2UU9K

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
molecule tags Ribosome
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uu9K00
3J7AP 4DV1K 5LMUK 4DUZK 4JI4K 1HNXK 4X65K 4LF4K 5LMNK 4DR7K 2ZM6K 5AJ3K 2VQEK 5BR8K 4LF7K 4JV5K 4LF9K 1HNZK 5LL6Z 2UXBK 4GKJK 4DR2K 4NXMK 3J80O 2UXCK 3T1YK 4JI3K 4JI0K 5FLXO 4X62K 2E5LK 1N32K 2HHHK 4DV4K 1IBKK 4B3TK 4JI8K 4K0KK 4JI1K 4LF8K 2F4VK 4LFBK 1IBLK 4DUYK 1XNRK 4DV5K 4JI6K 4DR6K 4LF5K 1HR0K 4KHPK 3OTOK 1FJGK 4LFCK 1N36K 4B3MK 4DR3K 4CW7B 4DR4K 2UXDK 5IWAK 4YY3K 4B3RK 4YHHK 3JAMO 2UUAK 1HNWK 2UUBK 1N33K 4LFAK 4X66K 3T1HK 3J7YP 1XNQK 5IT9O 4DV6K 5A2QO 3J81O 1XMQK 4DV3K 1XMOK 4JI2K 4DR5K 1IBMK 4X64K 4DR1K 4DV7K 2VQFK 4JYAK 4OX9K 4DV0K 4AQYK 2UUCK 4GKKK 4B3SK 4NXNK 4DV2K 1J5EK 1I94K 4JI5K 4LF6K 4V19S 2UU9K 4CVNE 1N34K 4JI7K
chains in the Genus database with same CATH superfamily
4KTQA 3SQ1A 4ELVA 3MWTA 3VQ8A 4FJ7A 4CZIA 4CGFA 1SAZA 5FROA 1C0GA 4BRKA 3ULEA 3VGLA 2Q1NA 3PO4A 1XUPO 4O4GA 5M1PA 5EU7A 3VA0A 4C8LA 4JD2B 5DMRA 3NH1A 2B5JA 4NXMK 1O1WA 2QXFA 4M3RA 1NJZA 1LAWA 3C0BA 3G6EN 2YKNA 3U9ZA 5FLXO 3THYA 5JLFA 3RMAA 2HHHK 4JRPA 3VQ5A 2KTQA 4DSKA 3MEDA 4JI8K 4K0KK 4C8OA 3MWPA 5C12A 4LFBK 1NKBA 1IBLK 4M45A 4OKKA 1JLCA 4E7HA 3E66A 3KZBA 3F2KA 1XNRK 3L4QA 4KB1A 4EP4A 4BVPA 5ELZA 3DOLA 2YHYA 1HYVA 4H0TB 1QQOA 1NK7A 3CC2N 1DLOA 3LDNA 3AGKA 1T05A 3L2QA 4WFNL 2WUSA 2P9UA 1SQKA 3DLEA 3UB5A 4OKJA 1QSLA 4B3RK 3NE6A 3ALYA 2A6AA 1N33K 2QWNA 4E19A 5AQPA 5K14A 3TTFA 1WSFA 3HP9A 3CFRA 2KZMA 4RW8A 5BPLA 1RBVA 4B8AB 4E3SA 4CJFA 2G8KA 1RNHA 2BGGA 3AVIA 3LZIA 3OYAA 2ZJPL 4W5TA 4NYNA 1NBWA 3SAHA 4ZTJA 1JLFA 3IS9A 1IKVA 4BE1A 4PQUA 1NGGA 2V52B 1BQMA 1B9FA 1WAFA 4IOXA 1YJNN 3M6GA 3EY1A 3V9UA 5J2MA 2O8CA 2WBNA 3V9WA 4W5OA 1NJXA 2JLEA 2HNZA 1FKPA 1YI2N 3L2VA 4IWVA 3HSCA 2W6LA 2F9WA 2BTFA 4YORA 3VQDA 4BR2A 2D0CA 5AQYA 1Q18A 4OLAA 4OVLA 3QIPA 1WSHA 1JL2A 1WUAA 2P9KA 2VG5A 2YV0X 3U9DA 4AHSA 3R1XA 4OGCA 1YUWA 3DXKA 4JKGB 3FZLA 1X1PA 5JS2A 4CJQA 1UAXA 2OCEA 3SUOA 1NK8A 1WN7A 1RTIA 1RILA 4CHQA 4C1NI 4Z4EA 3C6AA 4RWTA 1VSJA 3SK3A 3O80A 3THYB 2ITGA 3OJSA 4GV6A 5E84A 4CIGA 3T7ZA 5LJVA 3O3GA 1HR0K 5AQVA 5AQUA 4Y1CA 3LALA 1KLMA 3LDPA 1RDWX 4DTSA 2YNFA 1KVBA 3JAMO 3VERA 3A5LC 3C6TA 4X66K 3L2UA 3NFAA 4YOWA 1QZ5A 3BZCA 3LP3A 3A5NC 3Q7BA 3RWUA 2A41A 3TANA 4JKAA 1T03A 3PX0A 1W2BM 3H45C 4JKFA 2HMIA 3WUHA 1LAVA 1YVNA 1L3UA 3D0PA 5ADXH 3C7NA 4O5FA 1BWFO 4LH5A 1QS4A 3OYLA 2G8FA 1CZAN 3U4LA 2UUCK 4CEBA 3SPYA 2OTLN 3ZEUA 1WAJA 3C6HA 4WQ4A 3D2EA 4K42A 3GOIA 2FXUA 4Y0WA 5EY4A 2UU9K 4CVNE 4MO5A 1J9AA 4AH9A 4JHDB 2QM1A 2UYTA 3EE9A 4DV1K 4JI4K 4IXCA 4CK1A 5I9EB 4XIUA 3AO2A 4BRQA 4FLYA 4BVOA 4B1ZA 4PHTX 1TAQA 3OS0A 2P9UB 1Q9XA 4KFBA 1C0FA 5F1XA 2UXBK 3OYJA 2NZTA 4FOEA 3AVNA 2H3GX 5AQGA 4YFUA 1QHTA 3L4IA 3CJ9A 1HJOA 4CHYA 3QETA 2IC3A 1M90O 4E0DA 4M42A 4O8UA 2QWLA 3CQXA 1SS6A 3RR8A 4FLUA 1BIZA 2PYLA 1K9MO 1S1TA 4CGHA 5FRNA 3BUZB 3EO3A 1YIJN 2PY5A 2JWKA 3ZT1A 1HQEA 1SKRA 2HBMA 3GBTA 4JI6K 3F5TA 1CZBA 3MXJA 1EKEA 1RTJA 5HOOA 1IKYA 3TTDA 3QNNA 1BU6O 4A61A 3VA3A 4M63C 1A5WA 5E41A 3VEYA 3WXJA 1XHXA 2DFEA 4DR3K 2RPIA 2Q36A 1VQ7N 2E1YA 2Q0RA 1ATRA 4JNEA 4UQGA 2E4LA 1W9HA 3J8AA 3ZSRA 4DB3A 2O8CB 2IVOA 2GV9A 1XNQK 1IG8A 2PBDA 1X9WA 3QESA 3V81A 4KB0A 4BROA 5GAHP 5BPMA 3VQ9A 2DTUA 1ATSA 2FF3B 1N8RO 3TAFA 2PAVA 3GDQA 5AQIA 3MN6A 3DM2A 3I55N 4B1WB 3DLRA 4JK7A 3AVCA 4FJLA 3AVFA 4QS8A 2EX3A 1VSEA 1J5OA 2GWJA 4IO8A 4DCHA 4AHVA 3VF6A 4K43A 3U3GA 3VPZA 1TK8A 2WFBA 3HRGA 1VHXA 2NRTA 4FJ9A 1HPMA 1HNXK 2KKZA 4IDHA 4Z4CA 4CF0A 4CFAA 2NNWA 2YKMA 1EWQA 3ENBA 4Z0UA 5AQOA 3CC4N 4N41A 4EHUA 3OHRA 4CBUA 2VWBA 4NCAA 1VRUA 3TABA 3FE1A 2P9IA 4BGBA 3V1QA 4FWOA 4DQPA 1NKCA 1T6DA 3AO4A 4KHSA 4E1NA 4OO1J 3KTQA 2CH6A 3GL1A 4BRLA 4QS9A 2B4JA 1G99A 2HVIA 3WNEA 4CJEA 4QAGA 1ESVA 1FKOA 2QWMA 3ENOA 4CESA 3K5OA 5AFUA 1YVUA 2KW4A 4PA1A 3CHWA 1IV0A 1JKHA 4QS7A 4DSIA 3VENA 1VQON 4DUYK 2YI1A 3VF2A 3K57A 3MCAB 3SAGA 3NHGA 4PWDA 1NK6A 2V7YA 1U49A 1NJIO 2A1SA 4KRFA 3CJAA 3HI0A 1L5UA 4KHPK 1RT3A 2EHGA 3OY9A 3O08A 1C0UA 3HK2A 1D9DA 2E2NA 4F9OA 4FK0A 2UXDK 1S6QA 4K41A 5M1OA 3I33A 4CZEA 1YT3A 2I5JA 2PFUA 4O0JA 4H4OA 4L8RB 4O55A 3RVCA 4CJUA 1TUYA 3VQPA 2YHWA 1G15A 3NCIA 4CGJA 1CZ9A 3L3UA 2VYPA 4FWQA 3UKRB 5SWMA 1S5JA 1XMQK 3KD5E 3CMAN 4CZGA 3EZ5A 3AVJA 4KHUA 4H5NA 3WNGA 4CD1A 1BA1A 3VMFB 4DG1A 4F3OA 1TKXA 1VSKA 3DLKA 4DQQA 1NM1A 1EX4A 4XH5A 4AQYK 3HJFA 4FWLA 4IJAA 5H1SQ 3TU5A 1QHAA 4GW6A 3DWLA 3C94A 3CF5L 3OYDA 4JKCA 4AILC 5CY4A 3O6WA 4DS5A 1RT4A 5DM6L 4H5RA 3TR8A 4U67L 1YTUA 4DR7K 4PKGA 5AQKA 1TAUA 4WQ5C 2VCPA 3HTVA 5FRMA 3ZT4A 2DY4A 4BR0A 4LF9K 4CEAA 4B08A 4CZKA 1RGIA 3AO1A 3SQ0A 3CCQN 4W5NA 3VEXA 4C8MA 3OYBA 4Z4IA 1DTQA 4FJMA 4H0PA 3CERA 1QVFM 4X62K 5AQHA 4I9LA 1U6ZA 1ATNA 3DXMA 4ZTFA 4BRDA 2YNGA 1U4BA 3S9HA 4KI4A 3QFPA 1NOZA 1NGDA 3CCSN 3QEXA 4L3QA 2XY8A 4N56A 5JVGL 3M8PA 4RTFD 3M8RA 4B1VA 1WNSA 