2UU9K

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uu9K00
1N32K 4V19S 2UUCK 1XNQK 4YY3K 2UXCK 2F4VK 1HNWK 3J80O 5IT9O 4DV2K 2VQEK 4OX9K 5IWAK 4DR7K 1N36K 5LL6Z 4DR3K 4K0KK 2UUAK 4JI0K 3J7AP 5A2QO 3T1YK 4JI4K 4LFAK 4DV4K 5AJ3K 4DV7K 1HNXK 4JI8K 4CVNE 3J81O 5LMUK 4DR2K 1I94K 5LMNK 4KHPK 5BR8K 2UXBK 1XNRK 1N33K 1IBLK 4YHHK 1HNZK 4AQYK 4DR4K 1IBKK 4NXNK 4JI2K 4B3MK 4LF7K 3T1HK 4DUZK 4X62K 4NXMK 4DR5K 4LFBK 4DV6K 2E5LK 3JAMO 4DUYK 1XMOK 5FLXO 4JI1K 2UUBK 1N34K 4GKKK 1XMQK 4JV5K 1J5EK 4DV1K 4X64K 2ZM6K 4LFCK 4LF5K 4X65K 4JI6K 4B3RK 4JYAK 4LF8K 1IBMK 4DV5K 4DV3K 4LF6K 4JI7K 3OTOK 4DR6K 2UXDK 4X66K 2VQFK 4B3TK 4JI5K 4LF9K 1HR0K 4GKJK 4DR1K 2HHHK 4B3SK 4LF4K 3J7YP 4JI3K 1FJGK 2UU9K 4DV0K 4CW7B
chains in the Genus database with same CATH superfamily
4I2QA 2HHQA 2OPRA 4OKKA 5HL7L 1XNQK 2WBNA 4CJEA 3TARA 4XH1A 1RTIA 5BRDA 3AO4A 3AVBA 2O8DB 3KLGA 2YJEA 3U8XA 3H46O 1NJZA 2UUAK 3OS0A 3D0PA 3J7AP 1SUQA 2O8EA 3CYMA 3KKSA 5AQFA 4JI4K 5KQDA 4AILC 3H1VX 1HX1A 3VESA 3W3DA 2A42A 1VQON 3KLIA 1UA0A 1NMNA 3I8DA 4MO4A 2UXBK 2QM1A 4RW6A 2QI2A 2F8SA 1RILA 4OKJA 3BY5A 4CJFA 4CCHA 1KAXA 1VK0A 3SUPA 1LW2A 3EE8A 4IWVA 4DR4K 1IBKK 1W7AA 4B9MA 1EWRA 1OH6A 2Q2RA 4FJNA 4YOWA 1TKXA 2RN2A 4JS5A 4UY8O 4BR2A 3HTVA 4CGDA 3ID8A 3OVNA 4H5VA 1WNSA 1BCMA 4IFVA 3WQUA 4KBOA 1DTTA 1YJWN 4IFYA 4W5QA 4FJLA 1ZBLA 4B08A 2ZGZA 3O3GA 5JICA 3OJUA 3NCIA 1VQKN 2AA4A 4QAGA 3E66A 4FPBA 4CBUA 4N41A 1VQ6N 3NH0A 2PFUA 2YHAA 1IJJA 3T69A 5C15A 4M3XA 2IVOA 4DFPA 4KTZA 1YVUA 4DTMA 4ELVA 4E1NA 3FFKB 3C6AA 2YV0X 1KCFA 4GW6A 4PKGA 5FRMA 1IH7A 1BIZA 4OPAA 3ZSQA 4CJ4A 3DYAA 5AQVA 5DM6L 3O9UA 5GIOA 5CYQA 4FM1A 3THVA 2QEXN 3FZKA 2HHTA 4HWIA 4CD3A 3CG7A 2ASOA 3VEXA 2E1YA 1TL1A 3SCXA 2ZJPL 4CEDA 3L2WA 2F4VK 4FK0A 3LANA 5AZIB 4K8XA 4DS5A 4DFMA 1JL1A 2Y1IA 3U9DA 3CHWA 2QWOA 3OS2A 1X9MA 3K9JA 4OVLA 3MXMA 1CZBA 3CMEN 4NLCA 1RNHA 2BANA 2QTDA 5J1EA 4KI4A 1UOCA 5EX5A 1WSIA 3E01A 3DOKA 3AO3A 5AQPA 4EIAA 4ZHRA 3HI0A 3K59A 5LMNK 1Z25A 1JCEA 4M45A 1VRUA 1VSEA 3PSFA 2FBXA 4HUGA 1HRHA 1E4FT 3SJJA 4PWDA 2FBYA 3DJCA 2G8VA 4DU1A 3OYEA 1G99A 4BRNA 2HSTA 5BN9A 1YUWA 4J2EA 1TUUA 3BZKA 3JXUA 4NYFA 1XI1A 1JLQA 1BDGA 3CIPA 1NLVA 2P9PB 2NLXA 4M3ZA 3QEPA 1GLJO 4C8LA 4HTUA 3CD6N 5EVZA 4FWOA 4LFCK 1S6QA 2IAJA 4J8FA 5K14A 2YNGA 1C0UA 1RT7A 3ZX2A 1NJYA 1IBMK 1JJ2M 3L2QA 4B1YB 2YKMA 3A5NC 4DQ8A 1TGOA 3MAQA 1RT3A 3O08A 4B1ZA 3G6EN 1M1KO 1MA9B 3T1AA 1V4TA 1O1WA 3MX5A 4XH5A 4DLEA 3FZLA 4Q0BA 3O8MA 4Z4EA 3NBPA 1T8EA 2UU9K 4RCHA 5HRSA 1BISA 4DMNA 4C1NK 4HCCA 3QETA 2P9SB 3UKRA 3LDPA 3VPZA 3ZETB 2P9UB 1W2BM 2UXCK 2ZD1A 3QEWA 3TWHA 3ULEA 5AQZA 4JKGB 2HHXA 3ZSOA 4R5PA 2D4WA 3QICA 1TUYA 3P31A 4JI0K 4BC5A 4E7LA 2P9NA 3P1GA 2QWQA 3C6TA 5BR9A 1IG9A 1Q81O 3SLCA 3VQAA 4JKCA 5CY4A 4CF1A 2OPQA 2VG5A 3VQ7A 3LAKA 3QMLA 3UKUB 5LMUK 3Q7BA 2NRRA 5TKWA 3CQ8A 3NAEA 3RMDA 1BHLA 2P1JA 4CF9A 4JS4A 3ATVA 4BR0A 4N47A 1ASWA 1KAZA 4BC2A 3P83D 5AQNA 3RMCA 4RWTA 3JS6A 2BTFA 4CESA 1QSLA 4IG3A 2E5LK 4CEOA 3JAMO 4I9QA 1WUAA 2NRHA 1NBWA 3G0ZA 3K5OA 1GLEG 3VEWA 3B8AX 4DF4A 4YOXA 2HVIA 2NRZA 4IXCA 3OA9A 4M3WA 2GEMA 1SL0A 4JI6K 4JYAK 3QEXA 5M1PA 1VHXA 3LZIA 2G8KA 3SQ1A 4N56A 1TK5A 3CJAA 1JLFA 5GAHP 2PYLA 1YJ9N 3EE9A 1X3NA 5AFUH 1RBUA 2ZJQL 4MFBA 2HMPA 1S9GA 3V1OA 3J7ZO 4YOTA 3O9QA 2YI1A 1HKBA 3LPTA 4AF1A 3CCQN 2HOEA 3OBWA 4XEIA 2ZF5O 5AQIA 3AGKA 5BRFA 4CJPA 3ZSZA 1OH8A 3BGRA 1SS6A 3D45A 4CK2A 4OGEA 1VQPN 2Q31A 3CQXA 1KSPA 5SWMA 2P9LB 2VG7A 1Z6RA 5H1SQ 4CJSA 4WCEL 3E9PA 3FZFA 1ZBHA 3AVMA 1JLCA 3ASMA 3OYNA 3PV8A 4E7IA 5E41A 1GLBG 1S22A 3AVNA 3DM2A 1KLMA 3M8QA 3J81O 4JHDB 4FWRA 4O5BA 2E2QA 1NKCA 1J5OA 1WOQA 2ASMA 3ENOA 1WBDA 1KTQA 4CBWA 1ZBFA 2D0PA 5BRHA 5GADP 4F3TA 3QERA 3KD5E 1GLCG 1EX4A 4JI2K 4DSLA 3T1HK 2V51B 4WYBA 4A5BA 3TABA 2R7YA 2XY7A 3M6GA 1VSFA 2IDOA 1XHZA 1NGEA 1DTQA 3TAPA 2OZSA 2P9SA 4BWJA 3CM6A 2X74A 4OKEA 4PL8A 2FF3B 2O8BA 4E89A 1S1TA 3CCEN 4AM6A 2GUPA 1ZBSA 4RW9A 4CHYA 3RMBA 1NK6A 3O3FA 5M1KA 1BCOA 1LV5A 1ATRA 2D0CA 4DQIA 3NMUA 3WXMB 5CR4A 4DR6K 1GOBA 3KJVA 4O4GA 3VQDA 1MU2A 3SBGA 3HK2A 3IMXA 1R59O 4AHCA 4G1QA 2HHHK 5ADXH 5CZ2A 1NKEA 4CEFA 2DTUA 2YHXA 3HP9A 3VOVA 4N76A 5KRSA 3GDQA 1OH5A 4DV0K 1NK9A 4WFAL 4IJNA 3DWLA 3L2VA 4O0JA 3DXMA 2HMIA 2UUCK 3CF5L 1NG9A 2A5XA 4CIFA 3PO5A 1QQCA 1QQMA 2Q3SA 3ALYA 3F5TA 1P8ZA 5DMRA 4YNQA 3OS1A 1NK8A 4DV2K 5IWAK 2B6AA 3AVGA 1HYSA 1QHAA 4DR3K 1LAVA 1CZ9A 4ISFA 4DCHA 2P9LA 3VEZA 2HHSA 1J53A 3AVCA 4CGJA 2WONA 1M90O 3ID6A 4DV4K 2FF6A 1L3UA 5AJ3K 1U4BA 1K8KA 3ZX3A 4KB1A 1VRTA 4FWMA 2E2NA 1NOZA 3ZEUA 4E7HA 3NHGA 4BVPA 3C6UA 1YT3A 4RW8A 3TPQA 1EKEA 1HNVA 4O0IA 1E4GT 5KQ8A 3TAQA 4CEAA 4CJRA 4OPKA 1YJNN 3BP8A 1E3MA 2A41A 1GOCA 1U6ZA 4BQZA 3THYA 3ZLJA 4DSJA 3KKRA 4DR5K 3DMJA 4BDPA 1BG3A 4K42A 4FJ5A 3SUOA 5KGWA 1K8AO 4H4OA 3O80A 4YOUA 3EKSA 3EY1A 5FDLA 4BRFA 1S3XA 4JHDA 1T44A 3S3OA 3F73A 3KHYA 4CIGA 1RDWX 3AY9A 2NRXA 3D6RA 3UKUA 