2UU9K

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uu9K00
2E5LK 4DV0K 5IT9O 4NXNK 1XNRK 4B3MK 4CW7B 2ZM6K 1N32K 4DR1K 3J81O 1J5EK 4DR4K 4JI6K 4DV5K 1HR0K 4LF7K 4GKKK 2UXBK 4DV1K 2UXCK 4X65K 4CVNE 5BR8K 4X62K 4JI1K 1N36K 4DV2K 3T1YK 2UUBK 4DR5K 4DV4K 4DUYK 4JI2K 4LFBK 2VQFK 4DR2K 3J7YP 4DUZK 4LFCK 2UU9K 2UUCK 1HNWK 2UXDK 4B3RK 4GKJK 4JI0K 4LF9K 3T1HK 3J80O 4JI7K 4LFAK 4KHPK 1I94K 4JYAK 1FJGK 3OTOK 4DR7K 4JI5K 4JI8K 5IWAK 2HHHK 4V19S 1IBMK 4K0KK 2VQEK 1N34K 1XMOK 4AQYK 5A2QO 3J7AP 4LF6K 4X66K 5LMUK 4X64K 5LMNK 4JI3K 4JI4K 4B3SK 4LF8K 4DR6K 4DV6K 1XMQK 2UUAK 4OX9K 4YY3K 5AJ3K 3JAMO 1N33K 4YHHK 4JV5K 1IBLK 4DV3K 5LL6Z 4LF5K 1HNZK 4B3TK 4DR3K 1XNQK 4LF4K 4DV7K 2F4VK 5FLXO 1HNXK 1IBKK 4NXMK
chains in the Genus database with same CATH superfamily
3DLLL 1IKYA 2RE2A 3IUCA 4BR9A 3V9XA 1TYQA 3TSPA 4NXNK 1RBRA 1ZXOA 5CYMA 2ZM6K 2P9SA 3V9ZA 3VTIA 3OBYA 4H0OA 3LPUA 3V81A 4DV1K 2UXCK 1X3MA 3J8AA 1NOZA 4JEPA 2QWNA 5AQPA 3UKRB 4E1NA 4FLYA 1VSIA 4Z94A 1S1TA 4BRDA 4BQLA 4O44A 1EWQA 3SQ1A 4B08A 3NBPA 3THWB 4CCHA 2KFNA 1K6YA 1OVQA 1NK4A 4BG9A 4DTRA 1KLNA 2ASMA 3K5MA 4FWQA 3FFKB 3PSFA 2KLAA 2P9UB 4FZYA 1WN7A 2XY7A 4N47A 4CJFA 4O4GA 3A5OC 4QOZB 3OYKA 4OKJA 1NGIA 3T1HK 3CCJN 4GVMA 5JS1A 3CCUN 4DTNA 4E89A 3FR0A 2P9LA 4JKHA 4OGCA 4LH4A 1T7PA 3TAFA 5T7BA 4FLTA 3AAPA 4BG8A 4CJUA 5KPZA 4OKKA 2V7ZA 4CEBA 3FZHA 4CEFA 1TYQB 4X64K 3QEWA 3P38A 1T6DA 1K8KB 5M1QA 4JI4K 1YI2N 4FM0A 2P9SB 4CJRA 4EP5A 1D8YA 4A2AA 3EZWA 3KLHA 3HM9A 3RWUA 4BR2A 3WNEA 4G1QA 3DOKA 1D5AA 1A5VA 1MDUB 1XC9A 3JAMO 3HVTA 1ZBUA 4BQZA 3KD5E 4HWIA 2E6LA 4CK1A 2FBTA 3ENOA 1NGHA 3GDQA 4DWIA 1ITGA 3SZ2A 1JL2A 5J2PA 3BP8A 1DLOA 5DM6L 1P8ZA 3H08A 4DLGA 3M8SA 3CM5A 1QHAA 4CERA 3HVRA 4B3MK 2P9LB 4CJ3A 1ZBSA 1ZC6A 4B9UA 2X78A 4U67L 3RSEB 3AVGA 3BUZB 4H5WA 2HHVA 1YIJN 4CVNE 1HX1A 4CJTA 1L3UA 4LSNA 3C6HA 3LWMA 1BQMA 2QWRA 1L3VA 1K73O 2HOEA 3KKRA 4DTOA 4M3ZA 4M3YA 1VSHA 1WSIA 3QEPA 4CJWA 3SAHA 3E01A 4CHPA 3L2WA 1GLLO 2YHWA 2DPNA 1JCEA 1NJYA 4KPYA 4IXCA 2E20A 2VG6A 1EETA 1HYSA 2UYTA 1L5UA 2Z1GA 1NU0A 5JLFA 4CEZA 1RT4A 2O4GA 3OHRA 1FKPA 3SJHA 3L2QA 4LF6K 2R7YA 4LY7A 4KH4A 3VEWA 4R5PA 2PY5A 4WYBA 3VF2A 3VF6A 3CCMN 1QZ5A 3AVJA 4M45A 4NCAA 4CBXA 4FJ9A 3NGYA 2JWLA 3H46O 2WC9A 1HKCA 1N33K 2QWOA 3SCXA 1KAZA 3DLKA 3DLGA 3TSUA 4NYNA 4U7BA 3ID6A 2CGKA 1S1VA 1KLMA 4H0TB 4JK8A 4FXDA 1UA1A 2W40A 3ATUA 5GAEP 3CD6N 1YAGA 3K59A 1Q8IA 1X9MA 4M3RA 3LM2A 5HRNA 3M8QA 1BDGA 1ASVA 3ZETA 4KHNA 2FSKA 5C15A 1XNRK 4JS5A 1TGOA 1C0GA 1SKWA 3ENHA 3N4QA 1NJWA 2E2OA 3CCRN 3ZT1A 1M1KO 2NUBA 2HBMA 5KGWA 4X62K 4KBOA 3NVKA 5KTQA 3KK2A 2B4JA 4BRNA 1KCFA 3O80A 3RMBA 3VEZA 3I55N 1X9SA 1JL1A 2ZGYA 2FSNA 4RTFD 4H03B 4AH9A 3A0IX 2NRTA 1TKTA 3CCVN 4DR2K 2E2NA 4NB4A 3D0PA 3K5NA 4DTUA 3G4SN 4PHTX 2XHBA 2VWKA 3N4PA 5DK5A 2QWMA 3AVBA 3S41A 2XY8A 1NK5A 1UAXA 3U8XA 3S3MA 3MEEA 5BREA 3OYBA 1RTDA 5CZ2A 3VQ6A 2QKBA 3CPEA 2V51B 1W97L 4FJHA 1B92A 4JI5K 4IG0A 3TTFA 4V19S 4CJQA 4C8MA 3TWHA 4N41A 1OH5A 5A2QO 2HBKA 4ISEA 5AQLA 4CJEA 3V9SA 4FOIA 1TK8A 4JKCA 1D9FA 4X66K 3L0QA 1T6CA 4HCCA 4BRKA 5JMVA 3SI6A 4DV6K 4G9ZA 1SZ2A 4O55A 3EY1A 2IVOA 4KHSA 3V1RA 1VAZA 4RWTA 2ZE2A 3KVGA 3NH1A 1GLDG 4WQ5C 3K2PA 5AJ3K 4BE0A 1V4TA 5BPMA 1DTQA 2A5XA 1IG9A 2WONA 3G71N 1L3SA 3QIOA 3CQXA 2E6MA 3O08A 3MN7A 4O5BA 3IFRA 5AR0A 1HNZK 4B9LA 3TAQA 3VQDA 4OPHA 2VWBA 3JXUA 1VSFA 2ZF5O 3VQBA 5CHIA 4BDPA 3TANA 4DR3K 1NJIO 3NMUA 3H1QA 3I56N 3QNOA 4Z0UA 1P90A 1RBVA 1HJOA 2QKKA 3PY8A 4FWKA 1NBWA 3ENBA 2QWPA 1WBDA 4WE1A 4HCBA 3CMAN 2GUPA 3OYLA 1RBTA 1W7AA 4FK4A 3CCQN 3W3DA 2G8HA 1WSJA 1HNIA 3TTCA 3HZ6A 4Q0BA 2RHKA 1NKBA 5EOYA 3DLEA 3F9MA 1RGIA 3P83D 1NJXA 2O8CB 2XRIA 2HVHA 2Q31A 1RT2A 5TKWA 4BRAA 5J1EA 1A5XA 3O9QA 3TSQA 3V9WA 1ZBIA 1YVNA 4F3OA 3E9PA 4KTZA 4M7YA 3ZX3A 3NGIA 4B8CA 4FVMA 1T44A 3MDQA 2FBXA 4BREA 5FPNA 1S1WA 3G25A 3HPGA 2E2QA 2FC0A 3CIPA 5KPTA 4CESA 1RT7A 3ZX0A 1BI4A 2JLEA 1RTJA 5HRRA 1QE1A 4CEOA 1VQ7N 1VQ4N 4BR7A 5EY4A 3DOLA 1BWFO 1FKOA 3V6DA 3SBGA 3QETA 2YHYA 1QVFM 4EHUA 3DXKB 4E3SA 4DV3K 1KFSA 1WBBA 3FGUA 2O4IA 2Z1IA 1NM1A 2G8FA 1LAVA 4XH5A 5ELZA 4NXMK 3P5JA 5K14A 1JLBA 1QVGM 1RBSA 2AA4A 3AARA 1XQSC 1K9MO 4BRLA 1CXQA 1FXXA 1GLBG 2Y1JA 5SWMA 2OYQA 3WXKA 1BGXT 2H3GX 1TUYA 3AVHA 4BROA 4X65K 4YNQA 5BR8K 1RT5A 2NRRA 1Z6RA 4B9QA 4EHTA 1MA9B 4DS4A 3EL2A 4CIGA 3RMAA 5C12A 5FDLA 1U2VA 3RR7A 3MEDA 3OA9A 3SPZA 4BRIA 3C94A 2ASOA 1MWMA 1TAQA 2PFUA 4B1XB 3ATVA 1NMDA 3DI6A 3H6EA 3HOTA 2X6NA 5CYQA 3T69A 2UU9K 2PYJA 5HRPA 4AM6A 4M3XA 1VQMN 5I9EB 1WSEA 1U4BA 4CGIA 3KLEA 1EP4A 3WXMB 5E84A 4OPKA 4JKDA 1MWKA 2P9IB 3PUFA 3ZX2A 2BDPA 2KFZA 4B9MA 3K0SA 3HRGA 1BOTO 3E9OA 4Y1CA 3G6EN 1T05A 1U47A 2FF6A 1J5OA 3SNNA 5EU7A 3K9KA 3AA3A 3ZEUA 4MQ3A 3U9DA 1XI1A 3EEQA 3SUPA 1RDUA 3H1VX 4JAXA 2W42A 4IDHA 4C8LA 5D3GA 1NK8A 3O6WA 3GOIA 3K57A 1JLGA 3AO3A 3KTQA 3DJCA 3VGMA 3DLBA 5HROA 1TKXA 1NGGA 4IEIA 4JNEA 5EXWA 