI A;  2ZBK B;  2DEJ A;  1T4N A;  1Z5B A;  5A2Q C;  4DPX A;  4X64 I;  4M30 A;  4WUD A;  1Z0E A;  3QT5 A;  4JI8 E;  1WUU A;  1ELO A;  2VQF I;  4LFC I;  4FW9 A;  2NPF A;  3Q1Q A;  4GKK E;  2VF3 A;  2CPN A;  3ZKD A;  2JY9 A;  3WU3 A;  5CFF E;  4DR1 I;  2N3H A;  1EI1 A;  1H74 A;  4OX9 E;  4JI2 I;  2L2M A;  4JI0 E;  3HTX A;  4ED4 A;  2UXC I;  1IBK I;  4KHP I;  4DR4 I;  2UUA E;  3QT7 A;  3ADG A;  1GQE A;  4B3R E;  3QT6 A;  4LF5 E;  4JI5 E;  2X36 A;  5FLX C;  1D6T A;  1FI4 A;  2L3J A;  4DR3 E;  3JAM Q;  4X66 I;  4LF9 E;  1FKA E;  4WYQ B;  2L33 A;  4UTG A;  1FJG I;  3J7Y p;  1O0W A;  1Z59 A;  1X49 A;  4X62 I;  2B3T B;  4DV1 I;  2E5L E;  1FNM A;  3QT8 A;  5IWA E;  4GKK I;  2IHR 1;  4XTJ A;  2UU9 I;  4JI1 I;  5A2Q Q;  1EKZ A;  4B3M E;  4JG4 A;  2BM1 A;  1YYK A;  3ADI A;  4B3S I;  4JI0 I;  1IBM I;  1MU5 A;  2KHX A;  3PYG A;  3V2U C;  1UIL A;  2UUA I;  1WHQ A;  1I94 I;  4B3R I;  4LFB E;  1WHN A;  5BR8 E;  2R42 A;  4LF4 E;  4DR3 I;  2L3C A;  4DR7 I;  1YYO A;  4PRX A;  4LF9 I;  2DIX A;  2VQE E;  1XNR I;  4JI4 E;  1KTV A;  2EZ6 A;  4EMD A;  5L3J A;  4X64 E;  4YHH E;  3V5R A;  2E5L I;  4NXN E;  2R3V A;  2EFG A;  5IWA I;  5FLX Q;  1RC7 A;  4DV5 E;  2MDR A;  4GKJ I;  2V8P A;  3D4J A;  4LFC E;  1XMQ I;  1ZM4 A;  4B3M I;  1Z5C A;  2HKJ A;  3LTO A;  4P52 A;  1H7S A;  2A2C A;  1PIE A;  4RPF A;  4DR1 E;  2WW4 A;  3ZZT A;  1IBK E;  4HAC A;  4NXM E;  3HUL A;  4LF8 E;  1XMO E;  4KHP E;  5BR8 I;  1PKP A;  1ZM3 A;  4LF4 I;  1Z5A A;  1MX0 A;  2YT4 A;  2VQE I;  4JI4 I;  1N32 E;  1U2R A;  3J7A M;  4X66 E;  4FWG A;  1N33 E;  1S4E A;  4Z7C A;  3VYX A;  2NUG A;  1FJG E;  4YHH I;  4NXN I;  1FWK A;  4X62 E;  4LF7 E;  4X8W A;  4DV5 I;  4DV1 E;  1HNX I;  1STU A;  2HK3 A;  5LMN I;  2UU9 E;  1FWL A;  2HKE A;  4JI1 E;  4JYA E;  3ZKB A;  2B7V A;  1B62 A;  4B3S E;  1PVG A;  3T1H E;  1IBM E;  4NXM I;  2A2D A;  4LF8 I;  1XMO I;  4FN5 A;  2UUB E;  4MYU A;  2UUC E;  1I94 E;  4DUY E;  1Z0B A;  1N32 I;  1N36 E;  4UT4 A;  3WU6 A;  4DR7 E;  1T4O A;  1N33 I;  1IBL E;  1XNR E;  2HHH E;  4DV6 I;  5GMD A;  2UXB I;  4LF7 I;  1YZ9 A;  2V2Q A;  4MYT A;  1NZ0 A;  2V34 A;  1QZR A;  2RS7 A;  1XNQ I;  1QU6 A;  4GKJ E;  1J26 A;  4JI3 E;  1XMQ E;  4FWH A;  3ZZU A;  1J5E I;  4JYA I;  4DU7 A;  2DB2 A;  3T1Y I;  1Z0G A;  3LPS A;  2LJP A;  4JI6 I;  3T1H I;  4DV0 I;  1N34 I;  2UUB I;  1ZXN A;  2UUC I;  2V2Z A;  4K0K I;  4DUY I;  3ADJ A;  3LNU A;  1A6F A;  1N36 I;  4R1F A;  1IBL I;  2HHH I;  2NUF A;  1S16 A;  1VIS