2UUAE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uuaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uuaE02
1RREA 1ZXNA 2GS8A 4DR1E 2L3CA 3T1YI 4GKKI 2CPNA 1N32I 4Z7CA 5LMNE 3ZM7A 2ZITA 4DPYA 4PRVA 1FWKA 1Z0WA 4JI3E 4DPTA 2NUGA 4DR5I 4DR4I 1X48A 1ZM2A 2UXDI 2R3VA 3WU5A 1I94E 3K1JA 4DXLA 3T1HI 1XNRI 2KHXA 4ED4A 2HHHI 5IT9C 4M30A 4KQVA 4USMA 1OJ4A 4YY3E 2HK2A 4YHHI 1H74A 4WUCA 4M2ZA 3WU3A 4JI6E 4NXNE 1DARA 1ZM4A 1H7UA 2DEIA 4B3TE 4X64E 1NHHA 2UU9I 3ZKDA 4R1FA 4UT4A 3ADJA 1Z0EA 3J80C 4LF6I 3QT8A 4LFBE 1RR9A 2E5LE 1IBKE 4K0KE 1MG7A 1PIEA 1UILA 5IWAE 4X62E 4JI0E 3HULA 2EZ6A 1HNXI 4LF5E 1EKZA 1T4NA 1Z5AA 1H7SA 3B8HA 3V2UC 4WYQB 2F4VI 1H73A 4GKJI 4X65I 4JG4A 4Z7YA 1FJGI 2UXBE 4DUYE 4DUZE 4DR6E 4JI2I 1UEKA 4DV0E 3HTXA 4LFAI 4DKKA 3OTOI 3GONA 2L3JA 4UTGA 4LF8E 1IBLI 2RTXA 4RPFA 4NXMI 4LF7I 4DV6E 2L33A 1N36E 1HNWE 4X8WA 4X66E 4JI4I 5GMDA 3VYXA 1B62A 2YT4A 3V5RA 1HR0E 4DV4I 3P1XA 1T4LB 4AQYI 2B7TA 1Z5CA 1VISA 1T4OA 2LUQA 3LLHA 1WHQA 2B7VA 4LF4I 3T1YE 4GKKE 1BKNA 5LMUE 5A2QQ 2DEJA 1QZRA 4DPXA 1RQ0A 1PKPA 4DR5E 1U2RA 4HACB 4HXZA 1XMQI 1N33I 4DV7E 2UXDE 2E1RA 1Z0VA 3T1HE 2V2ZA 2VQFI 4JI1I 3C4BA 3PYEA 3F0NA 1NHJA 1HNZI 2A2CA 5BR8E 4ZVIA 4YHHE 3Q1QA 1XMOI 4FWDA 3D4JA 2A2DA 3ZZUA 3ZKBA 1UHZA 3B82A 2UUAI 2UU9E 1NHIA 2NUEA 3ZZ0A 1IBMI 2RSMA 4LF6E 1N34I 1ZBTA 2UUCI 4JI5E 3ADGA 4JV5E 3QT6A 2DB2A 2EFGA 2DMYA 2VQEI 1J5EI 4B3SI 4DV2I 4DV1E 1FKAE 1X47A 1FJGE 2X7IA 1EA6A 4JI2E 3LNUA 2JVAA 4LFAE 4JI3I 3OTOE 1YYKA 4B3RE 4DV5I 3ADLA 2J7KA 1IBLE 4NXME 4LF7E 1I94I 1XNQE 4LF9I 2ZBKB 1MX0A 4FN5A 1MU5A 2LTRA 4JI4E 2ZM6I 2RS6A 3PYFA 4DPWA 4OX9I 1WUUA 4AQYE 1FWLA 2V8PA 2HK3A 1NZ0A 4DV3I 4LF4E 3QT7A 2HKEA 4FW9A 4B3TI 1S4EA 1DI2A 2V2VA 4JI8I 2UXCE 4JYAI 1KTVA 1ZXMA 3J7AM 4DR7I 2B3TB 1GQEA 2Q2EB 5LL6R 4P52A 1S16A 5A2QC 1XMQE 1N33E 2E5LI 4KHPI 4K0KI 3ADIA 5IWAI 4PRXA 3LPSA 4DR3I 4JI1E 1N32E 3J7AG 1ZM3A 2UUBI 1K47A 3PYDA 4URLA 1KVKA 1HNZE 4HACA 2BM1A 3M6AA 4DUYI 4DUZI 2LUPB 1KKHA 4DR4E 1H72C 4DV0I 4OOGC 4USKA 3H4LA 1FI4A 4LF8I 1XNRE 4DU8A 2HHHE 1IBME 4DV6I 1N36I 4B3MI 4HY1A 3J7Yp 3C4TA 1N34E 1RC7A 2UUCE 2L2KB 1HR0I 1B63A 3PYGA 4PU9A 1J5EE 4B3SE 2V2QA 3CWVA 1STUA 4LFCI 1A6FA 1N0VC 4DR2I 2HFUA 1Z0BA 5LMUI 1QU6A 2N3HA 1J26A 2R42A 2LJHA 4DV5E 4JI7I 4WUDA 4DV7I 2VF3A 1D6TA 1ELOA 4MYTA 1HNXE 4LF9E 1YYOA 4DR1I 2DIXA 2F4VE 2ZM6E 4GKJE 4X65E 1Z0TA 4HYMA 5LMNI 1Z0CA 2LBSB 4OX9E 1KIJA 5BR8I 5GMEA 2L2MA 2CZ9A 2N3GA 2WW4A 4DU7A 4DV3E 1EI1A 2LJPA 3WU6A 5IT9Q 2X36A 4JI8E 4JYAE 1O0WA 4DR7E 4DV4E 4JI5I 4JV5I 5CFFE 4YY3I 4KHPE 3VYYA 5L3JA 2L2NA 4WUBA 4DV1I 4JI6I 4DR3E 4NXNI 3J80Q 1N0UA 2UUBE 2LTSA 4X64I 5FLXC 2BV3A 2BM0A 2AJ4A 3JAMC 1ZM9A 1Z5BA 4DPUA 2NPFA 4LFBI 4MYUA 1IBKI 2HKJA 4B3RI 3WU4A 5FLXQ 3B78A 4X62I 2VQFE 4JI0I 1YZ9A 2NUFA 3JAMQ 1XNQI 1Z59A 4B3ME 4LF5I 4WFTA 1Z0GA 2XEXA 3K17A 2UXBI 2RS7A 1PVGA 1XMOE 1YYWA 3J81C 4DR6I 2JY9A 3LTOA 4M1KA 2V34A 2LRSA 1X49A 4LFCE 4XTJA 2IHR1 1XHKA 1FNMA 2UUAE 4DR2E 2OI2A 2MDRA 2NA2A 4I3HA 3J81Q 1HNWI 2UXCI 4FWGA 1WHNA 4X66I 3ZZTA 4EMDA 3QT5A 4P7AA 4JI7E 2HFSA 2VQEE 4DV2E 4FWHA
chains in the Genus database with same CATH superfamily
1E3PA 2YTGA 1RREA 1Y5YA 1ZXNA 2GS8A 2WBUA 4DR1E 2EM8A 2L3CA 3T1YI 4GKKI 5K36B 4O5GA 2CPNA 5DROA 1N32I 4Z7CA 2EMHA 5LMNE 3ZM7A 2ZITA 4DPYA 2YTQA 1YPNA 1F2IG 5KL3A 4NHRA 4PRVA 3RMPA 1FWKA 4BA2A 2JEBB 2EMKA 1Z0WA 4JI3E 4DPTA 2NUGA 2O1WA 1JK2A 4DR5I 4DR4I 2HGHA 1MEYC 1X48A 2L8TA 5KL5A 1ZM2A 2BA1G 2UXDI 2R3VA 3WU5A 2JYAA 1QNTA 1I94E 2F1DA 3K1JA 4DXLA 3M85G 3T1HI 1XNRI 2KHXA 4ED4A 1USVA 4FW3A 5IV8B 3BIDA 1EH6A 2ENCA 5DRQA 5JEAA 2HHHI 5IT9C 3DJWA 4M30A 4KQVA 2BB8A 3H09A 3Q6MA 2PNZB 4USMA 3HQ1A 1OJ4A 1X6EA 4FWHA 2NN6C 3PRYA 2LCEA 4IS1C 2EQ1A 4YY3E 1OYPA 2HK2A 4YHHI 1H74A 4WUCA 1A1HA 4BHCA 5DNLA 2CGEA 4F6MA 2EMCA 2JP9A 4M2ZA 3WU3A 4LCGA 2EM2A 2EPXA 4JI6E 2JEAB 3NZKA 4NXNE 1DARA 1ZM4A 1MGTA 2DLKA 1ZU1A 1H7UA 2DEIA 4B3TE 1G2DC 4X64E 2PO1B 1NHHA 1PJTA 2V86A 3ZKDA 2UU9I 4R1FA 4UT4A 4IJDA 1DQ3A 3ADJA 2EM0A 2BR2B 3CDJA 1Z0EA 3H1CA 2YSPA 3J80C 4FK5C 2Z5CA 4LF6I 3CDIA 2LV2A 5K36D 2CTDA 5DRRA 3QT8A 5T6JA 2EM5A 4WSPA 1WXRA 4LFBE 2E5LE 1RR9A 2C39A 4BA1A 5K36F 1IBKE 4K0KE 2YU8A 2YTDA 1MG7A 1PIEA 1UILA 2YRHA 5IWAE 2E1MA 4X62E 1A1GA 4R2DA 5K36E 4JI0E 4MLVA 3B4TA 3HULA 1Y4SA 2EOSA 3C6MA 2EZ6A 