3VQCA 1ATSA 4M63C 3UE5A 1RT6A 1X1PA 3ZSZA 3FZLA 4CF9A 3PO5A 5LL6Z 3C6TA 3HSTB 4N5SA 3OYAA 4CHNA 1VQNN 2KZZA 4B3OA 4OKEA 2IAJA 3I33A 4RW9A 3OJUA 1BIUA 1GOAA 3IS9A 3PX6A 1VQKN 3HJFA 2KW4A 4FCYA 1G15A 3LP1A 3DWLA 4JD2A 2FBVA 4CD1A 4IDKA 3MX2A 3MWPA 4WCEL 1RDAA 2JGUA 4NCBA 3KK1A 1LWCA 3U4LA 3PV8A 2E88A 4CFDA 5J2QA 3T1AA 1C0FA 4DU1A 3CCEN 3SAGA 1LOTB 1VQ9N 4BDYA 3CHWA 4IG3A 4CHOA 2UUBK 4DR5K 3HSCA 4F3TA 1X3NA 4C1NI 4OGEA 1NG9A 1BQNA 4FLUA 1DTTA 1GLCG 1S1UA 2OPPA 4DSFA 3VESA 2E4LA 4OPJA 2D5RA 3CERA 2Q1NA 3HPHA 4CBUA 4DCHA 1BL3A 2OANA 3CPWM 3TU5A 4CHYA 4CFBA 4XH4A 2ITMA 5C2DA 4QS9A 4AHCA 4CBWA 5AQHA 5AZJA 3ZSXA 4NCGA 4BR5A 4WFBL 3AVFA 3ZSWA 3B6PA 2QXFA 2A40A 1IBMK 2Z1HA 3VENA 2VG7A 2G8IA 4KAZA 1J9AA 4KI4A 4UY8O 4N56A 4JD2B 3EE8A 4DFKA 3NF9A 4O0JA 3LM9A 4BDZA 4RW6A 1KXPA 4A59A 3TR8A 4JKBA 4A2BA 5AQRA 3NHGA 3M5RA 4M42A 1TL1A 4GMJB 4DQ8A 4FJXA 4HVJA 3MXIA 2IVPA 5DMRA 4FW2A 4KH6A 2QK9A 2D1KA 4BC5A 1S6PA 3B6OA 1S3XA 3WNHA 2HHSA 3CG7A 4FJIA 2W6KA 1TVRA 2YKNA 1TUUA 1Y64A 4LF5K 4W5NA 2YX6A 3SPYA 4BRHA 4Y1DA 1XC3A 1B9FA 3O3GA 5M1PA 3VPZA 4DV7K 3ISNC 4H4OA 1JLFA 2HNDA 4CIFA 1U45A 4H0PA 2QWQA 1H1VA 2A41A 5FRNA 3LL3A 3ZSYA 5BPLA 3THXA 4CIEA 4CW7B 3WXLA 1N32K 5AQXA 4IFEA 5JS2A 2CH6A 4DV5K 4PUOA 4DB3A 1HMVA 2NRHA 3OJSA 4RW4A 5H1SQ 3QESA 3AA4A 1EQYA 1RT1A 2QA4N 2X74A 3T1YK 3ZSQA 4GW6A 1OVYA 2YKMA 1RCHA 3L3VA 3FE1A 5I42A 3S3NA 3AO5A 3CCSN 3AO2A 4DSEA 1W2BM 4W5TA 4QCLA 2IC3A 1KC8O 4B1ZA 4E7JA 5BN9A 1VQ8N 4M7XA 4H8KA 3AVMA 3AGRA 3HP9A 3MXJA 2YCHA 3P4IA 1I94K 1HNVA 1VHXA 3AGKA 3VQ5A 1FJGK 4JKAA 3MECA 4FSVA 1Q82O 4IEEA 5C10A 2HBJA 2HHQA 1EWRA 4KREA 4JK9A 4H0XB 2DTUA 4CGJA 2RF2A 2HNZA 2NRVA 3VF4A 3HL8A 1WOQA 5J2NA 1XMOK 3V9UA 3L6QA 4BWMA 1HYZA 1GLAG 3THXB 4H5VA 1CXUA 1GLEG 4NYFA 2VGNA 2O8EA 4CZIA 1RBUA 2WFBA 2E2PA 2GTDA 2ASPA 2HHXA 2NLXA 3SAFA 4F2RA 3WQTA 4C8KA 3OS1A 4AHUA 3R9PA 1TV6A 3DRSA 1VQPN 3CC2N 3F73A 4I6MA 3VQAA 1Z25A 1WB9A 4FJNA 5HBMA 3GBTA 3BGRA 4AHTA 4DSIA 3ID8A 3NAEA 1ASWA 1NGDA 3CJ9A 3FZFA 1EKEA 1IBKK 1HUXA 2FBYA 4Z4HA 3MK6A 2ZWHA 5J2MA 2HB5A 1VQ5N 2BANA 3RTVA 3ZCMA 1KVCA 3J81O 4CJKA 3O4QA 4GV6A 4GKKK 4ELUA 3D2FA 3VOVA 3THYA 3O1WA 4DTJA 3UB5A 4OO1J 5CY4A 2I7PA 3HPOA 2HNYA 4I9LA 3DRRA 4JI1K 1C0UA 3SYZA 3ZLJA 1N36K 1IO2A 3VQPA 3CQYA 1NK0A 2ATQA 5E26A 4MO5A 3LP3A 3OYEA 5F1XA 1JKHA 1KAXA 3V4IA 3CFPA 1VSJA 2A42A 3VMFB 3VEOA 5BN8A 4F4KA 4L8RB 3V1QA 3ZSRA 2W41A 4CGFA 3AVIA 5ADXA 2I5JA 2F9TA 3IG1A 3SQ2A 1YJWN 2QWLA 3RR8A 2GEMA 3QIPA 4YDUC 3MAQA 3HK2A 4I6MB 3LDLA 5KRSA 2XO7A 5JLHA 1LCUA 1GOCA 3RRHA 5JVHL 4H4MA 3DXMA 4YDUA 2DFFA 4FWNA 4JRPA 5AQWA 2OPQA 4W5RA 3H45C 4HUGA 3J7AP 1HKGA 4OJRA 3U6FA 3HI0A 3BZKA 4DQQA 1NGBA 3A8YA 5SZTA 4H5NA 1CLQA 4XEIA 3OBWA 1SKRA 4B3SK 4LF8K 3D2FB 3Q7BA 4YOVA 3THYB 4CJVA 3FZKA 2P5GA 3O4NA 4GVEA 3G10A 1Q7YO 4JKFA 2Q2RA 4JKEA 4NLCA 4TSXA 3VA3A 2ZJPL 1IBLK 2FLOA 4DU4A 3MN9A 4FJMA 3ZETB 2WBNA 4KKOA 2XY6A 4E1MA 1ASUA 4CEDA 5MLCQ 1S1XA 5BPNA 1XNQK 1HNXK 2OTJN 1S9EA 4K25A 3AVAA 2E8AA 4F2SA 1IV0A 3KKSA 4IBNA 4CZFA 4DMNA 3OYFA 1HPZA 1NGJA 3CC4N 5LY3A 3JSMA 4CGHA 2A1RA 2P51A 1U48A 2HBLA 1C1CA 2RKIA 2IIRA 1Q9YA 4FJGA 3M1FA 1NNEA 1HPMA 3KLFA 3U3YA 1NWKA 4B1YB 4CJ5A 3ZT3A 1LWFA 1YXQA 2ZJRL 1IH7A 5AQKA 4FLXA 1J6ZA 1NMNA 4ZHRA 2CH5A 1KQSM 1RDDA 5ADXH 3OS2A 1NKEA 4ID5A 4J2DA 4CJ4A 4H5TA 4JKGA 3MEGA 3AVNA 2UUCK 3IKMA 5AQVA 3QEXA 5GADP 4KTWA 5FRMA 4FJ5A 2F9WA 2NRZA 1QTMA 3M8RA 2YV0X 1RFQA 4KHUA 3TI0A 5AQZA 4LFAK 4O8UA 4MLHA 2HMPA 1WNSA 5KI6A 4B1WB 2VYPA 1NGEA 3LANA 4W5OA 2VWJA 4EIAA 3NF7A 1ZBHA 2IS3A 1L3TA 2P1JA 2D0PA 1QSSA 2GX9A 3VQ8A 3QICA 1U04A 2E1ZA 4IFVA 3VGKA 5JICA 2HW3A 4JHDA 3CJBA 2QI2A 4J2AA 1BCMA 4PWDA 4OX9K 4BY9C 3T7ZA 1U49A 4BC3A 3WNFA 2OZMA 3CJAA 3U3GA 3EE9A 1WAJA 1HQEA 1NGAA 4JK7A 4CEQA 1KSPA 3D6RA 3C95A 1SUQA 4H5RA 4DFJA 1HRHA 3PIPL 3OVNA 4H0VB 4CGDA 1LV5A 4DSKA 5GAHP 1KFDA 2BGGA 2Q36A 3TAPA 4CECA 1VSDA 4B3TK 2W6LA 4ZTFA 3PX0A 4Y0WA 4JKGB 3LAMA 3KWGA 1TL3A 2HF4A 1QQCA 3OYMA 2KHOA 2WUSA 5HRSA 3HM8A 2VG5A 5IT9O 4UQGA 1TK5A 4BVPA 3R8EA 4LH5A 4DR1K 4CEEA 5AQMA 2ITGA 1YTAA 3K9JA 3WQUA 4WF9L 1JJ2M 4AHRA 4QS8A 3T3FA 1XHXA 3KK3A 3A5NC 4DSLA 2D0OA 4IFYA 2G8VA 1SQKA 3ITHA 3AVKA 3VQQA 4AHVA 4DU3A 4BACA 1UA0A 4QS7A 5AFUA 4FLWA 1J54A 4JHDB 4BRMA 2HMIA 1KD1O 5AQJA 1LWEA 2VQFK 3CJ1A 1Z26A 3AA5X 5C42A 3NE6A 4E7LA 4LFCK 3MCAB 5EVZA 4KB1A 4FPAA 3G0ZA 3L8BA 1HLUA 1Y97A 4EZ6A 2UXDK 3LP0A 2YNHA 4MLEA 1YUWA 4JI0K 4JI7K 5AQUA 3RVCA 2Q0UA 3UKUA 3CFOA 1BI4B 4KHPK 3JS6A 3HO1A 3R1XA 1VK0A 1HKBA 3O5BA 4FWPA 5C25A 4WFNL 5AQOA 5IWAK 4CF8A 4DF4A 1JXEA 1M90O 1RDBA 4K0KK 2QM1A 1RDWX 1Q86O 4FZZA 1RTIA 4KV8A 3D7EO 1NGFA 4CK2A 2YHAA 3NCIA 4L3QA 5LMNK 4CFAA 1B9DA 2JWKA 3OYDA 3WEEA 3CXCM 3QEIA 3ULEA 3LPTA 1OH7A 2P9NA 4KH5A 3CJ7A 4YHHK 2PYLA 1E3MA 3SK3A 3SJJA 4K41A 4I2PA 2P9KA 1BISA 3SUQA 2HSTA 3KIOA 1JLCA 2VGMA 3OYIA 2PAVA 3AO4A 3CYMA 3C6AA 4CZMA 3NF8A 1YJNN 2A6AA 