2UUAE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uuaE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uuaE02
1FWLA 4DR3I 3J80Q 1A6FA 1X48A 3C4TA 2HHHE 1YYKA 2DIXA 2UXDI 1UEKA 4DUZE 5FLXQ 2UU9I 1HR0I 4FWGA 2L2KB 3ADIA 3PYGA 3PYFA 4LF4I 4DV3I 1BKNA 1N0UA 1ZM2A 4DR5I 2LJHA 4NXNI 1N32I 1MG7A 4X64I 4OX9I 4DV4I 4USKA 2R3VA 4X66I 5GMDA 1EKZA 2E5LE 1NHIA 2HKEA 2MDRA 4JI8E 2UUCE 1N36E 5LMUE 3K1JA 4UTGA 3WU3A 4JI2I 4JI6I 1RC7A 1QZRA 1IBLI 3ADJA 4HXZA 2UXBE 4I3HA 1N33E 1K47A 2VQEI 3J7AG 4GKJI 4LF9I 4DV1E 4DR4E 2HFUA 4OOGC 1KIJA 1HNZE 3PYEA 4DPUA 1OJ4A 3B82A 4JI0I 2EFGA 1FI4A 4DKKA 2RSMA 2NPFA 4B3SI 1N0VC 4B3RE 3GONA 3QT8A 3T1YI 4AQYE 3VYXA 4MYUA 1WHQA 3OTOE 4JG4A 3H4LA 4EMDA 3LPSA 1B62A 3JAMC 4WYQB 5LMNE 3C4BA 4ZVIA 5BR8E 1HNWE 2DB2A 3V5RA 1NZ0A 2RTXA 4LF8I 1QU6A 4DUYE 2HHHI 4JV5I 4DR2I 4M30A 4DUZI 4WUCA 4DR1I 4DV2E 1N34E 3HTXA 1MX0A 2RS6A 1XNQE 1D6TA 4ED4A 1HNXE 3J81C 1YZ9A 1IBME 2E5LI 1J5EI 4LFBI 1Z0CA 2L2NA 2J7KA 4JI8I 1Z5CA 2UUCI 4K0KI 1N36I 1EI1A 5LMUI 2L33A 4JI3E 4NXME 2DEJA 4WUBA 4GKKI 2UXBI 1N33I 4LF6E 2CZ9A 2UUAE 1Z5BA 4B3TI 4DR4I 2VF3A 3JAMQ 2UXCI 4LF7E 1PVGA 1HNZI 1DARA 3P1XA 4X8WA 1PIEA 2B7TA 1FJGE 2DEIA 4FWDA 4LFAE 4X65I 2V8PA 2EZ6A 4JI1E 5IWAE 4AQYI 4JI4E 2KHXA 2ZM6I 3J7Yp 2UUBI 4B3ME 4XTJA 4DPXA 2E1RA 1FWKA 4DR6E 4FWHA 5LMNI 5BR8I 4Z7YA 1YYOA 3LTOA 3J81Q 1KTVA 1XMOE 2NUGA 3WU6A 4DXLA 4DPTA 1H73A 1ZXNA 2WW4A 2X36A 3VYYA 2V2QA 4YY3E 2JVAA 1MU5A 4FN5A 4DR7I 2IHR1 3M6AA 1N34I 1UILA 1X49A 1XNQI 1GQEA 2LRSA 1EA6A 1T4OA 4DU8A 4DR3E 1KVKA 1T4NA 5A2QC 2LUQA 4JI3I 2UU9E 4DV0E 2HK2A 4LF4E 1I94I 3LNUA 2UUAI 4LF5E 4NXNE 1WHNA 4JYAE 1IBKE 2RS7A 3WU5A 1N32E 4X64E 4DV4E 2V34A 4LF7I 1ZM3A 3WU4A 4WFTA 4HACB 4PRVA 1PKPA 4DV5E 4X62E 2NUEA 2ZBKB 4KHPE 2BM0A 4LFAI 1YYWA 2F4VE 2ZITA 3QT7A 4JI1I 1KKHA 2NA2A 4GKJE 4LF9E 2L3CA 3J7AM 4YHHE 4DV7E 1ELOA 2AJ4A 2L2MA 5LL6R 4DU7A 1T4LB 1Z0TA 1RR9A 1WUUA 2X7IA 4M2ZA 1ZBTA 4DV1I 4JI5E 4P7AA 1H74A 1Z59A 1RREA 2HKJA 1X47A 2Q2EB 3K17A 1RQ0A 1DI2A 3ZZUA 3T1HE 4PRXA 4P52A 1FKAE 4DV6E 4B3RI 3HULA 2B3TB 2LUPB 2LTSA 3OTOI 4JV5E 4DR2E 1XNRE 1ZM9A 4DR1E 4DV0I 2VQFE 4DPYA 1ZM4A 1H7SA 1S4EA 1XMQE 2V2ZA 2R42A 4UT4A 1HNWI 4LF5I 4LFCE 2V2VA 2B7VA 4JYAI 1IBKI 1U2RA 4DUYI 2L3JA 4JI7E 2NUFA 4LFBE 1J5EE 3LLHA 1S16A 5CFFE 1NHHA 2BV3A 4K0KE 2LTRA 4Z7CA 4DV2I 4DV5I 3ADLA 4X62I 5IT9C 4KHPI 2F4VI 1UHZA 4GKKE 4DPWA 1J26A 1H7UA 4B3TE 3ZKBA 2A2CA 2OI2A 1HNXI 2A2DA 4R1FA 1IBMI 4YHHI 2DMYA 2UXCE 2HK3A 4DV7I 2UXDE 1Z0EA 3F0NA 4URLA 2N3HA 1HR0E 1Z0GA 4PU9A 1B63A 4NXMI 4DV3E 1Z0VA 3QT5A 4LF6I 3B8HA 