3LALA 2HBMA 1HQUA 5TKYA 3LWLA 5M1FA 4E0DA 3IAYA 1XHXA 4KPYA 2VGMA 5C12A 1JXEA 5KRTA 3H45C 3OYHA 4H0VB 1Y64A 2CH6A 3L3VA 1NNEA 3VF2A 4B9NA 3LL3A 1OVYA 4M7YA 4BRIA 1RT1A 5AQRA 4EAHD 4UQGA 2Z1IA 2CH5A 1NGCA 3R9PA 4E1MA 3HYFA 3CERA 4FWKA 1DKGD 2VWBA 3MCPA 3A0IX 3HT3A 3FFIA 1DGKN 2HBLA 2QWLA 4ZTFA 1KRPA 3PO4A 3SBTA 1X9SA 3C7NA 3KVGA 3ZSRA 5I3UA 3L4QA 5J2NA 2KW4A 2PYJA 3K5MA 2FSJA 3DXKA 4DTJA 3VGLA 5EXWA 1VSJA 3VQ5A 4ILHA 1JXBA 2VWKA 4JKFA 1G15A 4ISEA 2P5OA 3MK6A 3O4NA 4JEPA 2YHBA 2X6SA 3GG4A 3OY9A 3OYMA 3CPEA 4NLBA 3F9MA 3OYCA 4DHYA 3QDKA 1KFDA 3WXJA 2P9PA 3VEVA 1IBLK 1KD1O 3N4PA 4BG8A 4IDHA 1W0HA 1LOTB 4KV8A 2QWNA 1U49A 2UYTA 2HB5A 3A5LC 5M1NA 2X78A 4GNIA 5HOOA 3K58A 4DTRA 1KQSM 4FLYA 1Q82O 1LAWA 5CZ1A 1YF5L 3BDPA 4B9SA 5KPRA 3M8SA 1LWEA 3UB5A 1HLUA 3MWTA 3A5MC 1P90A 4LH4A 1L3SA 1CXQA 3KIOA 2NRWA 3FGUA 3HBTA 4KH5A 4LSLA 3LP3A 1WBBA 1W97L 4DTOA 4LF5K 4JKAA 4X65K 4R79A 1ESVA 1T7PA 3AVLA 1ZBIA 3OYJA 3NGZA 1NWKA 4JKHA 4ICLA 4B3TK 4H5NA 3ZSVA 4JI5K 2E1ZA 4YFUA 4FOIA 4MO5A 3ZT0A 4CF2A 4FJ9A 3EL2A 1IKYA 4JKGA 4Y1CA 3KWIA 3WNFA 4B9QA 4BRKA 3OYDA 4BE0A 2OZMA 1BGXT 2V52B 4E7JA 3KD1E 2ZQBA 3DRPA 2ATQA 5LY3A 1HYVA 2O4GA 3LM2A 4OJRA 3J80O 5BPLA 3W0LA 3AVFA 1X9JA 4BR4A 2QKKA 4O55A 4DFJA 3H3NO 3WNHA 1RT2A 3MX2A 3KWGA 4JD2B 1WB9A 4KHQA 4BROA 2VYPA 3RWUA 1RTDA 3O1WA 2ZGYA 3VMFB 3T19A 5M1OA 3OYKA 1N33K 4CZMA 2W42A 3MEEA 4NYNA 3G71N 4CZJA 4YOYA 3SV3A 4MQ3A 1SL1A 4IJAA 4PA1A 4NXMK 1BUPA 3S3NA 3DAWA 1U47A 2NNWA 1C0MA 4M41A 2Z1JA 1TVRA 1QZ5A 5AQSA 5JMVA 3NH2A 4HTLA 4WQ4A 1UA1A 2YCHA 4H0PA 2IOCA 1ZBUA 3CJ9A 3WUHA 1JLGA 1CXUA 4RG8A 2DFEA 2XRIA 3PY8A 4K8ZA 4X64K 3QFUA 1U48A 3C7NB 4BRPA 4IFEA 4DV5K 3AA4A 3P5JA 5AQOA 3QBWA 4JD2A 1QQOA 4JK9A 4NB4A 1VSHA 1KLNA 5HP1A 4XH4A 2HNDA 2LSNA 1QZ6A 2HW3A 4JI3K 1RBSA 3DOLA 4BVOA 3KK3A 1BA1A 1IG8A 4DTUA 5AR0A 3THXA 3TANA 2O8FB 1K6YA 2XY8A 2P9KA 4QS8A 4B9TA 4EZ9A 1FKPA 1N32K 1VSKA 4BGBA 4GMJB 2HNYA 4BRGA 3SK3A 3IRXA 3MN6A 1OKJA 1VQ7N 4KTQA 1YITN 4GV6A 1HPMA 4PHTX 1BI4A 4CZHA 2F9WA 3MN9A 2EWSA 3HXMA 4B9LA 4NCGA 4W5NA 1BO5O 1QVFM 1TKTA 2CGJA 4BR7A 3NF6A 5AQQA 1B92A 2DPNA 3IS9A 3EEQA 3CCUN 4CHPA 4FYDA 5AQKA 1NMDA 3OYFA 5J2MA 2VGNA 2JLEA 4JK7A 2BDPA 1WSJA 3P4IA 4U7BA 3A2FA 1FW6A 4CJQA 2ZE2A 3C94A 3NDKA 4CE9A 4DS4A 4EHUA 5DM7L 3OYGA 4RW7A 4LFBK 2WTUA 1ATNA 3CFPA 4GY2B 4Z94A 3HM9A 3HPOA 5EOYA 3TU5A 1YAGA 1S72N 2PY5A 1K8KB 3NVKA 3VTIA 3ULEB 3VENA 1NU0A 1TAQA 3FLCO 1HUXA 3TR8A 1NK0A 1BOTO 4B8CA 3F9KA 4LF9K 4KHYA 3HPGA 4JN4A 3TTCA 4DSEA 3GOIA 1SKWA 2O8CB 2GX9A 3RSEB 4BR5A 4OPJA 4E19A 4DTXA 3H1QA 1KVBA 1VQ5N 2V7ZA 1BIUA 3BF3A 4LSNA 4O8UA 3NE6A 4FZXC 3E9LA 3V9XA 4KHSA 1WAFA 4XIUA 3V81A 4FWNA 2F7TA 3RVCA 4C8KA 4IO9L 3NF9A 1S1XA 4PUOA 2E2OA 1ILYA 2GV9A 1C1AA 3VGKA 3NF8A 2HF4A 1RTJA 3AVAA 4W5RA 3H6EA 3PIOL 2F9TA 1QS4A 2Z1GA 2W41A 1W9HA 5AQJA 3BEXA 4RW4A 3VGMA 4ELUA 4CFBA 3OHRA 4C8MA 3NFAA 5KGXA 3CC2N 3NGYA 3T1YK 3VF6A 1JCGA 1NK7A 2AP1A 1YXQA 5FPEA 1RBRA 1HNXK 4MDAA 2RHKA 4A2BA 2A1RA 5EY4A 4DTPA 3ZX0A 5LJVA 1BI4B 3SUNA 3CC7N 2KFNA 4LY7A 1R0AA 4QS7A 3TTDA 4M3TA 4H4MA 3JSMA 4CJLA 1MWMA 3UKRB 1U2VA 5SZTA 4WFBL 1JKHA 2P9KB 1C1CA 4DV6K 4ELTA 3EYZA 1D8YA 2FBVA 1J54A 3F2KA 3V9WA 3DLHA 3V1RA 4EHTA 4DTSA 4JNEA 1L5UA 1L3VA 2HHUA 3O5BA 1S9EA 1D9DA 1ASVA 1YVNA 2YHYA 3SMPA 4M42A 5AQLA 2FXUA 3ZT2A 1WSHA 4B3RK 1S5JA 3VQ6A 4KH6A 3OTOK 4WF9L 2O4IA 4AHRA 3DRSA 3ZCMA 1TKZA 4M7XA 1S1WA 5AQGA 4C1NI 5JVHL 1QSYA 2BE2A 5AQHA 2XY5A 1NK5A 4I6MA 5I9EB 3LZJA 2D5RA 3K9KA 1FKOA 1SV5A 5GINA 4E7KA 4O5FA 3DLBA 5JVGL 2JWLA 1ASUA 2Q0UA 3RSEA 4OLBA 3KK2A 2NRVA 3AO1A 5DK5A 2OA8A 1HJOA 2VQEK 4DR7K 1KVAA 4KFBA 4CF8A 2GWKA 4IG0A 3ULDA 5CE3A 4K0KK 1XC9A 3TI0A 3THWB 4IOAL 4FJKA 4MLEA 5A2QO 3LP2A 5FPNA 4W5OA 3MN7A 3CJ1A 3H3OB 4LFAK 4MDBA 3HOSA 4HCBA 4KHWA 4FJHA 1TV6A 4I2PA 2O8DA 4CZKA 3AGRA 2Y1JA 5HRRA 2YJFA 4A61A 3AARA 4IZ9A 4CJ7A 3ZYYX 3IG1A 3MXIA 5AQWA 2DY4A 2KQ2A 3BUZB 1BA0A 2W6LA 3ZSYA 1NGJA 2Q36A 3AO5A 3H08A 4F2RA 3I55N 4NXNK 3RR8A 3L2UA 2QWMA 1SKRA 2E4LA 3K5LA 4DUZK 3TSPA 1GLLO 2YHWA 2AJQA 1HKCA 2RPIA 4ILJA 3KK7A 1QVGM 2G8UA 4CHNA 3VA0A 3CI5A 3KLHA 3V9UA 1XMOK 3I33A 3LP1A 5LJWA 3VERA 1N34K 1Q9XA 4HUEA 4FW2A 1I39A 1J9AA 1YTAA 5C10A 1J5EK 4BE2A 1VQ8N 1GOAA 4CEZA 3O9SA 2CGKA 1MDUB 2WUSA 4PQUA 3OYLA 5F0XA 3DLRA 3L0QA 5JS1A 5B8HA 1EETA 2A40A 4BDYA 2E8AA 2IVNA 3U3GA 3ISNC 4DSFA 1RFQA 1N8RO 3DLGA 2VQFK 1CZAN 1N6QA 1HR0K 3EN9A 1EP4A 2Q1NA 4BRAA 5AQXA 4DB3A 3I56N 3WXKA 3J7YP 4LF4K 1I3AA 1GLFO 3LWMA 3L2RA 3AVKA 3DLEA 1QHTA 1A5WA 2KZMA 5C24A 5FPMA 3ZT4A 1VAZA 4FJGA 4LH5A 3HJFA 4QOZB 4Y0WA 4K41A 1VQNN 3PSIA 3M1FA 2G8IA 4DQRA 3GE1A 3A5OC 4YORA 1QSSA 5HRNA 3QEIA 4CHOA 4CZGA 2GELA 4DQQA 1NGAA 1UWBA 3R6MA 2OCEA 1Q9YA 1J6ZA 3KTQA 3CCLN 1SL2A 1RDUA 3TSUA 4ID5A 3THWA 4F2SA 2GWJA 3TAMA 4M63C 1MWKA 4JK8A 1RDBA 4H03B 4AHTA 4FWPA 4BG9A 5J2QA 1S6PA 4B9UA 3IFRA 3NH1A 4KHPK 5BR8K 4H0TB 1KAYA 1IKWA 