2DY4A 2HVIA 5BRDA 2BTFA 5BRHA 4M3WA 4FZXC 4LSLA 3NGZA 1U2VB 2EHGA 4JI6K 4E7HA 3OYJA 1OH6A 4JRQA 1VQON 4NO7A 3EKSA 3F2KA 5AFUH 3LDSA 4ELTA 3DM2A 1N8RO 1X9WA 2OA8A 4CHZA 1BU6O 4Q5VA 1IKWA 3SBTA 1C1BA 4FOEA 2BE2A 4B9TA 1BIZA 4A5BA 1OH8A 4M41A 3ULEB 4LFBK 1DKGD 4BE1A 4WQ4A 2P9NB 4IOCL 4BGAA 4O0IA 1HNWK 2OCEA 1R59O 4IOXA 3GG4A 4CZKA 3CF5L 5HL7L 3ZEUB 3THWA 4LF9K 1QHTA 3SV4A 3J80O 2P9KB 3VEVA 3BF1A 4YOWA 1NJZA 5AQYA 2PBDA 3BF3A 1Q18A 4PA1A 3SQ4A 1BO5O 2NZTA 5AQNA 5KRTA 1JCFA 3WXJA 4PY5A 2V7YA 4Z4GA 3TPQA 5LMUK 1KTQA 4JI3K 4BGBA 1Z05A 4CZJA 3JYTA 1YITN 1SAZA 4B1UB 4YOYA 2KTQA 5AQQA 2QEXN 3OY9A 2YJEA 2J4RA 4OLBA 3AAQA 5M1NA 2ZGZA 1K8KA 4FJJA 3R3LA 3TAMA 1RT3A 1ILYA 3EO3A 3H3OB 3L3UA 1Q9XA 4YOUA 3NDKA 4CF1A 3QBWA 1DEJA 3QERA 4KTQA 4JS4A 5FPEA 4JN4A 1C0MA 2KQ2A 5HP1A 4CEAA 3RMCA 2F4VK 4J2EA 4PL7A 4BRQA 5FPDA 5LJWA 2G8UA 3P31A 2Q3SA 4CJSA 3OW2M 4CZLA 3TABA 2QXLA 2ZJQL 3SLCA 4CZHA 5AQSA 4I9QA 1BA0A 4DR4K 4K8XA 1W9HA 4AILC 4CK3A 1HR0K 2B5JA 4ISFA 4KHQA 2B6AA 3MXMA 1ZBFA 3E1YA 3TTDA 3QNNA 2OZSA 4YOTA 1DGKN 1QSYA 3MMVA 3CM6A 3SV3A 3L4QA 3RSEA 4IO9L 4FWRA 4JI2K 2F8TA 4FK2A 1FW6A 4O8KA 2G8KA 4FWLA 3WUHA 2IOCA 5AZJB 3J7YP 3HOSA 5M1FA 4ZTJA 4ICLA 4DLEA 2F8SA 2CGLA 4A5AA 2E1YA 3A2FA 1C1AA 3W0LA 1C6VA 4DTMA 2AP1A 3HXMA 2NRXA 4BVOA 3NH2A 3O9UA 4JYAK 3FLCO 4MO4A 4RW7A 3OTOK 3ALYA 3WNGA 3DMJA 3L2VA 2G8WA 3A5LC 3NVMA 3HTVA 2GUIA 4CZEA 4EAHD 4AF1A 1YTUA 4IKFA 4O5FA 3LZIA 4KHWA 1IG8A 4FLVA 1WSHA 2Z1JA 4A61A 3HT3A 4B9VA 1XMQK 1BUPA 1F21A 4ELVA 1LW2A 4IZ9A 1JLEA 4BRFA 4B9NA 5E41A 4DF8A 4HUFA 2FSJA 3KWIA 3QFPA 1BA1A 1U6ZA 4CJ7A 4CF2A 4ILHA 1ZYQA 3E9LA 5LJVA 3I0SA 1SV5A 1VQ6N 3MWTA 4GY2B 3HYFA 3QO9A 4AHSA 4C23A 4YOXA 4CFCA 2DFHA 3J7ZO 1IKVA 1KAYA 3DLRA 2IGIA 1WAFA 3Q7CA 1QS4A 4E7KA 1D9DA 2YNGA 3SUNA 1RNHA 2YJFA 4DKWA 4I7FA 3VEYA 1NK7A 2O8BA 3WXIA 4FM1A 3LAKA 2RN2A 1RDCA 2YI1A 2EWSA 5M1KA 4Z4FA 4DUZK 1UOCA 3ASMA 4ID1A 1S72N 3CQ8A 3ZSOA 2ZQBA 3D2EA 3C6UA 4CD3A 1N5YA 4KHYA 2WOMA 4B9SA 2IDOA 3KK7A 5AQTA 1ATNA 2O8EB 3ZT2A 1S9GA 4LC9B 5FROA 5KPRA 3VQ7A 1SL2A 1REVA 4F8RA 4FJ7A 5F2RA 3MCPA 4WFAL 4JLHA 5C24A 3CMEN 1CZBA 3M6GA 3VETA 3LDQA 2ETJA 3QMLA 1X9JA 3O8MA 4FWMA 1TK0A 1HJRA 3AY9A 3BZCA 4DTSA 1XUPO 4CHQA 3CJCA 1RTHA 4C8NA 1GLFO 2A1SA 4EP4A 3F9KA 1JLAA 5AZIA 3THVA 4JV5K 2QTDA 1WSFA 3S3OA 3EZ5A 4A62A 3O4WA 3ZSVA 2VCPA 4N76A 2O8BB 2GBZA 4FL9A 5C0YA 2GV9A 2YHBA 1HQUA 3BY5A 4FJLA 4CI6A 4DQIA 5GIPA 4IWVA 4RG8A 2V52B 3AA2A 4I2QA 4KB0A 3ULDA 3PO4A 4KI6A 1VSKA 4DV0K 4EZ9A 1CZAN 3D2EB 5KQ8A 2PZSA 2YHXA 4DHYA 3VQ9A 4MDBA 1TKDA 2KZMA 1BCOA 4DFPA 3H3NO 3S9HA 1YT3A 3LDPA 3SUOA 5BRFA 3A5MC 3KD1E 1YJ9N 1EX4A 1VSLA 2I7NA 5TKYA 3LZJA 1YF5L 4RW8A 4IJAA 5I3UA 2NNWA 2YNIA 4E7IA 5GINA 5AQGA 3CC7N 1SL0A 4DUYK 5C2FA 3QEVA 3OS0A 4IJNA 3O9TA 4DQRA 3KHYA 3AV9A 3EN9A 5AZIB 3I8BA 4BRGA 4PQUA 4BE2A 3HBTA 2BH1A 1G99A 3DXMB 1NLVA 4GKJK 4DTPA 2O8CA 4XH1A 1BG3A 3TARA 2O8DA 2D0BA 4K8ZA 1KVBA 3V1OA 3ZYYX 3O3FA 5HOOA 3ZT0A 4C1NK 4DR7K 2HHHK 4Z4CA 4DTXA 4KFBA 3OYGA 5AQIA 4YFUA 4J2BA 4CJPA 3O9RA 1EXQA 4DS5A 4WQ5A 1ZBLA 3PLAA 3VERA 2O8FA 1WUAA 3LWLA 5B8HA 2XY5A 1KRPA 4DR6K 4KO0A 3DLHA 5F0XA 1C0TA 1A5WA 3AVLA 4FK0A 4ILJA 4YORA 4PL8A 1LAWA 3CCLN 1MU2A 1T03A 4CF0A 3P1GA 3K58A 1I39A 1ESVA 3AO1A 3CFRA 5HLFA 3GL1A 4BC2A 5FPMA 2QW9A 1JLQA 2GWKA 3BDPA 2KKZA 3B8AX 2Q0RA 2D0AA 5CZ1A 4BR0A 4LF4K 1R0AA 4AM7A 1VSEA 3PIOL 5CE3A 2E5LK 3DXKA 4GV9A 4FJ8A 1WLJA 3QDKA 1QQOA 3OYCA 1NKCA 3C7NA 3PSIA 1QZ6A 2FXUA 3CETA 4R79A 4XIUA 2O8DB 3VTHA 1IJJA 1J5EK 4CE9A 2UXBK 4E1JA 4FM2A 1HYVA 3I0RA 4K42A 2F96A 2D0CA 1VQLN 3VEXA 3K5LA 4IO8A 1KVAA 4OPAA 5CR4A 3MN6A 2O8FB 4DV2K 4B1VA 4FJKA 4LD0A 3E66A 3RRGA 4CJLA 2P9PA 4GNIA 3DAWA 1SKSA 5KGXA 4CZGA 4DG1A 1SL1A 3NH0A 3EKUA 2HHTA 3EYZA 4HHTA 1N6QA 3LDOA 4MDAA 4M3TA 3KLGA 2AJQA 2HHUA 5AQFA 1CZ9A 3C65A 2DFEA 4BR4A 4OLAA 4PKIA 4FPBA 4B8AB 3QBXA 4DQPA 4W5QA 2BUPA 1GOBA 2X6SA 3SMPA 1S5JA 3QFUA 5EX5A 3F5TA 3M8PA 1N34K 3DYAA 4FYDA 1S22A 1NK6A 4BWJA 3ZT4A 4DSJA 3C7NB 2Q97A 1I3AA 4DQSA 1J53A 1VRUA 2P9IA 3MX5A 1V4SA 5JVGL 3VN5A 4BRCA 4DFMA 3FZMA 3NFAA 4H0YB 4E0DA 3GE1A 1K8AO 3FFIA 3KLIA 4IOAL 4CGGA 3RMDA 4FO0A 1GLJO 1NOYA 2GELA 1UWBA 1RILA 2LSNA 3LALA 2P9PB 4HUEA 3O9SA 2GWJA 1JCGA 4A57A 3DRPA 3PX4A 4HTLA 3KZBA 3TAEA 3L2RA 2YNFA 4Z4EA 2F7TA 2OPRA 3SQ0A 1O1WA 1ATRA 3VQ4A 1D4XA 1JXBA 5GIOA 3IAYA 1QQNA 4K43A 4NLBA 3I8DA 2FF3B 1DT9A 1S6QA 3C0BA 3KJVA 1XHZA 4BC4A 3WT0A 3VQEA 2OPSA 4LF7K 2A3ZA 2IVNA 1O13A 3BEXA 2ZD1A 3QLHA 1W0HA 3SMSA 1BHLA 4PKHA 4MFBA 4GV3A 4BRPA 3O3HA 4KRFA 3MN5A 2RPIA 1QQMA 4ILGB 1WSGA 3NF6A 3L2UA 4DV4K 3R6MA 4J8FA 3U9ZA 4FWSA 1E4FT 3L4IA 4QAGA 3K5OA 3LP2A 3UKUB 3P39A 2EX3A 5GAGP 3HP6A 4HTUA 3TAGA 3OYNA 4OVLA 3IDHA 3IMXA 1TKZA 5BR9A 2WTUA 4B3RK 3D45A 2OTLN 1Q81O 2P5OA 1NGCA 2HF3A 5M1OA 4E19A 1VSMA 3IRXA 4WQ4C 1T8EA 4FW1A 1T3VA 4JI8K 4PKGA 3WEEB 4M3UA 2VQEK 4AQYK 4F9OA 4RCHA 5KQDA 3CI5A 1SS6A 1IKXA 3UKRA 1E4GT 1TAUA 3OYHA 3QB0A 1YHQN 2HHWA 3LDNA 1EO1A 2UUAK 2Y1IA 4C8OA 1VRTA 3QINA 4YY3K 2D4WA 1FK9A 1YVUA 2CGJA 2P9UA 2NRWA 4Z4IA 1LW0A 1OKJA 3O1BA 1NK9A 3VGLA 3AVCA 5DM7L 3UIQA 4FLZA 4EFHA 1XWLA 3T19A 4FWOA 4FVUA 3M3ZA 1QSLA 5FLXO 4ISGA 3VA0A