1HNXI 4LF5E 2WNRA 2JWOA 1EKZA 1T4NA 1Z5AA 1H7SA 2EM4A 2YTIA 4WXDA 3B8HA 3V2UC 4WYQB 2F4VI 1H73A 4GKJI 4X65I 4JG4A 4Z7YA 1FJGI 2UXBE 5C0XC 4R8OA 4WPYA 3Q6NA 2YTPA 3BF2A 4LCHA 4DUYE 4DUZE 4DR6E 4MQYA 4IZJA 1UDQA 4JI2I 4IZKB 4MU3A 1UEKA 4QNKA 4DV0E 2E72A 3KZZA 1UDSA 4LOMA 3HTXA 4LFAI 4DKKA 3OTOI 3GONA 2L3JA 2EN3A 4MLQA 4UTGA 4LF8E 1IBLI 2ADRA 2EL5A 2RTXA 4LCFA 4Q28A 4RPFA 4NXMI 1EH7A 2KOUA 4LF7I 4J8ZA 1YHCA 2R76A 4DV6E 2L33A 1N36E 2RQLA 1HNWE 4X8WA 4O24A 4X66E 4JI4I 5GMDA 4OO1C 3VYXA 1B62A 2YT4A 4ZYDA 1YSAC 2C38A 1R6MA 2EN8A 4BMJA 2MDGA 3V5RA 1HR0E 4DV5I 4DV4I 3P1XA 1T4LB 4FW6A 4AQYI 2B7TA 4L8NA 2EPPA 1Z5CA 1VISA 4NBQA 1T4OA 3K6QA 3VHTB 4DV2E 2LUQA 3LLHA 3P76A 1WHQA 2B7VA 4LF4I 3T1YE 4GKKE 1X3CA 2ODRD 4F6NA 1BKNA 4BC7A 5KL7A 2ELZA 1UN6B 2LO3A 5LMUE 5A2QQ 2DEJA 1QZRA 1ZAAC 3JTZA 2EOZA 1XXEA 4GEQB 2YU5A 1KJKA 4R2EA 2ELYA 2G7HA 1RQ0A 1A1JA 1IQSA 1PKPA 4DPXA 1BBGA 2VRDA 2V83A 3THNA 2EL4A 2M9AA 2HJJA 4DR5E 1U2RA 4HACB 4HXZA 1XMQI 1N33I 2EOYA 4DV7E 2ENAA 2N8XA 2FV4B 2UXDE 2LE2A 5K36A 2LT7A 2WZOA 5AE3A 2E1RA 3KZYA 2O1UA 1Z0VA 2MC5A 3T1HE 2V2ZA 2MKNA 2VQFI 5AC5A 1R6LA 4JI1I 1USUA 3C4BA 2LJUA 3F0NA 3PYEA 3M99B 2JEBA 5JEAC 3THOB 1NHJA 4MU1A 1HNZI 2A2CA 4AM3A 3K85A 5BR8E 2WBSA 1A1LA 2VESA 3PS2A 4ZVIA 4YHHE 3Q1QA 1YUIA 2EMBA 1T38A 3UK3C 1XMOI 2EOEA 1UBDC 4FWDA 3D4JA 2A2DA 3ZZUA 5A69A 1JK1A 2Z5EA 3ZKBA 1UHZA 2L6MA 3U1YA 3P3EA 3B82A 2UUAI 2PNZA 2IERA 2UU9E 1NHIA 2NUEA 2LVHA 1TN9A 3ZZ0A 1IBMI 2EORA 2I13A 2RSMA 4MDTA 4IFDC 5A6AA 2GLIA 2YWQA 4LF6E 2PO2B 1N34I 4BCAA 1ZBTA 1AAYA 5KL2A 2PO0B 2UUCI 4JI5E 3ADGA 4JV5E 3GLLA 1X6HA 3QT6A 2DB2A 2EFGA 2JEAA 2DMYA 2EM6A 2EN1A 2VE7C 2PRTA 1WRJA 2F8BA 3GCMA 2VQEI 1J5EI 2PO1A 4B3SI 4DV2I 4DV1E 3HKMA 2BR2A 1FKAE 1X47A 5ADZA 5A6BA 3ZOQB 2EWLA 2EPKX 4WSGA 2FTXB 2YTEA 1FJGE 3M85D 5AASA 2EQ0A 2EOIA 2JXPA 2K4VA 4TUIA 2EPMX 3EPLA 2X7IA 1EA6A 4RH8A 4JI2E 3LNUA 5IXMB 1KYQA 2JVAA 2EMFA 1RHYA 2WP8B 2CVEA 4LFAE 4JI3I 2YZTA 3OTOE 4TUGA 1YYKA 4B3RE 3ADLA 1E3HA 2J7KA 1GZ6A 5F3WA 1IBLE 4NXME 1ZBQA 1YFHA 4LF7E 4FW5A 1PDAA 1I94I 1XNQE 4LF9I 2YRKA 2ZBKB 2O3ZA 5KL6A 1MX0A 4FN5A 2WBTA 1MU5A 4F9CB 2LTRA 4JI4E 2ZM6I 4IZKA 2DGCA 4IFDB 2EMWA 2RS6A 2GQ0A 3PYFA 4DPWA 4OX9I 1WUUA 1Y6ZA 2EMAA 4N3OA 4AQYE 1FWLA 2NN6B 3EPKA 2JT2A 1B69A 2EM3A 2V89A 2M1SA 2EPLX 2HK3A 2V8PA 2JPAA 2O1TA 1NZ0A 2EOFA 2JOBA 2YTJA 3MHHC 4DV3I 4M0VA 4LF4E 4O43A 2YTFA 3QT7A 4HTGA 2JE6B 2HKEA 4R03A 4FW9A 4J3DA 4B3TI 2IOQA 1S4EA 3DF6A 1DI2A 2VF1A 2V2VA 2UXCE 4JI8I 1KTVA 4JYAI 2Z5BB 5A6JA 1ZXMA 3J7AM 4DR7I 5EL9A 2B3TB 1GQEA 3BGHA 4R2RA 2CSHA 2Q2EB 5LL6R 5A2QC 2DLQA 1S16A 4P52A 1GTKA 2EMLA 2M7QA 4RHBB 3LMLA 1XMQE 1N33E 1L4SA 2E5LI 2EPUA 3M7NG 4KHPI 2AE8A 3P3GA 4K0KI 1RMDA 3ADIA 1UDNA 2ENHA 5IWAI 4PRXA 3LPSA 3UHMA 5EKWA 4DR3I 3IWBA 4JI1E 3AV0A 1N32E 3J7AG 2EMXA 4KZSA 1ZM3A 1Y4UA 2UUBI 2EMYA 1K47A 4WXCA 3PYDA 4URLA 1TF3A 1KVKA 1HNZE 4HACA 2BM1A 2HC5A 3M6AA 4DUYI 5C0XB 4DUZI 4X9JA 5AC4A 2NABA 1BB8A 2LUPB 2MC6A 1KKHA 1LLMC 4DR4E 3PS3A 2EMZA 1H72C 4DV0I 4IFDD 4OOGC 2CT1A 4R2QA 4KWYA 3H4LA 1FI4A 4USKA 2YTNA 4IFDF 4LF8I 2GHFA 4U3DA 1XNRE 1UDOA 2NN6D 2M4IA 4BHBA 4BS9A 4DU8A 1P42A 2HHHE 2JR1A 2EPOA 1IBME 2I9IA 2NN6F 4DV6I 4IFDE 1N36I 4B3MI 4HY1A 3J7Yp 2EN6A 3C4TA 5KL4A 1N34E 2DMIA 2EN7A 1RC7A 4FW7A 2UUCE 1TF6A 2NN6E 2L2KB 5LLQA 2EE8A 4OO1B 1YUJA 2R1FA 1HR0I 2C37B 2DSYA 1B63A 2EN4A 2Q8UA 1N3GA 3QG5C 3VK6A 2EOQA 1NEIA 3MSWA 1J5EE 3PYGA 4PU9A 4B3SE 2V2QA 1OYSA 5FWKA 2EL6A 3CWVA 1STUA 4LFCI 5ELWA 1A6FA 4WX9A 2BA0D 2RSIA 4U3BA 2D9HA 1N0VC 5AE2A 2PO2A 4DR2I 2HFUA 3L7ZB 2PO0A 4IZJD 2EMGA 1Z0BA 5LMUI 2EM7A 1QU6A 2KONA 4I8OA 2N3HA 2EPAA 5DNYA 4DMIA 1HK7A 3U1KA 1J26A 3PS1A 2ODRC 2YTOA 2J7JA 2R42A 2LJHA 4DV5E 4JI7I 4OZEA 4WUDA 4DV7I 1SR9A 4BA2B 2VF3A 3TQMA 5C0XD 1D6TA 1ELOA 4L5NC 4MYTA 1HNXE 4LF9E 1IMUA 2O1VA 4N4RB 2BA1D 5C0XF 1YYOA 4DR1I 4FW4A 3EQ1A 2DIXA 1P47A 4P78A 2F4VE 2ZM6E 2J65A 4GKJE 4X65E 3DD6A 1Z0TA 4HYMA 5LMNI 1Z0CA 2WP8A 2L92A 2LBSB 1OYRA 5C0XE 4OX9E 1KIJA 5JEAB 3OMLA 5BR8I 4QNJA 2V85A 5GMEA 2PNLA 3BBGA 4LU9A 2EPZA 1X6FA 2L2MA 2CZ9A 2N3GA 2WW4A 3FIGA 2GPIA 4DU7A 2GO3A 4OO1D 4DV3E 1EI1A 2LJPA 2A25A 2EM9A 4R2AA 3HJCA 3WU6A 1A1IA 5IT9Q 1AH5A 2EOXA 4F9BB 4NZVA 4OO1F 2X36A 4IFDA 4AIMA 4JI8E 1X5WA 4JYAE 1O0WA 4OO1E 4DR7E 2LMZA 5AE1A 2NN6A 3HPZA 4DV4E 