2UU9K

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uu9K00
4DV3K 4DV0K 4DR3K 2UXBK 1IBKK 4LF4K 4LFBK 1HNXK 5LMUK 1J5EK 4K0KK 4YHHK 4DUZK 1XNQK 4X66K 4AQYK 2VQFK 4JI3K 4DR6K 5IWAK 3T1YK 4LF9K 4DR1K 4JI0K 4JI6K 4LF6K 5IT9O 5FLXO 1HNWK 4DV1K 4DR2K 5A2QO 4LFAK 2UUCK 2VQEK 1XMOK 4NXMK 2HHHK 4DR7K 1N34K 5AJ3K 3J80O 5LL6Z 4DR5K 1N36K 4JI5K 2E5LK 1XNRK 4X64K 3T1HK 4LF7K 2UU9K 4B3SK 4X65K 4DV5K 4B3TK 4DV4K 1IBLK 4X62K 4NXNK 5LMNK 4DUYK 4DR4K 2UXDK 4JV5K 2F4VK 4B3MK 4JYAK 4DV7K 5BR8K 4DV2K 1XMQK 4JI2K 4GKKK 2ZM6K 4JI1K 4JI4K 1IBMK 4YY3K 2UUAK 4LF8K 3JAMO 3OTOK 4KHPK 4CVNE 1N32K 4V19S 4JI7K 3J81O 4GKJK 4CW7B 4DV6K 1FJGK 3J7YP 1HR0K 4OX9K 1I94K 1N33K 1HNZK 3J7AP 4LFCK 4JI8K 2UXCK 2UUBK 4B3RK 4LF5K
chains in the Genus database with same CATH superfamily
4RW9A 4IKFA 3U3GA 4WQ5C 1VSJA 2HNDA 4FM0A 5GADP 1MU2A 4H5RA 1HYVA 2P9SA 4CEZA 4DUZK 5KGWA 5JS1A 2VQFK 4DR6K 2YNHA 3K57A 2D4WA 4CHNA 2ASMA 1P90A 2O8BB 1FK9A 3RR8A 3PX6A 5FLXO 3QESA 3GBTA 1QHAA 1U04A 3P1GA 5AQZA 2PYLA 1LWEA 4CJ4A 1SKRA 2HHHK 3Q7CA 1LAVA 5DK5A 4PHTX 2G8FA 3DXKB 4B9NA 2VG6A 2ZWHA 2ATQA 1D5AA 3FZLA 1RNHA 1EWRA 2P9UB 2LSNA 1Y64A 2NNWA 2Q1NA 4E89A 4YOVA 3SQ1A 4J2EA 1WSEA 4CGHA 4C8MA 1WAJA 2QA4N 2VWKA 1RFQA 3THWA 2DTUA 1ATNA 3C6UA 3MN6A 4BE0A 4FPAA 3CIPA 3C0BA 1QTMA 3VQ5A 1NOYA 4X62K 4FOEA 2HB5A 1GLEG 1KAZA 3CC7N 3CMAN 4XEIA 3KTQA 3HSTB 4CESA 2WUSA 1NMNA 1GLDG 1NGBA 3CFPA 2OZSA 4JI4K 3CF5L 2B5JA 4HCBA 1BOTO 1Q7YO 4JI7K 1YJWN 5JICA 3J7YP 1W97L 4CFAA 4Z4CA 5C0YA 1T7PA 3QEPA 1C0MA 2P9NB 3NGIA 4OJRA 4K41A 4OLAA 3C7NB 1T44A 5EVZA 4R5PA 3QFPA 4JD2B 1C1BA 5AQTA 3BZCA 1KSPA 2VYPA 2KQ2A 2QWRA 1Q9YA 3AY9A 3ZSXA 5BRHA 3MWTA 5TKWA 4KI4A 4YDUC 3MXJA 4F4KA 3VF6A 1REVA 4IWVA 3FR0A 5EX5A 1NJWA 2E20A 2HF3A 1NGIA 3ZT0A 3IAYA 1N8RO 4KH5A 5HROA 1WSGA 4JRPA 3OYEA 3CPEA 1XNQK 1KQSM 3ASMA 2FSKA 2BE2A 3HRGA 1JL1A 3V9ZA 2W40A 4J8FA 4ILHA 1Y97A 3OYNA 4DQIA 3IFRA 4DR2K 3AO3A 1JXBA 4CZJA 4IEEA 4FWSA 4IOXA 5AJ3K 3E9PA 3J80O 1YHQN 1KD1O 1QQNA 3J8AA 4MO5A 3ZSYA 4CJRA 3LDLA 3RSEB 4BRGA 3VGLA 5GIOA 5F0XA 4DTRA 3NHGA 3TAGA 2Z1IA 2G8VA 3P83D 3O3FA 4RWTA 3S3OA 3BZKA 2JWKA 4FJJA 4WFAL 1U2VA 4B3SK 1CLQA 1FXXA 3FE1A 1YIJN 4DTNA 5BN9A 1LWCA 1RT3A 1WBDA 3VOVA 3VPZA 3SK3A 1E4GT 1JXEA 4UQGA 1KFSA 2KZZA 5M1OA 3NVMA 5AFUA 3F73A 4C1NI 3HP6A 5I3UA 2WBNA 4F2SA 3LDOA 4M3WA 1ITGA 5CZ2A 4CHYA 3SAGA 3R1XA 1JL2A 3CI5A 3O4QA 3TSPA 1IO2A 3HTVA 3OYFA 3NE6A 4CJWA 3N4PA 3AO5A 4E7KA 5HLFA 1FW6A 2D0OA 1YAGA 3LDSA 1NKEA 3DOLA 2W42A 3DI6A 3SAFA 4M7YA 4B1VA 1RT1A 1Z05A 3KKRA 2XO7A 2F96A 1EWQA 1NGFA 4CJKA 1ASUA 1NGCA 3TAPA 2GTDA 2O8DB 4BRDA 2HHWA 4CEDA 3AVAA 3AVKA 2Q36A 4H5NA 1NWKA 5HRRA 4A57A 4E7IA 3DJCA 3P5JA 4CJSA 2HSTA 4XH1A 4BR9A 2OZMA 1L3UA 4JK9A 1VQ9N 4W5RA 2A6AA 4HHTA 2O8FB 4NLBA 3C6TA 4FJ9A 2CH5A 2HBKA 1X9WA 2VCPA 1KCFA 4FW1A 4LF6K 2O8EA 4J2BA 3LWLA 4DSIA 3L6QA 3WNGA 4CJLA 1VQON 1NKCA 3ENOA 3ZEUA 2X6NA 3F9MA 1XMOK 1N34K 3ZSRA 3QINA 1KFDA 4E7HA 3M5RA 2BGGA 4BG9A 1O1WA 1NK0A 4FLYA 3AARA 1JCEA 2EX3A 3LZJA 1NK7A 2QWLA 2YKNA 4FK2A 1K8KA 2D0AA 3NH2A 3MXIA 4KHYA 1NK5A 4DCHA 3T19A 1Q81O 4WQ5A 5JMVA 4LY7A 5BPNA 1J6ZA 5KPTA 3O08A 4DR4K 3GDQA 5CYMA 4FL9A 1U6ZA 1YITN 5BR8K 3V9XA 3K9JA 4JI2K 3VQPA 3AO1A 4Q5VA 4L3QA 4CEQA 2Q2RA 2ZQBA 3RMAA 1G99A 1RDAA 3OYJA 1IBMK 2G8IA 3D7EO 1DEJA 4YOXA 2V7YA 4DFMA 2G8UA 2UUAK 4B9VA 1CZ9A 4V19S 4CF0A 1NK8A 2HNYA 1HKBA 3OS2A 3HT3A 3DXMB 1QQOA 5LJVA 3MCAB 1OVYA 3PUFA 1V4SA 1NK9A 3VN5A 5C2FA 5C12A 4YOYA 4FWKA 1WOQA 4CJ3A 2O8CA 2E88A 3VQDA 2QTDA 4KHSA 4H0VB 3CCEN 4JEPA 2FF3B 5AQJA 5FPNA 5KTQA 3NAEA 3CCJN 3G71N 5B8HA 1HJOA 2ZJQL 5E84A 4Z4HA 2P9PB 4OVLA 4FPBA 3O1WA 1BIZA 2F9WA 4BQLA 4BDPA 1MDUB 1JLGA 4Y0WA 4CF8A 5AQMA 4C8KA 4CHOA 4AQYK 1S1WA 1Z26A 2A42A 2QKBA 4DQ8A 4FVUA 2HHTA 2ZGYA 3LDPA 1XUPO 3SLCA 3MEDA 3O3GA 5BPLA 4FJKA 1HNWK 3M3ZA 4NCAA 1HNVA 1CXUA 1SUQA 3IS9A 5JVHL 3V4IA 3SAHA 2ITMA 3CJ9A 4KTZA 2WONA 1UAXA 3MAQA 3OYIA 4B9LA 2G8KA 4JI5K 1TKZA 1YVUA 3G6EN 3CG7A 4A2AA 1J5OA 4TSXA 4FWLA 3KK7A 4HUFA 5KRSA 4YDUA 4C23A 3D0PA 4C8LA 4DQPA 1HQEA 3U6FA 2QM1A 3KK1A 2QWOA 2NRRA 1ASVA 4JYAK 4CZIA 5F1XA 1WN7A 3NCIA 2FBXA 4O0JA 2YKMA 3S9HA 4YFUA 4FLXA 3ZYYX 1HUXA 2Q31A 3UB5A 2ZD1A 5C24A 5AQXA 4KPYA 4H8KA 3A5NC 2QWQA 4BDZA 2BANA 1ZBFA 4GKJK 3LALA 1BA0A 2OTLN 1RT7A 1D9DA 2D1KA 2X78A 3IG1A 3B8AX 3J7AP 3Q7BA 1DKGD 3QNOA 4CIEA 2Z1JA 3VQBA 3S3NA 3J7ZO 1RDUA 1VK0A 4B9TA 3LP2A 3A5LC 1T6CA 3L4QA 3O8MA 4ID1A 1B9DA 1VRTA 3BGRA 5CR4A 3MXMA 4FZYA 4DSJA 4DQRA 2E4LA 3T1AA 3SQ2A 2F8SA 3WQTA 4HCCA 2GX9A 5HP1A 3D2EB 3EYZA 4LSNA 4B8CA 2XY6A 1EX4A 2V52B 3QLHA 5DM7L 4CEAA 2VQEK 1VSKA 3TARA 4EP5A 3TR8A 3ZX0A 4CZHA 4DR7K 3SJJA 3UIQA 1EQYA 1NGEA 4BRAA 1S22A 4A2BA 1O13A 3I8BA 3HM9A 3MECA 4JNEA 4CZMA 1U2VB 2QK9A 5FPDA 5GAGP 1RT4A 2QXFA 4ELTA 1XWLA 4N76A 3KK2A 1SQKA 1HLUA 2E2QA 4LD0A 1U4BA 4FVMA 1GOCA 4PQUA 3KWIA 4EHTA 2WTUA 3FLCO 4F8RA 2DY4A 3EN9A 