chains in the Genus database with same CATH topology
2E5LK 4DV0K 5IT9O 4NXNK 1XNRK 4B3MK 4CW7B 2ZM6K 1N32K 4DR1K 3J81O 1J5EK 4DR4K 4JI6K 4DV5K 1HR0K 4LF7K 4GKKK 2UXBK 4DV1K 2UXCK 4X65K 4CVNE 5BR8K 4X62K 4JI1K 1N36K 4DV2K 3T1YK 2UUBK 4DR5K 4DV4K 4DUYK 4JI2K 4LFBK 2VQFK 4DR2K 3J7YP 4DUZK 4LFCK 2UU9K 2UUCK 1HNWK 2UXDK 4B3RK 4GKJK 4JI0K 4LF9K 3T1HK 3J80O 4JI7K 4LFAK 4KHPK 1I94K 4JYAK 1FJGK 3OTOK 4DR7K 4JI5K 4JI8K 5IWAK 2HHHK 4V19S 1IBMK 4K0KK 2VQEK 1N34K 1XMOK 4AQYK 5A2QO 3J7AP 4LF6K 4X66K 5LMUK 4X64K 5LMNK 4JI3K 4JI4K 4B3SK 4LF8K 4DR6K 4DV6K 1XMQK 2UUAK 4OX9K 4YY3K 5AJ3K 3JAMO 1N33K 4YHHK 4JV5K 1IBLK 4DV3K 5LL6Z 4LF5K 1HNZK 4B3TK 4DR3K 1XNQK 4LF4K 4DV7K 2F4VK 5FLXO 1HNXK 1IBKK 4NXMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L K;  4DV0 K;  5IT9 O;  4NXN K;  1XNR K;  4B3M K;  4CW7 B;  2ZM6 K;  1N32 K;  4DR1 K;  3J81 O;  1J5E K;  4DR4 K;  4JI6 K;  4DV5 K;  1HR0 K;  4LF7 K;  4GKK K;  2UXB K;  4DV1 K;  2UXC K;  4X65 K;  4CVN E;  5BR8 K;  4X62 K;  4JI1 K;  1N36 K;  4DV2 K;  3T1Y K;  2UUB K;  4DR5 K;  4DV4 K;  4DUY K;  4JI2 K;  4LFB K;  2VQF K;  4DR2 K;  3J7Y P;  4DUZ K;  4LFC K;  2UU9 K;  2UUC K;  1HNW K;  2UXD K;  4B3R K;  4GKJ K;  4JI0 K;  4LF9 K;  3T1H K;  3J80 O;  4JI7 K;  4LFA K;  4KHP K;  1I94 K;  4JYA K;  1FJG K;  3OTO K;  4DR7 K;  4JI5 K;  4JI8 K;  5IWA K;  2HHH K;  4V19 S;  1IBM K;  4K0K K;  2VQE K;  1N34 K;  1XMO K;  4AQY K;  5A2Q O;  3J7A P;  4LF6 K;  4X66 K;  5LMU K;  4X64 K;  5LMN K;  4JI3 K;  4JI4 K;  4B3S K;  4LF8 K;  4DR6 K;  4DV6 K;  1XMQ K;  2UUA K;  4OX9 K;  4YY3 K;  5AJ3 K;  3JAM O;  1N33 K;  4YHH K;  4JV5 K;  1IBL K;  4DV3 K;  5LL6 Z;  4LF5 K;  1HNZ K;  4B3T K;  4DR3 K;  1XNQ K;  4LF4 K;  4DV7 K;  2F4V K;  5FLX O;  1HNX K;  1IBK K;  4NXM K; 
#chains in the Genus database with same CATH topology
 3DLL L;  1IKY A;  2RE2 A;  3IUC A;  4BR9 A;  3V9X A;  1TYQ A;  3TSP A;  4NXN K;  1RBR A;  1ZXO A;  5CYM A;  2ZM6 K;  2P9S A;  3V9Z A;  3VTI A;  3OBY A;  4H0O A;  3LPU A;  3V81 A;  4DV1 K;  2UXC K;  1X3M A;  3J8A A;  1NOZ A;  4JEP A;  2QWN A;  5AQP A;  3UKR B;  4E1N A;  4FLY A;  1VSI A;  4Z94 A;  1S1T A;  4BRD A;  4BQL A;  4O44 A;  1EWQ A;  3SQ1 A;  4B08 A;  3NBP A;  3THW B;  4CCH A;  2KFN A;  1K6Y A;  1OVQ A;  1NK4 A;  4BG9 A;  4DTR A;  1KLN A;  2ASM A;  3K5M A;  4FWQ A;  3FFK B;  3PSF A;  2KLA A;  2P9U B;  4FZY A;  1WN7 A;  2XY7 A;  4N47 A;  4CJF A;  4O4G A;  3A5O C;  4QOZ B;  3OYK A;  4OKJ A;  1NGI A;  3T1H K;  3CCJ N;  4GVM A;  5JS1 A;  3CCU N;  4DTN A;  4E89 A;  3FR0 A;  2P9L A;  4JKH A;  4OGC A;  4LH4 A;  1T7P A;  3TAF A;  5T7B A;  4FLT A;  3AAP A;  4BG8 A;  4CJU A;  5KPZ A;  4OKK A;  2V7Z A;  4CEB A;  3FZH A;  4CEF A;  1TYQ B;  4X64 K;  3QEW A;  3P38 A;  1T6D A;  1K8K B;  5M1Q A;  4JI4 K;  1YI2 N;  4FM0 A;  2P9S B;  4CJR A;  4EP5 A;  1D8Y A;  4A2A A;  3EZW A;  3KLH A;  3HM9 A;  3RWU A;  4BR2 A;  3WNE A;  4G1Q A;  3DOK A;  1D5A A;  1A5V A;  1MDU B;  1XC9 A;  3JAM O;  3HVT A;  1ZBU A;  4BQZ A;  3KD5 E;  4HWI A;  2E6L A;  4CK1 A;  2FBT A;  3ENO A;  1NGH A;  3GDQ A;  4DWI A;  1ITG A;  3SZ2 A;  1JL2 A;  5J2P A;  3BP8 A;  1DLO A;  5DM6 L;  1P8Z A;  3H08 A;  4DLG A;  3M8S A;  3CM5 A;  1QHA A;  4CER A;  3HVR A;  4B3M K;  2P9L B;  4CJ3 A;  1ZBS A;  1ZC6 A;  4B9U A;  2X78 A;  4U67 L;  3RSE B;  3AVG A;  3BUZ B;  4H5W A;  2HHV A;  1YIJ N;  4CVN E;  1HX1 A;  4CJT A;  1L3U A;  4LSN A;  3C6H A;  3LWM A;  1BQM A;  2QWR A;  1L3V A;  1K73 O;  2HOE A;  3KKR A;  4DTO A;  4M3Z A;  4M3Y A;  1VSH A;  1WSI A;  3QEP A;  4CJW A;  3SAH A;  3E01 A;  4CHP A;  3L2W A;  1GLL O;  2YHW A;  2DPN A;  1JCE A;  1NJY A;  4KPY A;  4IXC A;  2E20 A;  2VG6 A;  1EET A;  1HYS A;  2UYT A;  1L5U A;  2Z1G A;  1NU0 A;  5JLF A;  4CEZ A;  1RT4 A;  2O4G A;  3OHR A;  1FKP A;  3SJH A;  3L2Q A;  4LF6 K;  2R7Y A;  4LY7 A;  4KH4 A;  3VEW A;  4R5P A;  2PY5 A;  4WYB A;  3VF2 A;  3VF6 A;  3CCM N;  1QZ5 A;  3AVJ A;  4M45 A;  4NCA A;  4CBX A;  4FJ9 A;  3NGY A;  2JWL A;  3H46 O;  2WC9 A;  1HKC A;  1N33 K;  2QWO A;  3SCX A;  1KAZ A;  3DLK A;  3DLG A;  3TSU A;  4NYN A;  4U7B A;  3ID6 A;  2CGK A;  1S1V A;  1KLM A;  4H0T B;  4JK8 A;  4FXD A;  1UA1 A;  2W40 A;  3ATU A;  5GAE P;  3CD6 N;  1YAG A;  3K59 A;  1Q8I A;  1X9M A;  4M3R A;  3LM2 A;  5HRN A;  3M8Q A;  1BDG A;  1ASV A;  3ZET A;  4KHN A;  2FSK A;  5C15 A;  1XNR K;  4JS5 A;  1TGO A;  1C0G A;  1SKW A;  3ENH A;  3N4Q A;  1NJW A;  2E2O A;  3CCR N;  3ZT1 A;  1M1K O;  2NUB A;  2HBM A;  5KGW A;  4X62 K;  4KBO A;  3NVK A;  5KTQ A;  3KK2 A;  2B4J A;  4BRN A;  1KCF A;  3O80 A;  3RMB