5DRPA 4JI5I 4JV5I 5CFFE 2EOOA 4YY3I 2EN2A 4KHPE 2EJ4A 2FGGA 2Z5CB 2JE6A 4GZNC 4F54A 1Y60A 4R2SA 3VYYA 3JU0A 2L2NA 5L3JA 2C39B 4BA1B 4WUBA 4DV1I 4JI6I 4DR3E 2Z5BA 4NXNI 3P3CA 3ECRA 3J80Q 1N0UA 2UUBE 2LTSA 4X64I 3F6GA 2V88A 5TSEA 5FLXC 2V87A 2BV3A 4Q35B 2BM0A 3L00A 4R2PA 2JOXA 2AJ4A 1Z1BA 4R2CA 3JAMC 1A1FA 1ZM9A 2WNRB 3MHSC 2B9DA 3HPSA 1Z5BA 4MU0A 4DPUA 4M9VC 2NPFA 2EOHA 3KWRA 4LFBI 1WJPA 4MU4A 1VI7A 2CG9A 4MYUA 1IBKI 2HKJA 1PJQA 2EPRA 5JEAD 2EQ3A 4B3RI 1EH8A 3F6HA 4LTYA 4IZJB 3WU4A 5FLXQ 1G2FC 3B78A 1ZR9A 1IQOA 4X62I 5JEAF 5K36C 2VQFE 4JI0I 2EPCA 1YZ9A 2NUFA 3JAMQ 2EMIA 1XNQI 1PJSA 1Z59A 1NCSA 4B3ME 2V8QB 4LF5I 2K7IA 4WFTA 3GMEA 1YH8A 5JEAE 1Z0GA 5C0XA 5A6KA 4IS9A 2XEXA 3K17A 2UXBI 2RS7A 2H36X 1PVGA 5DNXA 2EOMA 1XMOE 3J81C 1YYWA 4DR6I 2JY9A 3KRNA 4BC9A 2PNMA 2IOPA 5A6BD 2EOJA 2C38B 3LTOA 3AUZA 2V34A 2LRSA 1X49A 4LFCE 4M1KA 4XTJA 4AIDA 2IHR1 2YSOA 2EP3A 1BBOA 1FNMA 2YRMA 1XHKA 3M7ND 4HEIA 2UUAE 4ZYEA 4DR2E 3IWCA 2OI2A 3EPHA 4LPFA 4F2JC 2MDRA 2GO4A 2MKDA 4P7DA 4OO1A 4ZYHA 2NA2A 4I3HA 1T39A 3J81Q 3IWDA 3EPJA 2C37A 4F9AB 4FWGA 1HNWI 1WHNA 2UXCI 4X66I 2RPCA 4OKGA 3P06A 4O4KA 4ISAA 4BBYA 2IESA 3ZZTA 1DGCA 4EMDA 2YPNA 2EPNA 1A1KA 3QT5A 4GQUA 1SFEA 4P7AA 4JI7E 4ZYGA 3HXLA 2BBGA 2HFSA 2WCC3 2VQEE 2BA0G 3C6KA 2DRPA 3L7ZA
chains in the Genus database with same CATH topology
1RREA 1ZXNA 2GS8A 4DR1E 2L3CA 3T1YI 4GKKI 2CPNA 1N32I 4Z7CA 5LMNE 3ZM7A 2ZITA 4DPYA 4PRVA 3RMPA 1FWKA 1Z0WA 4JI3E 4DPTA 2NUGA 2O1WA 4DR5I 4DR4I 1X48A 2L8TA 1ZM2A 2UXDI 2R3VA 3WU5A 1I94E 3K1JA 4DXLA 3T1HI 1XNRI 2KHXA 4ED4A 1USVA 2HHHI 5IT9C 3DJWA 4M30A 4KQVA 3Q6MA 3H09A 4USMA 3HQ1A 1OJ4A 3PRYA 4YY3E 2HK2A 4YHHI 1H74A 4WUCA 2CGEA 4M2ZA 3WU3A 4JI6E 4NXNE 1DARA 1ZM4A 1H7UA 2DEIA 4B3TE 4X64E 1NHHA 2V86A 2UU9I 3ZKDA 4R1FA 4UT4A 1DQ3A 3ADJA 1Z0EA 3J80C 2Z5CA 4LF6I 3QT8A 5T6JA 1WXRA 4WSPA 4LFBE 1RR9A 2E5LE 1IBKE 4K0KE 1MG7A 1PIEA 1UILA 5IWAE 2E1MA 4X62E 4JI0E 3HULA 1Y4SA 2EZ6A 1HNXI 4LF5E 2JWOA 1EKZA 1T4NA 1Z5AA 1H7SA 3B8HA 3V2UC 4WYQB 2F4VI 1H73A 4GKJI 4X65I 4JG4A 4Z7YA 1FJGI 2UXBE 4R8OA 4WPYA 3Q6NA 4DUYE 4DUZE 4DR6E 4IZJA 4JI2I 4IZKB 1UEKA 4DV0E 3HTXA 4LFAI 4DKKA 3OTOI 3GONA 2L3JA 4UTGA 4LF8E 1IBLI 2RTXA 4RPFA 4NXMI 4Q28A 2KOUA 4LF7I 4J8ZA 4DV6E 2L33A 1N36E 1HNWE 4X8WA 4X66E 4JI4I 5GMDA 3VYXA 1B62A 2YT4A 4BMJA 3V5RA 1HR0E 4DV4I 3P1XA 1T4LB 4AQYI 2B7TA 4L8NA 1Z5CA 1VISA 1T4OA 3K6QA 2LUQA 3LLHA 1WHQA 2B7VA 4LF4I 3T1YE 4GKKE 2ODRD 1BKNA 4BC7A 5LMUE 5A2QQ 2DEJA 1QZRA 3JTZA 4GEQB 2G7HA 1RQ0A 4DPXA 1PKPA 2V83A 4DR5E 1U2RA 4HACB 4HXZA 1XMQI 1N33I 4DV7E 2FV4B 2UXDE 2LE2A 2WZOA 5AE3A 2E1RA 2O1UA 1Z0VA 2MC5A 3T1HE 2V2ZA 2VQFI 4JI1I 1USUA 3C4BA 3PYEA 3F0NA 1NHJA 1HNZI 2A2CA 3K85A 5BR8E 4ZVIA 4YHHE 3Q1QA 1XMOI 4FWDA 3D4JA 2A2DA 3ZZUA 2Z5EA 3ZKBA 1UHZA 2L6MA 3B82A 2UUAI 2UU9E 1NHIA 2NUEA 3ZZ0A 1IBMI 2RSMA 4LF6E 1N34I 4BCAA 1ZBTA 2UUCI 4JI5E 3ADGA 4JV5E 3QT6A 2DB2A 2EFGA 2DMYA 2VE7C 2F8BA 2VQEI 1J5EI 4B3SI 4DV2I 4DV1E 1FKAE 1X47A 5ADZA 3ZOQB 2EWLA 2FTXB 1FJGE 5AASA 2K4VA 4TUIA 2X7IA 1EA6A 4JI2E 3LNUA 2JVAA 4LFAE 4JI3I 2YZTA 4B3RE 3OTOE 4TUGA 1YYKA 3ADLA 4DV5I 2J7KA 1GZ6A 5F3WA 1IBLE 4NXME 1ZBQA 4LF7E 1I94I 1XNQE 4LF9I 2ZBKB 1MX0A 4FN5A 1MU5A 4F9CB 2LTRA 4JI4E 2ZM6I 4IZKA 2RS6A 2GQ0A 3PYFA 4DPWA 4OX9I 1WUUA 1Y6ZA 4N3OA 4AQYE 1FWLA 2V89A 2M1SA 2HK3A 2V8PA 2O1TA 1NZ0A 2JOBA 4DV3I 4M0VA 4LF4E 3QT7A 2HKEA 4R03A 4FW9A 4B3TI 2IOQA 1S4EA 3DF6A 1DI2A 2VF1A 2V2VA 2UXCE 4JI8I 1KTVA 4JYAI 2Z5BB 1ZXMA 3J7AM 4DR7I 2B3TB 1GQEA 2Q2EB 5LL6R 5A2QC 1S16A 4P52A 2M7QA 3LMLA 1XMQE 1N33E 2E5LI 4KHPI 4K0KI 3ADIA 5IWAI 4PRXA 3LPSA 4DR3I 3IWBA 4JI1E 3AV0A 1N32E 3J7AG 4KZSA 1ZM3A 1Y4UA 2UUBI 1K47A 3PYDA 4URLA 1KVKA 1HNZE 4HACA 2BM1A 3M6AA 4DUYI 4DUZI 2LUPB 2MC6A 1KKHA 4DR4E 1H72C 4DV0I 4OOGC 4USKA 3H4LA 1FI4A 4LF8I 1XNRE 2M4IA 4BS9A 4DU8A 2HHHE 2JR1A 1IBME 4DV6I 1N36I 4B3MI 4HY1A 3J7Yp 3C4TA 1N34E 1RC7A 2UUCE 2L2KB 1HR0I 2DSYA 1B63A 3PYGA 3VK6A 4PU9A 3MSWA 1J5EE 4B3SE 2V2QA 5FWKA 3CWVA 1STUA 4LFCI 1A6FA 1N0VC 5AE2A 4DR2I 2HFUA 4IZJD 1Z0BA 5LMUI 1QU6A 2KONA 4I8OA 2N3HA 5DNYA 4DMIA 1HK7A 1J26A 2ODRC 2R42A 2LJHA 4DV5E 4JI7I 4WUDA 4DV7I 1SR9A 2VF3A 1D6TA 1ELOA 4L5NC 4MYTA 1HNXE 4LF9E 2O1VA 1YYOA 4DR1I 2DIXA 4P78A 2F4VE 2ZM6E 4GKJE 4X65E 1Z0TA 4HYMA 5LMNI 1Z0CA 2L92A 2LBSB 4OX9E 1KIJA 