4JI1K 1TKTA 3VGKA 4E7JA 3RVCA 3GOIA 3JAMO 4CVNE 3OYKA 4CIGA 4BVPA 1OH6A 4K43A 3IUCA 2QXLA 1ASWA 3ZSOA 3ZT4A 3IKMA 2UYTA 3CM5A 3VQ4A 4FJ8A 4OX9K 5CY4A 4CFCA 1V4TA 2O4GA 3SCXA 2WFBA 4IFYA 1RBSA 3O3HA 4Y1CA 1M1KO 4IXCA 4CGGA 4F3TA 3KIOA 5BPMA 4R79A 2I7PA 1Z25A 1J9AA 4B9UA 3OJSA 4GV6A 3L2RA 3C6AA 4A61A 4H4MA 2A40A 4B8AB 5AQUA 4LF4K 2CH6A 4LFBK 3VQQA 3THYA 4NCBA 4DWIA 4JKDA 4W5TA 1EKEA 4CF2A 4CHPA 3H1QA 2Q97A 4FWRA 2JGUA 3HSCA 3PX4A 4E0DA 1ZXOA 3UKRA 5AQOA 4FWMA 4DU3A 2Y1IA 3ZEUB 1BU6O 4CCHA 4JI6K 3SPZA 4C8OA 3VERA 3QICA 3L2WA 4OPJA 1QSLA 3MEGA 1QS4A 4M7XA 2GWJA 3VEWA 4DV1K 4WE1A 1QSYA 1LW2A 4CGFA 1TYQA 4JS4A 2UUCK 1XQSC 3VMFB 4CJVA 4DKWA 4M3TA 4H5TA 4M3ZA 4M3RA 4DR5K 3ULEB 1ESVA 2Z1GA 4DSLA 2GWKA 1I39A 3HM8A 2P5OA 2W6LA 4BR4A 2E1ZA 3AGRA 4IDHA 1B92A 5J2NA 1ZBHA 3D2FA 2OA8A 4JKAA 3CMEN 4DFPA 3THXB 3CCQN 2OANA 1C6VA 1HNIA 4HUGA 4CJ5A 4DG1A 1XHZA 4JHDB 1T8EA 1WB9A 4K8ZA 3WXLA 4QS8A 1IH7A 5BN8A 2HBJA 4OGEA 2ASPA 3LDNA 4I6MA 2NRWA 4BWMA 5C15A 1GLAG 4B1XB 3UE5A 1S6PA 2HOEA 1HRHA 1YTAA 3CJ1A 2V51B 2DFHA 3UKUB 4JKCA 4FWOA 4YOUA 1IKYA 3VTIA 4BRPA 3U9DA 4KH4A 1UA1A 4BACA 4HTLA 1NK6A 1N33K 5JLFA 3ISNC 3KLIA 4Z94A 3SQ4A 4KB0A 1QE1A 2PAVA 1NMDA 4B3RK 2IVNA 3OHRA 3JSMA 1QSSA 1KLMA 4CFBA 4CZLA 2BUPA 4DV0K 3P39A 2E2NA 4CJFA 4N47A 4CJPA 5HL7L 1RDWX 1RTHA 3EE9A 3G0ZA 3JXUA 3AO4A 3K58A 4YHHK 3DLBA 1S9EA 1UOCA 4C8NA 4DSEA 3L4IA 3K2PA 5J2MA 3FGUA 5AZIB 4CE9A 4QAGA 2F8TA 4CZGA 4DFKA 3PLAA 3P4IA 4PKHA 3VEYA 1TL1A 3CJCA 4BWJA 2WOMA 3L0QA 4H03B 3E66A 1KVAA 1RT5A 3MMVA 2A5XA 3CCUN 2P9LB 3QIPA 4DTXA 1JLAA 2PY5A 2YHAA 1ZBSA 4CF9A 3ZETA 5AQQA 3L2VA 3KLFA 2NRXA 3HZ6A 3LL3A 5M1FA 4B3TK 2ASOA 5HRSA 3H08A 5AQWA 3I8DA 1A5WA 4CD1A 3SYZA 4B1UB 1KXPA 1NKBA 3WEEA 2OPPA 4BG8A 2HHQA 1N5YA 2NRHA 3OVNA 4YORA 4BRQA 4I7FA 1RT2A 1NJZA 2Q0RA 3RWUA 3CERA 4BR0A 2PYJA 2NLXA 2P9IA 3ZSWA 3CCRN 2GUIA 4KHNA 1GOBA 3WXJA 1OVQA 1L3TA 2HHSA 4AHTA 3OYGA 3PIPL 1VQPN 4PKIA 5FRNA 4BRNA 2Q3SA 3A8YA 4ISGA 1NNEA 3FZFA 2CGLA 2VWBA 3O9RA 4DFJA 2BTFA 4GW6A 1SKWA 5AQKA 5JS2A 1HNXK 3K59A 4IJAA 4YOTA 4IOAL 4FJXA 5AQVA 4DLGA 1E3MA 5LMUK 3EL2A 3I55N 4B1YB 1N6QA 2YNGA 3M1FA 4Y1DA 4X66K 1SZ2A 4LC9B 2I7NA 1C0FA 4JKFA 3OYDA 4MO4A 1WSFA 4CJQA 3ZSQA 5CYQA 1LV5A 4Z4EA 3I33A 4BR5A 5AZJA 3G4SN 1VQMN 4F3OA 5JLHA 3MN7A 4MFBA 4KFBA 4M3XA 1FKOA 3MK6A 2GELA 4I2QA 3L2QA 2E6MA 3ZSZA 3CFRA 5J2QA 3HK2A 3SNNA 4DS5A 3R3LA 3T1HK 1HYZA 2YHYA 4O5BA 3SMSA 4AHVA 3KLEA 2UU9K 3CCVN 4IDKA 4QCLA 4BGAA 3RRGA 4M42A 1BI4A 2VGNA 3NF9A 3QB0A 4FM2A 3AVCA 4NXNK 4DUYK 3CCLN 3AVLA 1A5VA 3BP8A 3VEZA 4U7BA 3H46O 4KO0A 5I42A 3BDPA 4EAHD 2ZM6K 3FFKB 3K5LA 3QO9A 2E8AA 1LWFA 3R9PA 3HVRA 4ELUA 1VQLN 1QHTA 2CGKA 1N32K 2X6SA 4AHRA 4W5QA 4FZXC 4E3SA 4CW7B 3OS0A 1P8ZA 3NF7A 4KV8A 3K5NA 1VSIA 4KB1A 4DSKA 2W41A 1ZBUA 4JKGA 3E01A 4JAXA 3K9KA 2HVHA 3DRSA 4JI8K 1YXQA 4RTFD 2HW3A 3PX0A 4BROA 3S41A 4AH9A 2OPQA 4BRMA 3THYB 3ZT3A 2F9TA 1NGAA 1VQ8N 1C1AA 2O8BA 3QBXA 5EU7A 3HI0A 3O80A 1YJNN 1YVNA 1WSIA 5GAEP 3VQ7A 3CYMA 3UKRB 3MN9A 2B6AA 4GY2B 3DXKA 4ELVA 3T1YK 3I0SA 1SV5A 1SL1A 1W2BM 4HVJA 2RKIA 5KQDA 3NF6A 1HX1A 1LW0A 1TYQB 2P9UA 5AQPA 1W9HA 3K0SA 4WQ4C 5KPRA 1WBBA 1WAFA 4GVMA 4B1WB 3TAEA 1X9MA 3DAWA 4LFAK 2JLEA 1WSHA 1YT3A 1KAYA 1YI2N 2P9SB 4EHUA 4IJNA 3U4LA 4N41A 2NZTA 2YV0X 4I9QA 3EEQA 2D0PA 4FSVA 3NMUA 3R6MA 3D2FB 4ICLA 4I2PA 1HKGA 5AQFA 4BDYA 3VQEA 5EXWA 1T03A 4BQZA 3G25A 4CHZA 4PKGA 3C6HA 1VQ7N 1NM1A 3VEOA 1NU0A 2OTJN 2QWNA 1JLBA 3LPTA 4DV4K 4EP4A 4JKEA 3ITHA 1TK0A 5HRPA 3CQXA 4MQ3A 3SUNA 4JLHA 2ZJPL 3ENBA 4PY5A 4XIUA 3IDHA 4BRCA 4JS5A 3THWB 3DLLL 4FLZA 2P9NA 3DRRA 3QFUA 3V9SA 3DMJA 4IBNA 4M63C 4DTMA 4IOCL 2YNIA 3A5MC 2KTQA 3A5OC 3OYHA 4MDAA 4L8RB 2BDPA 1R0AA 4EIAA 4CBXA 3ENHA 3LANA 4CJUA 1FJGK 4CK2A 4DTPA 2G8WA 4M45A 4W5NA 1D9FA 3WNFA 1S6QA 4KTWA 3DRPA 4E1NA 4WFBL 4M41A 2XHBA 4QOZB 4CJEA 5C2DA 3EO3A 1ATRA 4DLEA 1XI1A 3AA5X 4NB4A 3WNHA 1NG9A 2RPIA 4CK1A 1X1PA 1KC8O 2IS3A 4QS9A 4PA1A 3RMDA 3LZIA 4DQQA 3ATVA 3KLGA 4IFEA 3V9UA 3DOKA 4E19A 3HP9A 3DYAA 4DF4A 3P31A 1OH5A 3NVKA 5D3GA 2VG5A 5FRMA 1S3XA 4DU1A 3U8XA 1QVFM 1HPZA 3AAPA 1ILYA 3KK3A 4BRIA 3L3UA 5GIPA 4H5VA 3AA2A 3VEVA 5SWMA 3QIOA 2B4JA 4CD3A 4ID5A 3M8SA 3AAQA 4FM1A 4NXMK 2RHKA 4KBOA 4OKKA 3O1BA 3PO5A 4KRFA 2YHBA 4Q0BA 1NGDA 1T05A 2HVIA 3LP1A 1X9JA 2E5LK 3V9WA 3ZCMA 4FLVA 4RCHA 4H0PA 3KHYA 2NRZA 3KD5E 4CFDA 3T69A 5KRTA 2VWJA 4KAZA 4LF7K 4PWDA 1J53A 4DV5K 3PSFA 1RCHA 3CQ8A 3CC4N 4BRKA 2AP1A 1JLFA 1RILA 2VG7A 3ZSVA 1MA9B 3T7ZA 5E26A 2XY7A 2YJEA 4DU4A 3VTHA 1K6YA 2KFNA 2WC9A 3VQ8A 3IMXA 3HYFA 2NRVA 2GEMA 1TL3A 3OA9A 3O9SA 4RW7A 3I0RA 3OYBA 4FOIA 4XH5A 1BHLA 2O8DA 1YF5L 1GLFO 1S1UA 4H0XB 5FDLA 1W7AA 1BGXT 3OJUA 2HNZA 1VSEA 3CJ7A 3PV8A 3GL1A 1X3MA 5I9EB 4DHYA 1ATSA 2E6LA 4U67L 2UXCK 4AHUA 2A1RA 2O8FA 4BC3A 2R7YA 1KRPA 3CJBA 1DTQA 5ELZA 3L3VA 5J1EA 2UXBK 1IBKK 1GLLO 1K73O 1RTDA 3V6DA 4CK3A 1R59O 2EWSA 2FF6A 