A;  3VEZ A;  3I55 N;  1X9S A;  1JL1 A;  2ZGY A;  2FSN A;  4RTF D;  4H03 B;  4AH9 A;  3A0I X;  2NRT A;  1TKT A;  3CCV N;  4DR2 K;  2E2N A;  4NB4 A;  3D0P A;  3K5N A;  4DTU A;  3G4S N;  4PHT X;  2XHB A;  2VWK A;  3N4P A;  5DK5 A;  2QWM A;  3AVB A;  3S41 A;  2XY8 A;  1NK5 A;  1UAX A;  3U8X A;  3S3M A;  3MEE A;  5BRE A;  3OYB A;  1RTD A;  5CZ2 A;  3VQ6 A;  2QKB A;  3CPE A;  2V51 B;  1W97 L;  4FJH A;  1B92 A;  4JI5 K;  4IG0 A;  3TTF A;  4V19 S;  4CJQ A;  4C8M A;  3TWH A;  4N41 A;  1OH5 A;  5A2Q O;  2HBK A;  4ISE A;  5AQL A;  4CJE A;  3V9S A;  4FOI A;  1TK8 A;  4JKC A;  1D9F A;  4X66 K;  3L0Q A;  1T6C A;  4HCC A;  4BRK A;  5JMV A;  3SI6 A;  4DV6 K;  4G9Z A;  1SZ2 A;  4O55 A;  3EY1 A;  2IVO A;  4KHS A;  3V1R A;  1VAZ A;  4RWT A;  2ZE2 A;  3KVG A;  3NH1 A;  1GLD G;  4WQ5 C;  3K2P A;  5AJ3 K;  4BE0 A;  1V4T A;  5BPM A;  1DTQ A;  2A5X A;  1IG9 A;  2WON A;  3G71 N;  1L3S A;  3QIO A;  3CQX A;  2E6M A;  3O08 A;  3MN7 A;  4O5B A;  3IFR A;  5AR0 A;  1HNZ K;  4B9L A;  3TAQ A;  3VQD A;  4OPH A;  2VWB A;  3JXU A;  1VSF A;  2ZF5 O;  3VQB A;  5CHI A;  4BDP A;  3TAN A;  4DR3 K;  1NJI O;  3NMU A;  3H1Q A;  3I56 N;  3QNO A;  4Z0U A;  1P90 A;  1RBV A;  1HJO A;  2QKK A;  3PY8 A;  4FWK A;  1NBW A;  3ENB A;  2QWP A;  1WBD A;  4WE1 A;  4HCB A;  3CMA N;  2GUP A;  3OYL A;  1RBT A;  1W7A A;  4FK4 A;  3CCQ N;  3W3D A;  2G8H A;  1WSJ A;  1HNI A;  3TTC A;  3HZ6 A;  4Q0B A;  2RHK A;  1NKB A;  5EOY A;  3DLE A;  3F9M A;  1RGI A;  3P83 D;  1NJX A;  2O8C B;  2XRI A;  2HVH A;  2Q31 A;  1RT2 A;  5TKW A;  4BRA A;  5J1E A;  1A5X A;  3O9Q A;  3TSQ A;  3V9W A;  1ZBI A;  1YVN A;  4F3O A;  3E9P A;  4KTZ A;  4M7Y A;  3ZX3 A;  3NGI A;  4B8C A;  4FVM A;  1T44 A;  3MDQ A;  2FBX A;  4BRE A;  5FPN A;  1S1W A;  3G25 A;  3HPG A;  2E2Q A;  2FC0 A;  3CIP A;  5KPT A;  4CES A;  1RT7 A;  3ZX0 A;  1BI4 A;  2JLE A;  1RTJ A;  5HRR A;  1QE1 A;  4CEO A;  1VQ7 N;  1VQ4 N;  4BR7 A;  5EY4 A;  3DOL A;  1BWF O;  1FKO A;  3V6D A;  3SBG A;  3QET A;  2YHY A;  1QVF M;  4EHU A;  3DXK B;  4E3S A;  4DV3 K;  1KFS A;  1WBB A;  3FGU A;  2O4I A;  2Z1I A;  1NM1 A;  2G8F A;  1LAV A;  4XH5 A;  5ELZ A;  4NXM K;  3P5J A;  5K14 A;  1JLB A;  1QVG M;  1RBS A;  2AA4 A;  3AAR A;  1XQS C;  1K9M O;  4BRL A;  1CXQ A;  1FXX A;  1GLB G;  2Y1J A;  5SWM A;  2OYQ A;  3WXK A;  1BGX T;  2H3G X;  1TUY A;  3AVH A;  4BRO A;  4X65 K;  4YNQ A;  5BR8 K;  1RT5 A;  2NRR A;  1Z6R A;  4B9Q A;  4EHT A;  1MA9 B;  4DS4 A;  3EL2 A;  4CIG A;  3RMA A;  5C12 A;  5FDL A;  1U2V A;  3RR7 A;  3MED A;  3OA9 A;  3SPZ A;  4BRI A;  3C94 A;  2ASO A;  1MWM A;  1TAQ A;  2PFU A;  4B1X B;  3ATV A;  1NMD A;  3DI6 A;  3H6E A;  3HOT A;  2X6N A;  5CYQ A;  3T69 A;  2UU9 K;  2PYJ A;  5HRP A;  4AM6 A;  4M3X A;  1VQM N;  5I9E B;  1WSE A;  1U4B A;  4CGI A;  3KLE A;  1EP4 A;  3WXM B;  5E84 A;  4OPK A;  4JKD A;  1MWK A;  2P9I B;  3PUF A;  3ZX2 A;  2BDP A;  2KFZ A;  4B9M A;  3K0S A;  3HRG A;  1BOT O;  3E9O A;  4Y1C A;  3G6E N;  1T05 A;  1U47 A;  2FF6 A;  1J5O A;  3SNN A;  5EU7 A;  3K9K A;  3AA3 A;  3ZEU A;  4MQ3 A;  3U9D A;  1XI1 A;  3EEQ A;  3SUP A;  1RDU A;  3H1V X;  4JAX A;  2W42 A;  4IDH A;  4C8L A;  5D3G A;  1NK8 A;  3O6W A;  3GOI A;  3K57 A;  1JLG A;  3AO3 A;  3KTQ A;  3DJC A;  3VGM A;  3DLB A;  5HRO A;  1TKX A;  1NGG A;  4IEI A;  4JNE A;  5EXW A;  3VQC A;  1ATS A;  4M63 C;  3UE5 A;  1RT6 A;  1X1P A;  3ZSZ A;  3FZL A;  4CF9 A;  3PO5 A;  5LL6 Z;  3C6T A;  3HST B;  4N5S A;  3OYA A;  4CHN A;  1VQN N;  2KZZ A;  4B3O A;  4OKE A;  2IAJ A;  3I33 A;  4RW9 A;  3OJU A;  1BIU A;  1GOA A;  3IS9 A;  3PX6 A;  1VQK N;  3HJF A;  2KW4 A;  4FCY A;  1G15 A;  3LP1 A;  3DWL A;  4JD2 A;  2FBV A;  4CD1 A;  4IDK A;  3MX2 A;  3MWP A;  4WCE L;  1RDA A;  2JGU A;  4NCB A;  3KK1 A;  1LWC A;  3U4L A;  3PV8 A;  2E88 A;  4CFD A;  5J2Q A;  3T1A A;  1C0F A;  4DU1 A;  3CCE N;  3SAG A;  1LOT B;  1VQ9 N;  4BDY A;  3CHW A;  4IG3 A;  4CHO A;  2UUB K;  4DR5 K;  3HSC A;  4F3T A;  1X3N A;  4C1N I;  4OGE A;  1NG9 A;  1BQN A;  4FLU A;  1DTT A;  1GLC G;  1S1U A;  2OPP A;  4DSF A;  3VES A;  2E4L A;  4OPJ A;  2D5R A;  3CER A;  2Q1N A;  3HPH A;  4CBU A;  4DCH A;  1BL3 A;  2OAN A;  3CPW M;  3TU5 A;  4CHY A;  4CFB A;  4XH4 A;  2ITM A;  5C2D A;  4QS9 A;  4AHC A;  4CBW A;  5AQH A;  5AZJ A;  3ZSX A;  4NCG A;  4BR5 A;  4WFB L;  3AVF A;  3ZSW A;  3B6P A;  2QXF A;  2A40 A;  1IBM K;  2Z1H A;  3VEN A;  2VG7 A;  2G8I A;  4KAZ A;  1J9A A;  4KI4 A;  4UY8 O;  4N56 A;  4JD2 B;  3EE8 A;  4DFK A;  3NF9 A;  4O0J A;  3LM9 A;  4BDZ A;  4RW6 A;  1KXP A;  4A59 A;  3TR8 A;  4JKB A;  4A2B A;  5AQR A;  3NHG A;  3M5R A;  4M42 A;  1TL1 A;  4GMJ B;  4DQ8 A;  4FJX A;  4HVJ A;  3MXI A;  2IVP A;  5DMR A;  4FW2 A;  4KH6 A;  2QK9 A;  2D1K A;  4BC5 A;  1S6P A;  3B6O A;  1S3X A;  3WNH A;  2HHS A;  3CG7 A;  4FJI A;  2W6K A;  1TVR A;  2YKN A;  