A;  1KIJ A;  2DMY A;  3CWV A;  3J81 C;  2N3G A;  2GS8 A;  1HNZ I;  3M6A A;  2RSM A;  1Z0C A;  4DPW A;  4USM A;  1UHZ A;  1DAR A;  1HNX E;  4JI3 I;  4M1K A;  1ZM9 A;  2B7T A;  1H73 A;  5LMN E;  2LRS A;  2HK2 A;  1N0V C;  4DKK A;  3VYY A;  5IT9 C;  2J7K A;  3J80 C;  4B3T E;  1NHH A;  4DR5 E;  1T4L B;  1KKH A;  1Z0V A;  2BM0 A;  3PYE A;  4DR2 E;  4WFT A;  4AQY E;  1KVK A;  5LL6 R;  2ZM6 I;  4LFA E;  1UEK A;  4WUC A;  2LUQ A;  4WUB A;  2LBS B;  1MG7 A;  4I3H A;  4DV6 E;  4URL A;  3B78 A;  1XHK A;  4DV4 I;  2UXB E;  4Z7Y A;  4X65 I;  4DXL A;  3K17 A;  1XNQ E;  2UXD I;  2CZ9 A;  4DR6 E;  1NHI A;  3J81 Q;  1J5E E;  4JV5 I;  4B3T I;  4JI7 E;  3T1Y E;  4USK A;  4DR5 I;  4JI6 E;  1DI2 A;  4DV0 E;  4DR2 I;  1N34 E;  3ADL A;  4PU9 A;  2F4V E;  4AQY I;  4K0K E;  1EA6 A;  1HR0 I;  4LFA I;  1K47 A;  2LTR A;  5IT9 Q;  2L2K B;  4M2Z A;  2OI2 A;  3J80 Q;  4HY1 A;  2NA2 A;  4DV2 I;  3OTO E;  3C4B A;  2HFU A;  1H72 C;  4FWD A;  1NHJ A;  2ZIT A;  2V2V A;  1HNZ E;  4KQV A;  3K1J A;  4HYM A;  1ZXM A;  4DV7 E;  1RR9 A;  4DR6 I;  4LF6 E;  2X7I A;  4PRV A;  4DV3 E;  4JI7 I;  2E1R A;  1H7U A;  2AJ4 A;  4ZVI A;  1ZM2 A;  3PYF A;  3F0N A;  4JI8 I;  3H4L A;  4DPU A;  4DUZ E;  3J7A G;  2F4V I;  1BKN A;  2XEX A;  1X48 A;  1X47 A;  3LLH A;  4DPT A;  1RQ0 A;  3B82 A;  2ZM6 E;  3GON A;  3OTO I;  2NUE A;  4OX9 I;  5LMU E;  4YY3 E;  4DPY A;  1HNW E;  4HAC B;  4DV4 E;  4DV7 I;  2L2N A;  4LF5 I;  2BV3 A;  4JI5 I;  1YYW A;  4LF6 I;  4X65 E;  1B63 A;  2UXD E;  2Q2E B;  4DV3 I;  2HFS A;  3B8H A;  4P7A A;  1Z0W A;  2RS6 A; 
#chains in the Genus database with same CATH topology
 4JV5 E;  2YTI A;  1IQS A;  2L8T A;  2CGE A;  2GHF A;  3IWB A;  4DUZ I;  2JOX A;  3K6Q A;  4OO1 B;  2RPC A;  4MU1 A;  2V8Q B;  4F9C B;  4DU8 A;  4LCF A;  4OOG C;  2VQF E;  1OJ4 A;  4X9J A;  3M7N D;  1RHY A;  2LTS A;  4HXZ A;  1HR0 E;  3ZZ0 A;  1YPN A;  3MSW A;  1Z0T A;  3MHH C;  3ZM7 A;  3CDI A;  5JEA D;  2EMK A;  2EMI A;  1N0U A;  2A25 A;  2F1D A;  3DJW A;  4QNK A;  4YY3 I;  5LMU I;  3WU5 A;  1XXE A;  4LOM A;  4OO1 C;  1HNW I;  3JAM C;  1PJT A;  4DV2 E;  3HJC A;  1RRE A;  3MHS C;  4ZYD A;  3UK3 C;  3WU4 A;  4BA2 A;  2V85 A;  2YTG A;  4JI2 E;  1ZBT A;  4F9B B;  5EKW A;  2DLQ A;  4IFD F;  4LFB I;  2UXC E;  2LUP B;  2JVA A;  4MU4 A;  4DR4 E;  3H1C A;  2PNZ B;  2EOR A;  4WX9 A;  3PYD A;  5IXM B;  2RTX A;  3C4T A;  2LJH A;  3P1X A;  5GME A;  4R2Q A;  2DEI A;  2ODR D;  2M9A A;  2GO4 A;  2O1T A;  2J65 A;  2EPA A;  2ZBK B;  