4M1KA 4DR5E 4X65E 3QT6A 3CWVA 4JI5I 2ZM6E 4OX9E 4X66E 2UUBE 4HYMA 4MYTA 1Z5AA 3J80C 1FJGI 3T1HI 4JI2E 2GS8A 4JI6E 3ZZTA 4DV6I 1IBLE 3ADGA 5FLXC 4FW9A 2LBSB 4USMA 5IWAI 2VQEE 1ZXMA 4JI4I 2YT4A 3PYDA 5IT9Q 4B3MI 5GMEA 4DR6I 4DR7E 1Z0WA 1XNRI 1H72C 3Q1QA 1Z0BA 3ZZ0A 2VQFI 4KQVA 1XMQI 4JI0E 2BM1A 2JY9A 1FNMA 4LFCI 4B3SE 1XMOI 5A2QQ 4JI7I 3T1YE 2N3GA 2CPNA 4HACA 3D4JA 1STUA 1O0WA 4YY3I 2LJPA 3ZM7A 1NHJA 1VISA 3B78A 3V2UC 4HY1A 4RPFA 2XEXA 1I94E 4WUDA 3ZKDA 4LF8E 5L3JA 1XHKA 2HFSA
chains in the Genus database with same CATH superfamily
2PO0B 1FWLA 2JE6B 4MU1A 4DR3I 3J80Q 1A6FA 2LO3A 1PJQA 1X48A 3C4TA 2IERA 2EM0A 2EMYA 2HHHE 2V87A 1YYKA 1Y60A 2DIXA 2UXDI 1UBDC 1UEKA 1DQ3A 2PNLA 4DUZE 2G7HA 5FLXQ 3ZOQB 4ISAA 3IWBA 1HR0I 4DV5I 4FWGA 2YU8A 4OKGA 2L2KB 4U3DA 5A6BA 5K36C 2RQLA 3ADIA 4F2JC 3PYGA 3PYFA 1DGCA 4LF4I 4DV3I 1BKNA 1N0UA 3FIGA 5AASA 1ZM2A 2O1WA 2MKNA 4DR5I 5JEAF 2LJHA 2BR2A 2L6MA 3B4TA 3L7ZB 4NXNI 5K36E 1N32I 1MG7A 1YFHA 2EPXA 3P06A 4X64I 4OX9I 4DV4I 4USKA 2R3VA 4X66I 4Q28A 3PS1A 5GMDA 1EKZA 2JOXA 2E5LE 2EPLX 1NHIA 2EWLA 2HKEA 2RSIA 1A1GA 2MDRA 4JI8E 1TF6A 2V85A 2YTOA 2UUCE 1E3HA 2JEBA 4Q35B 2VESA 1N36E 4L5NC 5LMUE 3K1JA 2C37A 4UTGA 3WU3A 4JI2I 2FTXB 2M9AA 1RC7A 1QZRA 1Y5YA 4JI6I 1IBLI 3PS3A 3ADJA 2DLQA 4HXZA 2UXBE 2NN6C 4I3HA 1N3GA 1G2FC 1N33E 3MHSC 1K47A 2VQEI 3J7AG 4GKJI 2EPRA 2EN3A 1BBGA 3BBGA 4LF9I 2ODRD 4DV1E 4DR4E 4BA1B 2HFUA 4OOGC 5KL4A 2NN6E 4R03A 1KIJA 1HNZE 3PYEA 4DPUA 4N4RB 2CSHA 3GMEA 2JOBA 2LCEA 4F9AB 1OJ4A 3B82A 4JI0I 1R6LA 5DRQA 2EFGA 2EPZA 1FI4A 4HTGA 4DKKA 2RSMA 5AE1A 2NPFA 4B3SI 1N0VC 4B3RE 3GONA 3HQ1A 2JEAB 3QT8A 1EH8A 2ODRC 1P47A 5DNLA 3T1YI 4BHCA 2WZOA 5KL2A 4AQYE 3VYXA 2PO1A 5A69A 4LU9A 2V88A 4MYUA 4R2DA 2EPAA 2HJJA 1WHQA 2EMZA 1L4SA 1RHYA 3OTOE 2EMAA 4JG4A 3H4LA 5DRPA 4EMDA 4FW4A 1TN9A 3LPSA 3U1YA 4BC9A 1B62A 1PDAA 2YPNA 2YTNA 3JAMC 4AM3A 2PO2A 4WYQB 5LMNE 3C4BA 1QNTA 2CG9A 1ZAAC 5DROA 4ZVIA 5BR8E 2EM9A 1HNWE 2WBUA 2DB2A 4R2AA 3V5RA 1NZ0A 5A6KA 2RTXA 4LF8I 1QU6A 2E1MA 3DJWA 4DUYE 1KJKA 2EMFA 4QNKA 4N3OA 2HHHI 2EOSA 4JV5I 5A6AA 1B69A 4IZJD 4OO1F 2YZTA 4M30A 1NEIA 3THNA 2JPAA 2KOUA 4DUZI 4DR2I 4R2EA 4WUCA 4DR1I 2EPMX 4DV2E 2WNRA 1N34E 2DRPA 2C39B 2DSYA 3BIDA 3H09A 3HTXA 1MX0A 2EM6A 2YTIA 2RS6A 3LMLA 3MSWA 1XNQE 2C38B 5C0XF 3K6QA 2V86A 2GHFA 2O1VA 1RMDA 4RHBB 4ED4A 2PRTA 1Y4SA 1GZ6A 2O3ZA 1HNXE 5KL6A 4KZSA 3J81C 1YZ9A 4BMJA 2LE2A 5A6BD 1IBME 2IESA 1J5EI 2E5LI 1Z0CA 4OZEA 4LFBI 3IWCA 2L2NA 4P7DA 2J7KA 4JI8I 1Z5CA 2UUCI 4LOMA 4K0KI 2WCC3 1N36I 4IJDA 1EI1A 5AE3A 5LMUI 4IFDA 2L33A 