1TUU A;  1Y64 A;  4LF5 K;  4W5N A;  2YX6 A;  3SPY A;  4BRH A;  4Y1D A;  1XC3 A;  1B9F A;  3O3G A;  5M1P A;  3VPZ A;  4DV7 K;  3ISN C;  4H4O A;  1JLF A;  2HND A;  4CIF A;  1U45 A;  4H0P A;  2QWQ A;  1H1V A;  2A41 A;  5FRN A;  3LL3 A;  3ZSY A;  5BPL A;  3THX A;  4CIE A;  4CW7 B;  3WXL A;  1N32 K;  5AQX A;  4IFE A;  5JS2 A;  2CH6 A;  4DV5 K;  4PUO A;  4DB3 A;  1HMV A;  2NRH A;  3OJS A;  4RW4 A;  5H1S Q;  3QES A;  3AA4 A;  1EQY A;  1RT1 A;  2QA4 N;  2X74 A;  3T1Y K;  3ZSQ A;  4GW6 A;  1OVY A;  2YKM A;  1RCH A;  3L3V A;  3FE1 A;  5I42 A;  3S3N A;  3AO5 A;  3CCS N;  3AO2 A;  4DSE A;  1W2B M;  4W5T A;  4QCL A;  2IC3 A;  1KC8 O;  4B1Z A;  4E7J A;  5BN9 A;  1VQ8 N;  4M7X A;  4H8K A;  3AVM A;  3AGR A;  3HP9 A;  3MXJ A;  2YCH A;  3P4I A;  1I94 K;  1HNV A;  1VHX A;  3AGK A;  3VQ5 A;  1FJG K;  4JKA A;  3MEC A;  4FSV A;  1Q82 O;  4IEE A;  5C10 A;  2HBJ A;  2HHQ A;  1EWR A;  4KRE A;  4JK9 A;  4H0X B;  2DTU A;  4CGJ A;  2RF2 A;  2HNZ A;  2NRV A;  3VF4 A;  3HL8 A;  1WOQ A;  5J2N A;  1XMO K;  3V9U A;  3L6Q A;  4BWM A;  1HYZ A;  1GLA G;  3THX B;  4H5V A;  1CXU A;  1GLE G;  4NYF A;  2VGN A;  2O8E A;  4CZI A;  1RBU A;  2WFB A;  2E2P A;  2GTD A;  2ASP A;  2HHX A;  2NLX A;  3SAF A;  4F2R A;  3WQT A;  4C8K A;  3OS1 A;  4AHU A;  3R9P A;  1TV6 A;  3DRS A;  1VQP N;  3CC2 N;  3F73 A;  4I6M A;  3VQA A;  1Z25 A;  1WB9 A;  4FJN A;  5HBM A;  3GBT A;  3BGR A;  4AHT A;  4DSI A;  3ID8 A;  3NAE A;  1ASW A;  1NGD A;  3CJ9 A;  3FZF A;  1EKE A;  1IBK K;  1HUX A;  2FBY A;  4Z4H A;  3MK6 A;  2ZWH A;  5J2M A;  2HB5 A;  1VQ5 N;  2BAN A;  3RTV A;  3ZCM A;  1KVC A;  3J81 O;  4CJK A;  3O4Q A;  4GV6 A;  4GKK K;  4ELU A;  3D2F A;  3VOV A;  3THY A;  3O1W A;  4DTJ A;  3UB5 A;  4OO1 J;  5CY4 A;  2I7P A;  3HPO A;  2HNY A;  4I9L A;  3DRR A;  4JI1 K;  1C0U A;  3SYZ A;  3ZLJ A;  1N36 K;  1IO2 A;  3VQP A;  3CQY A;  1NK0 A;  2ATQ A;  5E26 A;  4MO5 A;  3LP3 A;  3OYE A;  5F1X A;  1JKH A;  1KAX A;  3V4I A;  3CFP A;  1VSJ A;  2A42 A;  3VMF B;  3VEO A;  5BN8 A;  4F4K A;  4L8R B;  3V1Q A;  3ZSR A;  2W41 A;  4CGF A;  3AVI A;  5ADX A;  2I5J A;  2F9T A;  3IG1 A;  3SQ2 A;  1YJW N;  2QWL A;  3RR8 A;  2GEM A;  3QIP A;  4YDU C;  3MAQ A;  3HK2 A;  4I6M B;  3LDL A;  5KRS A;  2XO7 A;  5JLH A;  1LCU A;  1GOC A;  3RRH A;  5JVH L;  4H4M A;  3DXM A;  4YDU A;  2DFF A;  4FWN A;  4JRP A;  5AQW A;  2OPQ A;  4W5R A;  3H45 C;  4HUG A;  3J7A P;  1HKG A;  4OJR A;  3U6F A;  3HI0 A;  3BZK A;  4DQQ A;  1NGB A;  3A8Y A;  5SZT A;  4H5N A;  1CLQ A;  4XEI A;  3OBW A;  1SKR A;  4B3S K;  4LF8 K;  3D2F B;  3Q7B A;  4YOV A;  3THY B;  4CJV A;  3FZK A;  2P5G A;  3O4N A;  4GVE A;  3G10 A;  1Q7Y O;  4JKF A;  2Q2R A;  4JKE A;  4NLC A;  4TSX A;  3VA3 A;  2ZJP L;  1IBL K;  2FLO A;  4DU4 A;  3MN9 A;  4FJM A;  3ZET B;  2WBN A;  4KKO A;  2XY6 A;  4E1M A;  1ASU A;  4CED A;  5MLC Q;  1S1X A;  5BPN A;  1XNQ K;  1HNX K;  2OTJ N;  1S9E A;  4K25 A;  3AVA A;  2E8A A;  4F2S A;  1IV0 A;  3KKS A;  4IBN A;  4CZF A;  4DMN A;  3OYF A;  1HPZ A;  1NGJ A;  3CC4 N;  5LY3 A;  3JSM A;  4CGH A;  2A1R A;  2P51 A;  1U48 A;  2HBL A;  1C1C A;  2RKI A;  2IIR A;  1Q9Y A;  4FJG A;  3M1F A;  1NNE A;  1HPM A;  3KLF A;  3U3Y A;  1NWK A;  4B1Y B;  4CJ5 A;  3ZT3 A;  1LWF A;  1YXQ A;  2ZJR L;  1IH7 A;  5AQK A;  4FLX A;  1J6Z A;  1NMN A;  4ZHR A;  2CH5 A;  1KQS M;  1RDD A;  5ADX H;  3OS2 A;  1NKE A;  4ID5 A;  4J2D A;  4CJ4 A;  4H5T A;  4JKG A;  3MEG A;  3AVN A;  2UUC K;  3IKM A;  5AQV A;  3QEX A;  5GAD P;  4KTW A;  5FRM A;  4FJ5 A;  2F9W A;  2NRZ A;  1QTM A;  3M8R A;  2YV0 X;  1RFQ A;  4KHU A;  3TI0 A;  5AQZ A;  4LFA K;  4O8U A;  4MLH A;  2HMP A;  1WNS A;  5KI6 A;  4B1W B;  2VYP A;  1NGE A;  3LAN A;  4W5O A;  2VWJ A;  4EIA A;  3NF7 A;  1ZBH A;  2IS3 A;  1L3T A;  2P1J A;  2D0P A;  1QSS A;  2GX9 A;  3VQ8 A;  3QIC A;  1U04 A;  2E1Z A;  4IFV A;  3VGK A;  5JIC A;  2HW3 A;  4JHD A;  3CJB A;  2QI2 A;  4J2A A;  1BCM A;  4PWD A;  4OX9 K;  4BY9 C;  3T7Z A;  1U49 A;  4BC3 A;  3WNF A;  2OZM A;  3CJA A;  3U3G A;  3EE9 A;  1WAJ A;  1HQE A;  1NGA A;  4JK7 A;  4CEQ A;  1KSP A;  3D6R A;  3C95 A;  1SUQ A;  4H5R A;  4DFJ A;  1HRH A;  3PIP L;  3OVN A;  4H0V B;  4CGD A;  1LV5 A;  4DSK A;  5GAH P;  1KFD A;  2BGG A;  2Q36 A;  3TAP A;  4CEC A;  1VSD A;  4B3T K;  2W6L A;  4ZTF A;  3PX0 A;  4Y0W A;  4JKG B;  3LAM A;  3KWG A;  1TL3 A;  2HF4 A;  1QQC A;  3OYM A;  2KHO A;  2WUS A;  5HRS A;  3HM8 A;  2VG5 A;  5IT9 O;  4UQG A;  1TK5 A;  4BVP A;  3R8E A;  4LH5 A;  4DR1 K;  4CEE A;  5AQM A;  2ITG A;  1YTA A;  3K9J A;  3WQU A;  4WF9 L;  1JJ2 M;  4AHR A;  4QS8 A;  3T3F A;  1XHX A;  3KK3 A;  3A5N C;  4DSL A;  2D0O A;  4IFY A;  2G8V A;  1SQK A;  3ITH A;  3AVK A;  3VQQ A;  4AHV A;  4DU3 A;  4BAC A;  1UA0 A;  4QS7 A;  5AFU A;  4FLW A;  1J54 A;  4JHD B;  4BRM A;  2HMI A;  1KD1 O;  5AQJ A;  1LWE A;  2VQF K;  