3AVBA 3MEEA 3O9TA 1UA0A 1DTTA 2YNFA 2IGIA 5AZJB 3OYAA 5TKYA 4DR1K 3VENA 1BCOA 4O5FA 4B9MA 4UY8O 4N5SA 3VQ6A 4MDBA 1L3VA 1GLJO 2G8HA 2AJQA 3AA3A 3NFAA 4JN4A 3RRHA 2HMIA 4AM7A 4Z4IA 2O8EB 5LJWA 5M1PA 1BIUA 5KPZA 4BR7A 4OGCA 1IKVA 3RMCA 1IKWA 1L3SA 3QDKA 3CC2N 4KKOA 3VEXA 1SKSA 3LAKA 3TAMA 3HPHA 4DQSA 4W5OA 1TVRA 4KREA 4B3MK 5KQ8A 3DXMA 1CXQA 3E1YA 3CQYA 3P38A 1K8KB 4IZ9A 4CJ7A 4WQ4A 3AVGA 1RTJA 2YHWA 4DF8A 5HOOA 2PBDA 1Q8IA 4JKGB 2IC3A 2ITGA 4AF1A 3OY9A 3QMLA 5AQIA 1HR0K 2HHUA 3ULDA 2FBVA 4AM6A 1I94K 2P9PA 3AVNA 1BO5O 1VSHA 3JS6A 3ZT2A 1VSMA 1MWKA 1IG8A 3DWLA 4O8KA 2KKZA 1RBTA 2DFFA 2E2OA 2QWMA 3KZBA 3G10A 3NBPA 3HPOA 1U47A 3OYMA 1C0TA 3QEVA 1DGKN 2QWPA 3QETA 3BF1A 2O8CB 3EKSA 4K0KK 3ID8A 1TUYA 2P5GA 4A62A 3SBTA 1TK5A 1MWMA 3K5MA 3WNEA 1B9FA 2HHXA 1F21A 1NGHA 1Q86O 4WF9L 5GINA 2KFZA 4O55A 4BR2A 4DTUA 1VAZA 1U49A 4M3UA 3CM6A 3CETA 4BRHA 4KHUA 5BR9A 3V81A 1YJ9N 3CPWM 4OPHA 1DT9A 1NBWA 5C42A 4BE2A 3AVMA 1HQUA 4OPAA 1NGGA 4F9OA 1TV6A 4IO9L 4PL7A 3ATUA 4IG0A 4NYNA 2D5RA 3QERA 2YCHA 4YNQA 3H3NO 4A59A 1QVGM 3VGMA 4O8UA 1XHXA 1KTQA 4BC5A 4FXDA 1IV0A 2Y1JA 3SV4A 4QS7A 3QEWA 1YTUA 1UWBA 2CGJA 3PIOL 2OCEA 3E9OA 4JK7A 3NDKA 4CZKA 1XMQK 4GKKK 4ZHRA 4C1NK 4RW8A 5BRDA 3SZ2A 4FCYA 4K25A 1LOTB 4YY3K 3QEXA 5CZ1A 2GV9A 3S3MA 3LPUA 3AVFA 4A5AA 4GVEA 4EZ9A 4LF8K 1QZ5A 3HOTA 3HVTA 1JLQA 5BRFA 2ZGZA 2Q0UA 3NGZA 3THVA 2X74A 3OW2M 1HYSA 1BG3A 5AQRA 3O9UA 5AQGA 3EZWA 2FSJA 5BREA 1J54A 2JWLA 3FZHA 4RG8A 4OPKA 3C95A 4CHQA 4EZ6A 3D2EA 1EETA 1RDCA 4CIFA 4IEIA 3O5BA 3WT0A 4N56A 3EZ5A 4CEFA 5CHIA 3TWHA 4FJ5A 4BC4A 4ILJA 2ZE2A 3HL8A 4FZZA 4FYDA 5AR0A 3KKSA 2FC0A 5IWAK 4FK4A 4BRLA 1VQNN 4B3OA 4FLUA 1L5UA 4BGBA 1IJJA 4KH6A 3WXIA 3KLHA 2P51A 1HKCA 2RF2A 5M1NA 3MCPA 4ILGB 1EXQA 2HF4A 3TPQA 2EHGA 4FJ7A 3VA0A 3PO4A 2O4IA 2I5JA 2IDOA 5AQLA 4F2RA 3W3DA 2H3GX 2YJFA 1VQ4N 3AVHA 1S1TA 1JCGA 2IIRA 4BVOA 3D6RA 3NH0A 3TTDA 3HXMA 4CZEA 4DTJA 4NO7A 2IAJA 5C10A 4X65K 4ZTFA 1NJXA 1BDGA 5F2RA 4RW6A 3W0LA 1TKXA 4JV5K 3KD1E 4B08A 4DV2K 4H0TB 3OYCA 4NCGA 4OLBA 4KHWA 5AQHA 3CD6N 4FJNA 3SMPA 1X9SA 1TGOA 1WSJA 3LAMA 1JJ2M 2BH1A 5GAHP 1A5XA 5HBMA 4B9QA 3M8PA 1NGJA 2P9KA 4FO0A 4CGJA 1VRUA 3OS1A 3V1QA 2E1YA 2HBMA 4H5WA 5LY3A 3FZMA 4FWNA 1VQ6N 3KWGA 3V1RA 1Z6RA 1QQCA 4ZTJA 3CFOA 3M8QA 1U48A 1CZBA 4GV9A 1VSFA 3C94A 3EE8A 3VQ9A 3MWPA 4CBUA 1IG9A 4BY9C 3AV9A 4DV3K 4DR3K 3NH1A 3TI0A 3AA4A 3B6OA 3L2UA 2ETJA 5AQNA 1BQMA 1TAUA 3PY8A 3O9QA 4FLWA 4WCEL 1M90O 4DB3A 4O4GA 4CF1A 1U45A 3DLHA 4FJGA 2KZMA 3O6WA 3OYLA 3O4NA 3WXKA 4CGDA 1QQMA 3M6GA 5ADXH 3WXMB 3MDQA 4GMJB 3HJFA 3SQ0A 4LH4A 1H1VA 3ULEA 1GLBG 5EY4A 3FFIA 1WLJA 1DLOA 4ISEA 3IRXA 2KHOA 5A2QO 3TABA 2J4RA 5M1QA 1VSDA 3VA3A 1NLVA 3GG4A 1FKPA 4O0IA 3THXA 3EY1A 3U3YA 3DLKA 2KLAA 4JRQA 4BREA 1XC9A 5LL6Z 1S5JA 4JHDA 4CI6A 4B1ZA 3M8RA 3ZX2A 1RDBA 3CCMN 4DS4A 4H4OA 3T3FA 1EO1A 1QZ6A 5H1SQ 1TAQA 1RBRA 3KJVA 1VSLA 1IBLK 4H0YB 4CEBA 1SL0A 1KVCA 5LMNK 1ZC6A 3ID6A 3UKUA 2D0BA 3QNNA 4DV7K 4OKEA 3CXCM 3VETA 1GLCG 1SS6A 4FK0A 4K8XA 4JKBA 3AVIA 1HPMA 4EFHA 3LDQA 3VQCA 1BISA 1JCFA 1WNSA 4K42A 3QEIA 3ALYA 5SZTA 4KHQA 2GBZA 2VGMA 3L8BA 5MLCQ 1I3AA 2QI2A 1TK8A 2AA4A 3LP3A 5J2PA 3HO1A 4E7LA 4XH4A 4AHCA 2HMPA 1E4FT 1VQKN 1HNZK 4I6MB 3NGYA 1S1XA 1RBUA 2W6KA 4O44A 2XRIA 3QBWA 2RE2A 3WQUA 2ZF5O 2A1SA 3BF3A 3C7NA 1TKDA 4E1MA 3FZKA 4JD2A 5FROA 1OH8A 2PFUA 4NYFA 3VF4A 1IKXA 5AZIA 3ZT1A 2FBYA 3U9ZA 3SJHA 4OO1J 2OYQA 2XY8A 1SAZA 3E9LA 1KVBA 3A2FA 3HPGA 2QEXN 2NUBA 1Q82O 3VF2A 2E2PA 4CEEA 2P9LA 3C65A 2OPSA 1RT6A 3TAQA 4GV3A 1NJYA 4WFNL 3KVGA 1C0GA 3DLEA 4JK8A 4CBWA 4MLEA 3SUQA 4BE1A 1G15A 2QKKA 1VQ5N 2HBLA 3DLGA 3VQAA 1S1VA 3JYTA 1S9GA 3BY5A 3CJAA 4DTOA 4X64K 2DPNA 1LCUA 1JLEA 5JVGL 1BL3A 3PSIA 3RSEA 3ZLJA 1CZAN 2IVPA 4A5BA 2NRTA 4HTUA 1Q9XA 2F4VK 1SL2A 4FJHA 4FJIA 1WUAA 3LP0A 3ZETB 4YOWA 1C0UA 3H6EA 3SV3A 1BUPA 4RW4A 3MX2A 4B9SA 5DMRA 5KI6A 1JLCA 5E41A 4Z4FA 4DV6K 3WEEB 3VESA 2A41A 1D4XA 4CJTA 3OBYA 2IVOA 4JKHA 4H0OA 1JKHA 4LFCK 1X3NA 2Z1HA 3O4WA 1K9MO 2QW9A 3CHWA 1W0HA 3RTVA 2UUBK 2YI1A 5AFUH 4BC2A 5EOYA 4FJLA 2P9IB 4LH5A 4CECA 3EKUA 3H1VX 1HJRA 1XC3A 5AQYA 3WUHA 2KW4A 2IOCA 3CCSN 3TSQA 1S72N 1D8YA 2A3ZA 3NF8A 4KTQA 1EP4A 3AO2A 3DM2A 2GUPA 1J5EK 4J2AA 1OH7A 2FBTA 3H45C 2FXUA 3LM2A 4JI3K 4IO8A 4CERA 2FLOA 4LF9K 2HHVA 4JI0K 4HUEA 1ZBLA 4HWIA 4PUOA 4DTSA 5IT9O 5FPEA 5HRNA 3TAFA 3SUPA 2YX6A 4MLHA 4AHSA 3SPYA 2FSNA 1T3VA 3MX5A 4DMNA 4ISFA 4BRFA 2D0CA 3D45A 3GE1A 4G9ZA 3RR7A 4I9LA 3SI6A 4FLTA 1Q18A 3SUOA 2DFEA 3MN5A 1N36K 1XNRK 1KAXA 3AGKA 1RTIA 4NLCA 3I56N 4DSFA 4FJMA 3RMBA 4GNIA 3N4QA 4CEOA 4G1QA 1LAWA 4LSLA 4FWPA 1OKJA 2P1JA 5FPMA 3R8EA 3TANA 4J2DA 5M1KA 5KGXA 1VHXA 3DLRA 5C25A 3H3OB 4M3YA 3AVJA 1HMVA 4Z0UA 1ZYQA 2UXDK 2V7ZA 3F9KA 3A0IX 1C1CA 3LM9A 3OBWA 1TUUA 3V1OA 1GOAA 2PZSA 5T7BA 1BWFO 3HBTA 1BCMA 3BUZB 3LWMA 2P9KB 3ZX3A 1BI4B 1RGIA 3TSUA 2YHXA 1RBVA 4FWQA 3TTCA 3OTOK 2XY5A 1T6DA 1NJIO 5CE3A 3TU5A 1K8AO 4Z4GA 4KHPK 4OKJA 3J81O 1ZBIA 4CZFA 4CGIA 5DM6L 4AILC 1KLNA 3K5OA 4PL8A 3F2KA 4FW2A 3SBGA 1NK4A 3F5TA 2ZJRL 2RN2A 4IFVA 4E1JA 5ADXA 5K14A 4KI6A 1YUWA 1BA1A 3B6PA 2OPRA 2F7TA 1RDDA 4WYBA 1NOZA 3TTFA 3HOSA 3BEXA 4IG3A 1BQNA 4LF5K 5AQSA