3OMLA 5BR8I 2V85A 5GMEA 2PNLA 4LU9A 2L2MA 2CZ9A 2N3GA 2WW4A 3FIGA 4DU7A 4DV3E 1EI1A 2LJPA 3HJCA 3WU6A 5IT9Q 4F9BB 2X36A 4JI8E 4JYAE 1O0WA 4DR7E 2LMZA 5AE1A 3HPZA 4DV4E 4JI5I 4JV5I 5CFFE 4YY3I 4KHPE 2FGGA 2Z5CB 4F54A 3VYYA 3JU0A 2L2NA 5L3JA 4WUBA 4DV1I 4JI6I 4DR3E 2Z5BA 4NXNI 3J80Q 1N0UA 2UUBE 2LTSA 4X64I 3F6GA 2V88A 5FLXC 2BV3A 2V87A 2BM0A 2JOXA 2AJ4A 3JAMC 1ZM9A 2B9DA 3HPSA 1Z5BA 4DPUA 2NPFA 3KWRA 4LFBI 4MYUA 2CG9A 1IBKI 2HKJA 4B3RI 3F6HA 4LTYA 4IZJB 3WU4A 5FLXQ 3B78A 4X62I 2VQFE 4JI0I 1YZ9A 2NUFA 3JAMQ 1XNQI 1Z59A 4B3ME 2V8QB 4LF5I 4WFTA 1Z0GA 2XEXA 3K17A 2UXBI 2RS7A 2H36X 1PVGA 1XMOE 1YYWA 3J81C 4DR6I 2JY9A 4BC9A 2PNMA 2IOPA 3LTOA 3AUZA 2V34A 2LRSA 1X49A 4LFCE 4M1KA 4XTJA 2IHR1 1XHKA 1FNMA 2UUAE 4DR2E 3IWCA 2OI2A 2MDRA 4P7DA 2NA2A 4I3HA 3J81Q 1HNWI 3IWDA 2UXCI 4FWGA 4F9AB 1WHNA 4X66I 3P06A 4BBYA 3ZZTA 4EMDA 3QT5A 4P7AA 4JI7E 3HXLA 2HFSA 2VQEE 4DV2E 4FWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRE A;  1ZXN A;  2GS8 A;  4DR1 E;  2L3C A;  3T1Y I;  4GKK I;  2CPN A;  1N32 I;  4Z7C A;  5LMN E;  3ZM7 A;  2ZIT A;  4DPY A;  4PRV A;  1FWK A;  1Z0W A;  4JI3 E;  4DPT A;  2NUG A;  4DR5 I;  4DR4 I;  1X48 A;  1ZM2 A;  2UXD I;  2R3V A;  3WU5 A;  1I94 E;  3K1J A;  4DXL A;  3T1H I;  1XNR I;  2KHX A;  4ED4 A;  2HHH I;  5IT9 C;  4M30 A;  4KQV A;  4USM A;  1OJ4 A;  4YY3 E;  2HK2 A;  4YHH I;  1H74 A;  4WUC A;  4M2Z A;  3WU3 A;  4JI6 E;  4NXN E;  1DAR A;  1ZM4 A;  1H7U A;  2DEI A;  4B3T E;  4X64 E;  1NHH A;  2UU9 I;  3ZKD A;  4R1F A;  4UT4 A;  3ADJ A;  1Z0E A;  3J80 C;  4LF6 I;  3QT8 A;  4LFB E;  1RR9 A;  2E5L E;  1IBK E;  4K0K E;  1MG7 A;  1PIE A;  1UIL A;  5IWA E;  4X62 E;  4JI0 E;  3HUL A;  2EZ6 A;  1HNX I;  4LF5 E;  1EKZ A;  1T4N A;  1Z5A A;  1H7S A;  3B8H A;  3V2U C;  4WYQ B;  2F4V I;  1H73 A;  4GKJ I;  4X65 I;  4JG4 A;  4Z7Y A;  1FJG I;  2UXB E;  4DUY E;  4DUZ E;  4DR6 E;  4JI2 I;  1UEK A;  4DV0 E;  3HTX A;  4LFA I;  4DKK A;  3OTO I;  3GON A;  2L3J A;  4UTG A;  4LF8 E;  1IBL I;  2RTX A;  4RPF A;  4NXM I;  4LF7 I;  4DV6 E;  2L33 A;  1N36 E;  1HNW E;  4X8W A;  4X66 E;  4JI4 I;  5GMD A;  3VYX A;  1B62 A;  2YT4 A;  3V5R A;  1HR0 E;  4DV4 I;  3P1X A;  1T4L B;  4AQY I;  2B7T A;  1Z5C A;  1VIS A;  1T4O A;  2LUQ A;  3LLH A;  1WHQ A;  2B7V A;  4LF4 I;  3T1Y E;  4GKK E;  1BKN A;  5LMU E;  5A2Q Q;  2DEJ A;  1QZR A;  4DPX A;  1RQ0 A;  1PKP A;  4DR5 E;  1U2R A;  4HAC B;  4HXZ A;  1XMQ I;  1N33 I;  4DV7 E;  2UXD E;  2E1R A;  1Z0V A;  3T1H E;  2V2Z A;  2VQF I;  4JI1 I;  3C4B A;  3PYE A;  3F0N A;  1NHJ A;  1HNZ I;  2A2C A;  5BR8 E;  4ZVI A;  4YHH E;  3Q1Q A;  1XMO I;  4FWD A;  3D4J A;  2A2D A;  3ZZU A;  3ZKB A;  1UHZ A;  3B82 A;  2UUA I;  2UU9 E;  1NHI A;  2NUE A;  3ZZ0 A;  1IBM I;  2RSM A;  4LF6 E;  1N34 I;  1ZBT A;  2UUC I;  4JI5 E;  3ADG A;  4JV5 E;  3QT6 A;  2DB2 A;  2EFG A;  2DMY A;  2VQE I;  1J5E I;  4B3S I;  4DV2 I;  4DV1 E;  1FKA E;  1X47 A;  1FJG E;  2X7I A;  1EA6 A;  4JI2 E;  3LNU A;  2JVA A;  4LFA E;  4JI3 I;  3OTO E;  1YYK A;  4B3R E;  4DV5 I;  3ADL A;  2J7K A;  1IBL E;  4NXM E;  4LF7 E;  1I94 I;  1XNQ E;  4LF9 I;  2ZBK B;  1MX0 A;  4FN5 A;  1MU5 A;  2LTR A;  4JI4 E;  2ZM6 I;  2RS6 A;  3PYF A;  4DPW A;  4OX9 I;  1WUU A;  4AQY E;  1FWL A;  2V8P A;  2HK3 A;  1NZ0 A;  4DV3 I;  4LF4 E;  3QT7 A;  2HKE A;  4FW9 A;  4B3T I;  1S4E A;  1DI2 A;  2V2V A;  4JI8 I;  2UXC E;  4JYA I;  1KTV A;  1ZXM A;  3J7A M;  4DR7 I;  2B3T B;  1GQE A;  2Q2E B;  5LL6 R;  4P52 A;  1S16 A;  5A2Q C;  1XMQ E;  1N33 E;  2E5L I;  4KHP I;  4K0K I;  3ADI A;  5IWA I;  4PRX A;  3LPS A;  4DR3 I;  4JI1 E;  1N32 E;  3J7A G;  1ZM3 A;  2UUB I;  1K47 A;  3PYD A;  4URL A;  1KVK A;  1HNZ E;  4HAC A;  2BM1 A;  3M6A A;  4DUY I;  4DUZ I;  2LUP B;  1KKH A;  4DR4 E;  1H72 C;  4DV0 I;  4OOG C;  4USK A;  3H4L A;  1FI4 A;  4LF8 I;  1XNR E;  4DU8 A;  2HHH E;  1IBM E;  4DV6 I;  1N36 I;  4B3M I;  4HY1 A;  3J7Y p;  3C4T A;  1N34 E;  1RC7 A;  2UUC E;  2L2K B;  1HR0 I;  1B63 A;  3PYG A;  4PU9 A;  1J5E E;  4B3S E;  2V2Q A;  3CWV A;  1STU A;  4LFC I;  1A6F A;  1N0V C;  4DR2 I;  2HFU A;  1Z0B A;  5LMU I;  1QU6 A;  2N3H A;  1J26 A;  2R42 A;  2LJH A;  4DV5 E;  4JI7 I;  4WUD A;  4DV7 I;  2VF3 A;  1D6T A;  1ELO A;  4MYT A;  1HNX E;  4LF9 E;  1YYO A;  4DR1 I;  2DIX A;  