3CJ1 A;  1Z26 A;  3AA5 X;  5C42 A;  3NE6 A;  4E7L A;  4LFC K;  3MCA B;  5EVZ A;  4KB1 A;  4FPA A;  3G0Z A;  3L8B A;  1HLU A;  1Y97 A;  4EZ6 A;  2UXD K;  3LP0 A;  2YNH A;  4MLE A;  1YUW A;  4JI0 K;  4JI7 K;  5AQU A;  3RVC A;  2Q0U A;  3UKU A;  3CFO A;  1BI4 B;  4KHP K;  3JS6 A;  3HO1 A;  3R1X A;  1VK0 A;  1HKB A;  3O5B A;  4FWP A;  5C25 A;  4WFN L;  5AQO A;  5IWA K;  4CF8 A;  4DF4 A;  1JXE A;  1M90 O;  1RDB A;  4K0K K;  2QM1 A;  1RDW X;  1Q86 O;  4FZZ A;  1RTI A;  4KV8 A;  3D7E O;  1NGF A;  4CK2 A;  2YHA A;  3NCI A;  4L3Q A;  5LMN K;  4CFA A;  1B9D A;  2JWK A;  3OYD A;  3WEE A;  3CXC M;  3QEI A;  3ULE A;  3LPT A;  1OH7 A;  2P9N A;  4KH5 A;  3CJ7 A;  4YHH K;  2PYL A;  1E3M A;  3SK3 A;  3SJJ A;  4K41 A;  4I2P A;  2P9K A;  1BIS A;  3SUQ A;  2HST A;  3KIO A;  1JLC A;  2VGM A;  3OYI A;  2PAV A;  3AO4 A;  3CYM A;  3C6A A;  4CZM A;  3NF8 A;  1YJN N;  2A6A A;  2DY4 A;  2HVI A;  5BRD A;  2BTF A;  5BRH A;  4M3W A;  4FZX C;  4LSL A;  3NGZ A;  1U2V B;  2EHG A;  4JI6 K;  4E7H A;  3OYJ A;  1OH6 A;  4JRQ A;  1VQO N;  4NO7 A;  3EKS A;  3F2K A;  5AFU H;  3LDS A;  4ELT A;  3DM2 A;  1N8R O;  1X9W A;  2OA8 A;  4CHZ A;  1BU6 O;  4Q5V A;  1IKW A;  3SBT A;  1C1B A;  4FOE A;  2BE2 A;  4B9T A;  1BIZ A;  4A5B A;  1OH8 A;  4M41 A;  3ULE B;  4LFB K;  1DKG D;  4BE1 A;  4WQ4 A;  2P9N B;  4IOC L;  4BGA A;  4O0I A;  1HNW K;  2OCE A;  1R59 O;  4IOX A;  3GG4 A;  4CZK A;  3CF5 L;  5HL7 L;  3ZEU B;  3THW A;  4LF9 K;  1QHT A;  3SV4 A;  3J80 O;  2P9K B;  3VEV A;  3BF1 A;  4YOW A;  1NJZ A;  5AQY A;  2PBD A;  3BF3 A;  1Q18 A;  4PA1 A;  3SQ4 A;  1BO5 O;  2NZT A;  5AQN A;  5KRT A;  1JCF A;  3WXJ A;  4PY5 A;  2V7Y A;  4Z4G A;  3TPQ A;  5LMU K;  1KTQ A;  4JI3 K;  4BGB A;  1Z05 A;  4CZJ A;  3JYT A;  1YIT N;  1SAZ A;  4B1U B;  4YOY A;  2KTQ A;  5AQQ A;  2QEX N;  3OY9 A;  2YJE A;  2J4R A;  4OLB A;  3AAQ A;  5M1N A;  2ZGZ A;  1K8K A;  4FJJ A;  3R3L A;  3TAM A;  1RT3 A;  1ILY A;  3EO3 A;  3H3O B;  3L3U A;  1Q9X A;  4YOU A;  3NDK A;  4CF1 A;  3QBW A;  1DEJ A;  3QER A;  4KTQ A;  4JS4 A;  5FPE A;  4JN4 A;  1C0M A;  2KQ2 A;  5HP1 A;  4CEA A;  3RMC A;  2F4V K;  4J2E A;  4PL7 A;  4BRQ A;  5FPD A;  5LJW A;  2G8U A;  3P31 A;  2Q3S A;  4CJS A;  3OW2 M;  4CZL A;  3TAB A;  2QXL A;  2ZJQ L;  3SLC A;  4CZH A;  5AQS A;  4I9Q A;  1BA0 A;  4DR4 K;  4K8X A;  1W9H A;  4AIL C;  4CK3 A;  1HR0 K;  2B5J A;  4ISF A;  4KHQ A;  2B6A A;  3MXM A;  1ZBF A;  3E1Y A;  3TTD A;  3QNN A;  2OZS A;  4YOT A;  1DGK N;  1QSY A;  3MMV A;  3CM6 A;  3SV3 A;  3L4Q A;  3RSE A;  4IO9 L;  4FWR A;  4JI2 K;  2F8T A;  4FK2 A;  1FW6 A;  4O8K A;  2G8K A;  4FWL A;  3WUH A;  2IOC A;  5AZJ B;  3J7Y P;  3HOS A;  5M1F A;  4ZTJ A;  4ICL A;  4DLE A;  2F8S A;  2CGL A;  4A5A A;  2E1Y A;  3A2F A;  1C1A A;  3W0L A;  1C6V A;  4DTM A;  2AP1 A;  3HXM A;  2NRX A;  4BVO A;  3NH2 A;  3O9U A;  4JYA K;  3FLC O;  4MO4 A;  4RW7 A;  3OTO K;  3ALY A;  3WNG A;  3DMJ A;  3L2V A;  2G8W A;  3A5L C;  3NVM A;  3HTV A;  2GUI A;  4CZE A;  4EAH D;  4AF1 A;  1YTU A;  4IKF A;  4O5F A;  3LZI A;  4KHW A;  1IG8 A;  4FLV A;  1WSH A;  2Z1J A;  4A61 A;  3HT3 A;  4B9V A;  1XMQ K;  1BUP A;  1F21 A;  4ELV A;  1LW2 A;  4IZ9 A;  1JLE A;  4BRF A;  4B9N A;  5E41 A;  4DF8 A;  4HUF A;  2FSJ A;  3KWI A;  3QFP A;  1BA1 A;  1U6Z A;  4CJ7 A;  4CF2 A;  4ILH A;  1ZYQ A;  3E9L A;  5LJV A;  3I0S A;  1SV5 A;  1VQ6 N;  3MWT A;  4GY2 B;  3HYF A;  3QO9 A;  4AHS A;  4C23 A;  4YOX A;  4CFC A;  2DFH A;  3J7Z O;  1IKV A;  1KAY A;  3DLR A;  2IGI A;  1WAF A;  3Q7C A;  1QS4 A;  4E7K A;  1D9D A;  2YNG A;  3SUN A;  1RNH A;  2YJF A;  4DKW A;  4I7F A;  3VEY A;  1NK7 A;  2O8B A;  3WXI A;  4FM1 A;  3LAK A;  2RN2 A;  1RDC A;  2YI1 A;  2EWS A;  5M1K A;  4Z4F A;  4DUZ K;  1UOC A;  3ASM A;  4ID1 A;  1S72 N;  3CQ8 A;  3ZSO A;  2ZQB A;  3D2E A;  3C6U A;  4CD3 A;  1N5Y A;  4KHY A;  2WOM A;  4B9S A;  2IDO A;  3KK7 A;  5AQT A;  1ATN A;  2O8E B;  3ZT2 A;  1S9G A;  4LC9 B;  5FRO A;  5KPR A;  3VQ7 A;  1SL2 A;  1REV A;  4F8R A;  4FJ7 A;  5F2R A;  3MCP A;  4WFA L;  4JLH A;  5C24 A;  3CME N;  1CZB A;  3M6G A;  3VET A;  3LDQ A;  2ETJ A;  3QML A;  1X9J A;  3O8M A;  4FWM A;  1TK0 A;  1HJR A;  3AY9 A;  3BZC A;  4DTS A;  1XUP O;  4CHQ A;  3CJC A;  1RTH A;  4C8N A;  1GLF O;  2A1S A;  4EP4 A;  3F9K A;  1JLA A;  5AZI A;  3THV A;  4JV5 K;  2QTD A;  1WSF A;  3S3O A;  3EZ5 A;  4A62 A;  3O4W A;  3ZSV A;  2VCP A;  4N76 A;  2O8B B;  2GBZ A;  4FL9 A;  5C0Y A;  2GV9 A;  2YHB A;  1HQU A;  3BY5 A;  4FJL A;  4CI6 A;  4DQI A;  5GIP A;  4IWV A;  4RG8 A;  2V52 B;  3AA2 A;  4I2Q A;  4KB0 A;  3ULD A;  3PO4 A;  4KI6 A;  1VSK A;  4DV0 K;  4EZ9 A;  1CZA N;  3D2E B;  5KQ8 A;  2PZS A;  2YHX A;  4DHY A;  3VQ9 A;  4MDB A;  1TKD A;  2KZM A;  1BCO A;  4DFP A;  3H3N O;  3S9H A;  1YT3 A;  3LDP A;  3SUO A;  5BRF A;  3A5M C;  3KD1 E;  1YJ9 N;  1EX4 A;  