1BBG A;  2MDG A;  4GEQ B;  2M7Q A;  2DEJ A;  1T4N A;  1R6L A;  4BCA A;  1Z5B A;  2EOJ A;  1TN9 A;  5A2Q C;  4DPX A;  4X64 I;  1UDN A;  1USV A;  4AIM A;  1UDO A;  4M30 A;  1EH8 A;  4WUD A;  1Z0E A;  3QT5 A;  4JI8 E;  1WUU A;  1ELO A;  1ZR9 A;  2VQF I;  3P3G A;  4LFC I;  4FW9 A;  2NPF A;  2EOO A;  3JTZ A;  4OO1 F;  3Q1Q A;  2BA0 G;  4GKK E;  3HQ1 A;  4R2A A;  2VF3 A;  1SFE A;  3FIG A;  2CPN A;  4RHB B;  5DNL A;  4P78 A;  1F2I G;  3ZKD A;  2JY9 A;  3M85 D;  3WU3 A;  4WSG A;  5CFF E;  4DR1 I;  2EM9 A;  2EOE A;  4O4K A;  2N3H A;  1EI1 A;  1H74 A;  4BBY A;  4TUI A;  4OX9 E;  2I9I A;  4JI2 I;  2C37 A;  2L2M A;  5IV8 B;  4JI0 E;  1UN6 B;  3HTX A;  4LCG A;  4ED4 A;  3IWC A;  1IBK I;  2UXC I;  4KHP I;  2DMI A;  4DR4 I;  2UUA E;  1A1G A;  1UDQ A;  2EMC A;  2EOQ A;  3ADG A;  4WXD A;  1GQE A;  5AC4 A;  4B3R E;  3QT6 A;  4LF5 E;  2O1U A;  4JI5 E;  5FLX C;  2X36 A;  1D6T A;  4FW6 A;  2CVE A;  2J7J A;  4O24 A;  2L3J A;  1FI4 A;  4DR3 E;  1T39 A;  2ADR A;  3M99 B;  4WSP A;  3JAM Q;  4X66 I;  4LF9 E;  1FKA E;  5JEA C;  4WYQ B;  2L33 A;  4UTG A;  1FJG I;  1E3H A;  4WXC A;  3EPL A;  2YTJ A;  2IOP A;  4IZK A;  3J7Y p;  1O0W A;  1Z59 A;  1X49 A;  4X62 I;  4R2R A;  3Q6M A;  2B3T B;  1Y6Z A;  4DV1 I;  2E5L E;  3EPJ A;  2JWO A;  1FNM A;  3QT8 A;  2BR2 A;  4BMJ A;  3M7N G;  2HJJ A;  2PO0 A;  5IWA E;  2WBS A;  2EOI A;  1NEI A;  5A69 A;  1UBD C;  4GKK I;  2EPK X;  2IHR 1;  4F2J C;  1USU A;  4XTJ A;  2UU9 I;  2ODR C;  1IQO A;  4JI1 I;  5A2Q Q;  3L00 A;  1EKZ A;  4B3M E;  4JG4 A;  4O5G A;  2BM1 A;  3TQM A;  2EPZ A;  1YYK A;  1A1K A;  1AAY A;  1VI7 A;  2JXP A;  3ADI A;  2EPR A;  4B3S I;  2EPN A;  2GLI A;  2GO3 A;  4JI0 I;  1IBM I;  1MU5 A;  2MC6 A;  2KHX A;  2Z5C B;  2EPO A;  3PYG A;  3V2U C;  1UIL A;  2YTQ A;  2KOU A;  2UUA I;  3UHM A;  2VF1 A;  2EN6 A;  1WHQ A;  2IES A;  5DRP A;  1I94 I;  4B3R I;  4LFB E;  1WHN A;  5C0X A;  5JEA F;  5K36 D;  4O43 A;  5KL2 A;  2PRT A;  5A6J A;  2JEA B;  5BR8 E;  4BS9 A;  2L6M A;  2V86 A;  1TF6 A;  2R42 A;  4LF4 E;  4DR3 I;  2PO1 A;  2L3C A;  4DR7 I;  1YYO A;  4PRX A;  4LF9 I;  5KL6 A;  2DIX A;  2B9D A;  4J8Z A;  2VQE E;  4JI4 E;  1KTV A;  1XNR I;  2YSO A;  2K4V A;  2Z5B A;  1DGC A;  2LT7 A;  1JK2 A;  2DGC A;  2EMB A;  2EZ6 A;  4EMD A;  2YTO A;  5L3J A;  2EN3 A;  2JT2 A;  5DRO A;  4X64 E;  4YHH E;  1DQ3 A;  1MEY C;  3V5R A;  1RMD A;  1X6F A;  1P42 A;  2E5L I;  2EML A;  4GZN C;  4NXN E;  2R3V A;  1Z1B A;  2EFG A;  2WP8 B;  5IWA I;  5FLX Q;  1RC7 