2F4V E;  2ZM6 E;  4GKJ E;  4X65 E;  1Z0T A;  4HYM A;  5LMN I;  1Z0C A;  2LBS B;  4OX9 E;  1KIJ A;  5BR8 I;  5GME A;  2L2M A;  2CZ9 A;  2N3G A;  2WW4 A;  4DU7 A;  4DV3 E;  1EI1 A;  2LJP A;  3WU6 A;  5IT9 Q;  2X36 A;  4JI8 E;  4JYA E;  1O0W A;  4DR7 E;  4DV4 E;  4JI5 I;  4JV5 I;  5CFF E;  4YY3 I;  4KHP E;  3VYY A;  5L3J A;  2L2N A;  4WUB A;  4DV1 I;  4JI6 I;  4DR3 E;  4NXN I;  3J80 Q;  1N0U A;  2UUB E;  2LTS A;  4X64 I;  5FLX C;  2BV3 A;  2BM0 A;  2AJ4 A;  3JAM C;  1ZM9 A;  1Z5B A;  4DPU A;  2NPF A;  4LFB I;  4MYU A;  1IBK I;  2HKJ A;  4B3R I;  3WU4 A;  5FLX Q;  3B78 A;  4X62 I;  2VQF E;  4JI0 I;  1YZ9 A;  2NUF A;  3JAM Q;  1XNQ I;  1Z59 A;  4B3M E;  4LF5 I;  4WFT A;  1Z0G A;  2XEX A;  3K17 A;  2UXB I;  2RS7 A;  1PVG A;  1XMO E;  1YYW A;  3J81 C;  4DR6 I;  2JY9 A;  3LTO A;  4M1K A;  2V34 A;  2LRS A;  1X49 A;  4LFC E;  4XTJ A;  2IHR 1;  1XHK A;  1FNM A;  2UUA E;  4DR2 E;  2OI2 A;  2MDR A;  2NA2 A;  4I3H A;  3J81 Q;  1HNW I;  2UXC I;  4FWG A;  1WHN A;  4X66 I;  3ZZT A;  4EMD A;  3QT5 A;  4P7A A;  4JI7 E;  2HFS A;  2VQE E;  4DV2 E;  4FWH A; 
#chains in the Genus database with same CATH topology
 1E3P A;  2YTG A;  1RRE A;  1Y5Y A;  1ZXN A;  2GS8 A;  2WBU A;  4DR1 E;  2EM8 A;  2L3C A;  3T1Y I;  4GKK I;  5K36 B;  4O5G A;  2CPN A;  5DRO A;  1N32 I;  4Z7C A;  2EMH A;  5LMN E;  3ZM7 A;  2ZIT A;  4DPY A;  2YTQ A;  1YPN A;  1F2I G;  5KL3 A;  4NHR A;  4PRV A;  3RMP A;  1FWK A;  4BA2 A;  2JEB B;  2EMK A;  1Z0W A;  4JI3 E;  4DPT A;  2NUG A;  2O1W A;  1JK2 A;  4DR5 I;  4DR4 I;  2HGH A;  1MEY C;  1X48 A;  2L8T A;  5KL5 A;  1ZM2 A;  2BA1 G;  2UXD I;  2R3V A;  3WU5 A;  2JYA A;  1QNT A;  1I94 E;  2F1D A;  3K1J A;  4DXL A;  3M85 G;  3T1H I;  1XNR I;  2KHX A;  4ED4 A;  1USV A;  4FW3 A;  5IV8 B;  3BID A;  1EH6 A;  2ENC A;  5DRQ A;  5JEA A;  2HHH I;  5IT9 C;  3DJW A;  4M30 A;  4KQV A;  2BB8 A;  3H09 A;  3Q6M A;  2PNZ B;  4USM A;  3HQ1 A;  1OJ4 A;  1X6E A;  4FWH A;  2NN6 C;  3PRY A;  2LCE A;  4IS1 C;  2EQ1 A;  4YY3 E;  1OYP A;  2HK2 A;  4YHH I;  1H74 A;  4WUC A;  1A1H A;  4BHC A;  5DNL A;  2CGE A;  4F6M A;  2EMC A;  2JP9 A;  4M2Z A;  3WU3 A;  4LCG A;  2EM2 A;  2EPX A;  4JI6 E;  2JEA B;  3NZK A;  4NXN E;  1DAR A;  1ZM4 A;  1MGT A;  2DLK A;  1ZU1 A;  1H7U A;  2DEI A;  4B3T E;  1G2D C;  4X64 E;  2PO1 B;  1NHH A;  1PJT A;  2V86 A;  3ZKD A;  2UU9 I;  4R1F A;  4UT4 A;  4IJD A;  1DQ3 A;  3ADJ A;  2EM0 A;  2BR2 B;  3CDJ A;  1Z0E A;  3H1C A;  2YSP A;  3J80 C;  4FK5 C;  2Z5C A;  4LF6 I;  3CDI A;  2LV2 A;  5K36 D;  2CTD A;  5DRR A;  3QT8 A;  5T6J A;  2EM5 A;  4WSP A;  1WXR A;  4LFB E;  2E5L E;  1RR9 A;  2C39 A;  4BA1 A;  5K36 F;  1IBK E;  4K0K E;  2YU8 A;  2YTD A;  1MG7 A;  1PIE A;  1UIL A;  2YRH A;  5IWA E;  2E1M A;  4X62 E;  1A1G A;  4R2D A;  5K36 E;  4JI0 E;  4MLV A;  3B4T A;  3HUL A;  1Y4S A;  2EOS A;  3C6M A;  2EZ6 A;  1HNX I;  4LF5 E;  2WNR A;  2JWO A;  1EKZ A;  1T4N A;  1Z5A A;  1H7S A;  2EM4 A;  2YTI A;  4WXD A;  3B8H A;  3V2U C;  4WYQ B;  2F4V I;  1H73 A;  4GKJ I;  4X65 I;  4JG4 A;  4Z7Y A;  1FJG I;  2UXB E;  5C0X C;  4R8O A;  4WPY A;  3Q6N A;  2YTP A;  3BF2 A;  4LCH A;  4DUY E;  4DUZ E;  4DR6 E;  4MQY A;  4IZJ A;  1UDQ A;  4JI2 I;  4IZK B;  4MU3 A;  1UEK A;  4QNK A;  4DV0 E;  2E72 A;  3KZZ A;  1UDS A;  4LOM A;  3HTX A;  4LFA I;  4DKK A;  3OTO I;  3GON A;  2L3J A;  2EN3 A;  4MLQ A;  4UTG A;  4LF8 E;  1IBL I;  2ADR A;  2EL5 A;  2RTX A;  4LCF A;  4Q28 A;  4RPF A;  4NXM I;  1EH7 A;  2KOU A;  4LF7 I;  4J8Z A;  1YHC A;  2R76 A;  4DV6 E;  2L33 A;  1N36 E;  2RQL A;  1HNW E;  4X8W A;  4O24 A;  4X66 E;  4JI4 I;  5GMD A;  4OO1 C;  3VYX A;  1B62 A;  2YT4 A;  4ZYD A;  1YSA C;  2C38 A;  1R6M A;  2EN8 A;  4BMJ A;  2MDG A;  3V5R A;  1HR0 E;  4DV5 I;  4DV4 I;  3P1X A;  1T4L B;  4FW6 A;  4AQY I;  2B7T A;  4L8N A;  2EPP A;  1Z5C A;  1VIS A;  4NBQ A;  1T4O A;  3K6Q A;  3VHT B;  4DV2 E;  2LUQ A;  3LLH A;  3P76 A;  1WHQ A;  2B7V A;  4LF4 I;  3T1Y E;  4GKK E;  1X3C A;  2ODR D;  4F6N A;  1BKN A;  4BC7 A;  5KL7 A;  2ELZ A;  1UN6 B;  2LO3 A;  5LMU E;  5A2Q Q;  2DEJ A;  1QZR A;  1ZAA C;  3JTZ A;  2EOZ A;  1XXE A;  4GEQ B;  2YU5 A;  1KJK A;  4R2E A;  2ELY A;  2G7H A;  1RQ0 A;  1A1J A;  1IQS A;  1PKP A;  4DPX A;  1BBG A;  2VRD A;  2V83 A;  3THN A;  