chains in the Genus database with same CATH topology
4DV3K 4DV0K 4DR3K 2UXBK 1IBKK 4LF4K 4LFBK 1HNXK 5LMUK 1J5EK 4K0KK 4YHHK 4DUZK 1XNQK 4X66K 4AQYK 2VQFK 4JI3K 4DR6K 5IWAK 3T1YK 4LF9K 4DR1K 4JI0K 4JI6K 4LF6K 5IT9O 5FLXO 1HNWK 4DV1K 4DR2K 5A2QO 4LFAK 2UUCK 2VQEK 1XMOK 4NXMK 2HHHK 4DR7K 1N34K 5AJ3K 3J80O 5LL6Z 4DR5K 1N36K 4JI5K 2E5LK 1XNRK 4X64K 3T1HK 4LF7K 2UU9K 4B3SK 4X65K 4DV5K 4B3TK 4DV4K 1IBLK 4X62K 4NXNK 5LMNK 4DUYK 4DR4K 2UXDK 4JV5K 2F4VK 4B3MK 4JYAK 4DV7K 5BR8K 4DV2K 1XMQK 4JI2K 4GKKK 2ZM6K 4JI1K 4JI4K 1IBMK 4YY3K 2UUAK 4LF8K 3JAMO 3OTOK 4KHPK 4CVNE 1N32K 4V19S 4JI7K 3J81O 4GKJK 4CW7B 4DV6K 1FJGK 3J7YP 1HR0K 4OX9K 1I94K 1N33K 1HNZK 3J7AP 4LFCK 4JI8K 2UXCK 2UUBK 4B3RK 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 K;  4DV0 K;  4DR3 K;  2UXB K;  1IBK K;  4LF4 K;  4LFB K;  1HNX K;  5LMU K;  1J5E K;  4K0K K;  4YHH K;  4DUZ K;  1XNQ K;  4X66 K;  4AQY K;  2VQF K;  4JI3 K;  4DR6 K;  5IWA K;  3T1Y K;  4LF9 K;  4DR1 K;  4JI0 K;  4JI6 K;  4LF6 K;  5IT9 O;  5FLX O;  1HNW K;  4DV1 K;  4DR2 K;  5A2Q O;  4LFA K;  2UUC K;  2VQE K;  1XMO K;  4NXM K;  2HHH K;  4DR7 K;  1N34 K;  5AJ3 K;  3J80 O;  5LL6 Z;  4DR5 K;  1N36 K;  4JI5 K;  2E5L K;  1XNR K;  4X64 K;  3T1H K;  4LF7 K;  2UU9 K;  4B3S K;  4X65 K;  4DV5 K;  4B3T K;  4DV4 K;  1IBL K;  4X62 K;  4NXN K;  5LMN K;  4DUY K;  4DR4 K;  2UXD K;  4JV5 K;  2F4V K;  4B3M K;  4JYA K;  4DV7 K;  5BR8 K;  4DV2 K;  1XMQ K;  4JI2 K;  4GKK K;  2ZM6 K;  4JI1 K;  4JI4 K;  1IBM K;  4YY3 K;  2UUA K;  4LF8 K;  3JAM O;  3OTO K;  4KHP K;  4CVN E;  1N32 K;  4V19 S;  4JI7 K;  3J81 O;  4GKJ K;  4CW7 B;  4DV6 K;  1FJG K;  3J7Y P;  1HR0 K;  4OX9 K;  1I94 K;  1N33 K;  1HNZ K;  3J7A P;  4LFC K;  4JI8 K;  2UXC K;  2UUB K;  4B3R K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 4RW9 A;  4IKF A;  3U3G A;  4WQ5 C;  1VSJ A;  2HND A;  4FM0 A;  5GAD P;  1MU2 A;  4H5R A;  1HYV A;  2P9S A;  4CEZ A;  4DUZ K;  5KGW A;  5JS1 A;  2VQF K;  4DR6 K;  2YNH A;  3K57 A;  2D4W A;  4CHN A;  2ASM A;  1P90 A;  2O8B B;  1FK9 A;  3RR8 A;  3PX6 A;  5FLX O;  3QES A;  3GBT A;  1QHA A;  1U04 A;  3P1G A;  5AQZ A;  2PYL A;  1LWE A;  4CJ4 A;  1SKR A;  2HHH K;  3Q7C A;  1LAV A;  5DK5 A;  4PHT X;  2G8F A;  3DXK B;  4B9N A;  2VG6 A;  2ZWH A;  2ATQ A;  1D5A A;  3FZL A;  1RNH A;  1EWR A;  2P9U B;  2LSN A;  1Y64 A;  2NNW A;  2Q1N A;  4E89 A;  4YOV A;  3SQ1 A;  4J2E A;  1WSE A;  4CGH A;  4C8M A;  1WAJ A;  2QA4 N;  2VWK A;  1RFQ A;  3THW A;  2DTU A;  1ATN A;  3C6U A;  3MN6 A;  4BE0 A;  4FPA A;  3CIP A;  3C0B A;  1QTM A;  3VQ5 A;  1NOY A;  4X62 K;  4FOE A;  2HB5 A;  1GLE G;  1KAZ A;  3CC7 N;  3CMA N;  4XEI A;  3KTQ A;  3HST B;  4CES A;  2WUS A;  1NMN A;  1GLD G;  1NGB A;  3CFP A;  2OZS A;  4JI4 K;  3CF5 L;  2B5J A;  4HCB A;  1BOT O;  1Q7Y O;  4JI7 K;  1YJW N;  5JIC A;  3J7Y P;  1W97 L;  4CFA A;  4Z4C A;  5C0Y A;  1T7P A;  3QEP A;  1C0M A;  2P9N B;  3NGI A;  4OJR A;  4K41 A;  4OLA A;  3C7N B;  1T44 A;  5EVZ A;  4R5P A;  3QFP A;  4JD2 B;  1C1B A;  5AQT A;  3BZC A;  1KSP A;  2VYP A;  2KQ2 A;  2QWR A;  1Q9Y A;  3AY9 A;  3ZSX A;  5BRH A;  3MWT A;  5TKW A;  4KI4 A;  4YDU C;  3MXJ A;  4F4K A;  3VF6 A;  1REV A;  4IWV A;  3FR0 A;  5EX5 A;  1NJW A;  2E20 A;  2HF3 A;  1NGI A;  3ZT0 A;  3IAY A;  1N8R O;  4KH5 A;  5HRO A;  1WSG A;  4JRP A;  3OYE A;  3CPE A;  1XNQ K;  1KQS M;  3ASM A;  2FSK A;  2BE2 A;  3HRG A;  1JL1 A;  3V9Z A;  2W40 A;  4J8F A;  4ILH A;  1Y97 A;  3OYN A;  4DQI A;  3IFR A;  4DR2 K;  3AO3 A;  1JXB A;  4CZJ A;  4IEE A;  4FWS A;  4IOX A;  5AJ3 K;  3E9P A;  3J80 O;  1YHQ N;  1KD1 O;  1QQN A;  3J8A A;  4MO5 A;  3ZSY A;  4CJR A;  3LDL A;  3RSE B;  4BRG A;  3VGL A;  5GIO A;  5F0X A;  4DTR A;  3NHG A;  3TAG A;  2Z1I A;  2G8V A;  3P83 D;  3O3F A;  4RWT A;  3S3O A;  3BZK A;  2JWK A;  4FJJ A;  4WFA L;  1U2V A;  4B3S K;  1CLQ A;  1FXX A;  3FE1 A;  1YIJ N;  4DTN A;  5BN9 A;  1LWC A;  1RT3 A;  1WBD A;  3VOV A;  3VPZ A;  3SK3 A;  1E4G T;  1JXE A;  4UQG A;  1KFS A;  2KZZ A;  5M1O A;  3NVM A;  5AFU A;  3F73 A;  4C1N I;  3HP6 A;  5I3U A;  2WBN A;  4F2S A;  3LDO A;  4M3W A;  1ITG A;  5CZ2 A;  4CHY A;  3SAG A;  3R1X A;  1JL2 A;  3CI5 A;  3O4Q A;  3TSP A;  1IO2 A;  3HTV A;  3OYF A;  3NE6 A;  4CJW A;  3N4P A;  3AO5 A;  4E7K A;  5HLF A;  1FW6 A;  2D0O A;  1YAG A;  3LDS A;  1NKE A;  3DOL A;  2W42 A;  3DI6 A;  3SAF A;  4M7Y A;  4B1V A;  1RT1 A;  1Z05 A;  3KKR A;  2XO7 A;  2F96 A;  1EWQ A;  1NGF A;  4CJK A;  1ASU A;  1NGC A;  3TAP A;  2GTD A;  2O8D B;  4BRD A;  2HHW A;  4CED A;  3AVA A;  3AVK A;  2Q36 A;  