A;  4L5N C;  2VRD A;  4DV5 E;  5F3W A;  2YRK A;  2MDR A;  4GKJ I;  1A1F A;  2V8P A;  3D4J A;  5DNX A;  4LFC E;  3M85 G;  1ZM4 A;  1XMQ I;  3OML A;  4B3M I;  1Z5C A;  3GME A;  2NN6 E;  2JE6 B;  4AID A;  2HKJ A;  3LTO A;  4P52 A;  4N4R B;  4I8O A;  1WXR A;  3K85 A;  2O3Z A;  1H7S A;  3EQ1 A;  1PIE A;  2A2C A;  2RQL A;  4RPF A;  4DR1 E;  2YU8 A;  2EOX A;  2JR1 A;  3BF2 A;  2PO2 B;  4MLV A;  4IZJ D;  1G2F C;  2WW4 A;  3ZZT A;  4IFD A;  4F9A B;  4BHC A;  1IBK E;  4NXM E;  4HAC A;  3HUL A;  2YTD A;  4Q35 B;  4LF8 E;  1XMO E;  4KHP E;  2PNM A;  5C0X E;  5BR8 I;  2EL5 A;  1PKP A;  1ZM3 A;  1WRJ A;  4LF4 I;  3EPK A;  2C38 A;  1Z5A A;  3NZK A;  3P06 A;  5DRQ A;  1MX0 A;  3VHT B;  2YT4 A;  2VQE I;  4JI4 I;  2D9H A;  1N32 E;  3U1Y A;  5A6A A;  2Q8U A;  5K36 B;  2EPU A;  1U2R A;  1A1L A;  3J7A M;  2CSH A;  3DD6 A;  4X66 E;  3RMP A;  4FWG A;  4FW7 A;  3ZOQ B;  1N33 E;  1S4E A;  4Z7C A;  3VYX A;  2NUG A;  1FJG E;  4YHH I;  5AE3 A;  4NXN I;  3GCM A;  1FWK A;  2BB8 A;  4ZYH A;  3L7Z B;  1HK7 A;  4X62 E;  4LF7 E;  4X8W A;  4MU0 A;  1BBO A;  4DV5 I;  4ZYE A;  4U3B A;  2YSP A;  4DV1 E;  2O1W A;  1HNX I;  4OO1 A;  1X5W A;  5K36 C;  2DRP A;  5A6B A;  4MDT A;  1STU A;  4ISA A;  2HK3 A;  5LMN I;  4GQU A;  2FTX B;  2UU9 E;  1FWL A;  3QT7 A;  2G7H A;  2HKE A;  4MU3 A;  4JI1 E;  4ZYG A;  2EN2 A;  4FK5 C;  4IZK B;  4LTY A;  2JP9 A;  4JYA E;  3ZKB A;  2ENA A;  2B7V A;  2LJU A;  2EM8 A;  1X6H A;  2LMZ A;  2LV2 A;  2WCC 3;  1B62 A;  4B3S E;  1PVG A;  5AE2 A;  2M1S A;  3T1H E;  2V83 A;  1IBM E;  1OYP A;  4NXM I;  4IFD E;  2A2D A;  4LF8 I;  3H09 A;  1OYS A;  1XMO I;  1MGT A;  4FN5 A;  2UUB E;  3Q6N A;  1SR9 A;  4MYU A;  2UUC E;  1I94 E;  2EPL X;  2C39 B;  1Y60 A;  2NN6 B;  4IZJ B;  4DUY E;  1Z0B A;  2PNZ A;  1N32 I;  2F8B A;  1N36 E;  4UT4 A;  3WU6 A;  4DR7 E;  5DNY A;  1T4O A;  2YZT A;  1KYQ A;  1IBL E;  1XNR E;  1N33 I;  3P3C A;  2EE8 A;  2HHH E;  4R2P A;  2CG9 A;  3B4T A;  3P3E A;  5EL9 A;  4DV6 I;  3F6H A;  5K36 F;  5KL4 A;  5GMD A;  2UXB I;  2EOY A;  4LF7 I;  1AH5 A;  2YTP A;  1YZ9 A;  5C0X B;  2EOM A;  5LLQ A;  2V2Q A;  5AE1 A;  1NZ0 A;  2V34 A;  4MYT A;  1X6E A;  3KWR A;  1QZR A;  2RS7 A;  4OO1 E;  2LCE A;  1XNQ I;  2EM7 A;  3AV0 A;  1EH6 A;  1QU6 A;  3P76 A;  1T38 A;  3BID A;  4GKJ E;  1J26 A;  1PJQ A;  2BA1 D;  4HEI A;  2ELY A;  2EPX A;  4BA1 B;  1B69 A;  4JI3 E;  2JYA A;  1XMQ E;  4FWH A;  3ZZU A;  1J5E I;  4JYA I;  4DU7 A;  2WNR B;  2EP3 A;  2DB2 A;  3T1Y I;  1Z0G