2EL4 A;  2M9A A;  2HJJ A;  4DR5 E;  1U2R A;  4HAC B;  4HXZ A;  1XMQ I;  1N33 I;  2EOY A;  4DV7 E;  2ENA A;  2N8X A;  2FV4 B;  2UXD E;  2LE2 A;  5K36 A;  2LT7 A;  2WZO A;  5AE3 A;  2E1R A;  3KZY A;  2O1U A;  1Z0V A;  2MC5 A;  3T1H E;  2V2Z A;  2MKN A;  2VQF I;  5AC5 A;  1R6L A;  4JI1 I;  1USU A;  3C4B A;  2LJU A;  3F0N A;  3PYE A;  3M99 B;  2JEB A;  5JEA C;  3THO B;  1NHJ A;  4MU1 A;  1HNZ I;  2A2C A;  4AM3 A;  3K85 A;  5BR8 E;  2WBS A;  1A1L A;  2VES A;  3PS2 A;  4ZVI A;  4YHH E;  3Q1Q A;  1YUI A;  2EMB A;  1T38 A;  3UK3 C;  1XMO I;  2EOE A;  1UBD C;  4FWD A;  3D4J A;  2A2D A;  3ZZU A;  5A69 A;  1JK1 A;  2Z5E A;  3ZKB A;  1UHZ A;  2L6M A;  3U1Y A;  3P3E A;  3B82 A;  2UUA I;  2PNZ A;  2IER A;  2UU9 E;  1NHI A;  2NUE A;  2LVH A;  1TN9 A;  3ZZ0 A;  1IBM I;  2EOR A;  2I13 A;  2RSM A;  4MDT A;  4IFD C;  5A6A A;  2GLI A;  2YWQ A;  4LF6 E;  2PO2 B;  1N34 I;  4BCA A;  1ZBT A;  1AAY A;  5KL2 A;  2PO0 B;  2UUC I;  4JI5 E;  3ADG A;  4JV5 E;  3GLL A;  1X6H A;  3QT6 A;  2DB2 A;  2EFG A;  2JEA A;  2DMY A;  2EM6 A;  2EN1 A;  2VE7 C;  2PRT A;  1WRJ A;  2F8B A;  3GCM A;  2VQE I;  1J5E I;  2PO1 A;  4B3S I;  4DV2 I;  4DV1 E;  3HKM A;  2BR2 A;  1FKA E;  1X47 A;  5ADZ A;  5A6B A;  3ZOQ B;  2EWL A;  2EPK X;  4WSG A;  2FTX B;  2YTE A;  1FJG E;  3M85 D;  5AAS A;  2EQ0 A;  2EOI A;  2JXP A;  2K4V A;  4TUI A;  2EPM X;  3EPL A;  2X7I A;  1EA6 A;  4RH8 A;  4JI2 E;  3LNU A;  5IXM B;  1KYQ A;  2JVA A;  2EMF A;  1RHY A;  2WP8 B;  2CVE A;  4LFA E;  4JI3 I;  2YZT A;  3OTO E;  4TUG A;  1YYK A;  4B3R E;  3ADL A;  1E3H A;  2J7K A;  1GZ6 A;  5F3W A;  1IBL E;  4NXM E;  1ZBQ A;  1YFH A;  4LF7 E;  4FW5 A;  1PDA A;  1I94 I;  1XNQ E;  4LF9 I;  2YRK A;  2ZBK B;  2O3Z A;  5KL6 A;  1MX0 A;  4FN5 A;  2WBT A;  1MU5 A;  4F9C B;  2LTR A;  4JI4 E;  2ZM6 I;  4IZK A;  2DGC A;  4IFD B;  2EMW A;  2RS6 A;  2GQ0 A;  3PYF A;  4DPW A;  4OX9 I;  1WUU A;  1Y6Z A;  2EMA A;  4N3O A;  4AQY E;  1FWL A;  2NN6 B;  3EPK A;  2JT2 A;  1B69 A;  2EM3 A;  2V89 A;  2M1S A;  2EPL X;  2HK3 A;  2V8P A;  2JPA A;  2O1T A;  1NZ0 A;  2EOF A;  2JOB A;  2YTJ A;  3MHH C;  4DV3 I;  4M0V A;  4LF4 E;  4O43 A;  2YTF A;  3QT7 A;  4HTG A;  2JE6 B;  2HKE A;  4R03 A;  4FW9 A;  4J3D A;  4B3T I;  2IOQ A;  1S4E A;  3DF6 A;  1DI2 A;  2VF1 A;  2V2V A;  2UXC E;  4JI8 I;  1KTV A;  4JYA I;  2Z5B B;  5A6J A;  1ZXM A;  3J7A M;  4DR7 I;  5EL9 A;  2B3T B;  1GQE A;  3BGH A;  4R2R A;  2CSH A;  2Q2E B;  5LL6 R;  5A2Q C;  2DLQ A;  1S16 A;  4P52 A;  1GTK A;  2EML A;  2M7Q A;  4RHB B;  3LML A;  1XMQ E;  1N33 E;  1L4S A;  2E5L I;  2EPU A;  3M7N G;  4KHP I;  2AE8 A;  3P3G A;  4K0K I;  1RMD A;  3ADI A;  1UDN A;  2ENH A;  5IWA I;  4PRX A;  3LPS A;  3UHM A;  5EKW A;  4DR3 I;  3IWB A;  4JI1 E;  3AV0 A;  1N32 E;  3J7A G;  2EMX A;  4KZS A;  1ZM3 A;  1Y4U A;  2UUB I;  2EMY A;  1K47 A;  4WXC A;  3PYD A;  4URL A;  1TF3 A;  1KVK A;  1HNZ E;  4HAC A;  2BM1 A;  2HC5 A;  3M6A A;  4DUY I;  5C0X B;  4DUZ I;  4X9J A;  5AC4 A;  2NAB A;  1BB8 A;  2LUP B;  2MC6 A;  1KKH A;  1LLM C;  4DR4 E;  3PS3 A;  2EMZ A;  1H72 C;  4DV0 I;  4IFD D;  4OOG C;  2CT1 A;  4R2Q A;  4KWY A;  3H4L A;  1FI4 A;  4USK A;  2YTN A;  4IFD F;  4LF8 I;  2GHF A;  4U3D A;  1XNR E;  1UDO A;  2NN6 D;  2M4I A;  4BHB A;  4BS9 A;  4DU8 A;  1P42 A;  2HHH E;  2JR1 A;  2EPO A;  1IBM E;  2I9I A;  2NN6 F;  4DV6 I;  4IFD E;  1N36 I;  4B3M I;  4HY1 A;  3J7Y p;  2EN6 A;  3C4T A;  5KL4 A;  1N34 E;  2DMI A;  2EN7 A;  1RC7 A;  4FW7 A;  2UUC E;  1TF6 A;  2NN6 E;  2L2K B;  5LLQ A;  2EE8 A;  4OO1 B;  1YUJ A;  2R1F A;  1HR0 I;  2C37 B;  2DSY A;  1B63 A;  2EN4 A;  2Q8U A;  1N3G A;  3QG5 C;  3VK6 A;  2EOQ A;  1NEI A;  3MSW A;  1J5E E;  3PYG A;  4PU9 A;  4B3S E;  2V2Q A;  1OYS A;  5FWK A;  2EL6 A;  3CWV A;  1STU A;  4LFC I;  5ELW A;  1A6F A;  4WX9 A;  2BA0 D;  2RSI A;  4U3B A;  2D9H A;  1N0V C;  5AE2 A;  2PO2 A;  4DR2 I;  2HFU A;  3L7Z B;  2PO0 A;  4IZJ D;  2EMG A;  1Z0B A;  5LMU I;  2EM7 A;  1QU6 A;  2KON A;  4I8O A;  2N3H A;  2EPA A;  5DNY A;  4DMI A;  1HK7 A;  3U1K A;  1J26 A;  3PS1 A;  2ODR C;  2YTO A;  2J7J A;  2R42 A;  2LJH A;  4DV5 E;  4JI7 I;  4OZE A;  4WUD A;  4DV7 I;  1SR9 A;  4BA2 B;  2VF3 A;  3TQM A;  5C0X D;  1D6T A;  1ELO A;  4L5N C;  4MYT A;  1HNX E;  4LF9 E;  