3EE8A 1Q9YA 4LF5K 1ZBFA 2F7TA 2HW3A 3OTOK 1Q7YO 5J1EA 3MDQA 2ATQA 4I9QA 2HHVA 4DF4A 4CW7B 4OPKA 2XY6A 4YHHK 4B8CA 3DXMB 5C25A 4LD0A 1RDBA 1Q86O 4KHYA 2D0BA 4EP5A 3CFOA 5AFUH 1VQ5N 1B92A 1TYQB 1EETA 3OBYA 5HP1A 5BPNA 3R6MA 4AM6A 4FSVA 4LSLA 2P9LB 1DT9A 2P9NA 3LWMA 2A1RA 2G8UA 3ULDA 1YJ9N 4CGDA 1CXUA 3EYZA 3VQEA 4FYDA 4G1QA 3LL3A 3LPTA 3CD6N 4J2DA 1D8YA 4ILJA 1ZBHA 2HHWA 2ZJRL 4OJRA 5J2NA 1RDUA 3D6RA 5CE3A 4CZJA 3VEWA 4V19S 1YAGA 4FW2A 3B6OA 2HOEA 3NF9A 1S1XA 4CEFA 4CI6A 4EHTA 1BISA 3LP2A 3ZT0A 3VEOA 3WNHA 4KHQA 3SUPA 4O44A 2E8AA 3D2EB 4B9QA 2KFZA 2YJFA 3ZT3A 2J4RA 3O1BA 4JKBA 4JK8A 4YOVA 3OYEA 1A5XA 3B6PA 4JD2A 1KLNA 4A57A 4DTOA 4N76A 1SUQA 1Z6RA 1QQCA 1HMVA 3SUNA 2G8WA 4N47A 5FPEA 4CF9A 3KLHA 2NRXA 4CHPA 3QLHA 5EOYA 4KHWA 1E4FT 1HLUA 1GLEG 2YX6A 3H08A 4CEOA 3DYAA 2AA4A 2IDOA 4J2BA 3T1AA 4BC4A 4ELUA 4M3WA 5AZIA 3TARA 4BY9C 1JLGA 3RMBA 5HLFA 4HUEA 4HTUA 4BDYA 1KTQA 4G9ZA 3NGYA 4FL9A 1C0MA 3FLCO 4DV5K 2FC0A 4Z4HA 2Y1JA 1LW0A 3THWA 4Q0BA 1T7PA 3VF4A 4BDZA 4GVMA 4ELTA 3TAMA 3OYMA 4GY2B 4YDUC 1O13A 1C6VA 4H5TA 3AARA 4FCYA 2CGLA 4IG3A 3K58A 1OKJA 2QKKA 2UUAK 3SAFA 1RBRA 1KFSA 4LFAK 2OZMA 1NOYA 1R59O 3N4PA 4ILGB 3BEXA 2P9NB 4WFAL 3BGRA 1BA0A 1LOTB 2D5RA 1KQSM 1K73O 4CGGA 4JI2K 3MCPA 3P83D 4YNQA 5KPTA 1L3SA 4FJNA 4BG9A 4W5RA 1E3MA 3CQYA 1T3VA 2NRHA 3L3VA 3VQBA 4J2AA 4FM1A 4I2PA 3QBXA 3AVGA 1MDUB 1RBSA 3UKUA 4FXDA 4GKKK 4KI6A 4NXNK 2E6MA 4ISFA 1YXQA 1GLCG 3L2RA 3KIOA 4KO0A 4OPAA 2W42A 5KQDA 5C42A 4FPBA 1GLDG 3KD1E 3PY8A 3VQ4A 4FJKA 5AQXA 1NGCA 1VQNN 3ZLJA 2YHBA 3E9OA 4DWIA 4OGEA 5F2RA 1KRPA 4BRAA 4CHNA 3CCVN 3LANA 1KAZA 5AQTA 5LL6Z 1HNZK 3VQ7A 2FLOA 1GLLO 4GNIA 4DR2K 2CGJA 5KRTA 4C8KA 1S1UA 2NLXA 4MFBA 3KJVA 1QE1A 2A42A 3AA3A 3M8QA 4IEIA 3WXIA 2GEMA 3OJUA 1GLFO 3RMCA 1QQNA 3LDSA 3ZX0A 2G8HA 3TSPA 3K9KA 4IG0A 4DMNA 1YJWN 2Z1IA 4IFYA 4F8RA 5KGWA 1EP4A 3U8XA 3LP0A 1C1BA 1CXQA 4CK3A 4RW4A 4B9MA 1F21A 1GOAA 1RDAA 4M3UA 4EIAA 3DLBA 4FW1A 2FBYA 4BRMA 4LFCK 1X3NA 3PX6A 3O3HA 2P9SB 1K8KB 4ICLA 1HNWK 4DFPA 2GWKA 3KWGA 4CZLA 1OH6A 1NK0A 4W5QA 3NGZA 1TK5A 1SL1A 1WOQA 2OPQA 1TKDA 3QERA 1LWEA 4DV3K 5HRSA 4DU4A 1XMOK 4M3YA 1SZ2A 2QKBA 5LJWA 4X64K 4K8XA 3J7ZO 3O4QA 4FZYA 5AQRA 4FOIA 4KTZA 3DLGA 2WONA 5TKYA 3CCEN 2O8FA 2F96A 3OYKA 3KK1A 1OVQA 1Z25A 3ZX2A 4CF1A 4A59A 1BGXT 4CJLA 1GLJO 3RSEB 2KZZA 1IKXA 3RTVA 4RW7A 4KPYA 4LF4K 3SLCA 1ZC6A 1QTMA 5EVZA 4FO0A 3V1OA 4B9LA 2HSTA 1WBBA 4AHTA 4KKOA 5LY3A 1LWFA 1NNEA 3ULEB 4BQZA 3WEEA 3NGIA 1C1CA 3P39A 1HX1A 1BOTO 3CIPA 4JI0K 2E5LK 3OW2M 3MN9A 2WTUA 1BIUA 2HF4A 3A0IX 3BP8A 3FZKA 3KKSA 4FLTA 3EKSA 2P1JA 2VG6A 3CETA 3AAPA 4FJ8A 3RSEA 2XO7A 1JLAA 3OYGA 4LF8K 4I2QA 1S9EA 1VSHA 4OPHA 1SKSA 1RT1A 4YOUA 5AQQA 5KPRA 3AVAA 3THVA 4I6MB 3PV8A 1ASWA 4BRFA 3DJCA 1T6CA 4WQ4C 2X6NA 3MAQA 3BDPA 3P5JA 1WLJA 2O8FB 4ISEA 3OS2A 3PUFA 3O9UA 3TSUA 4J2EA 2E20A 2OANA 5M1QA 4E7IA 3T19A 2VG7A 1DKGD 1X9MA 2ASPA 2ZF5O 1QQMA 3UE5A 2LSNA 2FBTA 3ATUA 5FDLA 4YOYA 4GVEA 3U3YA 3WXMB 1B9DA 1NKEA 4DSEA 4FJJA 1Q8IA 3KVGA 5FPNA 4RCHA 1SV5A 2VWKA 4IEEA 4ILHA 3DRPA 3O4NA 3A8YA 4XH1A 1I3AA 1KXPA 3VEVA 4WYBA 1Z05A 2VGNA 4N5SA 4CJTA 4KAZA 4JYAK 3WEEB 4CGIA 5CHIA 3C65A 3C7NB 3QB0A 3MX5A 5C15A 1LW2A 4DLGA 4B3SK 1KC8O 4MLEA 1N34K 1UWBA 3VETA 5JS1A 4BR4A 5HL7L 3J7AP 4PL8A 2YNHA 3SI6A 4X65K 5LMNK 4E1MA 3NF7A 4C23A 1W97L 1U04A 1VSMA 2IAJA 4E7LA 4JV5K 3HZ6A 3VQCA 3HL8A 3DOKA 4NLCA 4FVUA 2FSJA 3R3LA 4NCBA 4IFVA 1XC9A 3JS6A 2RKIA 1JL1A 4LY7A 4DTMA 4CERA 3VQAA 4CBXA 5CYMA 4EFHA 5FPMA 4IBNA 2BANA 3ISNC 4HVJA 1QSYA 2E2OA 3PLAA 2QWQA 2Q0UA 3T69A 4CCHA 1RBTA 4JAXA 4KH4A 3V9ZA 3SZ2A 3CI5A 2WC9A 2OTJN 3AVBA 1L3TA 5AQSA 4CEDA 3IUCA 1WSGA 3AVHA 4B3MK 3CYMA 4BR7A 2ZE2A 1GOCA 3CM6A 1RT2A 2IIRA 1DTTA 3NDKA 3E9LA 4NYFA 2QTDA 4MDBA 2X6SA 4ZHRA 3NF8A 3W3DA 4HTLA 4CJPA 3G4SN 2F8TA 4H0YB 5E26A 4OKEA 3NVMA 3G71N 2W40A 5AQWA 2D0OA 3MN7A 4BE0A 3KLFA 3K5LA 5CYQA 3OYFA 1TL3A 4EAHD 4MO4A 3C6UA 3I0RA 3PIPL 1MWKA 4WFBL 3FZFA 2R7YA 4OX9K 3ZSVA 4CF8A 4BRPA 2RHKA 1EXQA 1JCEA 4RG8A 5BRDA 3WNFA 2Q97A 1ZBIA 4JS5A 4HCCA 1GLAG 3K59A 3IDHA 2E2QA 4IZ9A 2ZQBA 3ZEUB 4CJRA 5AZIB 3U6FA 1NGJA 4IOCL 3PSIA 1BG3A 1TL1A 4E7JA 2IGIA 2DFFA 3CXCM 2HHUA 2CH5A 3VGMA 1IG9A 2HHTA 2I7PA 4JK9A 3L0QA 2E88A 3QDKA 3OYHA 3OA9A 1IKWA 3AVLA 1NK9A 3B8AX 1K6YA 1JLBA 3D2FB 3ZX3A 2UXCK 1C0TA 1HPZA 1T44A 3NAEA 1JXEA 3HSTB 2B6AA 4IOAL 3O3FA 4DTPA 4BE2A 3SYZA 3CCMN 2P9IB 1VSFA 3KWIA 1KD1O 1L3VA 1ZXOA 2QWPA 3D45A 3LAMA 4FM2A 4LSNA 1HYSA 2QWOA 2I7NA 3PIOL 3KK3A 2RN2A 4CJWA 1BHLA 3LDLA 4BC2A 3HOTA 2FF6A 2ZWHA 3F73A 3SV3A 2RF2A 3E01A 3IAYA 4FLZA 1C1AA 3KKRA 3RR7A 1IO2A 3P31A 3CM5A 3JXUA 3L6QA 4CJSA 4TSXA 2UUBK 4BRGA 4QOZB 4CFDA 1XC3A 1H1VA 1TYQA 4DTJA 3SBTA 3SPZA 3MXIA 5TKWA 1YTAA 1HNVA 4FM0A 2HVHA 4H5WA 3C95A 2GTDA 5AQLA 5AZJB 4PKHA 1S6PA 3K2PA 4JKEA 3HPHA 5AQNA 3VTHA 5D3GA 2VQFK 1KFDA 2YHXA 4H8KA 1ZBSA 4QCLA 4CHZA 4MDAA 3V6DA 1U2VB 3TAQA 1J5EK 