1A1JA 4JI3E 2GO4A 3DD6A 4NXME 3KRNA 3TQMA 2EN8A 3H1CA 3DF6A 2N8XA 4LCFA 2DEJA 4WUBA 1IQSA 2EOHA 3M99B 2O1UA 4GKKI 2UXBI 1N33I 4LF6E 2CZ9A 1ZR9A 3EPKA 5LLQA 2UUAE 1Z5BA 5K36F 4B3TI 2J7JA 4F9BB 1MEYC 1HK7A 1VI7A 4MU0A 4FW5A 2JYAA 2I9IA 4ZYGA 1P42A 4DR4I 2M4IA 2VF3A 2EOOA 2I13A 3JAMQ 2EQ3A 2UXCI 5DNXA 4BC7A 1LLMC 4LF7E 1PVGA 2EMBA 1HNZI 2Z5BB 1DARA 5K36B 5IXMB 3KZYA 3P1XA 4X8WA 1PIEA 2B7TA 3MHHC 3THOB 3EPJA 2JEBB 1FJGE 4FW7A 2DEIA 1UDNA 4FWDA 4LFAE 2WP8A 2V8PA 2EZ6A 1YH8A 4X65I 4GQUA 5DRRA 4JI1E 4FW6A 5IWAE 4AQYI 1YPNA 2Q8UA 2EOQA 2ELYA 1SR9A 2KHXA 4JI4E 2ZM6I 3J7Yp 1T38A 2NN6F 2UUBI 4B3ME 4XTJA 1Y4UA 4DPXA 1A1LA 2E1RA 4IZKA 4WX9A 1EH7A 2BA1G 4ZYEA 4DR6E 3L00A 1FWKA 3GLLA 1WXRA 4FWHA 4BHBA 2EPUA 1Y6ZA 2NN6B 5LMNI 2BA0G 2WBSA 5JEAD 4KWYA 5BR8I 2F1DA 4Z7YA 1YYOA 1MGTA 3LTOA 3J81Q 2PO0A 2YTGA 2JE6A 2EE8A 4HEIA 2LJUA 2YSPA 3ECRA 1WJPA 2MDGA 4F6MA 1XMOE 1KTVA 2NUGA 3WU6A 4DXLA 2IOPA 4DPTA 3K85A 3IWDA 2WBTA 1H73A 3BF2A 3JU0A 1ZXNA 2WW4A 2V83A 3VYYA 2X36A 2V2QA 4MLQA 2JVAA 2VRDA 4YY3E 4FK5C 1MU5A 4FN5A 2EM4A 4IS9A 4NBQA 2IHR1 3C6KA 2V89A 2PO1B 1JK2A 1UDSA 2EOZA 4TUGA 3M6AA 1N34I 1UILA 1X49A 4BA2A 4O4KA 4AIMA 3L7ZA 2RPCA 2E72A 1XNQI 1GQEA 2LRSA 2LMZA 1BB8A 2EOIA 1EA6A 4LPFA 5KL7A 2JT2A 1UN6B 5JEAA 1T4OA 4DU8A 2PNZA 2A25A 4DR3E 3HJCA 5TSEA 1KVKA 5AC5A 4WXDA 1T4NA 2Z5EA 2YRKA 5A2QC 2LUQA 2V8QB 4R8OA 5AC4A 5T6JA 4RH8A 4JI3I 2FV4B 2UU9E 4DV0E 2HK2A 1YSAC 4LF4E 1I94I 3LNUA 3RMPA 2UUAI 1X6HA 4ZYDA 2YU5A 4LF5E 1XXEA 2EQ1A 2EMLA 2KONA 4NXNE 1WHNA 4JYAE 1IBKE 3OMLA 2RS7A 3CDIA 3WU5A 1N32E 3HKMA 2EN7A 4X64E 4IFDD 4DV4E 2O1TA 2V34A 1UDQA 1TF3A 2CT1A 4LF7I 5DNYA 1ZM3A 3WU4A 2CGEA 4WFTA 4R2RA 4HACB 4NHRA 1PJTA 2VE7C 2EMCA 2K7IA 2IOQA 4PRVA 1PKPA 5KL5A 4DV5E 4X62E 2ENCA 2NUEA 4WXCA 1YUIA 2EOEA 3BGHA 3M7ND 4R2SA 2YTJA 2ZBKB 4R2PA 4KHPE 2BM0A 2Z5CA 4LFAI 1YYWA 2F4VE 2ZITA 2LT7A 3PS2A 2EM8A 3QT7A 4IZJB 2EL6A 4JI1I 5FWKA 1KKHA 4IFDC 2NA2A 4GKJE 2PNMA 2GPIA 4ZYHA 4LF9E 2HC5A 2L3CA 3J7AM 4O43A 4YHHE 2BA1D 5IV8B 4DV7E 4IFDE 2LVHA 1ELOA 2AJ4A 4AIDA 2EORA 4LCGA 2EM7A 2EOFA 2BA0D 5C0XD 2BBGA 2EPNA 1X3CA 2L2MA 5LL6R 4DU7A 1T4LB 3AUZA 4X9JA 3HPZA 1Z0TA 2EN2A 5KL3A 2EN1A 1RR9A 1WUUA 2X7IA 2YSOA 2EM3A 1A1HA 1ZBTA 4M2ZA 2BR2B 2WP8B 4DV1I 4JI5E 4P7AA 1A1FA 4DMIA 1E3PA 1H74A 1Z59A 1RREA 1YUJA 1X47A 2HKJA 2Q2EB 1D6TA 3QG5C 3K17A 2EPPA 1RQ0A 4MDTA 2ENAA 5ADZA 4IZKB 1DI2A 2C38A 4OO1A 3ZZUA 3PRYA 2YTQA 3T1HE 4F6NA 4PRXA 4P52A 3M7NG 1FKAE 4DV6E 2C37B 3CDJA 4DR7I 4B3RI 4NZVA 1OYSA 4BCAA 2EOMA 3HULA 3VK6A 3P3GA 5C0XA 2DGCA 2B3TB 5A6JA 2EOYA 2LUPB 