1IMU A;  2O1V A;  4N4R B;  2BA1 D;  5C0X F;  1YYO A;  4DR1 I;  4FW4 A;  3EQ1 A;  2DIX A;  1P47 A;  4P78 A;  2F4V E;  2ZM6 E;  2J65 A;  4GKJ E;  4X65 E;  3DD6 A;  1Z0T A;  4HYM A;  5LMN I;  1Z0C A;  2WP8 A;  2L92 A;  2LBS B;  1OYR A;  5C0X E;  4OX9 E;  1KIJ A;  5JEA B;  3OML A;  5BR8 I;  4QNJ A;  2V85 A;  5GME A;  2PNL A;  3BBG A;  4LU9 A;  2EPZ A;  1X6F A;  2L2M A;  2CZ9 A;  2N3G A;  2WW4 A;  3FIG A;  2GPI A;  4DU7 A;  2GO3 A;  4OO1 D;  4DV3 E;  1EI1 A;  2LJP A;  2A25 A;  2EM9 A;  4R2A A;  3HJC A;  3WU6 A;  1A1I A;  5IT9 Q;  1AH5 A;  2EOX A;  4F9B B;  4NZV A;  4OO1 F;  2X36 A;  4IFD A;  4AIM A;  4JI8 E;  1X5W A;  4JYA E;  1O0W A;  4OO1 E;  4DR7 E;  2LMZ A;  5AE1 A;  2NN6 A;  3HPZ A;  4DV4 E;  5DRP A;  4JI5 I;  4JV5 I;  5CFF E;  2EOO A;  4YY3 I;  2EN2 A;  4KHP E;  2EJ4 A;  2FGG A;  2Z5C B;  2JE6 A;  4GZN C;  4F54 A;  1Y60 A;  4R2S A;  3VYY A;  3JU0 A;  2L2N A;  5L3J A;  2C39 B;  4BA1 B;  4WUB A;  4DV1 I;  4JI6 I;  4DR3 E;  2Z5B A;  4NXN I;  3P3C A;  3ECR A;  3J80 Q;  1N0U A;  2UUB E;  2LTS A;  4X64 I;  3F6G A;  2V88 A;  5TSE A;  5FLX C;  2V87 A;  2BV3 A;  4Q35 B;  2BM0 A;  3L00 A;  4R2P A;  2JOX A;  2AJ4 A;  1Z1B A;  4R2C A;  3JAM C;  1A1F A;  1ZM9 A;  2WNR B;  3MHS C;  2B9D A;  3HPS A;  1Z5B A;  4MU0 A;  4DPU A;  4M9V C;  2NPF A;  2EOH A;  3KWR A;  4LFB I;  1WJP A;  4MU4 A;  1VI7 A;  2CG9 A;  4MYU A;  1IBK I;  2HKJ A;  1PJQ A;  2EPR A;  5JEA D;  2EQ3 A;  4B3R I;  1EH8 A;  3F6H A;  4LTY A;  4IZJ B;  3WU4 A;  5FLX Q;  1G2F C;  3B78 A;  1ZR9 A;  1IQO A;  4X62 I;  5JEA F;  5K36 C;  2VQF E;  4JI0 I;  2EPC A;  1YZ9 A;  2NUF A;  3JAM Q;  2EMI A;  1XNQ I;  1PJS A;  1Z59 A;  1NCS A;  4B3M E;  2V8Q B;  4LF5 I;  2K7I A;  4WFT A;  3GME A;  1YH8 A;  5JEA E;  1Z0G A;  5C0X A;  5A6K A;  4IS9 A;  2XEX A;  3K17 A;  2UXB I;  2RS7 A;  2H36 X;  1PVG A;  5DNX A;  2EOM A;  1XMO E;  3J81 C;  1YYW A;  4DR6 I;  2JY9 A;  3KRN A;  4BC9 A;  2PNM A;  2IOP A;  5A6B D;  2EOJ A;  2C38 B;  3LTO A;  3AUZ A;  2V34 A;  2LRS A;  1X49 A;  4LFC E;  4M1K A;  4XTJ A;  4AID A;  2IHR 1;  2YSO A;  2EP3 A;  1BBO A;  1FNM A;  2YRM A;  1XHK A;  3M7N D;  4HEI A;  2UUA E;  4ZYE A;  4DR2 E;  3IWC A;  2OI2 A;  3EPH A;  4LPF A;  4F2J C;  2MDR A;  2GO4 A;  2MKD A;  4P7D A;  4OO1 A;  4ZYH A;  2NA2 A;  4I3H A;  1T39 A;  3J81 Q;  3IWD A;  3EPJ A;  2C37 A;  4F9A B;  4FWG A;  1HNW I;  1WHN A;  2UXC I;  4X66 I;  2RPC A;  4OKG A;  3P06 A;  4O4K A;  4ISA A;  4BBY A;  2IES A;  3ZZT A;  1DGC A;  4EMD A;  2YPN A;  2EPN A;  1A1K A;  3QT5 A;  4GQU A;  1SFE A;  4P7A A;  4JI7 E;  4ZYG A;  3HXL A;  2BBG A;  2HFS A;  2WCC 3;  2VQE E;  2BA0 G;  3C6K A;  2DRP A;  3L7Z A; 
#chains in the Genus database with same CATH homology
 1RRE A;  1ZXN A;  2GS8 A;  4DR1 E;  2L3C A;  3T1Y I;  4GKK I;  2CPN A;  1N32 I;  4Z7C A;  5LMN E;  3ZM7 A;  2ZIT A;  4DPY A;  4PRV A;  3RMP A;  1FWK A;  1Z0W A;  4JI3 E;  4DPT A;  2NUG A;  2O1W A;  4DR5 I;  4DR4 I;  1X48 A;  2L8T A;  1ZM2 A;  2UXD I;  2R3V A;  3WU5 A;  1I94 E;  3K1J A;  4DXL A;  3T1H I;  1XNR I;  2KHX A;  4ED4 A;  1USV A;  2HHH I;  5IT9 C;  3DJW A;  4M30 A;  4KQV A;  3Q6M A;  3H09 A;  4USM A;  3HQ1 A;  1OJ4 A;  3PRY A;  4YY3 E;  2HK2 A;  4YHH I;  1H74 A;  4WUC A;  2CGE A;  4M2Z A;  3WU3 A;  4JI6 E;  4NXN E;  1DAR A;  1ZM4 A;  1H7U A;  2DEI A;  4B3T E;  4X64 E;  1NHH A;  2V86 A;  2UU9 I;  3ZKD A;  4R1F A;  4UT4 A;  1DQ3 A;  3ADJ A;  1Z0E A;  3J80 C;  2Z5C A;  4LF6 I;  3QT8 A;  5T6J A;  1WXR A;  4WSP A;  4LFB E;  1RR9 A;  2E5L E;  1IBK E;  4K0K E;  1MG7 A;  1PIE A;  1UIL A;  5IWA E;  2E1M A;  4X62 E;  4JI0 E;  3HUL A;  1Y4S A;  2EZ6 A;  1HNX I;  4LF5 E;  2JWO A;  1EKZ A;  1T4N A;  1Z5A A;  1H7S A;  3B8H A;  3V2U C;  4WYQ B;  2F4V I;  1H73 A;  4GKJ I;  4X65 I;  4JG4 A;  4Z7Y A;  1FJG I;  2UXB E;  4R8O A;  4WPY A;  3Q6N A;  4DUY E;  4DUZ E;  4DR6 E;  4IZJ A;  4JI2 I;  4IZK B;  1UEK A;  4DV0 E;  3HTX A;  4LFA I;  4DKK A;  3OTO I;  3GON A;  2L3J A;  4UTG A;  4LF8 E;  1IBL I;  2RTX A;  4RPF A;  4NXM I;  4Q28 A;  2KOU A;  4LF7 I;  4J8Z A;  4DV6 E;  2L33 A;  1N36 E;  1HNW E;  4X8W A;  4X66 E;  4JI4 I;  5GMD A;  3VYX A;  1B62 A;  2YT4 A;  4BMJ A;  3V5R A;  1HR0 E;  4DV4 I;  3P1X A;  1T4L B;  4AQY I;  2B7T A;  4L8N A;  1Z5C A;  1VIS