2O4GA 5HROA 4H4MA 3EEQA 4FWKA 1NMDA 4FJXA 3TAPA 2YHAA 2P5OA 3ZSWA 3OYNA 3CJBA 2NUBA 3LWLA 4DQIA 3DI6A 3FGUA 3SBGA 5AJ3K 5B8HA 3THXA 2HBJA 3LP1A 3TPQA 1BDGA 5GINA 3EL2A 1N5YA 4GV3A 5BREA 3I56N 4HCBA 5MLCQ 1CLQA 3NVKA 4H0VB 2FBXA 4DS4A 1TK0A 3DAWA 4BRNA 4CE9A 1LWCA 1A5VA 2VGMA 3J80O 1NK5A 2X74A 3KLIA 3K0SA 1Q82O 4DV4K 3IRXA 5DK5A 5J2QA 4M7YA 2QEXN 2DPNA 3LPUA 4XEIA 2O8EA 4B3TK 1ASUA 4JI1K 4H0XB 1Q81O 1KAXA 3G25A 4JN4A 3OBWA 5JLHA 3SQ2A 4FWSA 3UKUB 4ISGA 2HHSA 4JRQA 4DTXA 4BGAA 4IKFA 4Q5VA 4HWIA 5JICA 4NB4A 4A2BA 3HVRA 3ZSXA 3ZYYX 3V9XA 4WE1A 4K25A 4AM7A 4LH4A 1NGBA 4YY3K 1RDDA 2HF3A 2OYQA 5F0XA 4BRHA 3FFKB 3VQQA 1MWMA 3I8DA 3WQTA 2QW9A 5KGXA 1ZYQA 4DV6K 4M41A 4BREA 4DTRA 1V4SA 3CCLN 5C10A 1FW6A 2O8BA 3J81O 1RFQA 3HO1A 3DLLL 4DQSA 3VEZA 3OVNA 4KTWA 2G8VA 3A2FA 3HOSA 3HPOA 4CHOA 3TAGA 1ILYA 1NJWA 1NGIA 3CG7A 1I39A 1QVGM 1SKWA 4PL7A 4DV2K 3H1QA 5AQJA 4JKHA 1I94K 3G0ZA 3CJCA 5KI6A 2Q3SA 1XHZA 1LCUA 2ASOA 2O8EB 3O1WA 2VWJA 1S22A 3HP6A 3AA2A 5AQFA 1HYZA 4FK4A 4Y1DA 1VQLN 2GELA 4I6MA 3R8EA 4FZZA 2VQEK 2NRVA 1UA0A 4B9UA 4WCEL 4BC5A 2Z1GA 1K8KA 3FZMA 4FVMA 5HBMA 1T8EA 2QI2A 3ZCMA 3VGKA 1JLEA 3VQ6A 3K5NA 4MQ3A 3M1FA 4E1JA 5ADXA 1SL2A 1IBKK 4F3TA 1X3MA 1Y64A 5AZJA 3ZETA 4DQ8A 5BRFA 1HUXA 3OS1A 2DFHA 4AHUA 1Z26A 4PUOA 1DEJA 3S41A 1S72N 2X78A 1K8AO 2O8BB 1X9SA 3KK2A 4DQRA 5C0YA 4K8ZA 1QSSA 4A62A 1MU2A 1NGHA 3F9KA 3AVKA 1V4TA 4IJNA 4M3ZA 3LM9A 1U2VA 5C2DA 3OYCA 3L8BA 4B9SA 5AR0A 3BY5A 3QMLA 4WF9L 4DF8A 1YHQN 2ETJA 3CMEN 2A3ZA 3CJ7A 2XHBA 3QFUA 2Y1IA 1U48A 3BF1A 3JSMA 1WSEA 2OPPA 5A2QO 4KREA 2A5XA 1N6QA 3AA5X 2ZGYA 3SV4A 2CGKA 3TSQA 1WSIA 1HNIA 4BQLA 2IVNA 4ID5A 1KCFA 3K9JA 3CFPA 5C2FA 4H03B 4FK2A 3SQ4A 3QEVA 4R79A 3AO5A 3O9RA 4PKIA 1MA9B 3IMXA 1HRHA 4I7FA 4IFEA 3M8SA 3HBTA 3SMPA 1BI4A 5I42A 1W7AA 3CC7N 4DUZK 2HHQA 1VSIA 1VQ8N 2KFNA 2FBVA 2BE2A 3IKMA 5DM7L 1SL0A 3KK7A 5BR8K 1VQMN 4LF7K 3ATVA 3MK6A 2E1ZA 1U47A 3O5BA 4CECA 4CIFA 4DSJA 4DSLA 2G8IA 3RMDA 2HHXA 1KAYA 2P51A 3T1YK 3CCJN 1W0HA 3THXB 1XI1A 4CFCA 3ZSYA 2O8DA 3IG1A 1VQPN 1P8ZA 2P5GA 2KLAA 4PY5A 1BI4B 4CJ3A 5I3UA 4A5BA 2V7ZA 2YJEA 1IJJA 3D7EO 4CJKA 3H1VX 3FR0A 3NH0A 4KH6A 3P1GA 4B9VA 1HJRA 1NGEA 2OZSA 1J54A 4RW9A 2D4WA 4BRIA 1TKTA 3ZSZA 4MLHA 2QXLA 3QIOA 1HKBA 4NLBA 3TAEA 4EZ6A 1N36K 4BG8A 4WQ5A 3QNOA 1BUPA 1YF5L 1FK9A 2P9PA 1RT6A 5JMVA 4RW6A 4YDUA 3S3OA 5BN9A 2O4IA 2ASMA 4KH5A 4DTNA 3HPGA 4CJ5A 1OH5A 3UKRA 1NWKA 1NMNA 5C24A 3H6EA 4Z94A 3SNNA 4A2AA 4AHCA 2ZJQL 4HUFA 3FZHA 1S3XA 4JLHA 1OH7A 2OPSA 3V4IA 3LM2A 3SMSA 5KPZA 2WOMA 3VN5A 4BRCA 3NH2A 1RBUA 3VESA 1XWLA 1KVAA 5GIPA 3DRRA 2F8SA 3F9MA 2D0PA 1ITGA 3BZKA 4YOTA 3S3MA 1D9FA 1UA1A 1UOCA 3QO9A 5GAEP 1TKZA 5JVHL 1KVCA 4AF1A 4JI5K 3QEPA 3JYTA 1RT7A 1BCOA 4CF2A 3E9PA 3LZJA 4JI7K 3CPEA 4DFMA 4H0OA 4CEEA 5LMUK 3H3NO 3ENHA 4BDPA 3NMUA 4CIEA 2HBLA 5KQ8A 4DU1A 2AJQA 3DXKB 4FPAA 1BQNA 4JKGA 2W41A 3OYIA 1VSDA 5J2PA 2BH1A 4DU3A 3AO3A 4BC3A 3MXMA 4CEQA 3AA4A 2ZGZA 5EXWA 3W0LA 3WQUA 4CJ4A 4LC9B 5KTQA 3NF6A 4FLWA 3WXKA 3G10A 1EWRA 3S3NA 4HHTA 1HKGA 4FWRA 1REVA 2IOCA 5SZTA 4IDKA 4B1UB 4U7BA 3E1YA 3RRGA 1VSLA 4A5AA 4BACA 4F2SA 3O8MA 2Z1JA 3THWB 2GX9A 1S1WA 1P90A 4DR6K 1WSJA 4GMJB 4BR9A 2QA4N 4OLBA 5FPDA 1NK4A 4H5VA 4FJGA 2FSNA 1FJGK 3LDOA 2BUPA 1HKCA 4DR4K 5IWAK 2BDPA 1GLBG 2NRRA 3LAKA 5T7BA 2YNIA 5CZ2A 3T1HK 4E89A 3HYFA 3MN5A 4FWNA 4KBOA 5BN8A 4BWJA 1ZBLA 1ZBUA 1Y97A 5HRNA 2P9LA 1X9JA 1D5AA 2OA8A 2HMPA 4YOXA 4E7KA 4JS4A 1YITN 2XY5A 3AAQA 3IFRA 3Q7CA 4CBWA 3BF3A 4KHNA 3DMJA 4NO7A 4DTUA 2HNYA 5M1FA 3T3FA 3TWHA 5CZ1A 4B3OA 3WXLA 1JCGA 3P38A 4DFJA 2GBZA 2YCHA 2PYJA 4CD3A 2ITMA 2PZSA 1JLQA 2P9SA 4CZFA 3CJ1A 2KHOA 2RE2A 1VAZA 1JXBA 2V51B 4M7XA 4CZHA 4FWMA 2W6KA 4CEZA 2IS3A 2Z1HA 3LDQA 2GUIA 3CQ8A 4O0IA 4GKJK 2D0AA 3ID6A 3HM8A 4JI3K 3ZSQA 4R5PA 1N32K 3A5MC 4DHYA 1TGOA 1IH7A 3GE1A 4F2RA 2XY7A 1J6ZA 1J53A 3AGRA 4CJ7A 5HRPA 1EO1A 4JHDA 3HVTA 1EQYA 5GIOA 1NG9A 5HRRA 1VK0A 2O8DB 3ZETB 1HQUA 1RCHA 4ID1A 2D1KA 4DSFA 1KSPA 1RDCA 3H46O 3V9SA 3DRSA 3SUQA 1OVYA 2EWSA 2ZD1A 3KLEA 2IVPA 2Q2RA 3O9TA 4AHRA 2FSKA 4KV8A 1VQ9N 3HT3A 1BL3A 2A40A 3CPWM 1JCFA 3P4IA 3VOVA 5BRHA 3RRHA 3NBPA 2Q31A 1D4XA 3ZSOA 4DLEA 3TTCA 4DFKA 2OPRA 3WT0A 1NLVA 5AQZA 3QEIA 4Z4FA 1NU0A 1RTDA 4UY8O 4IO9L 4DR5K 1IBMK 4OPJA 4FZXC 4DR1K 3SCXA 3SJHA 1RTHA 3N4QA 3L2WA 3MEGA 1VQKN 4M3TA 4DV0K 2JGUA 5GAGP 1S9GA 1BO5O 1R0AA 1VQ6N 3TI0A 3PX4A 2E2PA 4LF6K 1TUUA 4B9NA 5BR9A 3ID8A 4J8FA 1M1KO 2AP1A 1GOBA 3EKUA 3ASMA 1E4GT 2ZM6K 3I8BA 4B1YB 4HUGA 2QK9A 4CJVA 4FLVA 1VQ4N 4FJ5A 2QWRA 4GV9A 1ASVA 2HNDA 3R9PA 4EZ9A 3FFIA 3M3ZA 3DLHA 1QZ6A 1BCMA 1XQSC 4O5BA 3AVMA 4B9TA 5AQMA 2P9KB 4JEPA 3EN9A 3I0SA 3MX2A 4JKDA 1TVRA 3PO5A 4M3XA 4FJIA 3MMVA 2F9TA 2NRWA 2F4VK 2HB5A 1TV6A 4BWMA 5M1NA 4F4KA 4CK2A 3GG4A 4C8NA 5M1KA 4FJHA 3UIQA 2E6LA 3O9QA 2NRZA 3CCUN 3SJJA 5CR4A 3V1RA 3O4WA 3O9SA 4Z4GA 1LV5A 3MECA 1WB9A 3M5RA 1VRTA 1NGFA 4FWPA 3AV9A 3HXMA 3MEEA 1DGKN 1NJYA 3K5MA 3QBWA 4DKWA 1FXXA 3J7YP 3D2FA 4FLXA 5GADP 5IT9O 1NGAA 2HBKA 3QINA 3QEWA 4C1NK 3EZWA 1RT5A 2KQ2A 1JJ2M 4BR5A 4DV7K 4NCGA 4O8KA 5EX5A 3QICA 3HM9A 1U45A 1S1VA 3ZT2A 3KLGA 3AY9A 4CFBA 1WBDA 2XRIA 3CCRN 3A5OC 2P9PB 4B1XB 3ITHA 4CZMA 2JWLA 2GUPA 4XH4A 1OH8A 5KRSA 3H3OB 3KHYA 3VTIA 3PSFA