4H5N A;  1NWK A;  5HRR A;  4A57 A;  4E7I A;  3DJC A;  3P5J A;  4CJS A;  2HST A;  4XH1 A;  4BR9 A;  2OZM A;  1L3U A;  4JK9 A;  1VQ9 N;  4W5R A;  2A6A A;  4HHT A;  2O8F B;  4NLB A;  3C6T A;  4FJ9 A;  2CH5 A;  2HBK A;  1X9W A;  2VCP A;  1KCF A;  4FW1 A;  4LF6 K;  2O8E A;  4J2B A;  3LWL A;  4DSI A;  3L6Q A;  3WNG A;  4CJL A;  1VQO N;  1NKC A;  3ENO A;  3ZEU A;  2X6N A;  3F9M A;  1XMO K;  1N34 K;  3ZSR A;  3QIN A;  1KFD A;  4E7H A;  3M5R A;  2BGG A;  4BG9 A;  1O1W A;  1NK0 A;  4FLY A;  3AAR A;  1JCE A;  2EX3 A;  3LZJ A;  1NK7 A;  2QWL A;  2YKN A;  4FK2 A;  1K8K A;  2D0A A;  3NH2 A;  3MXI A;  4KHY A;  1NK5 A;  4DCH A;  3T19 A;  1Q81 O;  4WQ5 A;  5JMV A;  4LY7 A;  5BPN A;  1J6Z A;  5KPT A;  3O08 A;  4DR4 K;  3GDQ A;  5CYM A;  4FL9 A;  1U6Z A;  1YIT N;  5BR8 K;  3V9X A;  3K9J A;  4JI2 K;  3VQP A;  3AO1 A;  4Q5V A;  4L3Q A;  4CEQ A;  2Q2R A;  2ZQB A;  3RMA A;  1G99 A;  1RDA A;  3OYJ A;  1IBM K;  2G8I A;  3D7E O;  1DEJ A;  4YOX A;  2V7Y A;  4DFM A;  2G8U A;  2UUA K;  4B9V A;  1CZ9 A;  4V19 S;  4CF0 A;  1NK8 A;  2HNY A;  1HKB A;  3OS2 A;  3HT3 A;  3DXM B;  1QQO A;  5LJV A;  3MCA B;  1OVY A;  3PUF A;  1V4S A;  1NK9 A;  3VN5 A;  5C2F A;  5C12 A;  4YOY A;  4FWK A;  1WOQ A;  4CJ3 A;  2O8C A;  2E88 A;  3VQD A;  2QTD A;  4KHS A;  4H0V B;  3CCE N;  4JEP A;  2FF3 B;  5AQJ A;  5FPN A;  5KTQ A;  3NAE A;  3CCJ N;  3G71 N;  5B8H A;  1HJO A;  2ZJQ L;  5E84 A;  4Z4H A;  2P9P B;  4OVL A;  4FPB A;  3O1W A;  1BIZ A;  2F9W A;  4BQL A;  4BDP A;  1MDU B;  1JLG A;  4Y0W A;  4CF8 A;  5AQM A;  4C8K A;  4CHO A;  4AQY K;  1S1W A;  1Z26 A;  2A42 A;  2QKB A;  4DQ8 A;  4FVU A;  2HHT A;  2ZGY A;  3LDP A;  1XUP O;  3SLC A;  3MED A;  3O3G A;  5BPL A;  4FJK A;  1HNW K;  3M3Z A;  4NCA A;  1HNV A;  1CXU A;  1SUQ A;  3IS9 A;  5JVH L;  3V4I A;  3SAH A;  2ITM A;  3CJ9 A;  4KTZ A;  2WON A;  1UAX A;  3MAQ A;  3OYI A;  4B9L A;  2G8K A;  4JI5 K;  1TKZ A;  1YVU A;  3G6E N;  3CG7 A;  4A2A A;  1J5O A;  4TSX A;  4FWL A;  3KK7 A;  4HUF A;  5KRS A;  4YDU A;  4C23 A;  3D0P A;  4C8L A;  4DQP A;  1HQE A;  3U6F A;  2QM1 A;  3KK1 A;  2QWO A;  2NRR A;  1ASV A;  4JYA K;  4CZI A;  5F1X A;  1WN7 A;  3NCI A;  2FBX A;  4O0J A;  2YKM A;  3S9H A;  4YFU A;  4FLX A;  3ZYY X;  1HUX A;  2Q31 A;  3UB5 A;  2ZD1 A;  5C24 A;  5AQX A;  4KPY A;  4H8K A;  3A5N C;  2QWQ A;  4BDZ A;  2BAN A;  1ZBF A;  4GKJ K;  3LAL A;  1BA0 A;  2OTL N;  1RT7 A;  1D9D A;  2D1K A;  2X78 A;  3IG1 A;  3B8A X;  3J7A P;  3Q7B A;  1DKG D;  3QNO A;  4CIE A;  2Z1J A;  3VQB A;  3S3N A;  3J7Z O;  1RDU A;  1VK0 A;  4B9T A;  3LP2 A;  3A5L C;  1T6C A;  3L4Q A;  3O8M A;  4ID1 A;  1B9D A;  1VRT A;  3BGR A;  5CR4 A;  3MXM A;  4FZY A;  4DSJ A;  4DQR A;  2E4L A;  3T1A A;  3SQ2 A;  2F8S A;  3WQT A;  4HCC A;  2GX9 A;  5HP1 A;  3D2E B;  3EYZ A;  4LSN A;  4B8C A;  2XY6 A;  1EX4 A;  2V52 B;  3QLH A;  5DM7 L;  4CEA A;  2VQE K;  1VSK A;  3TAR A;  4EP5 A;  3TR8 A;  3ZX0 A;  4CZH A;  4DR7 K;  3SJJ A;  3UIQ A;  1EQY A;  1NGE A;  4BRA A;  1S22 A;  4A2B A;  1O13 A;  3I8B A;  3HM9 A;  3MEC A;  4JNE A;  4CZM A;  1U2V B;  2QK9 A;  5FPD A;  5GAG P;  1RT4 A;  2QXF A;  4ELT A;  1XWL A;  4N76 A;  3KK2 A;  1SQK A;  1HLU A;  2E2Q A;  4LD0 A;  1U4B A;  4FVM A;  1GOC A;  4PQU A;  3KWI A;  4EHT A;  2WTU A;  3FLC O;  4F8R A;  2DY4 A;  3EN9 A;  4JI1 K;  1TKT A;  3VGK A;  4E7J A;  3RVC A;  3GOI A;  3JAM O;  4CVN E;  3OYK A;  4CIG A;  4BVP A;  1OH6 A;  4K43 A;  3IUC A;  2QXL A;  1ASW A;  3ZSO A;  3ZT4 A;  3IKM A;  2UYT A;  3CM5 A;  3VQ4 A;  4FJ8 A;  4OX9 K;  5CY4 A;  4CFC A;  1V4T A;  2O4G A;  3SCX A;  2WFB A;  4IFY A;  1RBS A;  3O3H A;  4Y1C A;  1M1K O;  4IXC A;  4CGG A;  4F3T A;  3KIO A;  5BPM A;  4R79 A;  2I7P A;  1Z25 A;  1J9A A;  4B9U A;  3OJS A;  4GV6 A;  3L2R A;  3C6A A;  4A61 A;  4H4M A;  2A40 A;  4B8A B;  5AQU A;  4LF4 K;  2CH6 A;  4LFB K;  3VQQ A;  3THY A;  4NCB A;  4DWI A;  4JKD A;  4W5T A;  1EKE A;  4CF2 A;  4CHP A;  3H1Q A;  2Q97 A;  4FWR A;  2JGU A;  3HSC A;  3PX4 A;  4E0D A;  1ZXO A;  3UKR A;  5AQO A;  4FWM A;  4DU3 A;  2Y1I A;  3ZEU B;  1BU6 O;  4CCH A;  4JI6 K;  3SPZ A;  4C8O A;  3VER A;  3QIC A;  3L2W A;  4OPJ A;  1QSL A;  3MEG A;  1QS4 A;  4M7X A;  2GWJ A;  3VEW A;  4DV1 K;  4WE1 A;  1QSY A;  1LW2 A;  4CGF A;  1TYQ A;  4JS4 A;  2UUC K;  1XQS C;  3VMF B;  4CJV A;  4DKW A;  4M3T A;  4H5T A;  4M3Z A;  4M3R A;  4DR5 K;  3ULE B;  1ESV A;  2Z1G A;  4DSL A;  2GWK A;  1I39 A;  3HM8 A;  2P5O A;  2W6L A;  4BR4 A;  2E1Z A;  3AGR A;  4IDH A;  1B92 A;  5J2N A;  1ZBH A;  3D2F A;  2OA8 A;  4JKA A;  3CME N;  4DFP A;  3THX B;  3CCQ N;  2OAN A;  1C6V A;  1HNI A;  4HUG A;  4CJ5 A;  4DG1 A;  1XHZ A;  4JHD B;  1T8E A;  1WB9 A;  4K8Z A;  3WXL A;  4QS8 A;  1IH7 A;  5BN8 A;  2HBJ A;  4OGE A;  2ASP A;  3LDN A;  4I6M A;  2NRW A;  4BWM A;  5C15 A;  1GLA G;  4B1X B;  3UE5 A;  1S6P