A;  1T4O A;  3K6Q A;  2LUQ A;  3LLH A;  1WHQ A;  2B7V A;  4LF4 I;  3T1Y E;  4GKK E;  2ODR D;  1BKN A;  4BC7 A;  5LMU E;  5A2Q Q;  2DEJ A;  1QZR A;  3JTZ A;  4GEQ B;  2G7H A;  1RQ0 A;  4DPX A;  1PKP A;  2V83 A;  4DR5 E;  1U2R A;  4HAC B;  4HXZ A;  1XMQ I;  1N33 I;  4DV7 E;  2FV4 B;  2UXD E;  2LE2 A;  2WZO A;  5AE3 A;  2E1R A;  2O1U A;  1Z0V A;  2MC5 A;  3T1H E;  2V2Z A;  2VQF I;  4JI1 I;  1USU A;  3C4B A;  3PYE A;  3F0N A;  1NHJ A;  1HNZ I;  2A2C A;  3K85 A;  5BR8 E;  4ZVI A;  4YHH E;  3Q1Q A;  1XMO I;  4FWD A;  3D4J A;  2A2D A;  3ZZU A;  2Z5E A;  3ZKB A;  1UHZ A;  2L6M A;  3B82 A;  2UUA I;  2UU9 E;  1NHI A;  2NUE A;  3ZZ0 A;  1IBM I;  2RSM A;  4LF6 E;  1N34 I;  4BCA A;  1ZBT A;  2UUC I;  4JI5 E;  3ADG A;  4JV5 E;  3QT6 A;  2DB2 A;  2EFG A;  2DMY A;  2VE7 C;  2F8B A;  2VQE I;  1J5E I;  4B3S I;  4DV2 I;  4DV1 E;  1FKA E;  1X47 A;  5ADZ A;  3ZOQ B;  2EWL A;  2FTX B;  1FJG E;  5AAS A;  2K4V A;  4TUI A;  2X7I A;  1EA6 A;  4JI2 E;  3LNU A;  2JVA A;  4LFA E;  4JI3 I;  2YZT A;  4B3R E;  3OTO E;  4TUG A;  1YYK A;  3ADL A;  4DV5 I;  2J7K A;  1GZ6 A;  5F3W A;  1IBL E;  4NXM E;  1ZBQ A;  4LF7 E;  1I94 I;  1XNQ E;  4LF9 I;  2ZBK B;  1MX0 A;  4FN5 A;  1MU5 A;  4F9C B;  2LTR A;  4JI4 E;  2ZM6 I;  4IZK A;  2RS6 A;  2GQ0 A;  3PYF A;  4DPW A;  4OX9 I;  1WUU A;  1Y6Z A;  4N3O A;  4AQY E;  1FWL A;  2V89 A;  2M1S A;  2HK3 A;  2V8P A;  2O1T A;  1NZ0 A;  2JOB A;  4DV3 I;  4M0V A;  4LF4 E;  3QT7 A;  2HKE A;  4R03 A;  4FW9 A;  4B3T I;  2IOQ A;  1S4E A;  3DF6 A;  1DI2 A;  2VF1 A;  2V2V A;  2UXC E;  4JI8 I;  1KTV A;  4JYA I;  2Z5B B;  1ZXM A;  3J7A M;  4DR7 I;  2B3T B;  1GQE A;  2Q2E B;  5LL6 R;  5A2Q C;  1S16 A;  4P52 A;  2M7Q A;  3LML A;  1XMQ E;  1N33 E;  2E5L I;  4KHP I;  4K0K I;  3ADI A;  5IWA I;  4PRX A;  3LPS A;  4DR3 I;  3IWB A;  4JI1 E;  3AV0 A;  1N32 E;  3J7A G;  4KZS A;  1ZM3 A;  1Y4U A;  2UUB I;  1K47 A;  3PYD A;  4URL A;  1KVK A;  1HNZ E;  4HAC A;  2BM1 A;  3M6A A;  4DUY I;  4DUZ I;  2LUP B;  2MC6 A;  1KKH A;  4DR4 E;  1H72 C;  4DV0 I;  4OOG C;  4USK A;  3H4L A;  1FI4 A;  4LF8 I;  1XNR E;  2M4I A;  4BS9 A;  4DU8 A;  2HHH E;  2JR1 A;  1IBM E;  4DV6 I;  1N36 I;  4B3M I;  4HY1 A;  3J7Y p;  3C4T A;  1N34 E;  1RC7 A;  2UUC E;  2L2K B;  1HR0 I;  2DSY A;  1B63 A;  3PYG A;  3VK6 A;  4PU9 A;  3MSW A;  1J5E E;  4B3S E;  2V2Q A;  5FWK A;  3CWV A;  1STU A;  4LFC I;  1A6F A;  1N0V C;  5AE2 A;  4DR2 I;  2HFU A;  4IZJ D;  1Z0B A;  5LMU I;  1QU6 A;  2KON A;  4I8O A;  2N3H A;  5DNY A;  4DMI A;  1HK7 A;  1J26 A;  2ODR C;  2R42 A;  2LJH A;  4DV5 E;  4JI7 I;  4WUD A;  4DV7 I;  1SR9 A;  2VF3 A;  1D6T A;  1ELO A;  4L5N C;  4MYT A;  1HNX E;  4LF9 E;  2O1V A;  1YYO A;  4DR1 I;  2DIX A;  4P78 A;  2F4V E;  2ZM6 E;  4GKJ E;  4X65 E;  1Z0T A;  4HYM A;  5LMN I;  1Z0C A;  2L92 A;  2LBS B;  4OX9 E;  1KIJ A;  3OML A;  5BR8 I;  2V85 A;  5GME A;  2PNL A;  4LU9 A;  2L2M A;  2CZ9 A;  2N3G A;  2WW4 A;  3FIG A;  4DU7 A;  4DV3 E;  1EI1 A;  2LJP A;  3HJC A;  3WU6 A;  5IT9 Q;  4F9B B;  2X36 A;  4JI8 E;  4JYA E;  1O0W A;  4DR7 E;  2LMZ A;  5AE1 A;  3HPZ A;  4DV4 E;  4JI5 I;  4JV5 I;  5CFF E;  4YY3 I;  4KHP E;  2FGG A;  2Z5C B;  4F54 A;  3VYY A;  3JU0 A;  2L2N A;  5L3J A;  4WUB A;  4DV1 I;  4JI6 I;  4DR3 E;  2Z5B A;  4NXN I;  3J80 Q;  1N0U A;  2UUB E;  2LTS A;  4X64 I;  3F6G A;  2V88 A;  5FLX C;  2BV3 A;  2V87 A;  2BM0 A;  2JOX A;  2AJ4 A;  3JAM C;  1ZM9 A;  2B9D A;  3HPS A;  1Z5B A;  4DPU A;  2NPF A;  3KWR A;  4LFB I;  4MYU A;  2CG9 A;  1IBK I;  2HKJ A;  4B3R I;  3F6H A;  4LTY A;  4IZJ B;  3WU4 A;  5FLX Q;  3B78 A;  4X62 I;  2VQF E;  4JI0 I;  1YZ9 A;  2NUF A;  3JAM Q;  1XNQ I;  1Z59 A;  4B3M E;  2V8Q B;  4LF5 I;  4WFT A;  1Z0G A;  2XEX A;  3K17 A;  2UXB I;  2RS7 A;  2H36 X;  1PVG A;  1XMO E;  1YYW A;  3J81 C;  4DR6 I;  2JY9 A;  4BC9 A;  2PNM A;  2IOP A;  3LTO A;  3AUZ A;  2V34 A;  2LRS A;  1X49 A;  4LFC E;  4M1K A;  4XTJ A;  2IHR 1;  1XHK A;  1FNM A;  2UUA E;  4DR2 E;  3IWC A;  2OI2 A;  2MDR A;  4P7D A;  2NA2 A;  4I3H A;  3J81 Q;  1HNW I;  3IWD A;  2UXC I;  4FWG A;  4F9A B;  1WHN A;  4X66 I;  3P06 A;  4BBY A;  3ZZT A;  4EMD A;  3QT5 A;  4P7A A;  4JI7 E;  3HXL A;  2HFS A;  2VQE E;  4DV2 E;  4FWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...