chains in the Genus database with same CATH topology
3J7AP 4DV1K 5LMUK 4DUZK 4JI4K 1HNXK 4X65K 4LF4K 5LMNK 4DR7K 2ZM6K 5AJ3K 2VQEK 5BR8K 4LF7K 4JV5K 4LF9K 1HNZK 5LL6Z 2UXBK 4GKJK 4DR2K 4NXMK 3J80O 2UXCK 3T1YK 4JI3K 4JI0K 5FLXO 4X62K 2E5LK 1N32K 2HHHK 4DV4K 1IBKK 4B3TK 4JI8K 4K0KK 4JI1K 4LF8K 2F4VK 4LFBK 1IBLK 4DUYK 1XNRK 4DV5K 4JI6K 4DR6K 4LF5K 1HR0K 4KHPK 3OTOK 1FJGK 4LFCK 1N36K 4B3MK 4DR3K 4CW7B 4DR4K 2UXDK 5IWAK 4YY3K 4B3RK 4YHHK 3JAMO 2UUAK 1HNWK 2UUBK 1N33K 4LFAK 4X66K 3T1HK 3J7YP 1XNQK 5IT9O 4DV6K 5A2QO 3J81O 1XMQK 4DV3K 1XMOK 4JI2K 4DR5K 1IBMK 4X64K 4DR1K 4DV7K 2VQFK 4JYAK 4OX9K 4DV0K 4AQYK 2UUCK 4GKKK 4B3SK 4NXNK 4DV2K 1J5EK 1I94K 4JI5K 4LF6K 4V19S 2UU9K 4CVNE 1N34K 4JI7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  4DV1 K;  5LMU K;  4DUZ K;  4JI4 K;  1HNX K;  4X65 K;  4LF4 K;  5LMN K;  4DR7 K;  2ZM6 K;  5AJ3 K;  2VQE K;  5BR8 K;  4LF7 K;  4JV5 K;  4LF9 K;  1HNZ K;  5LL6 Z;  2UXB K;  4GKJ K;  4DR2 K;  4NXM K;  3J80 O;  2UXC K;  3T1Y K;  4JI3 K;  4JI0 K;  5FLX O;  4X62 K;  2E5L K;  1N32 K;  2HHH K;  4DV4 K;  1IBK K;  4B3T K;  4JI8 K;  4K0K K;  4JI1 K;  4LF8 K;  2F4V K;  4LFB K;  1IBL K;  4DUY K;  1XNR K;  4DV5 K;  4JI6 K;  4DR6 K;  4LF5 K;  1HR0 K;  4KHP K;  3OTO K;  1FJG K;  4LFC K;  1N36 K;  4B3M K;  4DR3 K;  4CW7 B;  4DR4 K;  2UXD K;  5IWA K;  4YY3 K;  4B3R K;  4YHH K;  3JAM O;  2UUA K;  1HNW K;  2UUB K;  1N33 K;  4LFA K;  4X66 K;  3T1H K;  3J7Y P;  1XNQ K;  5IT9 O;  4DV6 K;  5A2Q O;  3J81 O;  1XMQ K;  4DV3 K;  1XMO K;  4JI2 K;  4DR5 K;  1IBM K;  4X64 K;  4DR1 K;  4DV7 K;  2VQF K;  4JYA K;  4OX9 K;  4DV0 K;  4AQY K;  2UUC K;  4GKK K;  4B3S K;  4NXN K;  4DV2 K;  1J5E K;  1I94 K;  4JI5 K;  4LF6 K;  4V19 S;  2UU9 K;  4CVN E;  1N34 K;  4JI7 K; 
#chains in the Genus database with same CATH topology
 4KTQ A;  3SQ1 A;  4ELV A;  3MWT A;  3VQ8 A;  4FJ7 A;  4CZI A;  4CGF A;  1SAZ A;  5FRO A;  1C0G A;  4BRK A;  3ULE A;  3VGL A;  2Q1N A;  3PO4 A;  1XUP O;  4O4G A;  5M1P A;  5EU7 A;  3VA0 A;  4C8L A;  4JD2 B;  5DMR A;  3NH1 A;  2B5J A;  4NXM K;  1O1W A;  2QXF A;  4M3R A;  1NJZ A;  1LAW A;  3C0B A;  3G6E N;  2YKN A;  3U9Z A;  5FLX O;  3THY A;  5JLF A;  3RMA A;  2HHH K;  4JRP A;  3VQ5 A;  2KTQ A;  4DSK A;  3MED A;  4JI8 K;  4K0K K;  4C8O A;  3MWP A;  5C12 A;  4LFB K;  1NKB A;  1IBL K;  4M45 A;  4OKK A;  1JLC A;  4E7H A;  3E66 A;  3KZB A;  3F2K A;  1XNR K;  3L4Q A;  4KB1 A;  4EP4 A;  4BVP A;  5ELZ A;  3DOL A;  2YHY A;  1HYV A;  4H0T B;  1QQO A;  1NK7 A;  3CC2 N;  1DLO A;  3LDN A;  3AGK A;  1T05 A;  3L2Q A;  4WFN L;  2WUS A;  2P9U A;  1SQK A;  3DLE A;  3UB5 A;  4OKJ A;  1QSL A;  4B3R K;  3NE6 A;  3ALY A;  2A6A A;  1N33 K;  2QWN A;  4E19 A;  5AQP A;  5K14 A;  3TTF A;  1WSF A;  3HP9 A;  3CFR A;  2KZM A;  4RW8 A;  5BPL A;  1RBV A;  4B8A B;  4E3S A;  4CJF A;  2G8K A;  1RNH A;  2BGG A;  3AVI A;  3LZI A;  3OYA A;  2ZJP L;  4W5T A;  4NYN A;  1NBW A;  3SAH A;  4ZTJ A;  1JLF A;  3IS9 A;  1IKV A;  4BE1 A;  4PQU A;  1NGG A;  2V52 B;  1BQM A;  1B9F A;  1WAF A;  4IOX A;  1YJN N;  3M6G A;  3EY1 A;  3V9U A;  5J2M A;  2O8C A;  2WBN A;  3V9W A;  4W5O A;  1NJX A;  2JLE A;  2HNZ A;  1FKP A;  1YI2 N;  3L2V A;  4IWV A;  3HSC A;  2W6L A;  2F9W A;  2BTF A;  4YOR A;  3VQD A;  4BR2 A;  2D0C A;  5AQY A;  1Q18 A;  4OLA A;  4OVL A;  3QIP A;  1WSH A;  1JL2 A;  1WUA A;  2P9K A;  2VG5 A;  2YV0 X;  3U9D A;  4AHS A;  3R1X A;  4OGC A;  1YUW A;  3DXK A;  4JKG B;  3FZL A;  1X1P A;  5JS2 A;  4CJQ A;  1UAX A;  2OCE A;  3SUO A;  1NK8 A;  1WN7 A;  1RTI A;  1RIL A;  4CHQ A;  4C1N I;  4Z4E A;  3C6A A;  4RWT A;  1VSJ A;  3SK3 A;  3O80 A;  3THY B;  2ITG A;  3OJS A;  4GV6 A;  5E84 A;  4CIG A;  3T7Z A;  5LJV A;  3O3G A;  1HR0 K;  5AQV A;  5AQU A;  4Y1C A;  3LAL A;  1KLM A;  3LDP A;  1RDW X;  4DTS A;  2YNF A;  1KVB A;  3JAM O;  3VER A;  3A5L C;  3C6T A;  4X66 K;  3L2U A;  3NFA A;  4YOW A;  1QZ5 A;  3BZC A;  3LP3 A;  3A5N C;  3Q7B A;  3RWU A;  2A41 A;  3TAN A;  4JKA A;  1T03 A;  3PX0 A;  1W2B M;  3H45 C;  4JKF A;  2HMI A;  3WUH A;  1LAV A;  1YVN A;  1L3U A;  3D0P A;  5ADX H;  3C7N A;  4O5F A;  1BWF O;  4LH5 A;  1QS4 A;  3OYL A;  2G8F A;  1CZA N;  3U4L A;  2UUC K;  4CEB A;  3SPY A;  2OTL N;  3ZEU A;  1WAJ A;  3C6H A;  4WQ4 A;  3D2E A;  4K42 A;  3GOI A;  2FXU A;  4Y0W A;  5EY4 A;  2UU9 K;  4CVN E;  4MO5 A;  1J9A A;  4AH9 A;  4JHD B;  2QM1 A;  2UYT A;  3EE9 A;  4DV1 K;  4JI4 K;  4IXC A;  4CK1 A;  5I9E B;  4XIU A;  3AO2 A;  4BRQ A;  4FLY A;  4BVO A;  4B1Z A;  4PHT X;  1TAQ A;  3OS0 A;  2P9U