A;  4L8N A;  3LPS A;  2LJP A;  4JI6 I;  3T1H I;  4DV0 I;  3BGH A;  2EM0 A;  2EN8 A;  4KZS A;  3HPZ A;  3EPH A;  4N3O A;  1N34 I;  2UUB I;  1ZXN A;  2UUC I;  2EM3 A;  5JEA A;  2V2Z A;  4K0K I;  2YPN A;  4J3D A;  4DUY I;  2IER A;  2N8X A;  3ADJ A;  3LNU A;  3VK6 A;  2ELZ A;  1YSA C;  1A6F A;  1N36 I;  4BC9 A;  4R1F A;  2JEB A;  1YFH A;  2YTN A;  2NN6 F;  1IBL I;  2HHH I;  4NZV A;  2NUF A;  3ECR A;  1S16 A;  1TF3 A;  4BA2 B;  1VIS A;  1KIJ A;  2Z5E A;  2DMY A;  4IFD B;  2EMG A;  2MKD A;  3J81 C;  3CWV A;  2N3G A;  2GS8 A;  3HPS A;  1HNZ I;  2R76 A;  3M6A A;  2RSM A;  2YTE A;  4AM3 A;  1Z0C A;  5A6K A;  2YWQ A;  2WBU A;  4DPW A;  4USM A;  5AC5 A;  1PDA A;  5KL7 A;  1UHZ A;  1DAR A;  1A1I A;  1E3P A;  2EPM X;  2AE8 A;  1HNX E;  4JI3 I;  4M1K A;  1ZM9 A;  2B7T A;  1H73 A;  1ZAA C;  1PJS A;  5LMN E;  2LRS A;  2HK2 A;  1N0V C;  2R1F A;  1JK1 A;  1KJK A;  5KL5 A;  4DKK A;  1NCS A;  3C6M A;  3VYY A;  5IT9 C;  2J7K A;  3J80 C;  2EM5 A;  2YRH A;  5FWK A;  4B3T E;  1Y4S A;  1NHH A;  4OKG A;  4IJD A;  2NN6 D;  2FV4 B;  4DR5 E;  1T4L B;  2V88 A;  2JOB A;  2Z5C A;  1KKH A;  2EQ0 A;  3BBG A;  3F6G A;  1Z0V A;  2BM0 A;  3PYE A;  5JEA E;  1L4S A;  4DR2 E;  2EOH A;  2PNL A;  4P7D A;  2EOZ A;  1UDS A;  4WFT A;  2EWL A;  4AQY E;  1KVK A;  5LL6 R;  4R03 A;  4MLQ A;  2O1V A;  4BHB A;  2JEA A;  2ZM6 I;  4QNJ A;  2CT1 A;  2EJ4 A;  4LFA E;  1UEK A;  4WUC A;  2LUQ A;  5C0X D;  4Q28 A;  3IWD A;  2H36 X;  1GZ6 A;  3PS1 A;  2C37 B;  4WUB A;  2LBS B;  1G2D C;  3KZZ A;  1MG7 A;  2LO3 A;  3KZY A;  4DV6 E;  5TSE A;  4I3H A;  4URL A;  3B78 A;  1XHK A;  4FW3 A;  4MQY A;  4DV4 I;  2UXB E;  2EOF A;  1YH8 A;  1EH7 A;  2EPP A;  4Z7Y A;  2KON A;  2BA1 G;  2IOQ A;  3HKM A;  4X65 I;  4DXL A;  2EMZ A;  2WP8 A;  3K17 A;  3PS3 A;  2NAB A;  1XNQ E;  2UXD I;  1A1H A;  3U1K A;  2CZ9 A;  4DR6 E;  2M4I A;  2GQ0 A;  4F54 A;  2WBT A;  2VES A;  4TUG A;  5T6J A;  1NHI A;  2L92 A;  3J81 Q;  1J5E E;  4NHR A;  4U3D A;  2JE6 A;  4JV5 I;  4B3T I;  4JI7 E;  3THO B;  4DMI A;  3T1Y E;  4KWY A;  4IS1 C;  4USK A;  4RH8 A;  1Y4U A;  4JI6 E;  2BR2 B;  2LVH A;  4DR5 I;  1DI2 A;  3QG5 C;  2PO0 B;  4DV0 E;  5JEA B;  2EL4 A;  2EQ1 A;  2PO2 A;  4FW4 A;  4DR2 I;  2CTD A;  1N34 E;  3AUZ A;  3ADL A;  2K7I A;  4PU9 A;  2F4V E;  2ENC A;  4R2E A;  2EMF A;  4AQY I;  4K0K E;  1EA6 A;  1HR0 I;  4FW5 A;  4LFA I;  2E72 A;  1K47 A;  2LTR A;  4IFD D;  2EMY A;  2EQ3 A;  3CDJ A;  5IT9 Q;  2L2K B;  4M9V C;  4M2Z A;  2OI2 A;  3J80 Q;  