3UE5A 5FROA 4CJ5A 1KC8O 2D0AA 1HNZK 1B9FA 3QO9A 4CZIA 3RR7A 5HBMA 3L8BA 4IEIA 4B9VA 4WQ5C 2E2PA 3D2EA 2G8HA 2D1KA 4J2AA 5AQYA 3U4LA 1NGBA 2HBKA 1RT4A 2E20A 4BRQA 2G8FA 3MCAB 3CPWM 4NCAA 3OYAA 3O4QA 4JI1K 2VCPA 4IOCL 2QK9A 1HPZA 4BWMA 1XMQK 2KZZA 3LPUA 4BR9A 1X3MA 4AHUA 3L6QA 3V9ZA 2ITMA 5CHIA 2P9NB 1SQKA 3M8PA 2WOMA 1BWFO 4A59A 3CQYA 2FLOA 4IKFA 1Q8IA 3HZ6A 3U3YA 4OO1J 2Q97A 4AH9A 3QIOA 3VF4A 1RTHA 1NOYA 3AA3A 4FXDA 4EP4A 3OBYA 2WFBA 2CGLA 3ENHA 1TL3A 3CCSN 4CZFA 1VSIA 3S9HA 3GBTA 3OJSA 1JL2A 3SQ0A 3OW2M 3VEOA 1K9MO 1NKBA 2X6NA 2HHWA 3V9SA 1C0FA 3PX4A 2EHGA 3SQ2A 3RRHA 2OYQA 2IGIA 2ETJA 4GVMA 3WQTA 1HQEA 4CFAA 4GV3A 3D2FB 1XWLA 3I8BA 4J2DA 3AVHA 3UIQA 4DQPA 3RTVA 4FK2A 2HNZA 2IS3A 1BU6O 1YHQN 4CJUA 3CC4N 1O13A 2QW9A 1FXXA 3TAFA 4JKEA 5C0YA 3VEYA 4G9ZA 4CJVA 3THYB 1I94K 1EO1A 2I7NA 4CBXA 2GUIA 3WEEA 3IKMA 1C6VA 4LC9B 2OPPA 4U67L 3P39A 4F9OA 1ZYQA 5KPTA 4KAZA 3A8YA 4FOEA 3C0BA 2BUPA 2XY6A 3EZWA 4JKBA 4H5TA 4BC4A 2HHVA 5BN8A 4B1UB 1RDAA 1TK8A 1C0GA 2J4RA 4FLXA 1F21A 1WAJA 4K43A 4DWIA 1ZXOA 1QTMA 5T7BA 2FBTA 4GV9A 2FC0A 1LCUA 3B6PA 3LDSA 4W5TA 4FWQA 3VQBA 3CFRA 3S3MA 3NF7A 1C0TA 5BPMA 3QFPA 3CFOA 4H5RA 1TK0A 1QE1A 3R1XA 2O8EB 4LF6K 4DSKA 4JI7K 1X9WA 3Q7CA 3LDLA 2G8WA 4CK3A 4B1VA 4WQ5A 2IIRA 4KREA 3HM8A 2F8TA 2OANA 3HOTA 3SI6A 1BL3A 4EZ6A 1XQSC 2KKZA 3VQQA 4Y1DA 4FLTA 1NGGA 3R3LA 4OLAA 3VQEA 3O4WA 3VETA 5KTQA 1ITGA 3TSQA 2XO7A 3VQPA 4DQSA 2I5JA 3U6FA 4FLZA 1HNWK 4FJIA 1D4XA 3L3UA 4JAXA 3ZT1A 3ITHA 4OX9K 4IEEA 4F4KA 3SQ4A 1HNIA 3HSCA 3RRGA 2O8BB 5CYMA 4FVMA 3K5NA 2P9UA 4FWSA 4BRLA 4FZYA 4KTWA 5AFUA 4BACA 1T05A 4C8NA 4H0YB 4DF8A 4CGGA 4H5WA 5FRNA 2P51A 5GIPA 3ZT3A 4Z4HA 3ENBA 3WT0A 1Q18A 4CEBA 2KFZA 2NZTA 3VQ4A 4CGIA 3CETA 2RKIA 3DRRA 2EX3A 2DFHA 2V7YA 5HROA 3D7EO 1REVA 3D2EB 3GL1A 1NGHA 2FSKA 3AO2A 4PY5A 4E1JA 2QXFA 2O8CA 4CECA 4FM0A 2IVPA 4FVUA 1YI2N 3VA3A 3R8EA 3L4IA 4K25A 3I0RA 3HSTB 1DLOA 4KHUA 4PKHA 4F8RA 4CJTA 4AHVA 2HF3A 3SAFA 1LWFA 4CGFA 2A3ZA 4DV1K 3WNGA 1HJRA 1NM1A 5AQMA 4ISGA 4IO8A 4A5AA 4BRMA 5D3GA 3B6OA 3SMSA 2F96A 3TTFA 2W6KA 3K2PA 5JLFA 1T03A 5EU7A 2E88A 4HVJA 3G10A 2BH1A 4GKJK 4A2AA 5FPDA 1LWCA 4CF0A 3PLAA 1SKSA 2PZSA 4FSVA 2QXLA 4F3OA 3LDQA 1JCFA 5JLHA 3J8AA 3SAGA 3EO3A 4BQLA 2QKBA 4KI6A 3P38A 2GTDA 4CJ3A 1NJWA 2JWKA 2QWPA 3G4SN 3CJBA 1HMVA 4CIEA 3CM5A 5AZJA 4CI6A 3KK1A 5IT9O 4TSXA 2B5JA 4BRCA 3SNNA 1EQYA 1OH7A 4DKWA 2QA4N 3V1QA 1UAXA 2OPSA 4I9LA 4JKDA 5C42A 4I7FA 4RTFD 1WN7A 2A6AA 3SYZA 1EXQA 4DG1A 5E84A 1NGFA 2YNIA 4DU4A 5AZIA 2NRTA 1NGDA 4LD0A 4M3RA 4AHSA 4CD1A 4FJJA 4BE1A 3DLLL 1NGIA 1XNRK 5C25A 4CJWA 5GAGP 1RT6A 3MWPA 4KH4A 3LDNA 4FK4A 4FPAA 4M3UA 3HO1A 4B3MK 3O1BA 3O9TA 4FJ8A 4BRHA 3ZETA 2ASPA 3PX6A 2JGUA 5F2RA 1RBTA 4YDUC 3CCMN 4DLGA 1LW0A 4FJMA 4BGAA 1KVCA 5BPNA 2OTLN 4DUYK 5AQUA 4BC3A 2UUBK 4CZEA 3JYTA 3AVJA 1ZC6A 2P9IA 2A1SA 2WC9A 3OYBA 3PX0A 1GLDG 3SZ2A 1A5VA 2KLAA 4A62A 1Y97A 3TAGA 2H3GX 3HRGA 3DXKB 3K57A 1VSDA 2NUBA 4CJKA 3MEDA 3FZMA 3MDQA 4FJ7A 3MECA 4H8KA 2XHBA 4O8KA 4AM7A 1JLAA 3PUFA 4Z4FA 4HHTA 3CXCM 3CCJN 4DR1K 2P5GA 1NJXA 3AA5X 3CMAN 3HP6A 3FR0A 1NJIO 1X1PA 1VQ4N 5HRPA 4C23A 1DEJA 1L3TA 1BQNA 3CCVN 3LP0A 2Z1HA 4QS9A 1N5YA 3EZ5A 4I6MB 1EWQA 2IC3A 4FLUA 4CW7B 2D0OA 1S1VA 3ZSXA 4DU3A 3FE1A 1IKVA 2BGGA 4B8AB 4O44A 4QCLA 5F1XA 4JRQA 4FLVA 3C65A 1N36K 1XUPO 5LL6Z 3KLEA 3LM9A 5ADXA 3CJ7A 3SPYA 1SZ2A 3E9OA 1V4SA 4KHNA 3RMAA 1ATSA 1IV0A 1RGIA 2E6MA 3DLKA 4FLWA 5I42A 1TYQB 4DTNA 1RDDA 3CJCA 1VSLA 4CFDA 4IOXA 4KB0A 3LDOA 3FZHA 4JI8K 3EKUA 4FM2A 1BQMA 3PIPL 4CVNE 1T6DA 3SAHA 4DR2K 3WXIA 1FK9A 2E6LA 1B9DA 3D2FA 1VQ9N 4JLHA 4A57A 1TKDA 2QWRA 4AQYK 2RF2A 4CK1A 2HBJA 4C8OA 4LF7K 4CERA 4H0OA 1HKGA 4Z4GA 4X62K 1RCHA 2ZWHA 4ILGB 4WE1A 4CEEA 3NGIA 4PKIA 3M3ZA 4N5SA 4CZLA 3AA2A 5GAEP 3TAEA 4Z4CA 1WSFA 5FLXO 3T3FA 5JS2A 3QBXA 3C6HA 4WQ4C 5C2FA 1OVQA 5MLCQ 4GKKK 5M1QA 1Q7YO 1TYQA 5ELZA 4JRPA 1RBVA 3AAQA 4L3QA 4NO7A 3QIPA 2ZM6K 3CCRN 4LF8K 4OGCA 4CGHA 1RDCA 3HVTA 4YDUA 4CHQA 3QNOA 1U45A 1A5XA 3BZCA 1TAUA 1H1VA 4CEQA 1T3VA 4M3YA 5HLFA 1U2VB 1JLEA 4FW1A 5AZJB 4NCBA 1DT9A 4B3SK 5BREA 4Q5VA 3G25A 1XC3A 4OPHA 4ZTJA 1T6CA 1C1BA 1NK4A 1FJGK 3I0SA 2YNHA 3KLFA 2ITGA 4HUFA 3WXLA 1D5AA 4GVEA 2FSNA 1GLAG 1SAZA 3SPZA 4V19S 3M8RA 3NVMA 4B1XB 4YY3K 2D0BA 1KXPA 1YIJN 2YKNA 3KZBA 4EFHA 3ZEUB 3AVIA 3QB0A 3SV4A 2RE2A 3QESA 4KKOA 1RT5A 3LAMA 2W40A 3U9ZA 3VQ8A 4FO0A 2B4JA 3OYIA 3SUQA 4ID1A 1VSMA 4IBNA 4FWLA 4BY9C 4DSIA 1JLBA 2I7PA 4WFNL 3E1YA 1WSGA 2KTQA 4B1WB 2VG6A 2YNFA 2GBZA 3QLHA 2PAVA 3HVRA 2VWJA 4DV7K 3ZSWA 3V4IA 4E3SA 2ZJRL 3V6DA 5KI6A 2YX6A 3DXMB 1YTUA 1Z05A 4YHHK 1QQNA 5AQTA 5KPZA 1WLJA 1IKXA 2P9IB 4MLHA 3AV9A 3IUCA 3MMVA 3WNEA 1CLQA 3O9RA 4DFKA 2PBDA 5J2PA 2OTJN 1HYZA 3VTHA 1VQMN 1D9FA 3O6WA 3IDHA 3O3HA 3QINA 4Z0UA 3M5RA 4B3OA 3K0SA 2Q0RA 4FCYA 3WEEB 4YOVA 5E26A 2KHOA 1Q86O 3MEGA 4J2BA 3BF1A 4FJXA 1KFSA 4PL7A 4FL9A 4Z4IA 3T7ZA 3VQ9A 4KO0A 3C95A 3ATUA 4JV5K 1VQLN 4EP5A 2HVHA 5C2DA 1K73O 1S1UA 4H0XB 1U04A 1WSEA 3AAPA 4BREA 4DV3K 3MXJA 3N4QA 3VN5A 2UXDK 4X66K 3MN5A 3HPHA 4IDKA 4CHZA 4BDZA 3QNNA 4KRFA 1Z26A 3SJHA 4BRDA 4L8RB 3VQCA 4FZZA 3S41A 2DFFA 3HL8A 1IO2A 4CFCA 3THXB 2O8FA 3QEVA 3DI6A