2ELZA 1OYRA 2LTSA 2LV2A 3Q6MA 4M9VC 2EN4A 3C6MA 2YTEA 3OTOI 4O24A 2EOXA 4GZNC 2ADRA 4JV5E 4DR2E 1XNRE 1ZM9A 2JWOA 4J3DA 2JXPA 4WSGA 4DR1E 1F2IG 2J65A 3NZKA 4DV0I 2VQFE 4DPYA 1ZM4A 1NCSA 1X5WA 1H7SA 1S4EA 1XMQE 1EH6A 2V2ZA 2R42A 2R1FA 4UT4A 2EM5A 1HNWI 4LF5I 4BA2B 4LFCE 3EPHA 2V2VA 2B7VA 4IS1C 2FGGA 4JYAI 1IBKI 1U2RA 4DUYI 2L3JA 2NN6D 3UHMA 4JI7E 2JP9A 3M85G 5K36A 2Z5BA 4MU4A 2NUFA 5JEAB 4F9CB 4LFBE 1J5EE 2MC6A 3P76A 3LLHA 2UU9I 1S16A 5CFFE 1NHHA 2PNZB 3HXLA 2EL5A 1A1KA 2BV3A 4K0KE 2LTRA 4Z7CA 2K4VA 4DV2I 3ADLA 4X62I 1PJSA 5IT9C 2MKDA 2M7QA 1G2DC 5JEAC 1IMUA 1YHCA 3EPLA 4KHPI 2EMXA 1WRJA 2F4VI 1UHZA 2D9HA 4GKKE 2EMHA 3VHTB 2PO2B 4DPWA 1A1IA 1J26A 2R76A 2EN6A 1H7UA 4B3TE 3ZKBA 5JEAE 1GTKA 2A2CA 2OI2A 1HNXI 2A2DA 4R1FA 4U3BA 2H36X 1IBMI 2M1SA 4GEQB 4P78A 4YHHI 2EQ0A 2DMYA 4M0VA 2UXCE 3P3EA 1Z1BA 4LCHA 2EPKX 3F6HA 2HK3A 2ENHA 4DV7I 2UXDE 1Z0EA 2NN6A 3F0NA 4URLA 2N3HA 2EMWA 2YRMA 1HR0E 1Z0GA 4PU9A 1B63A 4NXMI 2YWQA 4I8OA 2HGHA 2CTDA 4DV3E 1Z0VA 2WNRB 3QT5A 4WSPA 4LF6I 2MC5A 3B8HA 4M1KA 4DR5E 4X65E 3QT6A 3CWVA 1KYQA 4LTYA 2Z5CB 3P3CA 4BA1A 1X6EA 5AE2A 4JI5I 2AE8A 2ZM6E 2GO3A 4OX9E 4X66E 2UUBE 4F54A 4BBYA 4IFDF 4HYMA 1IQOA 1AH5A 4MYTA 5F3WA 1Z5AA 2EOJA 3J80C 2EL4A 4QNJA 4MLVA 2EPCA 1FJGI 2YRHA 4BS9A 4JI2E 5EL9A 3T1HI 1R6MA 3F6GA 2GS8A 4JI6E 2JEAA 3U1KA 3ZZTA 1JK1A 4DV6I 1IBLE 4IFDB 3ADGA 5FLXC 3HPSA 1USVA 2EMKA 4FW9A 2LBSB 4USMA 2F8BA 5IWAI 2VQEE 1ZXMA 4JI4I 1AAYA 2YTDA 2YT4A 3PYDA 3AV0A 2EMGA 4R2QA 4B3MI 5IT9Q 4OO1D 5GMEA 2EP3A 4DR6I 4DR7E 1Z0WA 1XNRI 1H72C 3Q1QA 1Z0BA 3ZZ0A 3EQ1A 4FW3A 2L8TA 2VQFI 1USUA 1X6FA 4KQVA 2B9DA 2DLKA 2JR1A 4JI0E 1XMQI 2YTFA 2BM1A 2BB8A 3UK3C 2JY9A 1FNMA 1ZU1A 1BBOA 4WPYA 4LFCI 2L92A 5ELWA 4B3SE 2GQ0A 1T39A 2YTPA 1XMOI 4L8NA 4R2CA 5A2QQ 1ZBQA 4MU3A 2EPOA 4JI7I 2EMIA 3KZZA 2N3GA 3T1YE 3M85D 4OO1C 2CPNA 4HACA 4J8ZA 3GCMA 4O5GA 1STUA 1O0WA 4TUIA 2NABA 3D4JA 4YY3I 5C0XB 2LJPA 2EJ4A 2C39A 5C0XC 1SFEA 2CVEA 3KWRA 3JTZA 1OYPA 3ZM7A 1NHJA 4OO1E 1UDOA 1VISA 3B78A 3V2UC 2VF1A 2DMIA 2EM2A 4IZJA 4HY1A 4RPFA 4OO1B 5K36D 2GLIA 2XEXA 1I94E 4WUDA 5EKWA 4MQYA 3ZKDA 5C0XE 3Q6NA 4LF8E 5L3JA 1XHKA 2HFSA
chains in the Genus database with same CATH topology