A;  2HOE A;  1HRH A;  1YTA A;  3CJ1 A;  2V51 B;  2DFH A;  3UKU B;  4JKC A;  4FWO A;  4YOU A;  1IKY A;  3VTI A;  4BRP A;  3U9D A;  4KH4 A;  1UA1 A;  4BAC A;  4HTL A;  1NK6 A;  1N33 K;  5JLF A;  3ISN C;  3KLI A;  4Z94 A;  3SQ4 A;  4KB0 A;  1QE1 A;  2PAV A;  1NMD A;  4B3R K;  2IVN A;  3OHR A;  3JSM A;  1QSS A;  1KLM A;  4CFB A;  4CZL A;  2BUP A;  4DV0 K;  3P39 A;  2E2N A;  4CJF A;  4N47 A;  4CJP A;  5HL7 L;  1RDW X;  1RTH A;  3EE9 A;  3G0Z A;  3JXU A;  3AO4 A;  3K58 A;  4YHH K;  3DLB A;  1S9E A;  1UOC A;  4C8N A;  4DSE A;  3L4I A;  3K2P A;  5J2M A;  3FGU A;  5AZI B;  4CE9 A;  4QAG A;  2F8T A;  4CZG A;  4DFK A;  3PLA A;  3P4I A;  4PKH A;  3VEY A;  1TL1 A;  3CJC A;  4BWJ A;  2WOM A;  3L0Q A;  4H03 B;  3E66 A;  1KVA A;  1RT5 A;  3MMV A;  2A5X A;  3CCU N;  2P9L B;  3QIP A;  4DTX A;  1JLA A;  2PY5 A;  2YHA A;  1ZBS A;  4CF9 A;  3ZET A;  5AQQ A;  3L2V A;  3KLF A;  2NRX A;  3HZ6 A;  3LL3 A;  5M1F A;  4B3T K;  2ASO A;  5HRS A;  3H08 A;  5AQW A;  3I8D A;  1A5W A;  4CD1 A;  3SYZ A;  4B1U B;  1KXP A;  1NKB A;  3WEE A;  2OPP A;  4BG8 A;  2HHQ A;  1N5Y A;  2NRH A;  3OVN A;  4YOR A;  4BRQ A;  4I7F A;  1RT2 A;  1NJZ A;  2Q0R A;  3RWU A;  3CER A;  4BR0 A;  2PYJ A;  2NLX A;  2P9I A;  3ZSW A;  3CCR N;  2GUI A;  4KHN A;  1GOB A;  3WXJ A;  1OVQ A;  1L3T A;  2HHS A;  4AHT A;  3OYG A;  3PIP L;  1VQP N;  4PKI A;  5FRN A;  4BRN A;  2Q3S A;  3A8Y A;  4ISG A;  1NNE A;  3FZF A;  2CGL A;  2VWB A;  3O9R A;  4DFJ A;  2BTF A;  4GW6 A;  1SKW A;  5AQK A;  5JS2 A;  1HNX K;  3K59 A;  4IJA A;  4YOT A;  4IOA L;  4FJX A;  5AQV A;  4DLG A;  1E3M A;  5LMU K;  3EL2 A;  3I55 N;  4B1Y B;  1N6Q A;  2YNG A;  3M1F A;  4Y1D A;  4X66 K;  1SZ2 A;  4LC9 B;  2I7N A;  1C0F A;  4JKF A;  3OYD A;  4MO4 A;  1WSF A;  4CJQ A;  3ZSQ A;  5CYQ A;  1LV5 A;  4Z4E A;  3I33 A;  4BR5 A;  5AZJ A;  3G4S N;  1VQM N;  4F3O A;  5JLH A;  3MN7 A;  4MFB A;  4KFB A;  4M3X A;  1FKO A;  3MK6 A;  2GEL A;  4I2Q A;  3L2Q A;  2E6M A;  3ZSZ A;  3CFR A;  5J2Q A;  3HK2 A;  3SNN A;  4DS5 A;  3R3L A;  3T1H K;  1HYZ A;  2YHY A;  4O5B A;  3SMS A;  4AHV A;  3KLE A;  2UU9 K;  3CCV N;  4IDK A;  4QCL A;  4BGA A;  3RRG A;  4M42 A;  1BI4 A;  2VGN A;  3NF9 A;  3QB0 A;  4FM2 A;  3AVC A;  4NXN K;  4DUY K;  3CCL N;  3AVL A;  1A5V A;  3BP8 A;  3VEZ A;  4U7B A;  3H46 O;  4KO0 A;  5I42 A;  3BDP A;  4EAH D;  2ZM6 K;  3FFK B;  3K5L A;  3QO9 A;  2E8A A;  1LWF A;  3R9P A;  3HVR A;  4ELU A;  1VQL N;  1QHT A;  2CGK A;  1N32 K;  2X6S A;  4AHR A;  4W5Q A;  4FZX C;  4E3S A;  4CW7 B;  3OS0 A;  1P8Z A;  3NF7 A;  4KV8 A;  3K5N A;  1VSI A;  4KB1 A;  4DSK A;  2W41 A;  1ZBU A;  4JKG A;  3E01 A;  4JAX A;  3K9K A;  2HVH A;  3DRS A;  4JI8 K;  1YXQ A;  4RTF D;  2HW3 A;  3PX0 A;  4BRO A;  3S41 A;  4AH9 A;  2OPQ A;  4BRM A;  3THY B;  3ZT3 A;  2F9T A;  1NGA A;  1VQ8 N;  1C1A A;  2O8B A;  3QBX A;  5EU7 A;  3HI0 A;  3O80 A;  1YJN N;  1YVN A;  1WSI A;  5GAE P;  3VQ7 A;  3CYM A;  3UKR B;  3MN9 A;  2B6A A;  4GY2 B;  3DXK A;  4ELV A;  3T1Y K;  3I0S A;  1SV5 A;  1SL1 A;  1W2B M;  4HVJ A;  2RKI A;  5KQD A;  3NF6 A;  1HX1 A;  1LW0 A;  1TYQ B;  2P9U A;  5AQP A;  1W9H A;  3K0S A;  4WQ4 C;  5KPR A;  1WBB A;  1WAF A;  4GVM A;  4B1W B;  3TAE A;  1X9M A;  3DAW A;  4LFA K;  2JLE A;  1WSH A;  1YT3 A;  1KAY A;  1YI2 N;  2P9S B;  4EHU A;  4IJN A;  3U4L A;  4N41 A;  2NZT A;  2YV0 X;  4I9Q A;  3EEQ A;  2D0P A;  4FSV A;  3NMU A;  3R6M A;  3D2F B;  4ICL A;  4I2P A;  1HKG A;  5AQF A;  4BDY A;  3VQE A;  5EXW A;  1T03 A;  4BQZ A;  3G25 A;  4CHZ A;  4PKG A;  3C6H A;  1VQ7 N;  1NM1 A;  3VEO A;  1NU0 A;  2OTJ N;  2QWN A;  1JLB A;  3LPT A;  4DV4 K;  4EP4 A;  4JKE A;  3ITH A;  1TK0 A;  5HRP A;  3CQX A;  4MQ3 A;  3SUN A;  4JLH A;  2ZJP L;  3ENB A;  4PY5 A;  4XIU A;  3IDH A;  4BRC A;  4JS5 A;  3THW B;  3DLL L;  4FLZ A;  2P9N A;  3DRR A;  3QFU A;  3V9S A;  3DMJ A;  4IBN A;  4M63 C;  4DTM A;  4IOC L;  2YNI A;  3A5M C;  2KTQ A;  3A5O C;  3OYH A;  4MDA A;  4L8R B;  2BDP A;  1R0A A;  4EIA A;  4CBX A;  3ENH A;  3LAN A;  4CJU A;  1FJG K;  4CK2 A;  4DTP A;  2G8W A;  4M45 A;  4W5N A;  1D9F A;  3WNF A;  1S6Q A;  4KTW A;  3DRP A;  4E1N A;  4WFB L;  4M41 A;  2XHB A;  4QOZ B;  4CJE A;  5C2D A;  3EO3 A;  1ATR A;  4DLE A;  1XI1 A;  3AA5 X;  4NB4 A;  3WNH A;  1NG9 A;  2RPI A;  4CK1 A;  1X1P A;  1KC8 O;  2IS3 A;  4QS9 A;  4PA1 A;  3RMD A;  3LZI A;  4DQQ A;  3ATV A;  3KLG A;  4IFE A;  3V9U A;  3DOK A;  4E19 A;  3HP9 A;  3DYA A;  4DF4 A;  3P31 A;  1OH5 A;  3NVK A;  5D3G A;  2VG5 A;  5FRM A;  1S3X A;  4DU1 A;  3U8X A;  1QVF M;  1HPZ A;  3AAP A;  1ILY A;  3KK3 A;  4BRI A;  3L3U A;  5GIP A;  4H5V A;  3AA2 A;  3VEV A;  5SWM A;  3QIO A;  2B4J A;  4CD3 A;  4ID5 A;  3M8S A;  3AAQ A;  4FM1 A;  4NXM K;  2RHK A;  4KBO A;  4OKK A;  3O1B A;  3PO5 A;  4KRF A;  2YHB A;  4Q0B A;  1NGD A;  1T05 A;  2HVI A;  3LP1 A;  