chains in the Genus database with same CATH topology
1N32K 4V19S 2UUCK 1XNQK 4YY3K 2UXCK 2F4VK 1HNWK 3J80O 5IT9O 4DV2K 2VQEK 4OX9K 5IWAK 4DR7K 1N36K 5LL6Z 4DR3K 4K0KK 2UUAK 4JI0K 3J7AP 5A2QO 3T1YK 4JI4K 4LFAK 4DV4K 5AJ3K 4DV7K 1HNXK 4JI8K 4CVNE 3J81O 5LMUK 4DR2K 1I94K 5LMNK 4KHPK 5BR8K 2UXBK 1XNRK 1N33K 1IBLK 4YHHK 1HNZK 4AQYK 4DR4K 1IBKK 4NXNK 4JI2K 4B3MK 4LF7K 3T1HK 4DUZK 4X62K 4NXMK 4DR5K 4LFBK 4DV6K 2E5LK 3JAMO 4DUYK 1XMOK 5FLXO 4JI1K 2UUBK 1N34K 4GKKK 1XMQK 4JV5K 1J5EK 4DV1K 4X64K 2ZM6K 4LFCK 4LF5K 4X65K 4JI6K 4B3RK 4JYAK 4LF8K 1IBMK 4DV5K 4DV3K 4LF6K 4JI7K 3OTOK 4DR6K 2UXDK 4X66K 2VQFK 4B3TK 4JI5K 4LF9K 1HR0K 4GKJK 4DR1K 2HHHK 4B3SK 4LF4K 3J7YP 4JI3K 1FJGK 2UU9K 4DV0K 4CW7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 K;  4V19 S;  2UUC K;  1XNQ K;  4YY3 K;  2UXC K;  2F4V K;  1HNW K;  3J80 O;  5IT9 O;  4DV2 K;  2VQE K;  4OX9 K;  5IWA K;  4DR7 K;  1N36 K;  5LL6 Z;  4DR3 K;  4K0K K;  2UUA K;  4JI0 K;  3J7A P;  5A2Q O;  3T1Y K;  4JI4 K;  4LFA K;  4DV4 K;  5AJ3 K;  4DV7 K;  1HNX K;  4JI8 K;  4CVN E;  3J81 O;  5LMU K;  4DR2 K;  1I94 K;  5LMN K;  4KHP K;  5BR8 K;  2UXB K;  1XNR K;  1N33 K;  1IBL K;  4YHH K;  1HNZ K;  4AQY K;  4DR4 K;  1IBK K;  4NXN K;  4JI2 K;  4B3M K;  4LF7 K;  3T1H K;  4DUZ K;  4X62 K;  4NXM K;  4DR5 K;  4LFB K;  4DV6 K;  2E5L K;  3JAM O;  4DUY K;  1XMO K;  5FLX O;  4JI1 K;  2UUB K;  1N34 K;  4GKK K;  1XMQ K;  4JV5 K;  1J5E K;  4DV1 K;  4X64 K;  2ZM6 K;  4LFC K;  4LF5 K;  4X65 K;  4JI6 K;  4B3R K;  4JYA K;  4LF8 K;  1IBM K;  4DV5 K;  4DV3 K;  4LF6 K;  4JI7 K;  3OTO K;  4DR6 K;  2UXD K;  4X66 K;  2VQF K;  4B3T K;  4JI5 K;  4LF9 K;  1HR0 K;  4GKJ K;  4DR1 K;  2HHH K;  4B3S K;  4LF4 K;  3J7Y P;  4JI3 K;  1FJG K;  2UU9 K;  4DV0 K;  4CW7 B; 
#chains in the Genus database with same CATH topology
 4I2Q A;  2HHQ A;  2OPR A;  4OKK A;  5HL7 L;  1XNQ K;  2WBN A;  4CJE A;  3TAR A;  4XH1 A;  1RTI A;  5BRD A;  3AO4 A;  3AVB A;  2O8D B;  3KLG A;  2YJE A;  3U8X A;  3H46 O;  1NJZ A;  2UUA K;  3OS0 A;  3D0P A;  3J7A P;  1SUQ A;  2O8E A;  3CYM A;  3KKS A;  5AQF A;  4JI4 K;  5KQD A;  4AIL C;  3H1V X;  1HX1 A;  3VES A;  3W3D A;  2A42 A;  1VQO N;  3KLI A;  1UA0 A;  1NMN A;  3I8D A;  4MO4 A;  2UXB K;  2QM1 A;  4RW6 A;  2QI2 A;  2F8S A;  1RIL A;  4OKJ A;  3BY5 A;  4CJF A;  4CCH A;  1KAX A;  1VK0 A;  3SUP A;  1LW2 A;  3EE8 A;  4IWV A;  4DR4 K;  1IBK K;  1W7A A;  4B9M A;  1EWR A;  1OH6 A;  2Q2R A;  4FJN A;  4YOW A;  1TKX A;  2RN2 A;  4JS5 A;  4UY8 O;  4BR2 A;  3HTV A;  4CGD A;  3ID8 A;  3OVN A;  4H5V A;  1WNS A;  1BCM A;  4IFV A;  3WQU A;  4KBO A;  1DTT A;  1YJW N;  4IFY A;  4W5Q A;  4FJL A;  1ZBL A;  4B08 A;  2ZGZ A;  3O3G A;  5JIC A;  3OJU A;  3NCI A;  1VQK N;  2AA4 A;  4QAG A;  3E66 A;  4FPB A;  4CBU A;  4N41 A;  1VQ6 N;  3NH0 A;  2PFU A;  2YHA A;  1IJJ A;  3T69 A;  5C15 A;  4M3X A;  2IVO A;  4DFP A;  4KTZ A;  1YVU A;  4DTM A;  4ELV A;  4E1N A;  3FFK B;  3C6A A;  2YV0 X;  1KCF A;  4GW6 A;  4PKG A;  5FRM A;  1IH7 A;  1BIZ A;  4OPA A;  3ZSQ A;  4CJ4 A;  3DYA A;  5AQV A;  5DM6 L;  3O9U A;  5GIO A;  5CYQ A;  4FM1 A;  3THV A;  2QEX N;  3FZK A;  2HHT A;  4HWI A;  4CD3 A;  3CG7 A;  2ASO A;  3VEX A;  2E1Y A;  1TL1 A;  3SCX A;  2ZJP L;  4CED A;  3L2W A;  2F4V K;  4FK0 A;  3LAN A;  5AZI B;  4K8X A;  4DS5 A;  4DFM A;  1JL1 A;  2Y1I A;  3U9D A;  3CHW A;  2QWO A;  3OS2 A;  1X9M A;  3K9J A;  4OVL A;  3MXM A;  1CZB A;  3CME N;  4NLC A;  1RNH A;  2BAN A;  2QTD A;  5J1E A;  4KI4 A;  1UOC A;  5EX5 A;  1WSI A;  3E01 A;  3DOK A;  3AO3 A;  5AQP A;  4EIA A;  4ZHR A;  3HI0 A;  3K59 A;  5LMN K;  1Z25 A;  1JCE A;  4M45 A;  1VRU A;  1VSE A;  3PSF A;  2FBX A;  4HUG A;  1HRH A;  1E4F T;  3SJJ A;  4PWD A;  2FBY A;  3DJC A;  2G8V A;  4DU1 A;  3OYE A;  1G99 A;  4BRN A;  2HST A;  5BN9 A;  1YUW A;  4J2E A;  1TUU A;  3BZK A;  3JXU A;  4NYF A;  1XI1 A;  1JLQ A;  1BDG A;  3CIP A;  1NLV A;  2P9P B;  2NLX A;  4M3Z A;  3QEP A;  1GLJ O;  4C8L A;  4HTU A;  3CD6 N;  5EVZ A;  4FWO A;  4LFC K;  1S6Q A;  2IAJ A;  4J8F A;  5K14 A;  2YNG A;  1C0U A;  1RT7 A;  3ZX2 A;  1NJY A;  1IBM K;  1JJ2 M;  3L2Q A;  4B1Y B;  2YKM A;  3A5N C;  4DQ8 A;  1TGO A;  3MAQ A;  1RT3 A;  3O08 A;  4B1Z A;  3G6E N;  1M1K O;  1MA9 B;  3T1A A;  1V4T A;  1O1W A;  3MX5 A;  4XH5 A;  4DLE A;  3FZL A;  4Q0B A;  3O8M A;  4Z4E A;  3NBP A;  1T8E A;  2UU9 K;  4RCH A;  5HRS A;  1BIS A;  4DMN A;  4C1N K;  4HCC A;  3QET A;  2P9S B;  3UKR A;  3LDP A;  3VPZ A;  3ZET B;  2P9U B;  1W2B M;  2UXC K;  2ZD1 A;  3QEW A;  3TWH A;  3ULE A;  5AQZ A;  4JKG B;  2HHX A;  3ZSO