4HY1 A;  2NA2 A;  4DV2 I;  2DSY A;  5K36 A;  4R2D A;  3OTO E;  3PS2 A;  4NBQ A;  2EL6 A;  3PRY A;  2MKN A;  3C4B A;  2HFU A;  3LML A;  2HC5 A;  1H72 C;  4R8O A;  1NHJ A;  4FWD A;  2V87 A;  1R6M A;  2GPI A;  2NN6 C;  1HNZ E;  2V2V A;  2ZIT A;  4KQV A;  4R2C A;  1A1J A;  2EM4 A;  2HGH A;  3K1J A;  2FGG A;  4HYM A;  2VE7 C;  2EPC A;  3L7Z A;  3C6K A;  1ZXM A;  4DV7 E;  2PO1 B;  2JEB B;  1YHC A;  3KRN A;  1RR9 A;  4DR6 I;  4LF6 E;  1ZU1 A;  1LLM C;  2X7I A;  2Z5B B;  4PRV A;  3JU0 A;  2EN7 A;  4DV3 E;  4F6M A;  4JI7 I;  2E1R A;  1H7U A;  4OO1 D;  2AJ4 A;  5C0X C;  4ZVI A;  5A6B D;  1ZM2 A;  3PYF A;  2V89 A;  2ENH A;  3F0N A;  4JI8 I;  3H4L A;  2EMX A;  4DPU A;  4F6N A;  4HTG A;  3DF6 A;  4DUZ E;  1IMU A;  4LPF A;  3J7A G;  2F4V I;  3GLL A;  1BKN A;  1QNT A;  3THN A;  2XEX A;  1X48 A;  2YTF A;  4OZE A;  5ELW A;  2DLK A;  1WJP A;  1X47 A;  2EM2 A;  3LLH A;  4LCH A;  4DPT A;  2C39 A;  1RQ0 A;  2I13 A;  2NN6 A;  4IZJ A;  2RSI A;  2YRM A;  3B82 A;  2BA0 D;  2ZM6 E;  3GON A;  2EN4 A;  3OTO I;  2EOS A;  5K36 E;  2NUE A;  4OX9 I;  5LMU E;  4YY3 E;  2EM6 A;  4IS9 A;  4DPY A;  2YU5 A;  1HNW E;  4HAC B;  4LU9 A;  1N3G A;  2BBG A;  2EMA A;  4DV4 E;  5DRR A;  2L2N A;  2C38 B;  4DV7 I;  4LF5 I;  2BV3 A;  4JI5 I;  2E1M A;  5C0X F;  5AAS A;  1GTK A;  2EMH A;  4WPY A;  1P47 A;  1YYW A;  1OYR A;  5KL3 A;  1Y5Y A;  4LF6 I;  4BC7 A;  4M0V A;  4X65 E;  2LE2 A;  4R2S A;  1B63 A;  1ZBQ A;  2MC5 A;  1YUJ A;  2UXD E;  5ADZ A;  2Q2E B;  2WZO A;  1YUI A;  4DV3 I;  4IFD C;  1BB8 A;  2HFS A;  4BA1 A;  2JPA A;  1X3C A;  3B8H A;  2EMW A;  4P7A A;  1Z0W A;  2WNR A;  2EN1 A;  2RS6 A;  3HXL A; 
#chains in the Genus database with same CATH homology
 4JV5 E;  2L8T A;  2CGE A;  3IWB A;  4DUZ I;  2JOX A;  3K6Q A;  2V8Q B;  4F9C B;  4DU8 A;  4OOG C;  2VQF E;  1OJ4 A;  2LTS A;  4HXZ A;  1HR0 E;  3ZZ0 A;  3MSW A;  1Z0T A;  3ZM7 A;  1N0U A;  5LMU I;  4YY3 I;  3DJW A;  3WU5 A;  1HNW I;  3JAM C;  4DV2 E;  3HJC A;  1RRE A;  3WU4 A;  2V85 A;  4JI2 E;  1ZBT A;  4F9B B;  4LFB I;  2UXC E;  2LUP B;  2JVA A;  4DR4 E;  3PYD A;  2RTX A;  3C4T A;  2LJH A;  3P1X A;  5GME A;  2DEI A;  2ODR D;  2O1T A;  2ZBK B;  4GEQ B;  2DEJ A;  2M7Q A;  1T4N A;  4BCA A;  1Z5B A;  5A2Q C;  4DPX A;  4X64 I;  1USV A;  4M30 A;  4WUD A;  1Z0E A;  3QT5 A;  4JI8 E;  1WUU A;  1ELO A;  2VQF I;  4LFC I;  4FW9 A;  2NPF A;  3JTZ A;  3Q1Q A;  4GKK E;  3HQ1 A;  2VF3 A;  3FIG A;  2CPN A;  4P78 A;  3ZKD A;  2JY9 A;  3WU3 A;  5CFF E;  