1X9J A;  2E5L K;  3V9W A;  3ZCM A;  4FLV A;  4RCH A;  4H0P A;  3KHY A;  2NRZ A;  3KD5 E;  4CFD A;  3T69 A;  5KRT A;  2VWJ A;  4KAZ A;  4LF7 K;  4PWD A;  1J53 A;  4DV5 K;  3PSF A;  1RCH A;  3CQ8 A;  3CC4 N;  4BRK A;  2AP1 A;  1JLF A;  1RIL A;  2VG7 A;  3ZSV A;  1MA9 B;  3T7Z A;  5E26 A;  2XY7 A;  2YJE A;  4DU4 A;  3VTH A;  1K6Y A;  2KFN A;  2WC9 A;  3VQ8 A;  3IMX A;  3HYF A;  2NRV A;  2GEM A;  1TL3 A;  3OA9 A;  3O9S A;  4RW7 A;  3I0R A;  3OYB A;  4FOI A;  4XH5 A;  1BHL A;  2O8D A;  1YF5 L;  1GLF O;  1S1U A;  4H0X B;  5FDL A;  1W7A A;  1BGX T;  3OJU A;  2HNZ A;  1VSE A;  3CJ7 A;  3PV8 A;  3GL1 A;  1X3M A;  5I9E B;  4DHY A;  1ATS A;  2E6L A;  4U67 L;  2UXC K;  4AHU A;  2A1R A;  2O8F A;  4BC3 A;  2R7Y A;  1KRP A;  3CJB A;  1DTQ A;  5ELZ A;  3L3V A;  5J1E A;  2UXB K;  1IBK K;  1GLL O;  1K73 O;  1RTD A;  3V6D A;  4CK3 A;  1R59 O;  2EWS A;  2FF6 A;  3AVB A;  3MEE A;  3O9T A;  1UA0 A;  1DTT A;  2YNF A;  2IGI A;  5AZJ B;  3OYA A;  5TKY A;  4DR1 K;  3VEN A;  1BCO A;  4O5F A;  4B9M A;  4UY8 O;  4N5S A;  3VQ6 A;  4MDB A;  1L3V A;  1GLJ O;  2G8H A;  2AJQ A;  3AA3 A;  3NFA A;  4JN4 A;  3RRH A;  2HMI A;  4AM7 A;  4Z4I A;  2O8E B;  5LJW A;  5M1P A;  1BIU A;  5KPZ A;  4BR7 A;  4OGC A;  1IKV A;  3RMC A;  1IKW A;  1L3S A;  3QDK A;  3CC2 N;  4KKO A;  3VEX A;  1SKS A;  3LAK A;  3TAM A;  3HPH A;  4DQS A;  4W5O A;  1TVR A;  4KRE A;  4B3M K;  5KQ8 A;  3DXM A;  1CXQ A;  3E1Y A;  3CQY A;  3P38 A;  1K8K B;  4IZ9 A;  4CJ7 A;  4WQ4 A;  3AVG A;  1RTJ A;  2YHW A;  4DF8 A;  5HOO A;  2PBD A;  1Q8I A;  4JKG B;  2IC3 A;  2ITG A;  4AF1 A;  3OY9 A;  3QML A;  5AQI A;  1HR0 K;  2HHU A;  3ULD A;  2FBV A;  4AM6 A;  1I94 K;  2P9P A;  3AVN A;  1BO5 O;  1VSH A;  3JS6 A;  3ZT2 A;  1VSM A;  1MWK A;  1IG8 A;  3DWL A;  4O8K A;  2KKZ A;  1RBT A;  2DFF A;  2E2O A;  2QWM A;  3KZB A;  3G10 A;  3NBP A;  3HPO A;  1U47 A;  3OYM A;  1C0T A;  3QEV A;  1DGK N;  2QWP A;  3QET A;  3BF1 A;  2O8C B;  3EKS A;  4K0K K;  3ID8 A;  1TUY A;  2P5G A;  4A62 A;  3SBT A;  1TK5 A;  1MWM A;  3K5M A;  3WNE A;  1B9F A;  2HHX A;  1F21 A;  1NGH A;  1Q86 O;  4WF9 L;  5GIN A;  2KFZ A;  4O55 A;  4BR2 A;  4DTU A;  1VAZ A;  1U49 A;  4M3U A;  3CM6 A;  3CET A;  4BRH A;  4KHU A;  5BR9 A;  3V81 A;  1YJ9 N;  3CPW M;  4OPH A;  1DT9 A;  1NBW A;  5C42 A;  4BE2 A;  3AVM A;  1HQU A;  4OPA A;  1NGG A;  4F9O A;  1TV6 A;  4IO9 L;  4PL7 A;  3ATU A;  4IG0 A;  4NYN A;  2D5R A;  3QER A;  2YCH A;  4YNQ A;  3H3N O;  4A59 A;  1QVG M;  3VGM A;  4O8U A;  1XHX A;  1KTQ A;  4BC5 A;  4FXD A;  1IV0 A;  2Y1J A;  3SV4 A;  4QS7 A;  3QEW A;  1YTU A;  1UWB A;  2CGJ A;  3PIO L;  2OCE A;  3E9O A;  4JK7 A;  3NDK A;  4CZK A;  1XMQ K;  4GKK K;  4ZHR A;  4C1N K;  4RW8 A;  5BRD A;  3SZ2 A;  4FCY A;  4K25 A;  1LOT B;  4YY3 K;  3QEX A;  5CZ1 A;  2GV9 A;  3S3M A;  3LPU A;  3AVF A;  4A5A A;  4GVE A;  4EZ9 A;  4LF8 K;  1QZ5 A;  3HOT A;  3HVT A;  1JLQ A;  5BRF A;  2ZGZ A;  2Q0U A;  3NGZ A;  3THV A;  2X74 A;  3OW2 M;  1HYS A;  1BG3 A;  5AQR A;  3O9U A;  5AQG A;  3EZW A;  2FSJ A;  5BRE A;  1J54 A;  2JWL A;  3FZH A;  4RG8 A;  4OPK A;  3C95 A;  4CHQ A;  4EZ6 A;  3D2E A;  1EET A;  1RDC A;  4CIF A;  4IEI A;  3O5B A;  3WT0 A;  4N56 A;  3EZ5 A;  4CEF A;  5CHI A;  3TWH A;  4FJ5 A;  4BC4 A;  4ILJ A;  2ZE2 A;  3HL8 A;  4FZZ A;  4FYD A;  5AR0 A;  3KKS A;  2FC0 A;  5IWA K;  4FK4 A;  4BRL A;  1VQN N;  4B3O A;  4FLU A;  1L5U A;  4BGB A;  1IJJ A;  4KH6 A;  3WXI A;  3KLH A;  2P51 A;  1HKC A;  2RF2 A;  5M1N A;  3MCP A;  4ILG B;  1EXQ A;  2HF4 A;  3TPQ A;  2EHG A;  4FJ7 A;  3VA0 A;  3PO4 A;  2O4I A;  2I5J A;  2IDO A;  5AQL A;  4F2R A;  3W3D A;  2H3G X;  2YJF A;  1VQ4 N;  3AVH A;  1S1T A;  1JCG A;  2IIR A;  4BVO A;  3D6R A;  3NH0 A;  3TTD A;  3HXM A;  4CZE A;  4DTJ A;  4NO7 A;  2IAJ A;  5C10 A;  4X65 K;  4ZTF A;  1NJX A;  1BDG A;  5F2R A;  4RW6 A;  3W0L A;  1TKX A;  4JV5 K;  3KD1 E;  4B08 A;  4DV2 K;  4H0T B;  3OYC A;  4NCG A;  4OLB A;  4KHW A;  5AQH A;  3CD6 N;  4FJN A;  3SMP A;  1X9S A;  1TGO A;  1WSJ A;  3LAM A;  1JJ2 M;  2BH1 A;  5GAH P;  1A5X A;  5HBM A;  4B9Q A;  3M8P A;  1NGJ A;  2P9K A;  4FO0 A;  4CGJ A;  1VRU A;  3OS1 A;  3V1Q A;  2E1Y A;  2HBM A;  4H5W A;  5LY3 A;  3FZM A;  4FWN A;  1VQ6 N;  3KWG A;  3V1R A;  1Z6R A;  1QQC A;  4ZTJ A;  3CFO A;  3M8Q A;  1U48 A;  1CZB A;  4GV9 A;  1VSF A;  3C94 A;  3EE8 A;  3VQ9 A;  3MWP A;  4CBU A;  1IG9 A;  4BY9 C;  3AV9 A;  4DV3 K;  4DR3 K;  3NH1 A;  3TI0 A;  3AA4 A;  3B6O A;  3L2U A;  2ETJ A;  5AQN A;  1BQM A;  1TAU A;  3PY8 A;  3O9Q A;  4FLW A;  4WCE L;  1M90 O;  4DB3 A;  4O4G A;  4CF1 A;  1U45 A;  3DLH A;  4FJG A;  2KZM A;  3O6W A;  3OYL A;  3O4N A;  3WXK A;  4CGD A;  1QQM A;  3M6G A;  5ADX H;  3WXM B;  3MDQ A;  4GMJ B;  3HJF A;  3SQ0 A;  4LH4 A;  1H1V A;  3ULE A;  1GLB G;  5EY4 A;  3FFI A;  1WLJ A;  1DLO A;  4ISE A;  3IRX