A;  4R5P A;  2D4W A;  3QIC A;  1TUY A;  3P31 A;  4JI0 K;  4BC5 A;  4E7L A;  2P9N A;  3P1G A;  2QWQ A;  3C6T A;  5BR9 A;  1IG9 A;  1Q81 O;  3SLC A;  3VQA A;  4JKC A;  5CY4 A;  4CF1 A;  2OPQ A;  2VG5 A;  3VQ7 A;  3LAK A;  3QML A;  3UKU B;  5LMU K;  3Q7B A;  2NRR A;  5TKW A;  3CQ8 A;  3NAE A;  3RMD A;  1BHL A;  2P1J A;  4CF9 A;  4JS4 A;  3ATV A;  4BR0 A;  4N47 A;  1ASW A;  1KAZ A;  4BC2 A;  3P83 D;  5AQN A;  3RMC A;  4RWT A;  3JS6 A;  2BTF A;  4CES A;  1QSL A;  4IG3 A;  2E5L K;  4CEO A;  3JAM O;  4I9Q A;  1WUA A;  2NRH A;  1NBW A;  3G0Z A;  3K5O A;  1GLE G;  3VEW A;  3B8A X;  4DF4 A;  4YOX A;  2HVI A;  2NRZ A;  4IXC A;  3OA9 A;  4M3W A;  2GEM A;  1SL0 A;  4JI6 K;  4JYA K;  3QEX A;  5M1P A;  1VHX A;  3LZI A;  2G8K A;  3SQ1 A;  4N56 A;  1TK5 A;  3CJA A;  1JLF A;  5GAH P;  2PYL A;  1YJ9 N;  3EE9 A;  1X3N A;  5AFU H;  1RBU A;  2ZJQ L;  4MFB A;  2HMP A;  1S9G A;  3V1O A;  3J7Z O;  4YOT A;  3O9Q A;  2YI1 A;  1HKB A;  3LPT A;  4AF1 A;  3CCQ N;  2HOE A;  3OBW A;  4XEI A;  2ZF5 O;  5AQI A;  3AGK A;  5BRF A;  4CJP A;  3ZSZ A;  1OH8 A;  3BGR A;  1SS6 A;  3D45 A;  4CK2 A;  4OGE A;  1VQP N;  2Q31 A;  3CQX A;  1KSP A;  5SWM A;  2P9L B;  2VG7 A;  1Z6R A;  5H1S Q;  4CJS A;  4WCE L;  3E9P A;  3FZF A;  1ZBH A;  3AVM A;  1JLC A;  3ASM A;  3OYN A;  3PV8 A;  4E7I A;  5E41 A;  1GLB G;  1S22 A;  3AVN A;  3DM2 A;  1KLM A;  3M8Q A;  3J81 O;  4JHD B;  4FWR A;  4O5B A;  2E2Q A;  1NKC A;  1J5O A;  1WOQ A;  2ASM A;  3ENO A;  1WBD A;  1KTQ A;  4CBW A;  1ZBF A;  2D0P A;  5BRH A;  5GAD P;  4F3T A;  3QER A;  3KD5 E;  1GLC G;  1EX4 A;  4JI2 K;  4DSL A;  3T1H K;  2V51 B;  4WYB A;  4A5B A;  3TAB A;  2R7Y A;  2XY7 A;  3M6G A;  1VSF A;  2IDO A;  1XHZ A;  1NGE A;  1DTQ A;  3TAP A;  2OZS A;  2P9S A;  4BWJ A;  3CM6 A;  2X74 A;  4OKE A;  4PL8 A;  2FF3 B;  2O8B A;  4E89 A;  1S1T A;  3CCE N;  4AM6 A;  2GUP A;  1ZBS A;  4RW9 A;  4CHY A;  3RMB A;  1NK6 A;  3O3F A;  5M1K A;  1BCO A;  1LV5 A;  1ATR A;  2D0C A;  4DQI A;  3NMU A;  3WXM B;  5CR4 A;  4DR6 K;  1GOB A;  3KJV A;  4O4G A;  3VQD A;  1MU2 A;  3SBG A;  3HK2 A;  3IMX A;  1R59 O;  4AHC A;  4G1Q A;  2HHH K;  5ADX H;  5CZ2 A;  1NKE A;  4CEF A;  2DTU A;  2YHX A;  3HP9 A;  3VOV A;  4N76 A;  5KRS A;  3GDQ A;  1OH5 A;  4DV0 K;  1NK9 A;  4WFA L;  4IJN A;  3DWL A;  3L2V A;  4O0J A;  3DXM A;  2HMI A;  2UUC K;  3CF5 L;  1NG9 A;  2A5X A;  4CIF A;  3PO5 A;  1QQC A;  1QQM A;  2Q3S A;  3ALY A;  3F5T A;  1P8Z A;  5DMR A;  4YNQ A;  3OS1 A;  1NK8 A;  4DV2 K;  5IWA K;  2B6A A;  3AVG A;  1HYS A;  1QHA A;  4DR3 K;  1LAV A;  1CZ9 A;  4ISF A;  4DCH A;  2P9L A;  3VEZ A;  2HHS A;  1J53 A;  3AVC A;  4CGJ A;  2WON A;  1M90 O;  3ID6 A;  4DV4 K;  2FF6 A;  1L3U A;  5AJ3 K;  1U4B A;  1K8K A;  3ZX3 A;  4KB1 A;  1VRT A;  4FWM A;  2E2N A;  1NOZ A;  3ZEU A;  4E7H A;  3NHG A;  4BVP A;  3C6U A;  1YT3 A;  4RW8 A;  3TPQ A;  1EKE A;  1HNV A;  4O0I A;  1E4G T;  5KQ8 A;  3TAQ A;  4CEA A;  4CJR A;  4OPK A;  1YJN N;  3BP8 A;  1E3M A;  2A41 A;  1GOC A;  1U6Z A;  4BQZ A;  3THY A;  3ZLJ A;  4DSJ A;  3KKR A;  4DR5 K;  3DMJ A;  4BDP A;  1BG3 A;  4K42 A;  4FJ5 A;  3SUO A;  5KGW A;  1K8A O;  4H4O A;  3O80 A;  4YOU A;  3EKS A;  3EY1 A;  5FDL A;  4BRF A;  1S3X A;  4JHD A;  1T44 A;  3S3O A;  3F73 A;  3KHY A;  4CIG A;  1RDW X;  3AY9 A;  2NRX A;  3D6R A;  3UKU A;  3LAL A;  2HBM A;  1HQU A;  5TKY A;  3LWL A;  5M1F A;  4E0D A;  3IAY A;  1XHX A;  4KPY A;  2VGM A;  5C12 A;  1JXE A;  5KRT A;  3H45 C;  3OYH A;  4H0V B;  1Y64 A;  2CH6 A;  3L3V A;  1NNE A;  3VF2 A;  4B9N A;  3LL3 A;  1OVY A;  4M7Y A;  4BRI A;  1RT1 A;  5AQR A;  4EAH D;  4UQG A;  2Z1I A;  2CH5 A;  1NGC A;  3R9P A;  4E1M A;  3HYF A;  3CER A;  4FWK A;  1DKG D;  2VWB A;  3MCP A;  3A0I X;  3HT3 A;  3FFI A;  1DGK N;  2HBL A;  2QWL A;  4ZTF A;  1KRP A;  3PO4 A;  3SBT A;  1X9S A;  3C7N A;  3KVG A;  3ZSR A;  5I3U A;  3L4Q A;  5J2N A;  2KW4 A;  2PYJ A;  3K5M A;  2FSJ A;  3DXK A;  4DTJ A;  3VGL A;  5EXW A;  1VSJ A;  3VQ5 A;  4ILH A;  1JXB A;  2VWK A;  4JKF A;  1G15 A;  4ISE A;  2P5O A;  3MK6 A;  3O4N A;  4JEP A;  2YHB A;  2X6S A;  3GG4 A;  3OY9 A;  3OYM A;  3CPE A;  4NLB A;  3F9M A;  3OYC A;  4DHY A;  3QDK A;  1KFD A;  3WXJ A;  2P9P A;  3VEV A;  1IBL K;  1KD1 O;  3N4P A;  4BG8 A;  4IDH A;  1W0H A;  1LOT B;  4KV8 A;  2QWN A;  1U49 A;  2UYT A;  2HB5 A;  3A5L C;  5M1N A;  2X78 A;  4GNI A;  5HOO A;  3K58 A;  4DTR A;  1KQS M;  4FLY A;  1Q82 O;  1LAW A;  5CZ1 A;  1YF5 L;  3BDP A;  4B9S A;  5KPR A;  3M8S A;  1LWE A;  3UB5 A;  1HLU A;  3MWT A;  3A5M C;  1P90 A;  4LH4 A;  1L3S A;  1CXQ A;  3KIO A;  2NRW A;  3FGU A;  3HBT A;  4KH5 A;  4LSL A;  3LP3 A;  1WBB A;  1W97 L;  4DTO A;  4LF5 K;  4JKA A;  4X65 K;  4R79 A;  1ESV A;  1T7P A;  3AVL A;  1ZBI A;  3OYJ A;  3NGZ A;  1NWK A;  4JKH A;  4ICL A;  4B3T K;  4H5N A;  3ZSV A;  4JI5 K;  2E1Z A;  