1VSL A;  2I7N A;  5TKY A;  3LZJ A;  1YF5 L;  4RW8 A;  4IJA A;  5I3U A;  2NNW A;  2YNI A;  4E7I A;  5GIN A;  5AQG A;  3CC7 N;  1SL0 A;  4DUY K;  5C2F A;  3QEV A;  3OS0 A;  4IJN A;  3O9T A;  4DQR A;  3KHY A;  3AV9 A;  3EN9 A;  5AZI B;  3I8B A;  4BRG A;  4PQU A;  4BE2 A;  3HBT A;  2BH1 A;  1G99 A;  3DXM B;  1NLV A;  4GKJ K;  4DTP A;  2O8C A;  4XH1 A;  1BG3 A;  3TAR A;  2O8D A;  2D0B A;  4K8Z A;  1KVB A;  3V1O A;  3ZYY X;  3O3F A;  5HOO A;  3ZT0 A;  4C1N K;  4DR7 K;  2HHH K;  4Z4C A;  4DTX A;  4KFB A;  3OYG A;  5AQI A;  4YFU A;  4J2B A;  4CJP A;  3O9R A;  1EXQ A;  4DS5 A;  4WQ5 A;  1ZBL A;  3PLA A;  3VER A;  2O8F A;  1WUA A;  3LWL A;  5B8H A;  2XY5 A;  1KRP A;  4DR6 K;  4KO0 A;  3DLH A;  5F0X A;  1C0T A;  1A5W A;  3AVL A;  4FK0 A;  4ILJ A;  4YOR A;  4PL8 A;  1LAW A;  3CCL N;  1MU2 A;  1T03 A;  4CF0 A;  3P1G A;  3K58 A;  1I39 A;  1ESV A;  3AO1 A;  3CFR A;  5HLF A;  3GL1 A;  4BC2 A;  5FPM A;  2QW9 A;  1JLQ A;  2GWK A;  3BDP A;  2KKZ A;  3B8A X;  2Q0R A;  2D0A A;  5CZ1 A;  4BR0 A;  4LF4 K;  1R0A A;  4AM7 A;  1VSE A;  3PIO L;  5CE3 A;  2E5L K;  3DXK A;  4GV9 A;  4FJ8 A;  1WLJ A;  3QDK A;  1QQO A;  3OYC A;  1NKC A;  3C7N A;  3PSI A;  1QZ6 A;  2FXU A;  3CET A;  4R79 A;  4XIU A;  2O8D B;  3VTH A;  1IJJ A;  1J5E K;  4CE9 A;  2UXB K;  4E1J A;  4FM2 A;  1HYV A;  3I0R A;  4K42 A;  2F96 A;  2D0C A;  1VQL N;  3VEX A;  3K5L A;  4IO8 A;  1KVA A;  4OPA A;  5CR4 A;  3MN6 A;  2O8F B;  4DV2 K;  4B1V A;  4FJK A;  4LD0 A;  3E66 A;  3RRG A;  4CJL A;  2P9P A;  4GNI A;  3DAW A;  1SKS A;  5KGX A;  4CZG A;  4DG1 A;  1SL1 A;  3NH0 A;  3EKU A;  2HHT A;  3EYZ A;  4HHT A;  1N6Q A;  3LDO A;  4MDA A;  4M3T A;  3KLG A;  2AJQ A;  2HHU A;  5AQF A;  1CZ9 A;  3C65 A;  2DFE A;  4BR4 A;  4OLA A;  4PKI A;  4FPB A;  4B8A B;  3QBX A;  4DQP A;  4W5Q A;  2BUP A;  1GOB A;  2X6S A;  3SMP A;  1S5J A;  3QFU A;  5EX5 A;  3F5T A;  3M8P A;  1N34 K;  3DYA A;  4FYD A;  1S22 A;  1NK6 A;  4BWJ A;  3ZT4 A;  4DSJ A;  3C7N B;  2Q97 A;  1I3A A;  4DQS A;  1J53 A;  1VRU A;  2P9I A;  3MX5 A;  1V4S A;  5JVG L;  3VN5 A;  4BRC A;  4DFM A;  3FZM A;  3NFA A;  4H0Y B;  4E0D A;  3GE1 A;  1K8A O;  3FFI A;  3KLI A;  4IOA L;  4CGG A;  3RMD A;  4FO0 A;  1GLJ O;  1NOY A;  2GEL A;  1UWB A;  1RIL A;  2LSN A;  3LAL A;  2P9P B;  4HUE A;  3O9S A;  2GWJ A;  1JCG A;  4A57 A;  3DRP A;  3PX4 A;  4HTL A;  3KZB A;  3TAE A;  3L2R A;  2YNF A;  4Z4E A;  2F7T A;  2OPR A;  3SQ0 A;  1O1W A;  1ATR A;  3VQ4 A;  1D4X A;  1JXB A;  5GIO A;  3IAY A;  1QQN A;  4K43 A;  4NLB A;  3I8D A;  2FF3 B;  1DT9 A;  1S6Q A;  3C0B A;  3KJV A;  1XHZ A;  4BC4 A;  3WT0 A;  3VQE A;  2OPS A;  4LF7 K;  2A3Z A;  2IVN A;  1O13 A;  3BEX A;  2ZD1 A;  3QLH A;  1W0H A;  3SMS A;  1BHL A;  4PKH A;  4MFB A;  4GV3 A;  4BRP A;  3O3H A;  4KRF A;  3MN5 A;  2RPI A;  1QQM A;  4ILG B;  1WSG A;  3NF6 A;  3L2U A;  4DV4 K;  3R6M A;  4J8F A;  3U9Z A;  4FWS A;  1E4F T;  3L4I A;  4QAG A;  3K5O A;  3LP2 A;  3UKU B;  3P39 A;  2EX3 A;  5GAG P;  3HP6 A;  4HTU A;  3TAG A;  3OYN A;  4OVL A;  3IDH A;  3IMX A;  1TKZ A;  5BR9 A;  2WTU A;  4B3R K;  3D45 A;  2OTL N;  1Q81 O;  2P5O A;  1NGC A;  2HF3 A;  5M1O A;  4E19 A;  1VSM A;  3IRX A;  4WQ4 C;  1T8E A;  4FW1 A;  1T3V A;  4JI8 K;  4PKG A;  3WEE B;  4M3U A;  2VQE K;  4AQY K;  4F9O A;  4RCH A;  5KQD A;  3CI5 A;  1SS6 A;  1IKX A;  3UKR A;  1E4G T;  1TAU A;  3OYH A;  3QB0 A;  1YHQ N;  2HHW A;  3LDN A;  1EO1 A;  2UUA K;  2Y1I A;  4C8O A;  1VRT A;  3QIN A;  4YY3 K;  2D4W A;  1FK9 A;  1YVU A;  2CGJ A;  2P9U A;  2NRW A;  4Z4I A;  1LW0 A;  1OKJ A;  3O1B A;  1NK9 A;  3VGL A;  3AVC A;  5DM7 L;  3UIQ A;  4FLZ A;  4EFH A;  1XWL A;  3T19 A;  4FWO A;  4FVU A;  3M3Z A;  1QSL A;  5FLX O;  4ISG A;  3VA0 A; 
#chains in the Genus database with same CATH homology
 2E5L K;  4DV0 K;  5IT9 O;  4NXN K;  1XNR K;  4B3M K;  4CW7 B;  2ZM6 K;  1N32 K;  4DR1 K;  3J81 O;  1J5E K;  4DR4 K;  4JI6 K;  4DV5 K;  1HR0 K;  4LF7 K;  4GKK K;  2UXB K;  4DV1 K;  2UXC K;  4X65 K;  4CVN E;  5BR8 K;  4X62 K;  4JI1 K;  1N36 K;  4DV2 K;  3T1Y K;  2UUB K;  4DR5 K;  4DV4 K;  4DUY K;  4JI2 K;  4LFB K;  2VQF K;  4DR2 K;  3J7Y P;  4DUZ K;  4LFC K;  2UU9 K;  2UUC K;  1HNW K;  2UXD K;  4B3R K;  4GKJ K;  4JI0 K;  4LF9 K;  3T1H K;  3J80 O;  4JI7 K;  4LFA K;  4KHP K;  1I94 K;  4JYA K;  1FJG K;  3OTO K;  4DR7 K;  4JI5 K;  4JI8 K;  5IWA K;  2HHH K;  4V19 S;  1IBM K;  4K0K K;  2VQE K;  1N34 K;  1XMO K;  4AQY K;  5A2Q O;  3J7A P;  4LF6 K;  4X66 K;  5LMU K;  4X64 K;  5LMN K;  4JI3 K;  4JI4 K;  4B3S K;  4LF8 K;  4DR6 K;  4DV6 K;  1XMQ K;  2UUA K;  4OX9 K;  4YY3 K;  5AJ3 K;  3JAM O;  1N33 K;  4YHH K;  4JV5 K;  1IBL K;  4DV3 K;  5LL6 Z;  4LF5 K;  1HNZ K;  4B3T K;  4DR3 K;  1XNQ K;  4LF4 K;  4DV7 K;  2F4V K;  5FLX O;  1HNX K;  1IBK K;  4NXM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...