1FWLA 4DR3I 3J80Q 1A6FA 1X48A 3C4TA 2HHHE 2V87A 1YYKA 2DIXA 2UXDI 1UEKA 1DQ3A 2PNLA 4DUZE 2G7HA 5FLXQ 3ZOQB 1HR0I 3IWBA 2UU9I 4FWGA 2L2KB 3ADIA 3PYGA 3PYFA 4LF4I 4DV3I 1BKNA 1N0UA 3FIGA 5AASA 1ZM2A 2O1WA 4DR5I 2LJHA 2L6MA 4NXNI 1N32I 1MG7A 3P06A 4X64I 4OX9I 4DV4I 4USKA 2R3VA 4X66I 4Q28A 5GMDA 1EKZA 2JOXA 2E5LE 1NHIA 2EWLA 2HKEA 2MDRA 4JI8E 2UUCE 2V85A 1N36E 4L5NC 5LMUE 3K1JA 4UTGA 3WU3A 4JI2I 2FTXB 4JI6I 1RC7A 1QZRA 1IBLI 3ADJA 4HXZA 2UXBE 4I3HA 1N33E 1K47A 2VQEI 3J7AG 4GKJI 4LF9I 2ODRD 4DV1E 4DR4E 2HFUA 4OOGC 4R03A 1KIJA 1HNZE 3PYEA 4DPUA 2JOBA 1OJ4A 4F9AB 3B82A 4JI0I 2EFGA 1FI4A 4DKKA 2RSMA 5AE1A 2NPFA 4B3SI 1N0VC 4B3RE 3GONA 3HQ1A 3QT8A 2ODRC 3T1YI 2WZOA 4AQYE 3VYXA 4LU9A 2V88A 4MYUA 1WHQA 3OTOE 4JG4A 3H4LA 4EMDA 3LPSA 4BC9A 1B62A 3JAMC 4WYQB 5LMNE 3C4BA 2CG9A 4ZVIA 5BR8E 1HNWE 2DB2A 3V5RA 1NZ0A 2RTXA 4LF8I 1QU6A 2E1MA 3DJWA 4DUYE 4N3OA 2HHHI 4JV5I 4IZJD 2YZTA 4M30A 4DUZI 4DR2I 2KOUA 4WUCA 4DR1I 4DV2E 1N34E 2DSYA 3H09A 3HTXA 1MX0A 3LMLA 2RS6A 3MSWA 1XNQE 1D6TA 3K6QA 2V86A 2O1VA 4ED4A 1Y4SA 1GZ6A 1HNXE 4KZSA 3J81C 1YZ9A 4BMJA 2LE2A 1IBME 2E5LI 1J5EI 4LFBI 1Z0CA 3IWCA 2L2NA 4P7DA 2J7KA 4JI8I 1Z5CA 2UUCI 4K0KI 1N36I 1EI1A 5AE3A 5LMUI 2L33A 4JI3E 4NXME 3DF6A 2DEJA 4WUBA 4GKKI 2O1UA 2UXBI 1N33I 4LF6E 2CZ9A 2UUAE 1Z5BA 4B3TI 4F9BB 1HK7A 4DR4I 2M4IA 2VF3A 3JAMQ 2UXCI 4BC7A 4LF7E 1PVGA 1HNZI 2Z5BB 1DARA 3P1XA 4X8WA 1PIEA 2B7TA 1FJGE 2DEIA 4FWDA 4LFAE 4X65I 2V8PA 2EZ6A 4JI1E 5IWAE 4AQYI 4JI4E 1SR9A 2KHXA 2ZM6I 3J7Yp 2UUBI 4B3ME 4XTJA 1Y4UA 4DPXA 2E1RA 4IZKA 1FWKA 4DR6E 4FWHA 1WXRA 1Y6ZA 5LMNI 5BR8I 4Z7YA 1YYOA 3LTOA 3J81Q 1KTVA 1XMOE 2NUGA 3WU6A 4DXLA 2IOPA 4DPTA 3K85A 3IWDA 1H73A 3JU0A 1ZXNA 2WW4A 2V83A 3VYYA 2X36A 2V2QA 2JVAA 4YY3E 1MU5A 4FN5A 4DR7I 2IHR1 2V89A 4TUGA 3M6AA 1N34I 1UILA 1X49A 1XNQI 1GQEA 2LRSA 2LMZA 1EA6A 1T4OA 4DU8A 4DR3E 3HJCA 1KVKA 2Z5EA 1T4NA 5A2QC 2LUQA 4R8OA 2V8QB 5T6JA 4JI3I 2FV4B 2UU9E 4DV0E 2HK2A 4LF4E 1I94I 3LNUA 3RMPA 2UUAI 4LF5E 2KONA 4NXNE 1WHNA 4JYAE 1IBKE 3OMLA 2RS7A 3WU5A 1N32E 4X64E 4DV4E 2O1TA 2V34A 4LF7I 5DNYA 1ZM3A 3WU4A 2CGEA 4WFTA 4HACB 2IOQA 2VE7C 4PRVA 1PKPA 4DV5E 4X62E 2NUEA 2ZBKB 4KHPE 2BM0A 2Z5CA 4LFAI 1YYWA 2F4VE 2ZITA 5FWKA 3QT7A 4IZJB 4JI1I 1KKHA 2NA2A 4GKJE 2PNMA 4LF9E 2L3CA 3J7AM 4YHHE 4DV7E 1ELOA 2AJ4A 2L2MA 5LL6R 4DU7A 1T4LB 3AUZA 3HPZA 1Z0TA 1RR9A 1WUUA 2X7IA 4M2ZA 1ZBTA 4DV1I 4JI5E 4P7AA 4DMIA 1H74A 1Z59A 1RREA 2HKJA 1X47A 2Q2EB 3K17A 1RQ0A 5ADZA 4IZKB 1DI2A 3ZZUA 3PRYA 3T1HE 4PRXA 4P52A 1FKAE 4DV6E 4B3RI 4BCAA 3HULA 3VK6A 2B3TB 2LUPB 2LTSA 3Q6MA 3OTOI 4JV5E 4DR2E 1XNRE 1ZM9A 2JWOA 4DR1E 4DV0I 2VQFE 4DPYA 1ZM4A 1H7SA 1S4EA 1XMQE 2V2ZA 2R42A 4UT4A 1HNWI 4LF5I 4LFCE 2V2VA 2B7VA 2FGGA 4JYAI 1IBKI 1U2RA 4DUYI 2L3JA 4JI7E 2Z5BA 2NUFA 4F9CB 4LFBE 1J5EE 2MC6A 3LLHA 1S16A 5CFFE 1NHHA 3HXLA 2BV3A 4K0KE 2LTRA 4Z7CA 2K4VA 4DV2I 3ADLA 4X62I 4DV5I 5IT9C 2M7QA 4KHPI 2F4VI 1UHZA 4GKKE 4DPWA 1J26A 1H7UA 4B3TE 3ZKBA 