4YFU A;  4FOI A;  4MO5 A;  3ZT0 A;  4CF2 A;  4FJ9 A;  3EL2 A;  1IKY A;  4JKG A;  4Y1C A;  3KWI A;  3WNF A;  4B9Q A;  4BRK A;  3OYD A;  4BE0 A;  2OZM A;  1BGX T;  2V52 B;  4E7J A;  3KD1 E;  2ZQB A;  3DRP A;  2ATQ A;  5LY3 A;  1HYV A;  2O4G A;  3LM2 A;  4OJR A;  3J80 O;  5BPL A;  3W0L A;  3AVF A;  1X9J A;  4BR4 A;  2QKK A;  4O55 A;  4DFJ A;  3H3N O;  3WNH A;  1RT2 A;  3MX2 A;  3KWG A;  4JD2 B;  1WB9 A;  4KHQ A;  4BRO A;  2VYP A;  3RWU A;  1RTD A;  3O1W A;  2ZGY A;  3VMF B;  3T19 A;  5M1O A;  3OYK A;  1N33 K;  4CZM A;  2W42 A;  3MEE A;  4NYN A;  3G71 N;  4CZJ A;  4YOY A;  3SV3 A;  4MQ3 A;  1SL1 A;  4IJA A;  4PA1 A;  4NXM K;  1BUP A;  3S3N A;  3DAW A;  1U47 A;  2NNW A;  1C0M A;  4M41 A;  2Z1J A;  1TVR A;  1QZ5 A;  5AQS A;  5JMV A;  3NH2 A;  4HTL A;  4WQ4 A;  1UA1 A;  2YCH A;  4H0P A;  2IOC A;  1ZBU A;  3CJ9 A;  3WUH A;  1JLG A;  1CXU A;  4RG8 A;  2DFE A;  2XRI A;  3PY8 A;  4K8Z A;  4X64 K;  3QFU A;  1U48 A;  3C7N B;  4BRP A;  4IFE A;  4DV5 K;  3AA4 A;  3P5J A;  5AQO A;  3QBW A;  4JD2 A;  1QQO A;  4JK9 A;  4NB4 A;  1VSH A;  1KLN A;  5HP1 A;  4XH4 A;  2HND A;  2LSN A;  1QZ6 A;  2HW3 A;  4JI3 K;  1RBS A;  3DOL A;  4BVO A;  3KK3 A;  1BA1 A;  1IG8 A;  4DTU A;  5AR0 A;  3THX A;  3TAN A;  2O8F B;  1K6Y A;  2XY8 A;  2P9K A;  4QS8 A;  4B9T A;  4EZ9 A;  1FKP A;  1N32 K;  1VSK A;  4BGB A;  4GMJ B;  2HNY A;  4BRG A;  3SK3 A;  3IRX A;  3MN6 A;  1OKJ A;  1VQ7 N;  4KTQ A;  1YIT N;  4GV6 A;  1HPM A;  4PHT X;  1BI4 A;  4CZH A;  2F9W A;  3MN9 A;  2EWS A;  3HXM A;  4B9L A;  4NCG A;  4W5N A;  1BO5 O;  1QVF M;  1TKT A;  2CGJ A;  4BR7 A;  3NF6 A;  5AQQ A;  1B92 A;  2DPN A;  3IS9 A;  3EEQ A;  3CCU N;  4CHP A;  4FYD A;  5AQK A;  1NMD A;  3OYF A;  5J2M A;  2VGN A;  2JLE A;  4JK7 A;  2BDP A;  1WSJ A;  3P4I A;  4U7B A;  3A2F A;  1FW6 A;  4CJQ A;  2ZE2 A;  3C94 A;  3NDK A;  4CE9 A;  4DS4 A;  4EHU A;  5DM7 L;  3OYG A;  4RW7 A;  4LFB K;  2WTU A;  1ATN A;  3CFP A;  4GY2 B;  4Z94 A;  3HM9 A;  3HPO A;  5EOY A;  3TU5 A;  1YAG A;  1S72 N;  2PY5 A;  1K8K B;  3NVK A;  3VTI A;  3ULE B;  3VEN A;  1NU0 A;  1TAQ A;  3FLC O;  1HUX A;  3TR8 A;  1NK0 A;  1BOT O;  4B8C A;  3F9K A;  4LF9 K;  4KHY A;  3HPG A;  4JN4 A;  3TTC A;  4DSE A;  3GOI A;  1SKW A;  2O8C B;  2GX9 A;  3RSE B;  4BR5 A;  4OPJ A;  4E19 A;  4DTX A;  3H1Q A;  1KVB A;  1VQ5 N;  2V7Z A;  1BIU A;  3BF3 A;  4LSN A;  4O8U A;  3NE6 A;  4FZX C;  3E9L A;  3V9X A;  4KHS A;  1WAF A;  4XIU A;  3V81 A;  4FWN A;  2F7T A;  3RVC A;  4C8K A;  4IO9 L;  3NF9 A;  1S1X A;  4PUO A;  2E2O A;  1ILY A;  2GV9 A;  1C1A A;  3VGK A;  3NF8 A;  2HF4 A;  1RTJ A;  3AVA A;  4W5R A;  3H6E A;  3PIO L;  2F9T A;  1QS4 A;  2Z1G A;  2W41 A;  1W9H A;  5AQJ A;  3BEX A;  4RW4 A;  3VGM A;  4ELU A;  4CFB A;  3OHR A;  4C8M A;  3NFA A;  5KGX A;  3CC2 N;  3NGY A;  3T1Y K;  3VF6 A;  1JCG A;  1NK7 A;  2AP1 A;  1YXQ A;  5FPE A;  1RBR A;  1HNX K;  4MDA A;  2RHK A;  4A2B A;  2A1R A;  5EY4 A;  4DTP A;  3ZX0 A;  5LJV A;  1BI4 B;  3SUN A;  3CC7 N;  2KFN A;  4LY7 A;  1R0A A;  4QS7 A;  3TTD A;  4M3T A;  4H4M A;  3JSM A;  4CJL A;  1MWM A;  3UKR B;  1U2V A;  5SZT A;  4WFB L;  1JKH A;  2P9K B;  1C1C A;  4DV6 K;  4ELT A;  3EYZ A;  1D8Y A;  2FBV A;  1J54 A;  3F2K A;  3V9W A;  3DLH A;  3V1R A;  4EHT A;  4DTS A;  4JNE A;  1L5U A;  1L3V A;  2HHU A;  3O5B A;  1S9E A;  1D9D A;  1ASV A;  1YVN A;  2YHY A;  3SMP A;  4M42 A;  5AQL A;  2FXU A;  3ZT2 A;  1WSH A;  4B3R K;  1S5J A;  3VQ6 A;  4KH6 A;  3OTO K;  4WF9 L;  2O4I A;  4AHR A;  3DRS A;  3ZCM A;  1TKZ A;  4M7X A;  1S1W A;  5AQG A;  4C1N I;  5JVH L;  1QSY A;  2BE2 A;  5AQH A;  2XY5 A;  1NK5 A;  4I6M A;  5I9E B;  3LZJ A;  2D5R A;  3K9K A;  1FKO A;  1SV5 A;  5GIN A;  4E7K A;  4O5F A;  3DLB A;  5JVG L;  2JWL A;  1ASU A;  2Q0U A;  3RSE A;  4OLB A;  3KK2 A;  2NRV A;  3AO1 A;  5DK5 A;  2OA8 A;  1HJO A;  2VQE K;  4DR7 K;  1KVA A;  4KFB A;  4CF8 A;  2GWK A;  4IG0 A;  3ULD A;  5CE3 A;  4K0K K;  1XC9 A;  3TI0 A;  3THW B;  4IOA L;  4FJK A;  4MLE A;  5A2Q O;  3LP2 A;  5FPN A;  4W5O A;  3MN7 A;  3CJ1 A;  3H3O B;  4LFA K;  4MDB A;  3HOS A;  4HCB A;  4KHW A;  4FJH A;  1TV6 A;  4I2P A;  2O8D A;  4CZK A;  3AGR A;  2Y1J A;  5HRR A;  2YJF A;  4A61 A;  3AAR A;  4IZ9 A;  4CJ7 A;  3ZYY X;  3IG1 A;  3MXI A;  5AQW A;  2DY4 A;  2KQ2 A;  3BUZ B;  1BA0 A;  2W6L A;  3ZSY A;  1NGJ A;  2Q36 A;  3AO5 A;  3H08 A;  4F2R A;  3I55 N;  4NXN K;  3RR8 A;  3L2U A;  2QWM A;  1SKR A;  2E4L A;  3K5L A;  4DUZ K;  3TSP A;  1GLL O;  2YHW A;  2AJQ A;  1HKC A;  2RPI A;  4ILJ A;  3KK7 A;  1QVG M;  2G8U A;  4CHN A;  3VA0 A;  3CI5 A;  3KLH A;  3V9U A;  1XMO K;  3I33 A;  3LP1 A;  5LJW A;  3VER A;  1N34 K;  1Q9X A;  4HUE A;  4FW2 A;  1I39 A;  1J9A A;  1YTA A;  5C10 A;  1J5E K;  4BE2 A;  1VQ8 N;  1GOA A;  4CEZ A;  3O9S A;  2CGK A;  1MDU B;  2WUS A;  4PQU A;  3OYL A;  5F0X A;  3DLR A;  