B;  1Q9X A;  4KFB A;  1C0F A;  5F1X A;  2UXB K;  3OYJ A;  2NZT A;  4FOE A;  3AVN A;  2H3G X;  5AQG A;  4YFU A;  1QHT A;  3L4I A;  3CJ9 A;  1HJO A;  4CHY A;  3QET A;  2IC3 A;  1M90 O;  4E0D A;  4M42 A;  4O8U A;  2QWL A;  3CQX A;  1SS6 A;  3RR8 A;  4FLU A;  1BIZ A;  2PYL A;  1K9M O;  1S1T A;  4CGH A;  5FRN A;  3BUZ B;  3EO3 A;  1YIJ N;  2PY5 A;  2JWK A;  3ZT1 A;  1HQE A;  1SKR A;  2HBM A;  3GBT A;  4JI6 K;  3F5T A;  1CZB A;  3MXJ A;  1EKE A;  1RTJ A;  5HOO A;  1IKY A;  3TTD A;  3QNN A;  1BU6 O;  4A61 A;  3VA3 A;  4M63 C;  1A5W A;  5E41 A;  3VEY A;  3WXJ A;  1XHX A;  2DFE A;  4DR3 K;  2RPI A;  2Q36 A;  1VQ7 N;  2E1Y A;  2Q0R A;  1ATR A;  4JNE A;  4UQG A;  2E4L A;  1W9H A;  3J8A A;  3ZSR A;  4DB3 A;  2O8C B;  2IVO A;  2GV9 A;  1XNQ K;  1IG8 A;  2PBD A;  1X9W A;  3QES A;  3V81 A;  4KB0 A;  4BRO A;  5GAH P;  5BPM A;  3VQ9 A;  2DTU A;  1ATS A;  2FF3 B;  1N8R O;  3TAF A;  2PAV A;  3GDQ A;  5AQI A;  3MN6 A;  3DM2 A;  3I55 N;  4B1W B;  3DLR A;  4JK7 A;  3AVC A;  4FJL A;  3AVF A;  4QS8 A;  2EX3 A;  1VSE A;  1J5O A;  2GWJ A;  4IO8 A;  4DCH A;  4AHV A;  3VF6 A;  4K43 A;  3U3G A;  3VPZ A;  1TK8 A;  2WFB A;  3HRG A;  1VHX A;  2NRT A;  4FJ9 A;  1HPM A;  1HNX K;  2KKZ A;  4IDH A;  4Z4C A;  4CF0 A;  4CFA A;  2NNW A;  2YKM A;  1EWQ A;  3ENB A;  4Z0U A;  5AQO A;  3CC4 N;  4N41 A;  4EHU A;  3OHR A;  4CBU A;  2VWB A;  4NCA A;  1VRU A;  3TAB A;  3FE1 A;  2P9I A;  4BGB A;  3V1Q A;  4FWO A;  4DQP A;  1NKC A;  1T6D A;  3AO4 A;  4KHS A;  4E1N A;  4OO1 J;  3KTQ A;  2CH6 A;  3GL1 A;  4BRL A;  4QS9 A;  2B4J A;  1G99 A;  2HVI A;  3WNE A;  4CJE A;  4QAG A;  1ESV A;  1FKO A;  2QWM A;  3ENO A;  4CES A;  3K5O A;  5AFU A;  1YVU A;  2KW4 A;  4PA1 A;  3CHW A;  1IV0 A;  1JKH A;  4QS7 A;  4DSI A;  3VEN A;  1VQO N;  4DUY K;  2YI1 A;  3VF2 A;  3K57 A;  3MCA B;  3SAG A;  3NHG A;  4PWD A;  1NK6 A;  2V7Y A;  1U49 A;  1NJI O;  2A1S A;  4KRF A;  3CJA A;  3HI0 A;  1L5U A;  4KHP K;  1RT3 A;  2EHG A;  3OY9 A;  3O08 A;  1C0U A;  3HK2 A;  1D9D A;  2E2N A;  4F9O A;  4FK0 A;  2UXD K;  1S6Q A;  4K41 A;  5M1O A;  3I33 A;  4CZE A;  1YT3 A;  2I5J A;  2PFU A;  4O0J A;  4H4O A;  4L8R B;  4O55 A;  3RVC A;  4CJU A;  1TUY A;  3VQP A;  2YHW A;  1G15 A;  3NCI A;  4CGJ A;  1CZ9 A;  3L3U A;  2VYP A;  4FWQ A;  3UKR B;  5SWM A;  1S5J A;  1XMQ K;  3KD5 E;  3CMA N;  4CZG A;  3EZ5 A;  3AVJ A;  4KHU A;  4H5N A;  3WNG A;  4CD1 A;  1BA1 A;  3VMF B;  4DG1 A;  4F3O A;  1TKX A;  1VSK A;  3DLK A;  4DQQ A;  1NM1 A;  1EX4 A;  4XH5 A;  4AQY K;  3HJF A;  4FWL A;  4IJA A;  5H1S Q;  3TU5 A;  1QHA A;  4GW6 A;  3DWL A;  3C94 A;  3CF5 L;  3OYD A;  4JKC A;  4AIL C;  5CY4 A;  3O6W A;  4DS5 A;  1RT4 A;  5DM6 L;  4H5R A;  3TR8 A;  4U67 L;  1YTU A;  4DR7 K;  4PKG A;  5AQK A;  1TAU A;  4WQ5 C;  2VCP A;  3HTV A;  5FRM A;  3ZT4 A;  2DY4 A;  4BR0 A;  4LF9 K;  4CEA A;  4B08 A;  4CZK A;  1RGI A;  3AO1 A;  3SQ0 A;  3CCQ N;  4W5N A;  3VEX A;  4C8M A;  3OYB A;  4Z4I A;  1DTQ A;  4FJM A;  4H0P A;  3CER A;  1QVF M;  4X62 K;  5AQH A;  4I9L A;  1U6Z A;  1ATN A;  3DXM A;  4ZTF A;  4BRD A;  2YNG A;  1U4B A;  3S9H A;  4KI4 A;  3QFP A;  1NOZ A;  1NGD A;  3CCS N;  3QEX A;  4L3Q A;  2XY8 A;  4N56 A;  5JVG L;  3M8P A;  4RTF D;  3M8R A;  4B1V A;  1WNS A;  3EE8 A;  1Q9Y A;  4LF5 K;  1ZBF A;  2F7T A;  2HW3 A;  3OTO K;  1Q7Y O;  5J1E A;  3MDQ A;  2ATQ A;  4I9Q A;  2HHV A;  4DF4 A;  4CW7 B;  4OPK A;  2XY6 A;  4YHH K;  4B8C A;  3DXM B;  5C25 A;  4LD0 A;  1RDB A;  1Q86 O;  4KHY A;  2D0B A;  4EP5 A;  3CFO A;  5AFU H;  1VQ5 N;  1B92 A;  1TYQ B;  1EET A;  3OBY A;  5HP1 A;  5BPN A;  3R6M A;  4AM6 A;  4FSV A;  4LSL A;  2P9L B;  1DT9 A;  2P9N A;  3LWM A;  2A1R A;  2G8U A;  3ULD A;  1YJ9 N;  4CGD A;  1CXU A;  3EYZ A;  3VQE A;  4FYD A;  4G1Q A;  3LL3 A;  3LPT A;  3CD6 N;  4J2D A;  1D8Y A;  4ILJ A;  1ZBH A;  2HHW A;  2ZJR L;  4OJR A;  5J2N A;  1RDU A;  3D6R A;  5CE3 A;  4CZJ A;  3VEW A;  4V19 S;  1YAG A;  4FW2 A;  3B6O A;  2HOE A;  3NF9 A;  1S1X A;  4CEF A;  4CI6 A;  4EHT A;  1BIS A;  3LP2 A;  3ZT0 A;  3VEO A;  3WNH A;  4KHQ A;  3SUP A;  4O44 A;  2E8A A;  3D2E B;  4B9Q A;  2KFZ A;  2YJF A;  3ZT3 A;  2J4R A;  3O1B A;  4JKB A;  4JK8 A;  4YOV A;  3OYE A;  1A5X A;  3B6P A;  4JD2 A;  1KLN A;  4A57 A;  4DTO A;  4N76 A;  1SUQ A;  1Z6R A;  1QQC A;  1HMV A;  3SUN A;  2G8W A;  4N47 A;  5FPE A;  4CF9 A;  3KLH A;  2NRX A;  4CHP A;  3QLH A;  5EOY A;  4KHW A;  1E4F T;  1HLU A;  1GLE G;  2YX6 A;  3H08 A;  4CEO A;  3DYA A;  2AA4 A;  2IDO A;  4J2B A;  3T1A A;  4BC4 A;  4ELU A;  4M3W A;  5AZI A;  3TAR A;  4BY9 C;  1JLG A;  3RMB A;  5HLF A;  4HUE A;  4HTU A;  4BDY A;  1KTQ A;  4G9Z A;  3NGY A;  4FL9 A;  1C0M A;  3FLC O;  4DV5 K;  2FC0 A;  4Z4H A;  2Y1J A;  1LW0 A;  3THW A;  4Q0B A;  1T7P A;  3VF4 A;  4BDZ A;  4GVM A;  4ELT A;  3TAM A;  3OYM A;  4GY2 B;  4YDU C;  1O13 A;  1C6V A;  