2A2CA 2OI2A 1HNXI 2A2DA 4R1FA 2H36X 1IBMI 2M1SA 4GEQB 4P78A 4YHHI 2DMYA 4M0VA 2UXCE 3F6HA 2HK3A 4DV7I 2UXDE 1Z0EA 3F0NA 4URLA 2N3HA 1HR0E 1Z0GA 4PU9A 1B63A 4NXMI 4I8OA 4DV3E 1Z0VA 3QT5A 4WSPA 4LF6I 2MC5A 3B8HA 4M1KA 4DR5E 4X65E 3QT6A 3CWVA 4LTYA 2Z5CB 5AE2A 4JI5I 2ZM6E 4OX9E 4X66E 2UUBE 4F54A 4BBYA 4HYMA 4MYTA 5F3WA 1Z5AA 3J80C 1FJGI 4BS9A 3T1HI 4JI2E 3F6GA 2GS8A 4JI6E 3ZZTA 4DV6I 1IBLE 3ADGA 5FLXC 3HPSA 1USVA 4FW9A 2LBSB 4USMA 2F8BA 5IWAI 2VQEE 1ZXMA 4JI4I 2YT4A 3PYDA 3AV0A 5IT9Q 4B3MI 5GMEA 4DR6I 4DR7E 1Z0WA 1XNRI 1H72C 3Q1QA 1Z0BA 3ZZ0A 2L8TA 2VQFI 1USUA 4KQVA 2B9DA 1XMQI 2JR1A 4JI0E 2BM1A 2JY9A 1FNMA 4WPYA 4LFCI 2L92A 4B3SE 2GQ0A 1XMOI 4L8NA 5A2QQ 1ZBQA 4JI7I 3T1YE 2N3GA 2CPNA 4HACA 4J8ZA 4TUIA 1STUA 1O0WA 3D4JA 4YY3I 2LJPA 3KWRA 3JTZA 3ZM7A 1NHJA 1VISA 3B78A 3V2UC 2VF1A 4IZJA 4HY1A 4RPFA 2XEXA 1I94E 4WUDA 3ZKDA 3Q6NA 4LF8E 5L3JA 1XHKA 2HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWL A;  4DR3 I;  3J80 Q;  1A6F A;  1X48 A;  3C4T A;  2HHH E;  1YYK A;  2DIX A;  2UXD I;  1UEK A;  4DUZ E;  5FLX Q;  2UU9 I;  1HR0 I;  4FWG A;  2L2K B;  3ADI A;  3PYG A;  3PYF A;  4LF4 I;  4DV3 I;  1BKN A;  1N0U A;  1ZM2 A;  4DR5 I;  2LJH A;  4NXN I;  1N32 I;  1MG7 A;  4X64 I;  4OX9 I;  4DV4 I;  4USK A;  2R3V A;  4X66 I;  5GMD A;  1EKZ A;  2E5L E;  1NHI A;  2HKE A;  2MDR A;  4JI8 E;  2UUC E;  1N36 E;  5LMU E;  3K1J A;  4UTG A;  3WU3 A;  4JI2 I;  4JI6 I;  1RC7 A;  1QZR A;  1IBL I;  3ADJ A;  4HXZ A;  2UXB E;  4I3H A;  1N33 E;  1K47 A;  2VQE I;  3J7A G;  4GKJ I;  4LF9 I;  4DV1 E;  4DR4 E;  2HFU A;  4OOG C;  1KIJ A;  1HNZ E;  3PYE A;  4DPU A;  1OJ4 A;  3B82 A;  4JI0 I;  2EFG A;  1FI4 A;  4DKK A;  2RSM A;  2NPF A;  4B3S I;  1N0V C;  4B3R E;  3GON A;  3QT8 A;  3T1Y I;  4AQY E;  3VYX A;  4MYU A;  1WHQ A;  3OTO E;  4JG4 A;  3H4L A;  4EMD A;  3LPS A;  1B62 A;  3JAM C;  4WYQ B;  5LMN E;  3C4B A;  4ZVI A;  5BR8 E;  1HNW E;  2DB2 A;  3V5R A;  1NZ0 A;  2RTX A;  4LF8 I;  1QU6 A;  4DUY E;  2HHH I;  4JV5 I;  4DR2 I;  4M30 A;  4DUZ I;  4WUC A;  4DR1 I;  4DV2 E;  1N34 E;  3HTX A;  1MX0 A;  2RS6 A;  1XNQ E;  1D6T A;  4ED4 A;  1HNX E;  3J81 C;  1YZ9 A;  1IBM E;  2E5L I;  1J5E I;  4LFB I;  1Z0C A;  2L2N A;  2J7K A;  4JI8 I;  1Z5C A;  2UUC I;  4K0K I;  1N36 I;  1EI1 A;  5LMU I;  2L33 A;  4JI3 E;  4NXM E;  2DEJ A;  4WUB A;  4GKK I;  2UXB I;  1N33 I;  4LF6 E;  2CZ9 A;  2UUA E;  1Z5B A;  4B3T I;  4DR4 I;  2VF3 A;  3JAM Q;  2UXC I;  4LF7 E;  1PVG A;  1HNZ I;  1DAR A;  3P1X A;  4X8W A;  1PIE A;  2B7T A;  1FJG E;  2DEI A;  4FWD A;  4LFA