3L0Q A;  5JS1 A;  5B8H A;  1EET A;  2A40 A;  4BDY A;  2E8A A;  2IVN A;  3U3G A;  3ISN C;  4DSF A;  1RFQ A;  1N8R O;  3DLG A;  2VQF K;  1CZA N;  1N6Q A;  1HR0 K;  3EN9 A;  1EP4 A;  2Q1N A;  4BRA A;  5AQX A;  4DB3 A;  3I56 N;  3WXK A;  3J7Y P;  4LF4 K;  1I3A A;  1GLF O;  3LWM A;  3L2R A;  3AVK A;  3DLE A;  1QHT A;  1A5W A;  2KZM A;  5C24 A;  5FPM A;  3ZT4 A;  1VAZ A;  4FJG A;  4LH5 A;  3HJF A;  4QOZ B;  4Y0W A;  4K41 A;  1VQN N;  3PSI A;  3M1F A;  2G8I A;  4DQR A;  3GE1 A;  3A5O C;  4YOR A;  1QSS A;  5HRN A;  3QEI A;  4CHO A;  4CZG A;  2GEL A;  4DQQ A;  1NGA A;  1UWB A;  3R6M A;  2OCE A;  1Q9Y A;  1J6Z A;  3KTQ A;  3CCL N;  1SL2 A;  1RDU A;  3TSU A;  4ID5 A;  3THW A;  4F2S A;  2GWJ A;  3TAM A;  4M63 C;  1MWK A;  4JK8 A;  1RDB A;  4H03 B;  4AHT A;  4FWP A;  4BG9 A;  5J2Q A;  1S6P A;  4B9U A;  3IFR A;  3NH1 A;  4KHP K;  5BR8 K;  4H0T B;  1KAY A;  1IKW A;  3UE5 A;  5FRO A;  4CJ5 A;  1KC8 O;  2D0A A;  1HNZ K;  1B9F A;  3QO9 A;  4CZI A;  3RR7 A;  5HBM A;  3L8B A;  4IEI A;  4B9V A;  4WQ5 C;  2E2P A;  3D2E A;  2G8H A;  2D1K A;  4J2A A;  5AQY A;  3U4L A;  1NGB A;  2HBK A;  1RT4 A;  2E20 A;  4BRQ A;  2G8F A;  3MCA B;  3CPW M;  4NCA A;  3OYA A;  3O4Q A;  4JI1 K;  2VCP A;  4IOC L;  2QK9 A;  1HPZ A;  4BWM A;  1XMQ K;  2KZZ A;  3LPU A;  4BR9 A;  1X3M A;  4AHU A;  3L6Q A;  3V9Z A;  2ITM A;  5CHI A;  2P9N B;  1SQK A;  3M8P A;  2WOM A;  1BWF O;  4A59 A;  3CQY A;  2FLO A;  4IKF A;  1Q8I A;  3HZ6 A;  3U3Y A;  4OO1 J;  2Q97 A;  4AH9 A;  3QIO A;  3VF4 A;  1RTH A;  1NOY A;  3AA3 A;  4FXD A;  4EP4 A;  3OBY A;  2WFB A;  2CGL A;  3ENH A;  1TL3 A;  3CCS N;  4CZF A;  1VSI A;  3S9H A;  3GBT A;  3OJS A;  1JL2 A;  3SQ0 A;  3OW2 M;  3VEO A;  1K9M O;  1NKB A;  2X6N A;  2HHW A;  3V9S A;  1C0F A;  3PX4 A;  2EHG A;  3SQ2 A;  3RRH A;  2OYQ A;  2IGI A;  2ETJ A;  4GVM A;  3WQT A;  1HQE A;  4CFA A;  4GV3 A;  3D2F B;  1XWL A;  3I8B A;  4J2D A;  3AVH A;  3UIQ A;  4DQP A;  3RTV A;  4FK2 A;  2HNZ A;  2IS3 A;  1BU6 O;  1YHQ N;  4CJU A;  3CC4 N;  1O13 A;  2QW9 A;  1FXX A;  3TAF A;  4JKE A;  5C0Y A;  3VEY A;  4G9Z A;  4CJV A;  3THY B;  1I94 K;  1EO1 A;  2I7N A;  4CBX A;  2GUI A;  3WEE A;  3IKM A;  1C6V A;  4LC9 B;  2OPP A;  4U67 L;  3P39 A;  4F9O A;  1ZYQ A;  5KPT A;  4KAZ A;  3A8Y A;  4FOE A;  3C0B A;  2BUP A;  2XY6 A;  3EZW A;  4JKB A;  4H5T A;  4BC4 A;  2HHV A;  5BN8 A;  4B1U B;  1RDA A;  1TK8 A;  1C0G A;  2J4R A;  4FLX A;  1F21 A;  1WAJ A;  4K43 A;  4DWI A;  1ZXO A;  1QTM A;  5T7B A;  2FBT A;  4GV9 A;  2FC0 A;  1LCU A;  3B6P A;  3LDS A;  4W5T A;  4FWQ A;  3VQB A;  3CFR A;  3S3M A;  3NF7 A;  1C0T A;  5BPM A;  3QFP A;  3CFO A;  4H5R A;  1TK0 A;  1QE1 A;  3R1X A;  2O8E B;  4LF6 K;  4DSK A;  4JI7 K;  1X9W A;  3Q7C A;  3LDL A;  2G8W A;  4CK3 A;  4B1V A;  4WQ5 A;  2IIR A;  4KRE A;  3HM8 A;  2F8T A;  2OAN A;  3HOT A;  3SI6 A;  1BL3 A;  4EZ6 A;  1XQS C;  2KKZ A;  3VQQ A;  4Y1D A;  4FLT A;  1NGG A;  3R3L A;  4OLA A;  3VQE A;  3O4W A;  3VET A;  5KTQ A;  1ITG A;  3TSQ A;  2XO7 A;  3VQP A;  4DQS A;  2I5J A;  3U6F A;  4FLZ A;  1HNW K;  4FJI A;  1D4X A;  3L3U A;  4JAX A;  3ZT1 A;  3ITH A;  4OX9 K;  4IEE A;  4F4K A;  3SQ4 A;  1HNI A;  3HSC A;  3RRG A;  2O8B B;  5CYM A;  4FVM A;  3K5N A;  2P9U A;  4FWS A;  4BRL A;  4FZY A;  4KTW A;  5AFU A;  4BAC A;  1T05 A;  4C8N A;  4H0Y B;  4DF8 A;  4CGG A;  4H5W A;  5FRN A;  2P51 A;  5GIP A;  3ZT3 A;  4Z4H A;  3ENB A;  3WT0 A;  1Q18 A;  4CEB A;  2KFZ A;  2NZT A;  3VQ4 A;  4CGI A;  3CET A;  2RKI A;  3DRR A;  2EX3 A;  2DFH A;  2V7Y A;  5HRO A;  3D7E O;  1REV A;  3D2E B;  3GL1 A;  1NGH A;  2FSK A;  3AO2 A;  4PY5 A;  4E1J A;  2QXF A;  2O8C A;  4CEC A;  4FM0 A;  2IVP A;  4FVU A;  1YI2 N;  3VA3 A;  3R8E A;  3L4I A;  4K25 A;  3I0R A;  3HST B;  1DLO A;  4KHU A;  4PKH A;  4F8R A;  4CJT A;  4AHV A;  2HF3 A;  3SAF A;  1LWF A;  4CGF A;  2A3Z A;  4DV1 K;  3WNG A;  1HJR A;  1NM1 A;  5AQM A;  4ISG A;  4IO8 A;  4A5A A;  4BRM A;  5D3G A;  3B6O A;  3SMS A;  2F96 A;  3TTF A;  2W6K A;  3K2P A;  5JLF A;  1T03 A;  5EU7 A;  2E88 A;  4HVJ A;  3G10 A;  2BH1 A;  4GKJ K;  4A2A A;  5FPD A;  1LWC A;  4CF0 A;  3PLA A;  1SKS A;  2PZS A;  4FSV A;  2QXL A;  4F3O A;  3LDQ A;  1JCF A;  5JLH A;  3J8A A;  3SAG A;  3EO3 A;  4BQL A;  2QKB A;  4KI6 A;  3P38 A;  2GTD A;  4CJ3 A;  1NJW A;  2JWK A;  2QWP A;  3G4S N;  3CJB A;  1HMV A;  4CIE A;  3CM5 A;  5AZJ A;  4CI6 A;  3KK1 A;  5IT9 O;  4TSX A;  2B5J A;  4BRC A;  3SNN A;  1EQY A;  1OH7 A;  4DKW A;  2QA4 N;  3V1Q A;  1UAX A;  2OPS A;  4I9L A;  4JKD A;  5C42 A;  4I7F A;  4RTF D;  1WN7 A;  2A6A A;  3SYZ A;  1EXQ A;  4DG1 A;  5E84 A;  1NGF A;  2YNI A;  4DU4 A;  5AZI A;  2NRT A;  1NGD A;  4LD0 A;  4M3R A;  4AHS A;  4CD1 A;  4FJJ A;  4BE1 A;  3DLL L;  1NGI A;  1XNR K;  5C25 A;  4CJW A;  5GAG P;  1RT6 A;  3MWP A;  4KH4 A;  3LDN A;  4FK4 A;  4FPA A;  