4H5T A;  3AAR A;  4FCY A;  2CGL A;  4IG3 A;  3K58 A;  1OKJ A;  2QKK A;  2UUA K;  3SAF A;  1RBR A;  1KFS A;  4LFA K;  2OZM A;  1NOY A;  1R59 O;  3N4P A;  4ILG B;  3BEX A;  2P9N B;  4WFA L;  3BGR A;  1BA0 A;  1LOT B;  2D5R A;  1KQS M;  1K73 O;  4CGG A;  4JI2 K;  3MCP A;  3P83 D;  4YNQ A;  5KPT A;  1L3S A;  4FJN A;  4BG9 A;  4W5R A;  1E3M A;  3CQY A;  1T3V A;  2NRH A;  3L3V A;  3VQB A;  4J2A A;  4FM1 A;  4I2P A;  3QBX A;  3AVG A;  1MDU B;  1RBS A;  3UKU A;  4FXD A;  4GKK K;  4KI6 A;  4NXN K;  2E6M A;  4ISF A;  1YXQ A;  1GLC G;  3L2R A;  3KIO A;  4KO0 A;  4OPA A;  2W42 A;  5KQD A;  5C42 A;  4FPB A;  1GLD G;  3KD1 E;  3PY8 A;  3VQ4 A;  4FJK A;  5AQX A;  1NGC A;  1VQN N;  3ZLJ A;  2YHB A;  3E9O A;  4DWI A;  4OGE A;  5F2R A;  1KRP A;  4BRA A;  4CHN A;  3CCV N;  3LAN A;  1KAZ A;  5AQT A;  5LL6 Z;  1HNZ K;  3VQ7 A;  2FLO A;  1GLL O;  4GNI A;  4DR2 K;  2CGJ A;  5KRT A;  4C8K A;  1S1U A;  2NLX A;  4MFB A;  3KJV A;  1QE1 A;  2A42 A;  3AA3 A;  3M8Q A;  4IEI A;  3WXI A;  2GEM A;  3OJU A;  1GLF O;  3RMC A;  1QQN A;  3LDS A;  3ZX0 A;  2G8H A;  3TSP A;  3K9K A;  4IG0 A;  4DMN A;  1YJW N;  2Z1I A;  4IFY A;  4F8R A;  5KGW A;  1EP4 A;  3U8X A;  3LP0 A;  1C1B A;  1CXQ A;  4CK3 A;  4RW4 A;  4B9M A;  1F21 A;  1GOA A;  1RDA A;  4M3U A;  4EIA A;  3DLB A;  4FW1 A;  2FBY A;  4BRM A;  4LFC K;  1X3N A;  3PX6 A;  3O3H A;  2P9S B;  1K8K B;  4ICL A;  1HNW K;  4DFP A;  2GWK A;  3KWG A;  4CZL A;  1OH6 A;  1NK0 A;  4W5Q A;  3NGZ A;  1TK5 A;  1SL1 A;  1WOQ A;  2OPQ A;  1TKD A;  3QER A;  1LWE A;  4DV3 K;  5HRS A;  4DU4 A;  1XMO K;  4M3Y A;  1SZ2 A;  2QKB A;  5LJW A;  4X64 K;  4K8X A;  3J7Z O;  3O4Q A;  4FZY A;  5AQR A;  4FOI A;  4KTZ A;  3DLG A;  2WON A;  5TKY A;  3CCE N;  2O8F A;  2F96 A;  3OYK A;  3KK1 A;  1OVQ A;  1Z25 A;  3ZX2 A;  4CF1 A;  4A59 A;  1BGX T;  4CJL A;  1GLJ O;  3RSE B;  2KZZ A;  1IKX A;  3RTV A;  4RW7 A;  4KPY A;  4LF4 K;  3SLC A;  1ZC6 A;  1QTM A;  5EVZ A;  4FO0 A;  3V1O A;  4B9L A;  2HST A;  1WBB A;  4AHT A;  4KKO A;  5LY3 A;  1LWF A;  1NNE A;  3ULE B;  4BQZ A;  3WEE A;  3NGI A;  1C1C A;  3P39 A;  1HX1 A;  1BOT O;  3CIP A;  4JI0 K;  2E5L K;  3OW2 M;  3MN9 A;  2WTU A;  1BIU A;  2HF4 A;  3A0I X;  3BP8 A;  3FZK A;  3KKS A;  4FLT A;  3EKS A;  2P1J A;  2VG6 A;  3CET A;  3AAP A;  4FJ8 A;  3RSE A;  2XO7 A;  1JLA A;  3OYG A;  4LF8 K;  4I2Q A;  1S9E A;  1VSH A;  4OPH A;  1SKS A;  1RT1 A;  4YOU A;  5AQQ A;  5KPR A;  3AVA A;  3THV A;  4I6M B;  3PV8 A;  1ASW A;  4BRF A;  3DJC A;  1T6C A;  4WQ4 C;  2X6N A;  3MAQ A;  3BDP A;  3P5J A;  1WLJ A;  2O8F B;  4ISE A;  3OS2 A;  3PUF A;  3O9U A;  3TSU A;  4J2E A;  2E20 A;  2OAN A;  5M1Q A;  4E7I A;  3T19 A;  2VG7 A;  1DKG D;  1X9M A;  2ASP A;  2ZF5 O;  1QQM A;  3UE5 A;  2LSN A;  2FBT A;  3ATU A;  5FDL A;  4YOY A;  4GVE A;  3U3Y A;  3WXM B;  1B9D A;  1NKE A;  4DSE A;  4FJJ A;  1Q8I A;  3KVG A;  5FPN A;  4RCH A;  1SV5 A;  2VWK A;  4IEE A;  4ILH A;  3DRP A;  3O4N A;  3A8Y A;  4XH1 A;  1I3A A;  1KXP A;  3VEV A;  4WYB A;  1Z05 A;  2VGN A;  4N5S A;  4CJT A;  4KAZ A;  4JYA K;  3WEE B;  4CGI A;  5CHI A;  3C65 A;  3C7N B;  3QB0 A;  3MX5 A;  5C15 A;  1LW2 A;  4DLG A;  4B3S K;  1KC8 O;  4MLE A;  1N34 K;  1UWB A;  3VET A;  5JS1 A;  4BR4 A;  5HL7 L;  3J7A P;  4PL8 A;  2YNH A;  3SI6 A;  4X65 K;  5LMN K;  4E1M A;  3NF7 A;  4C23 A;  1W97 L;  1U04 A;  1VSM A;  2IAJ A;  4E7L A;  4JV5 K;  3HZ6 A;  3VQC A;  3HL8 A;  3DOK A;  4NLC A;  4FVU A;  2FSJ A;  3R3L A;  4NCB A;  4IFV A;  1XC9 A;  3JS6 A;  2RKI A;  1JL1 A;  4LY7 A;  4DTM A;  4CER A;  3VQA A;  4CBX A;  5CYM A;  4EFH A;  5FPM A;  4IBN A;  2BAN A;  3ISN C;  4HVJ A;  1QSY A;  2E2O A;  3PLA A;  2QWQ A;  2Q0U A;  3T69 A;  4CCH A;  1RBT A;  4JAX A;  4KH4 A;  3V9Z A;  3SZ2 A;  3CI5 A;  2WC9 A;  2OTJ N;  3AVB A;  1L3T A;  5AQS A;  4CED A;  3IUC A;  1WSG A;  3AVH A;  4B3M K;  3CYM A;  4BR7 A;  2ZE2 A;  1GOC A;  3CM6 A;  1RT2 A;  2IIR A;  1DTT A;  3NDK A;  3E9L A;  4NYF A;  2QTD A;  4MDB A;  2X6S A;  4ZHR A;  3NF8 A;  3W3D A;  4HTL A;  4CJP A;  3G4S N;  2F8T A;  4H0Y B;  5E26 A;  4OKE A;  3NVM A;  3G71 N;  2W40 A;  5AQW A;  2D0O A;  3MN7 A;  4BE0 A;  3KLF A;  3K5L A;  5CYQ A;  3OYF A;  1TL3 A;  4EAH D;  4MO4 A;  3C6U A;  3I0R A;  3PIP L;  1MWK A;  4WFB L;  3FZF A;  2R7Y A;  4OX9 K;  3ZSV A;  4CF8 A;  4BRP A;  2RHK A;  1EXQ A;  1JCE A;  4RG8 A;  5BRD A;  3WNF A;  2Q97 A;  1ZBI A;  4JS5 A;  4HCC A;  1GLA G;  3K59 A;  3IDH A;  2E2Q A;  4IZ9 A;  2ZQB A;  3ZEU B;  4CJR A;  5AZI B;  3U6F A;  1NGJ A;  4IOC L;  3PSI A;  1BG3 A;  1TL1 A;  4E7J A;  2IGI A;  2DFF A;  3CXC M;  2HHU A;  2CH5 A;  3VGM A;  1IG9 A;  2HHT A;  2I7P A;  4JK9 A;  3L0Q A;  2E88 A;  3QDK A;  3OYH A;  3OA9 A;  1IKW A;  3AVL A;  1NK9 A;  3B8A X;  1K6Y A;  1JLB A;  3D2F B;  3ZX3 A;  2UXC K;  1C0T A;  1HPZ A;  1T44 A;  3NAE A;  1JXE A;  3HST B;  