E;  4X65 I;  2V8P A;  2EZ6 A;  4JI1 E;  5IWA E;  4AQY I;  4JI4 E;  2KHX A;  2ZM6 I;  3J7Y p;  2UUB I;  4B3M E;  4XTJ A;  4DPX A;  2E1R A;  1FWK A;  4DR6 E;  4FWH A;  5LMN I;  5BR8 I;  4Z7Y A;  1YYO A;  3LTO A;  3J81 Q;  1KTV A;  1XMO E;  2NUG A;  3WU6 A;  4DXL A;  4DPT A;  1H73 A;  1ZXN A;  2WW4 A;  2X36 A;  3VYY A;  2V2Q A;  4YY3 E;  2JVA A;  1MU5 A;  4FN5 A;  4DR7 I;  2IHR 1;  3M6A A;  1N34 I;  1UIL A;  1X49 A;  1XNQ I;  1GQE A;  2LRS A;  1EA6 A;  1T4O A;  4DU8 A;  4DR3 E;  1KVK A;  1T4N A;  5A2Q C;  2LUQ A;  4JI3 I;  2UU9 E;  4DV0 E;  2HK2 A;  4LF4 E;  1I94 I;  3LNU A;  2UUA I;  4LF5 E;  4NXN E;  1WHN A;  4JYA E;  1IBK E;  2RS7 A;  3WU5 A;  1N32 E;  4X64 E;  4DV4 E;  2V34 A;  4LF7 I;  1ZM3 A;  3WU4 A;  4WFT A;  4HAC B;  4PRV A;  1PKP A;  4DV5 E;  4X62 E;  2NUE A;  2ZBK B;  4KHP E;  2BM0 A;  4LFA I;  1YYW A;  2F4V E;  2ZIT A;  3QT7 A;  4JI1 I;  1KKH A;  2NA2 A;  4GKJ E;  4LF9 E;  2L3C A;  3J7A M;  4YHH E;  4DV7 E;  1ELO A;  2AJ4 A;  2L2M A;  5LL6 R;  4DU7 A;  1T4L B;  1Z0T A;  1RR9 A;  1WUU A;  2X7I A;  4M2Z A;  1ZBT A;  4DV1 I;  4JI5 E;  4P7A A;  1H74 A;  1Z59 A;  1RRE A;  2HKJ A;  1X47 A;  2Q2E B;  3K17 A;  1RQ0 A;  1DI2 A;  3ZZU A;  3T1H E;  4PRX A;  4P52 A;  1FKA E;  4DV6 E;  4B3R I;  3HUL A;  2B3T B;  2LUP B;  2LTS A;  3OTO I;  4JV5 E;  4DR2 E;  1XNR E;  1ZM9 A;  4DR1 E;  4DV0 I;  2VQF E;  4DPY A;  1ZM4 A;  1H7S A;  1S4E A;  1XMQ E;  2V2Z A;  2R42 A;  4UT4 A;  1HNW I;  4LF5 I;  4LFC E;  2V2V A;  2B7V A;  4JYA I;  1IBK I;  1U2R A;  4DUY I;  2L3J A;  4JI7 E;  2NUF A;  4LFB E;  1J5E E;  3LLH A;  1S16 A;  5CFF E;  1NHH A;  2BV3 A;  4K0K E;  2LTR A;  4Z7C A;  4DV2 I;  4DV5 I;  3ADL A;  4X62 I;  5IT9 C;  4KHP I;  2F4V I;  1UHZ A;  4GKK E;  4DPW A;  1J26 A;  1H7U A;  4B3T E;  3ZKB A;  2A2C A;  2OI2 A;  1HNX I;  2A2D A;  4R1F A;  1IBM I;  4YHH I;  2DMY A;  2UXC E;  2HK3 A;  4DV7 I;  2UXD E;  1Z0E A;  3F0N A;  4URL A;  2N3H A;  1HR0 E;  1Z0G A;  4PU9 A;  1B63 A;  4NXM I;  4DV3 E;  1Z0V A;  3QT5 A;  4LF6 I;  3B8H A;  4M1K A;  4DR5 E;  4X65 E;  3QT6 A;  3CWV A;  4JI5 I;  2ZM6 E;  4OX9 E;  4X66 E;  2UUB E;  4HYM A;  4MYT A;  1Z5A A;  3J80 C;  1FJG I;  3T1H I;  4JI2 E;  2GS8 A;  4JI6 E;  3ZZT A;  4DV6 I;  1IBL E;  3ADG A;  5FLX C;  4FW9 A;  2LBS B;  4USM A;  5IWA I;  2VQE E;  1ZXM A;  4JI4 I;  2YT4 A;  3PYD A;  5IT9 Q;  4B3M I;  5GME A;  4DR6 I;  4DR7 E;  1Z0W A;  1XNR I;  1H72 C;  3Q1Q A;  1Z0B A;  3ZZ0 A;  2VQF I;  4KQV A;  1XMQ I;  4JI0 E;  2BM1 A;  2JY9 A;  1FNM A;  4LFC I;  4B3S E;  1XMO I;  5A2Q Q;  4JI7 I;  3T1Y E;  2N3G A;  2CPN A;  4HAC A;  3D4J A;  1STU A;  1O0W A;  4YY3 I;  2LJP A;  3ZM7 A;  1NHJ A;  1VIS A;  3B78 A;  3V2U C;  4HY1 A;  4RPF A;  2XEX A;  1I94 E;  4WUD A;  3ZKD A;  4LF8 E;  5L3J A;  1XHK A;  2HFS A; 