4M3U A;  3HO1 A;  4B3M K;  3O1B A;  3O9T A;  4FJ8 A;  4BRH A;  3ZET A;  2ASP A;  3PX6 A;  2JGU A;  5F2R A;  1RBT A;  4YDU C;  3CCM N;  4DLG A;  1LW0 A;  4FJM A;  4BGA A;  1KVC A;  5BPN A;  2OTL N;  4DUY K;  5AQU A;  4BC3 A;  2UUB K;  4CZE A;  3JYT A;  3AVJ A;  1ZC6 A;  2P9I A;  2A1S A;  2WC9 A;  3OYB A;  3PX0 A;  1GLD G;  3SZ2 A;  1A5V A;  2KLA A;  4A62 A;  1Y97 A;  3TAG A;  2H3G X;  3HRG A;  3DXK B;  3K57 A;  1VSD A;  2NUB A;  4CJK A;  3MED A;  3FZM A;  3MDQ A;  4FJ7 A;  3MEC A;  4H8K A;  2XHB A;  4O8K A;  4AM7 A;  1JLA A;  3PUF A;  4Z4F A;  4HHT A;  3CXC M;  3CCJ N;  4DR1 K;  2P5G A;  1NJX A;  3AA5 X;  3CMA N;  3HP6 A;  3FR0 A;  1NJI O;  1X1P A;  1VQ4 N;  5HRP A;  4C23 A;  1DEJ A;  1L3T A;  1BQN A;  3CCV N;  3LP0 A;  2Z1H A;  4QS9 A;  1N5Y A;  3EZ5 A;  4I6M B;  1EWQ A;  2IC3 A;  4FLU A;  4CW7 B;  2D0O A;  1S1V A;  3ZSX A;  4DU3 A;  3FE1 A;  1IKV A;  2BGG A;  4B8A B;  4O44 A;  4QCL A;  5F1X A;  4JRQ A;  4FLV A;  3C65 A;  1N36 K;  1XUP O;  5LL6 Z;  3KLE A;  3LM9 A;  5ADX A;  3CJ7 A;  3SPY A;  1SZ2 A;  3E9O A;  1V4S A;  4KHN A;  3RMA A;  1ATS A;  1IV0 A;  1RGI A;  2E6M A;  3DLK A;  4FLW A;  5I42 A;  1TYQ B;  4DTN A;  1RDD A;  3CJC A;  1VSL A;  4CFD A;  4IOX A;  4KB0 A;  3LDO A;  3FZH A;  4JI8 K;  3EKU A;  4FM2 A;  1BQM A;  3PIP L;  4CVN E;  1T6D A;  3SAH A;  4DR2 K;  3WXI A;  1FK9 A;  2E6L A;  1B9D A;  3D2F A;  1VQ9 N;  4JLH A;  4A57 A;  1TKD A;  2QWR A;  4AQY K;  2RF2 A;  4CK1 A;  2HBJ A;  4C8O A;  4LF7 K;  4CER A;  4H0O A;  1HKG A;  4Z4G A;  4X62 K;  1RCH A;  2ZWH A;  4ILG B;  4WE1 A;  4CEE A;  3NGI A;  4PKI A;  3M3Z A;  4N5S A;  4CZL A;  3AA2 A;  5GAE P;  3TAE A;  4Z4C A;  1WSF A;  5FLX O;  3T3F A;  5JS2 A;  3QBX A;  3C6H A;  4WQ4 C;  5C2F A;  1OVQ A;  5MLC Q;  4GKK K;  5M1Q A;  1Q7Y O;  1TYQ A;  5ELZ A;  4JRP A;  1RBV A;  3AAQ A;  4L3Q A;  4NO7 A;  3QIP A;  2ZM6 K;  3CCR N;  4LF8 K;  4OGC A;  4CGH A;  1RDC A;  3HVT A;  4YDU A;  4CHQ A;  3QNO A;  1U45 A;  1A5X A;  3BZC A;  1TAU A;  1H1V A;  4CEQ A;  1T3V A;  4M3Y A;  5HLF A;  1U2V B;  1JLE A;  4FW1 A;  5AZJ B;  4NCB A;  1DT9 A;  4B3S K;  5BRE A;  4Q5V A;  3G25 A;  1XC3 A;  4OPH A;  4ZTJ A;  1T6C A;  1C1B A;  1NK4 A;  1FJG K;  3I0S A;  2YNH A;  3KLF A;  2ITG A;  4HUF A;  3WXL A;  1D5A A;  4GVE A;  2FSN A;  1GLA G;  1SAZ A;  3SPZ A;  4V19 S;  3M8R A;  3NVM A;  4B1X B;  4YY3 K;  2D0B A;  1KXP A;  1YIJ N;  2YKN A;  3KZB A;  4EFH A;  3ZEU B;  3AVI A;  3QB0 A;  3SV4 A;  2RE2 A;  3QES A;  4KKO A;  1RT5 A;  3LAM A;  2W40 A;  3U9Z A;  3VQ8 A;  4FO0 A;  2B4J A;  3OYI A;  3SUQ A;  4ID1 A;  1VSM A;  4IBN A;  4FWL A;  4BY9 C;  4DSI A;  1JLB A;  2I7P A;  4WFN L;  3E1Y A;  1WSG A;  2KTQ A;  4B1W B;  2VG6 A;  2YNF A;  2GBZ A;  3QLH A;  2PAV A;  3HVR A;  2VWJ A;  4DV7 K;  3ZSW A;  3V4I A;  4E3S A;  2ZJR L;  3V6D A;  5KI6 A;  2YX6 A;  3DXM B;  1YTU A;  1Z05 A;  4YHH K;  1QQN A;  5AQT A;  5KPZ A;  1WLJ A;  1IKX A;  2P9I B;  4MLH A;  3AV9 A;  3IUC A;  3MMV A;  3WNE A;  1CLQ A;  3O9R A;  4DFK A;  2PBD A;  5J2P A;  2OTJ N;  1HYZ A;  3VTH A;  1VQM N;  1D9F A;  3O6W A;  3IDH A;  3O3H A;  3QIN A;  4Z0U A;  3M5R A;  4B3O A;  3K0S A;  2Q0R A;  4FCY A;  3WEE B;  4YOV A;  5E26 A;  2KHO A;  1Q86 O;  3MEG A;  4J2B A;  3BF1 A;  4FJX A;  1KFS A;  4PL7 A;  4FL9 A;  4Z4I A;  3T7Z A;  3VQ9 A;  4KO0 A;  3C95 A;  3ATU A;  4JV5 K;  1VQL N;  4EP5 A;  2HVH A;  5C2D A;  1K73 O;  1S1U A;  4H0X B;  1U04 A;  1WSE A;  3AAP A;  4BRE A;  4DV3 K;  3MXJ A;  3N4Q A;  3VN5 A;  2UXD K;  4X66 K;  3MN5 A;  3HPH A;  4IDK A;  4CHZ A;  4BDZ A;  3QNN A;  4KRF A;  1Z26 A;  3SJH A;  4BRD A;  4L8R B;  3VQC A;  4FZZ A;  3S41 A;  2DFF A;  3HL8 A;  1IO2 A;  4CFC A;  3THX B;  2O8F A;  3QEV A;  3DI6 A; 
#chains in the Genus database with same CATH homology
 1N32 K;  4V19 S;  2UUC K;  1XNQ K;  4YY3 K;  2UXC K;  2F4V K;  1HNW K;  3J80 O;  5IT9 O;  4DV2 K;  2VQE K;  4OX9 K;  5IWA K;  4DR7 K;  1N36 K;  5LL6 Z;  4DR3 K;  4K0K K;  2UUA K;  4JI0 K;  3J7A P;  5A2Q O;  3T1Y K;  4JI4 K;  4LFA K;  4DV4 K;  5AJ3 K;  4DV7 K;  1HNX K;  4JI8 K;  4CVN E;  3J81 O;  5LMU K;  4DR2 K;  1I94 K;  5LMN K;  4KHP K;  5BR8 K;  2UXB K;  1XNR K;  1N33 K;  1IBL K;  4YHH K;  1HNZ K;  4AQY K;  4DR4 K;  1IBK K;  4NXN K;  4JI2 K;  4B3M K;  4LF7 K;  3T1H K;  4DUZ K;  4X62 K;  4NXM K;  4DR5 K;  4LFB K;  4DV6 K;  2E5L K;  3JAM O;  4DUY K;  1XMO K;  5FLX O;  4JI1 K;  2UUB K;  1N34 K;  4GKK K;  1XMQ K;  4JV5 K;  1J5E K;  4DV1 K;  4X64 K;  2ZM6 K;  4LFC K;  4LF5 K;  4X65 K;  4JI6 K;  4B3R K;  4JYA K;  4LF8 K;  1IBM K;  4DV5 K;  4DV3 K;  4LF6 K;  4JI7 K;  3OTO K;  4DR6 K;  2UXD K;  4X66 K;  2VQF K;  4B3T K;  4JI5 K;  4LF9 K;  1HR0 K;  4GKJ K;  4DR1 K;  2HHH K;  4B3S K;  4LF4 K;  3J7Y P;  4JI3 K;  1FJG K;  2UU9 K;  4DV0 K;  4CW7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...