2B6A A;  4IOA L;  3O3F A;  4DTP A;  4BE2 A;  3SYZ A;  3CCM N;  2P9I B;  1VSF A;  3KWI A;  1KD1 O;  1L3V A;  1ZXO A;  2QWP A;  3D45 A;  3LAM A;  4FM2 A;  4LSN A;  1HYS A;  2QWO A;  2I7N A;  3PIO L;  3KK3 A;  2RN2 A;  4CJW A;  1BHL A;  3LDL A;  4BC2 A;  3HOT A;  2FF6 A;  2ZWH A;  3F73 A;  3SV3 A;  2RF2 A;  3E01 A;  3IAY A;  4FLZ A;  1C1A A;  3KKR A;  3RR7 A;  1IO2 A;  3P31 A;  3CM5 A;  3JXU A;  3L6Q A;  4CJS A;  4TSX A;  2UUB K;  4BRG A;  4QOZ B;  4CFD A;  1XC3 A;  1H1V A;  1TYQ A;  4DTJ A;  3SBT A;  3SPZ A;  3MXI A;  5TKW A;  1YTA A;  1HNV A;  4FM0 A;  2HVH A;  4H5W A;  3C95 A;  2GTD A;  5AQL A;  5AZJ B;  4PKH A;  1S6P A;  3K2P A;  4JKE A;  3HPH A;  5AQN A;  3VTH A;  5D3G A;  2VQF K;  1KFD A;  2YHX A;  4H8K A;  1ZBS A;  4QCL A;  4CHZ A;  4MDA A;  3V6D A;  1U2V B;  3TAQ A;  1J5E K;  2O4G A;  5HRO A;  4H4M A;  3EEQ A;  4FWK A;  1NMD A;  4FJX A;  3TAP A;  2YHA A;  2P5O A;  3ZSW A;  3OYN A;  3CJB A;  2NUB A;  3LWL A;  4DQI A;  3DI6 A;  3FGU A;  3SBG A;  5AJ3 K;  5B8H A;  3THX A;  2HBJ A;  3LP1 A;  3TPQ A;  1BDG A;  5GIN A;  3EL2 A;  1N5Y A;  4GV3 A;  5BRE A;  3I56 N;  4HCB A;  5MLC Q;  1CLQ A;  3NVK A;  4H0V B;  2FBX A;  4DS4 A;  1TK0 A;  3DAW A;  4BRN A;  4CE9 A;  1LWC A;  1A5V A;  2VGM A;  3J80 O;  1NK5 A;  2X74 A;  3KLI A;  3K0S A;  1Q82 O;  4DV4 K;  3IRX A;  5DK5 A;  5J2Q A;  4M7Y A;  2QEX N;  2DPN A;  3LPU A;  4XEI A;  2O8E A;  4B3T K;  1ASU A;  4JI1 K;  4H0X B;  1Q81 O;  1KAX A;  3G25 A;  4JN4 A;  3OBW A;  5JLH A;  3SQ2 A;  4FWS A;  3UKU B;  4ISG A;  2HHS A;  4JRQ A;  4DTX A;  4BGA A;  4IKF A;  4Q5V A;  4HWI A;  5JIC A;  4NB4 A;  4A2B A;  3HVR A;  3ZSX A;  3ZYY X;  3V9X A;  4WE1 A;  4K25 A;  4AM7 A;  4LH4 A;  1NGB A;  4YY3 K;  1RDD A;  2HF3 A;  2OYQ A;  5F0X A;  4BRH A;  3FFK B;  3VQQ A;  1MWM A;  3I8D A;  3WQT A;  2QW9 A;  5KGX A;  1ZYQ A;  4DV6 K;  4M41 A;  4BRE A;  4DTR A;  1V4S A;  3CCL N;  5C10 A;  1FW6 A;  2O8B A;  3J81 O;  1RFQ A;  3HO1 A;  3DLL L;  4DQS A;  3VEZ A;  3OVN A;  4KTW A;  2G8V A;  3A2F A;  3HOS A;  3HPO A;  4CHO A;  3TAG A;  1ILY A;  1NJW A;  1NGI A;  3CG7 A;  1I39 A;  1QVG M;  1SKW A;  4PL7 A;  4DV2 K;  3H1Q A;  5AQJ A;  4JKH A;  1I94 K;  3G0Z A;  3CJC A;  5KI6 A;  2Q3S A;  1XHZ A;  1LCU A;  2ASO A;  2O8E B;  3O1W A;  2VWJ A;  1S22 A;  3HP6 A;  3AA2 A;  5AQF A;  1HYZ A;  4FK4 A;  4Y1D A;  1VQL N;  2GEL A;  4I6M A;  3R8E A;  4FZZ A;  2VQE K;  2NRV A;  1UA0 A;  4B9U A;  4WCE L;  4BC5 A;  2Z1G A;  1K8K A;  3FZM A;  4FVM A;  5HBM A;  1T8E A;  2QI2 A;  3ZCM A;  3VGK A;  1JLE A;  3VQ6 A;  3K5N A;  4MQ3 A;  3M1F A;  4E1J A;  5ADX A;  1SL2 A;  1IBK K;  4F3T A;  1X3M A;  1Y64 A;  5AZJ A;  3ZET A;  4DQ8 A;  5BRF A;  1HUX A;  3OS1 A;  2DFH A;  4AHU A;  1Z26 A;  4PUO A;  1DEJ A;  3S41 A;  1S72 N;  2X78 A;  1K8A O;  2O8B B;  1X9S A;  3KK2 A;  4DQR A;  5C0Y A;  4K8Z A;  1QSS A;  4A62 A;  1MU2 A;  1NGH A;  3F9K A;  3AVK A;  1V4T A;  4IJN A;  4M3Z A;  3LM9 A;  1U2V A;  5C2D A;  3OYC A;  3L8B A;  4B9S A;  5AR0 A;  3BY5 A;  3QML A;  4WF9 L;  4DF8 A;  1YHQ N;  2ETJ A;  3CME N;  2A3Z A;  3CJ7 A;  2XHB A;  3QFU A;  2Y1I A;  1U48 A;  3BF1 A;  3JSM A;  1WSE A;  2OPP A;  5A2Q O;  4KRE A;  2A5X A;  1N6Q A;  3AA5 X;  2ZGY A;  3SV4 A;  2CGK A;  3TSQ A;  1WSI A;  1HNI A;  4BQL A;  2IVN A;  4ID5 A;  1KCF A;  3K9J A;  3CFP A;  5C2F A;  4H03 B;  4FK2 A;  3SQ4 A;  3QEV A;  4R79 A;  3AO5 A;  3O9R A;  4PKI A;  1MA9 B;  3IMX A;  1HRH A;  4I7F A;  4IFE A;  3M8S A;  3HBT A;  3SMP A;  1BI4 A;  5I42 A;  1W7A A;  3CC7 N;  4DUZ K;  2HHQ A;  1VSI A;  1VQ8 N;  2KFN A;  2FBV A;  2BE2 A;  3IKM A;  5DM7 L;  1SL0 A;  3KK7 A;  5BR8 K;  1VQM N;  4LF7 K;  3ATV A;  3MK6 A;  2E1Z A;  1U47 A;  3O5B A;  4CEC A;  4CIF A;  4DSJ A;  4DSL A;  2G8I A;  3RMD A;  2HHX A;  1KAY A;  2P51 A;  3T1Y K;  3CCJ N;  1W0H A;  3THX B;  1XI1 A;  4CFC A;  3ZSY A;  2O8D A;  3IG1 A;  1VQP N;  1P8Z A;  2P5G A;  2KLA A;  4PY5 A;  1BI4 B;  4CJ3 A;  5I3U A;  4A5B A;  2V7Z A;  2YJE A;  1IJJ A;  3D7E O;  4CJK A;  3H1V X;  3FR0 A;  3NH0 A;  4KH6 A;  3P1G A;  4B9V A;  1HJR A;  1NGE A;  2OZS A;  1J54 A;  4RW9 A;  2D4W A;  4BRI A;  1TKT A;  3ZSZ A;  4MLH A;  2QXL A;  3QIO A;  1HKB A;  4NLB A;  3TAE A;  4EZ6 A;  1N36 K;  4BG8 A;  4WQ5 A;  3QNO A;  1BUP A;  1YF5 L;  1FK9 A;  2P9P A;  1RT6 A;  5JMV A;  4RW6 A;  4YDU A;  3S3O A;  5BN9 A;  2O4I A;  2ASM A;  4KH5 A;  4DTN A;  3HPG A;  4CJ5 A;  1OH5 A;  3UKR A;  1NWK A;  1NMN A;  5C24 A;  3H6E A;  4Z94 A;  3SNN A;  4A2A A;  4AHC A;  2ZJQ L;  4HUF A;  3FZH A;  1S3X A;  4JLH A;  1OH7 A;  2OPS A;  3V4I A;  3LM2 A;  3SMS A;  5KPZ A;  2WOM A;  3VN5 A;  4BRC A;  3NH2 A;  1RBU A;  3VES A;  1XWL A;  1KVA A;  5GIP A;  3DRR A;  2F8S A;  3F9M A;  2D0P A;  1ITG A;  3BZK A;  4YOT A;  3S3M A;  1D9F A;  1UA1 A;  1UOC A;  3QO9 A;  5GAE P;  1TKZ A;  5JVH L;  1KVC A;  4AF1 A;  