4DR1 I;  2N3H A;  1EI1 A;  1H74 A;  4BBY A;  4TUI A;  4OX9 E;  4JI2 I;  2L2M A;  4JI0 E;  3HTX A;  4ED4 A;  2UXC I;  1IBK I;  3IWC A;  4KHP I;  4DR4 I;  2UUA E;  3QT7 A;  3ADG A;  1GQE A;  4B3R E;  3QT6 A;  4LF5 E;  2O1U A;  4JI5 E;  5FLX C;  2X36 A;  1D6T A;  1FI4 A;  2L3J A;  4DR3 E;  4WSP A;  3JAM Q;  4X66 I;  4LF9 E;  1FKA E;  4WYQ B;  2L33 A;  4UTG A;  1FJG I;  2IOP A;  4IZK A;  3J7Y p;  1O0W A;  1Z59 A;  1X49 A;  4X62 I;  3Q6M A;  2B3T B;  1Y6Z A;  4DV1 I;  2E5L E;  1FNM A;  2JWO A;  3QT8 A;  4BMJ A;  5IWA E;  4GKK I;  2IHR 1;  1USU A;  4XTJ A;  2UU9 I;  2ODR C;  4JI1 I;  5A2Q Q;  1EKZ A;  4B3M E;  4JG4 A;  2BM1 A;  1YYK A;  3ADI A;  4B3S I;  4JI0 I;  1IBM I;  1MU5 A;  2MC6 A;  2KHX A;  2Z5C B;  3PYG A;  3V2U C;  1UIL A;  2UUA I;  2KOU A;  2VF1 A;  1WHQ A;  1I94 I;  4B3R I;  4LFB E;  1WHN A;  5BR8 E;  4BS9 A;  2L6M A;  2V86 A;  2R42 A;  4LF4 E;  4DR3 I;  2L3C A;  4DR7 I;  1YYO A;  4PRX A;  4LF9 I;  2DIX A;  2B9D A;  4J8Z A;  2VQE E;  4JI4 E;  1KTV A;  1XNR I;  2K4V A;  2Z5B A;  2EZ6 A;  4EMD A;  5L3J A;  4X64 E;  4YHH E;  1DQ3 A;  3V5R A;  2E5L I;  4NXN E;  2R3V A;  2EFG A;  5IWA I;  5FLX Q;  1RC7 A;  4L5N C;  4DV5 E;  5F3W A;  2MDR A;  4GKJ I;  2V8P A;  3D4J A;  4LFC E;  1XMQ I;  1ZM4 A;  3OML A;  4B3M I;  1Z5C A;  2HKJ A;  3LTO A;  4P52 A;  4I8O A;  1WXR A;  3K85 A;  1H7S A;  2A2C A;  1PIE A;  4RPF A;  4DR1 E;  2JR1 A;  4IZJ D;  2WW4 A;  3ZZT A;  4F9A B;  1IBK E;  4NXM E;  4HAC A;  3HUL A;  4LF8 E;  2PNM A;  1XMO E;  4KHP E;  5BR8 I;  1PKP A;  1ZM3 A;  4LF4 I;  3P06 A;  1Z5A A;  1MX0 A;  2YT4 A;  2VQE I;  4JI4 I;  1N32 E;  1U2R A;  3J7A M;  4X66 E;  3RMP A;  4FWG A;  3ZOQ B;  1N33 E;  1S4E A;  4Z7C A;  3VYX A;  2NUG A;  1FJG E;  4YHH I;  5AE3 A;  4NXN I;  1FWK A;  1HK7 A;  4X62 E;  4LF7 E;  4X8W A;  4DV5 I;  4DV1 E;  2O1W A;  1HNX I;  1STU A;  2HK3 A;  5LMN I;  2FTX B;  2UU9 E;  1FWL A;  2G7H A;  2HKE A;  4JI1 E;  4IZK B;  4LTY A;  4JYA E;  3ZKB A;  2B7V A;  2LMZ A;  1B62 A;  4B3S E;  1PVG A;  5AE2 A;  1IBM E;  2M1S A;  2V83 A;  3T1H E;  4NXM I;  2A2D A;  4LF8 I;  3H09 A;  1XMO I;  4FN5 A;  2UUB E;  3Q6N A;  1SR9 A;  4MYU A;  2UUC E;  1I94 E;  4IZJ B;  4DUY E;  1Z0B A;  1N32 I;  2F8B A;  1N36 E;  4UT4 A;  3WU6 A;  4DR7 E;  5DNY A;  1T4O A;  2YZT A;  1IBL E;  1XNR E;  1N33 I;  2HHH E;  4DV6 I;  2CG9 A;  3F6H A;  5GMD A;  2UXB I;  4LF7 I;  1YZ9 A;  2V2Q A;  5AE1 A;  1NZ0 A;  2V34 A;  4MYT A;  3KWR A;  1QZR A;  2RS7 A;  1XNQ I;  3AV0 A;  1QU6 