A;  2KHO A;  5A2Q O;  3TAB A;  2J4R A;  5M1Q A;  1VSD A;  3VA3 A;  1NLV A;  3GG4 A;  1FKP A;  4O0I A;  3THX A;  3EY1 A;  3U3Y A;  3DLK A;  2KLA A;  4JRQ A;  4BRE A;  1XC9 A;  5LL6 Z;  1S5J A;  4JHD A;  4CI6 A;  4B1Z A;  3M8R A;  3ZX2 A;  1RDB A;  3CCM N;  4DS4 A;  4H4O A;  3T3F A;  1EO1 A;  1QZ6 A;  5H1S Q;  1TAQ A;  1RBR A;  3KJV A;  1VSL A;  1IBL K;  4H0Y B;  4CEB A;  1SL0 A;  1KVC A;  5LMN K;  1ZC6 A;  3ID6 A;  3UKU A;  2D0B A;  3QNN A;  4DV7 K;  4OKE A;  3CXC M;  3VET A;  1GLC G;  1SS6 A;  4FK0 A;  4K8X A;  4JKB A;  3AVI A;  1HPM A;  4EFH A;  3LDQ A;  3VQC A;  1BIS A;  1JCF A;  1WNS A;  4K42 A;  3QEI A;  3ALY A;  5SZT A;  4KHQ A;  2GBZ A;  2VGM A;  3L8B A;  5MLC Q;  1I3A A;  2QI2 A;  1TK8 A;  2AA4 A;  3LP3 A;  5J2P A;  3HO1 A;  4E7L A;  4XH4 A;  4AHC A;  2HMP A;  1E4F T;  1VQK N;  1HNZ K;  4I6M B;  3NGY A;  1S1X A;  1RBU A;  2W6K A;  4O44 A;  2XRI A;  3QBW A;  2RE2 A;  3WQU A;  2ZF5 O;  2A1S A;  3BF3 A;  3C7N A;  1TKD A;  4E1M A;  3FZK A;  4JD2 A;  5FRO A;  1OH8 A;  2PFU A;  4NYF A;  3VF4 A;  1IKX A;  5AZI A;  3ZT1 A;  2FBY A;  3U9Z A;  3SJH A;  4OO1 J;  2OYQ A;  2XY8 A;  1SAZ A;  3E9L A;  1KVB A;  3A2F A;  3HPG A;  2QEX N;  2NUB A;  1Q82 O;  3VF2 A;  2E2P A;  4CEE A;  2P9L A;  3C65 A;  2OPS A;  1RT6 A;  3TAQ A;  4GV3 A;  1NJY A;  4WFN L;  3KVG A;  1C0G A;  3DLE A;  4JK8 A;  4CBW A;  4MLE A;  3SUQ A;  4BE1 A;  1G15 A;  2QKK A;  1VQ5 N;  2HBL A;  3DLG A;  3VQA A;  1S1V A;  3JYT A;  1S9G A;  3BY5 A;  3CJA A;  4DTO A;  4X64 K;  2DPN A;  1LCU A;  1JLE A;  5JVG L;  1BL3 A;  3PSI A;  3RSE A;  3ZLJ A;  1CZA N;  2IVP A;  4A5B A;  2NRT A;  4HTU A;  1Q9X A;  2F4V K;  1SL2 A;  4FJH A;  4FJI A;  1WUA A;  3LP0 A;  3ZET B;  4YOW A;  1C0U A;  3H6E A;  3SV3 A;  1BUP A;  4RW4 A;  3MX2 A;  4B9S A;  5DMR A;  5KI6 A;  1JLC A;  5E41 A;  4Z4F A;  4DV6 K;  3WEE B;  3VES A;  2A41 A;  1D4X A;  4CJT A;  3OBY A;  2IVO A;  4JKH A;  4H0O A;  1JKH A;  4LFC K;  1X3N A;  2Z1H A;  3O4W A;  1K9M O;  2QW9 A;  3CHW A;  1W0H A;  3RTV A;  2UUB K;  2YI1 A;  5AFU H;  4BC2 A;  5EOY A;  4FJL A;  2P9I B;  4LH5 A;  4CEC A;  3EKU A;  3H1V X;  1HJR A;  1XC3 A;  5AQY A;  3WUH A;  2KW4 A;  2IOC A;  3CCS N;  3TSQ A;  1S72 N;  1D8Y A;  2A3Z A;  3NF8 A;  4KTQ A;  1EP4 A;  3AO2 A;  3DM2 A;  2GUP A;  1J5E K;  4J2A A;  1OH7 A;  2FBT A;  3H45 C;  2FXU A;  3LM2 A;  4JI3 K;  4IO8 A;  4CER A;  2FLO A;  4LF9 K;  2HHV A;  4JI0 K;  4HUE A;  1ZBL A;  4HWI A;  4PUO A;  4DTS A;  5IT9 O;  5FPE A;  5HRN A;  3TAF A;  3SUP A;  2YX6 A;  4MLH A;  4AHS A;  3SPY A;  2FSN A;  1T3V A;  3MX5 A;  4DMN A;  4ISF A;  4BRF A;  2D0C A;  3D45 A;  3GE1 A;  4G9Z A;  3RR7 A;  4I9L A;  3SI6 A;  4FLT A;  1Q18 A;  3SUO A;  2DFE A;  3MN5 A;  1N36 K;  1XNR K;  1KAX A;  3AGK A;  1RTI A;  4NLC A;  3I56 N;  4DSF A;  4FJM A;  3RMB A;  4GNI A;  3N4Q A;  4CEO A;  4G1Q A;  1LAW A;  4LSL A;  4FWP A;  1OKJ A;  2P1J A;  5FPM A;  3R8E A;  3TAN A;  4J2D A;  5M1K A;  5KGX A;  1VHX A;  3DLR A;  5C25 A;  3H3O B;  4M3Y A;  3AVJ A;  1HMV A;  4Z0U A;  1ZYQ A;  2UXD K;  2V7Z A;  3F9K A;  3A0I X;  1C1C A;  3LM9 A;  3OBW A;  1TUU A;  3V1O A;  1GOA A;  2PZS A;  5T7B A;  1BWF O;  3HBT A;  1BCM A;  3BUZ B;  3LWM A;  2P9K B;  3ZX3 A;  1BI4 B;  1RGI A;  3TSU A;  2YHX A;  1RBV A;  4FWQ A;  3TTC A;  3OTO K;  2XY5 A;  1T6D A;  1NJI O;  5CE3 A;  3TU5 A;  1K8A O;  4Z4G A;  4KHP K;  4OKJ A;  3J81 O;  1ZBI A;  4CZF A;  4CGI A;  5DM6 L;  4AIL C;  1KLN A;  3K5O A;  4PL8 A;  3F2K A;  4FW2 A;  3SBG A;  1NK4 A;  3F5T A;  2ZJR L;  2RN2 A;  4IFV A;  4E1J A;  5ADX A;  5K14 A;  4KI6 A;  1YUW A;  1BA1 A;  3B6P A;  2OPR A;  2F7T A;  1RDD A;  4WYB A;  1NOZ A;  3TTF A;  3HOS A;  3BEX A;  4IG3 A;  1BQN A;  4LF5 K;  5AQS A; 
#chains in the Genus database with same CATH homology
 4DV3 K;  4DV0 K;  4DR3 K;  2UXB K;  1IBK K;  4LF4 K;  4LFB K;  1HNX K;  5LMU K;  1J5E K;  4K0K K;  4YHH K;  4DUZ K;  1XNQ K;  4X66 K;  4AQY K;  2VQF K;  4JI3 K;  4DR6 K;  5IWA K;  3T1Y K;  4LF9 K;  4DR1 K;  4JI0 K;  4JI6 K;  4LF6 K;  5IT9 O;  5FLX O;  1HNW K;  4DV1 K;  4DR2 K;  5A2Q O;  4LFA K;  2UUC K;  2VQE K;  1XMO K;  4NXM K;  2HHH K;  4DR7 K;  1N34 K;  5AJ3 K;  3J80 O;  5LL6 Z;  4DR5 K;  1N36 K;  4JI5 K;  2E5L K;  1XNR K;  4X64 K;  3T1H K;  4LF7 K;  2UU9 K;  4B3S K;  4X65 K;  4DV5 K;  4B3T K;  4DV4 K;  1IBL K;  4X62 K;  4NXN K;  5LMN K;  4DUY K;  4DR4 K;  2UXD K;  4JV5 K;  2F4V K;  4B3M K;  4JYA K;  4DV7 K;  5BR8 K;  4DV2 K;  1XMQ K;  4JI2 K;  4GKK K;  2ZM6 K;  4JI1 K;  4JI4 K;  1IBM K;  4YY3 K;  2UUA K;  4LF8 K;  3JAM O;  3OTO K;  4KHP K;  4CVN E;  1N32 K;  4V19 S;  4JI7 K;  3J81 O;  4GKJ K;  4CW7 B;  4DV6 K;  1FJG K;  3J7Y P;  1HR0 K;  4OX9 K;  1I94 K;  1N33 K;  1HNZ K;  3J7A P;  4LFC K;  4JI8 K;  2UXC K;  2UUB K;  4B3R K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...