4JI5 K;  3QEP A;  3JYT A;  1RT7 A;  1BCO A;  4CF2 A;  3E9P A;  3LZJ A;  4JI7 K;  3CPE A;  4DFM A;  4H0O A;  4CEE A;  5LMU K;  3H3N O;  3ENH A;  4BDP A;  3NMU A;  4CIE A;  2HBL A;  5KQ8 A;  4DU1 A;  2AJQ A;  3DXK B;  4FPA A;  1BQN A;  4JKG A;  2W41 A;  3OYI A;  1VSD A;  5J2P A;  2BH1 A;  4DU3 A;  3AO3 A;  4BC3 A;  3MXM A;  4CEQ A;  3AA4 A;  2ZGZ A;  5EXW A;  3W0L A;  3WQU A;  4CJ4 A;  4LC9 B;  5KTQ A;  3NF6 A;  4FLW A;  3WXK A;  3G10 A;  1EWR A;  3S3N A;  4HHT A;  1HKG A;  4FWR A;  1REV A;  2IOC A;  5SZT A;  4IDK A;  4B1U B;  4U7B A;  3E1Y A;  3RRG A;  1VSL A;  4A5A A;  4BAC A;  4F2S A;  3O8M A;  2Z1J A;  3THW B;  2GX9 A;  1S1W A;  1P90 A;  4DR6 K;  1WSJ A;  4GMJ B;  4BR9 A;  2QA4 N;  4OLB A;  5FPD A;  1NK4 A;  4H5V A;  4FJG A;  2FSN A;  1FJG K;  3LDO A;  2BUP A;  1HKC A;  4DR4 K;  5IWA K;  2BDP A;  1GLB G;  2NRR A;  3LAK A;  5T7B A;  2YNI A;  5CZ2 A;  3T1H K;  4E89 A;  3HYF A;  3MN5 A;  4FWN A;  4KBO A;  5BN8 A;  4BWJ A;  1ZBL A;  1ZBU A;  1Y97 A;  5HRN A;  2P9L A;  1X9J A;  1D5A A;  2OA8 A;  2HMP A;  4YOX A;  4E7K A;  4JS4 A;  1YIT N;  2XY5 A;  3AAQ A;  3IFR A;  3Q7C A;  4CBW A;  3BF3 A;  4KHN A;  3DMJ A;  4NO7 A;  4DTU A;  2HNY A;  5M1F A;  3T3F A;  3TWH A;  5CZ1 A;  4B3O A;  3WXL A;  1JCG A;  3P38 A;  4DFJ A;  2GBZ A;  2YCH A;  2PYJ A;  4CD3 A;  2ITM A;  2PZS A;  1JLQ A;  2P9S A;  4CZF A;  3CJ1 A;  2KHO A;  2RE2 A;  1VAZ A;  1JXB A;  2V51 B;  4M7X A;  4CZH A;  4FWM A;  2W6K A;  4CEZ A;  2IS3 A;  2Z1H A;  3LDQ A;  2GUI A;  3CQ8 A;  4O0I A;  4GKJ K;  2D0A A;  3ID6 A;  3HM8 A;  4JI3 K;  3ZSQ A;  4R5P A;  1N32 K;  3A5M C;  4DHY A;  1TGO A;  1IH7 A;  3GE1 A;  4F2R A;  2XY7 A;  1J6Z A;  1J53 A;  3AGR A;  4CJ7 A;  5HRP A;  1EO1 A;  4JHD A;  3HVT A;  1EQY A;  5GIO A;  1NG9 A;  5HRR A;  1VK0 A;  2O8D B;  3ZET B;  1HQU A;  1RCH A;  4ID1 A;  2D1K A;  4DSF A;  1KSP A;  1RDC A;  3H46 O;  3V9S A;  3DRS A;  3SUQ A;  1OVY A;  2EWS A;  2ZD1 A;  3KLE A;  2IVP A;  2Q2R A;  3O9T A;  4AHR A;  2FSK A;  4KV8 A;  1VQ9 N;  3HT3 A;  1BL3 A;  2A40 A;  3CPW M;  1JCF A;  3P4I A;  3VOV A;  5BRH A;  3RRH A;  3NBP A;  2Q31 A;  1D4X A;  3ZSO A;  4DLE A;  3TTC A;  4DFK A;  2OPR A;  3WT0 A;  1NLV A;  5AQZ A;  3QEI A;  4Z4F A;  1NU0 A;  1RTD A;  4UY8 O;  4IO9 L;  4DR5 K;  1IBM K;  4OPJ A;  4FZX C;  4DR1 K;  3SCX A;  3SJH A;  1RTH A;  3N4Q A;  3L2W A;  3MEG A;  1VQK N;  4M3T A;  4DV0 K;  2JGU A;  5GAG P;  1S9G A;  1BO5 O;  1R0A A;  1VQ6 N;  3TI0 A;  3PX4 A;  2E2P A;  4LF6 K;  1TUU A;  4B9N A;  5BR9 A;  3ID8 A;  4J8F A;  1M1K O;  2AP1 A;  1GOB A;  3EKU A;  3ASM A;  1E4G T;  2ZM6 K;  3I8B A;  4B1Y B;  4HUG A;  2QK9 A;  4CJV A;  4FLV A;  1VQ4 N;  4FJ5 A;  2QWR A;  4GV9 A;  1ASV A;  2HND A;  3R9P A;  4EZ9 A;  3FFI A;  3M3Z A;  3DLH A;  1QZ6 A;  1BCM A;  1XQS C;  4O5B A;  3AVM A;  4B9T A;  5AQM A;  2P9K B;  4JEP A;  3EN9 A;  3I0S A;  3MX2 A;  4JKD A;  1TVR A;  3PO5 A;  4M3X A;  4FJI A;  3MMV A;  2F9T A;  2NRW A;  2F4V K;  2HB5 A;  1TV6 A;  4BWM A;  5M1N A;  4F4K A;  4CK2 A;  3GG4 A;  4C8N A;  5M1K A;  4FJH A;  3UIQ A;  2E6L A;  3O9Q A;  2NRZ A;  3CCU N;  3SJJ A;  5CR4 A;  3V1R A;  3O4W A;  3O9S A;  4Z4G A;  1LV5 A;  3MEC A;  1WB9 A;  3M5R A;  1VRT A;  1NGF A;  4FWP A;  3AV9 A;  3HXM A;  3MEE A;  1DGK N;  1NJY A;  3K5M A;  3QBW A;  4DKW A;  1FXX A;  3J7Y P;  3D2F A;  4FLX A;  5GAD P;  5IT9 O;  1NGA A;  2HBK A;  3QIN A;  3QEW A;  4C1N K;  3EZW A;  1RT5 A;  2KQ2 A;  1JJ2 M;  4BR5 A;  4DV7 K;  4NCG A;  4O8K A;  5EX5 A;  3QIC A;  3HM9 A;  1U45 A;  1S1V A;  3ZT2 A;  3KLG A;  3AY9 A;  4CFB A;  1WBD A;  2XRI A;  3CCR N;  3A5O C;  2P9P B;  4B1X B;  3ITH A;  4CZM A;  2JWL A;  2GUP A;  4XH4 A;  1OH8 A;  5KRS A;  3H3O B;  3KHY A;  3VTI A;  3PSF A; 
#chains in the Genus database with same CATH homology
 3J7A P;  4DV1 K;  5LMU K;  4DUZ K;  4JI4 K;  1HNX K;  4X65 K;  4LF4 K;  5LMN K;  4DR7 K;  2ZM6 K;  5AJ3 K;  2VQE K;  5BR8 K;  4LF7 K;  4JV5 K;  4LF9 K;  1HNZ K;  5LL6 Z;  2UXB K;  4GKJ K;  4DR2 K;  4NXM K;  3J80 O;  2UXC K;  3T1Y K;  4JI3 K;  4JI0 K;  5FLX O;  4X62 K;  2E5L K;  1N32 K;  2HHH K;  4DV4 K;  1IBK K;  4B3T K;  4JI8 K;  4K0K K;  4JI1 K;  4LF8 K;  2F4V K;  4LFB K;  1IBL K;  4DUY K;  1XNR K;  4DV5 K;  4JI6 K;  4DR6 K;  4LF5 K;  1HR0 K;  4KHP K;  3OTO K;  1FJG K;  4LFC K;  1N36 K;  4B3M K;  4DR3 K;  4CW7 B;  4DR4 K;  2UXD K;  5IWA K;  4YY3 K;  4B3R K;  4YHH K;  3JAM O;  2UUA K;  1HNW K;  2UUB K;  1N33 K;  4LFA K;  4X66 K;  3T1H K;  3J7Y P;  1XNQ K;  5IT9 O;  4DV6 K;  5A2Q O;  3J81 O;  1XMQ K;  4DV3 K;  1XMO K;  4JI2 K;  4DR5 K;  1IBM K;  4X64 K;  4DR1 K;  4DV7 K;  2VQF K;  4JYA K;  4OX9 K;  4DV0 K;  4AQY K;  2UUC K;  4GKK K;  4B3S K;  4NXN K;  4DV2 K;  1J5E K;  1I94 K;  4JI5 K;  4LF6 K;  4V19 S;  2UU9 K;  4CVN E;  1N34 K;  4JI7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...