A;  4GKJ E;  1J26 A;  4JI3 E;  1XMQ E;  4FWH A;  3ZZU A;  1J5E I;  4JYA I;  4DU7 A;  2DB2 A;  3T1Y I;  1Z0G A;  4L8N A;  3LPS A;  2LJP A;  4JI6 I;  3T1H I;  4DV0 I;  4KZS A;  3HPZ A;  4N3O A;  1N34 I;  2UUB I;  1ZXN A;  2UUC I;  2V2Z A;  4K0K I;  4DUY I;  3ADJ A;  3LNU A;  3VK6 A;  1A6F A;  1N36 I;  4BC9 A;  4R1F A;  1IBL I;  2HHH I;  2NUF A;  1S16 A;  1VIS A;  1KIJ A;  2Z5E A;  2DMY A;  3J81 C;  3CWV A;  2N3G A;  2GS8 A;  3HPS A;  1HNZ I;  3M6A A;  2RSM A;  1Z0C A;  4DPW A;  4USM A;  1UHZ A;  1DAR A;  1HNX E;  4JI3 I;  4M1K A;  1ZM9 A;  2B7T A;  1H73 A;  5LMN E;  2LRS A;  2HK2 A;  1N0V C;  4DKK A;  3VYY A;  5IT9 C;  2J7K A;  3J80 C;  5FWK A;  4B3T E;  1Y4S A;  1NHH A;  2FV4 B;  4DR5 E;  1T4L B;  2V88 A;  2JOB A;  2Z5C A;  1KKH A;  1Z0V A;  2BM0 A;  3F6G A;  3PYE A;  4DR2 E;  2PNL A;  4P7D A;  4WFT A;  2EWL A;  4AQY E;  1KVK A;  5LL6 R;  4R03 A;  2O1V A;  2ZM6 I;  4LFA E;  1UEK A;  4WUC A;  2LUQ A;  4Q28 A;  3IWD A;  2H36 X;  1GZ6 A;  4WUB A;  2LBS B;  1MG7 A;  4I3H A;  4DV6 E;  4URL A;  3B78 A;  1XHK A;  4DV4 I;  2UXB E;  4Z7Y A;  2KON A;  2IOQ A;  4X65 I;  4DXL A;  3K17 A;  1XNQ E;  2UXD I;  2CZ9 A;  4DR6 E;  2M4I A;  2GQ0 A;  4F54 A;  4TUG A;  5T6J A;  1NHI A;  2L92 A;  3J81 Q;  1J5E E;  4JV5 I;  4B3T I;  4JI7 E;  4DMI A;  3T1Y E;  4USK A;  1Y4U A;  4JI6 E;  4DR5 I;  1DI2 A;  4DV0 E;  4DR2 I;  1N34 E;  3AUZ A;  3ADL A;  4PU9 A;  2F4V E;  4AQY I;  4K0K E;  1EA6 A;  1HR0 I;  4LFA I;  1K47 A;  2LTR A;  5IT9 Q;  2L2K B;  4M2Z A;  2OI2 A;  3J80 Q;  4HY1 A;  2NA2 A;  4DV2 I;  2DSY A;  3OTO E;  3PRY A;  3C4B A;  2HFU A;  3LML A;  1H72 C;  4R8O A;  1NHJ A;  4FWD A;  2V87 A;  2ZIT A;  2V2V A;  1HNZ E;  4KQV A;  3K1J A;  2FGG A;  4HYM A;  2VE7 C;  1ZXM A;  4DV7 E;  1RR9 A;  4DR6 I;  4LF6 E;  2X7I A;  2Z5B B;  4PRV A;  3JU0 A;  4DV3 E;  4JI7 I;  2E1R A;  1H7U A;  2AJ4 A;  4ZVI A;  1ZM2 A;  3PYF A;  2V89 A;  3F0N A;  4JI8 I;  3H4L A;  4DPU A;  3DF6 A;  4DUZ E;  3J7A G;  2F4V I;  1BKN A;  2XEX A;  1X48 A;  1X47 A;  3LLH A;  4DPT A;  1RQ0 A;  4IZJ A;  3B82 A;  2ZM6 E;  3GON A;  3OTO I;  2NUE A;  4OX9 I;  5LMU E;  4YY3 E;  4DPY A;  1HNW E;  4HAC B;  4LU9 A;  4DV4 E;  4DV7 I;  2L2N A;  4LF5 I;  2BV3 A;  4JI5 I;  2E1M A;  5AAS A;  4WPY A;  1YYW A;  4LF6 I;  4BC7 A;  4M0V A;  1B63 A;  2LE2 A;  4X65 E;  1ZBQ A;  2MC5 A;  2UXD E;  2Q2E B;  5ADZ A;  4DV3 I;  2WZO A;  2HFS A;  3B8H A;  4P7A A;  1Z0W A;  2RS6 A;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...