#chains in the Genus database with same CATH topology
 2PO0 B;  1FWL A;  2JE6 B;  4MU1 A;  4DR3 I;  3J80 Q;  1A6F A;  2LO3 A;  1PJQ A;  1X48 A;  3C4T A;  2IER A;  2EM0 A;  2EMY A;  2HHH E;  2V87 A;  1YYK A;  1Y60 A;  2DIX A;  2UXD I;  1UBD C;  1UEK A;  1DQ3 A;  2PNL A;  4DUZ E;  2G7H A;  5FLX Q;  3ZOQ B;  4ISA A;  3IWB A;  1HR0 I;  4DV5 I;  4FWG A;  2YU8 A;  4OKG A;  2L2K B;  4U3D A;  5A6B A;  5K36 C;  2RQL A;  3ADI A;  4F2J C;  3PYG A;  3PYF A;  1DGC A;  4LF4 I;  4DV3 I;  1BKN A;  1N0U A;  3FIG A;  5AAS A;  1ZM2 A;  2O1W A;  2MKN A;  4DR5 I;  5JEA F;  2LJH A;  2BR2 A;  2L6M A;  3B4T A;  3L7Z B;  4NXN I;  5K36 E;  1N32 I;  1MG7 A;  1YFH A;  2EPX A;  3P06 A;  4X64 I;  4OX9 I;  4DV4 I;  4USK A;  2R3V A;  4X66 I;  4Q28 A;  3PS1 A;  5GMD A;  1EKZ A;  2JOX A;  2E5L E;  2EPL X;  1NHI A;  2EWL A;  2HKE A;  2RSI A;  1A1G A;  2MDR A;  4JI8 E;  1TF6 A;  2V85 A;  2YTO A;  2UUC E;  1E3H A;  2JEB A;  4Q35 B;  2VES A;  1N36 E;  4L5N C;  5LMU E;  3K1J A;  2C37 A;  4UTG A;  3WU3 A;  4JI2 I;  2FTX B;  2M9A A;  1RC7 A;  1QZR A;  1Y5Y A;  4JI6 I;  1IBL I;  3PS3 A;  3ADJ A;  2DLQ A;  4HXZ A;  2UXB E;  2NN6 C;  4I3H A;  1N3G A;  1G2F C;  1N33 E;  3MHS C;  1K47 A;  2VQE I;  3J7A G;  4GKJ I;  2EPR A;  2EN3 A;  1BBG A;  3BBG A;  4LF9 I;  2ODR D;  4DV1 E;  4DR4 E;  4BA1 B;  2HFU A;  4OOG C;  5KL4 A;  2NN6 E;  4R03 A;  1KIJ A;  1HNZ E;  3PYE A;  4DPU A;  4N4R B;  2CSH A;  3GME A;  2JOB A;  2LCE A;  4F9A B;  1OJ4 A;  3B82 A;  4JI0 I;  1R6L A;  5DRQ A;  2EFG A;  2EPZ A;  1FI4 A;  4HTG A;  4DKK A;  2RSM A;  5AE1 A;  2NPF A;  4B3S I;  1N0V C;  4B3R E;  3GON A;  3HQ1 A;  2JEA B;  3QT8 A;  1EH8 A;  2ODR C;  1P47 A;  5DNL A;  3T1Y I;  4BHC A;  2WZO A;  5KL2 A;  4AQY E;  3VYX A;  2PO1 A;  5A69 A;  4LU9 A;  2V88 A;  4MYU A;  4R2D A;  2EPA A;  2HJJ A;  1WHQ A;  2EMZ A;  1L4S A;  1RHY A;  3OTO E;  2EMA A;  4JG4 A;  3H4L A;  5DRP A;  4EMD A;  4FW4 A;  1TN9 A;  3LPS A;  3U1Y A;  4BC9 A;  1B62 A;  1PDA A;  2YPN A;  2YTN A;  3JAM C;  4AM3 A;  2PO2 A;  4WYQ B;  5LMN E;  3C4B A;  1QNT A;  2CG9 A;  1ZAA C;  5DRO A;  4ZVI A;  5BR8 E;  2EM9 A;  1HNW E;  2WBU A;  2DB2 A;  4R2A A;  3V5R A;  1NZ0 A;  5A6K A;  2RTX A;  4LF8 I;  1QU6 A;  2E1M A;  3DJW A;  4DUY E;  1KJK A;  2EMF A;  4QNK A;  4N3O A;  2HHH I;  2EOS A;  4JV5 I;  5A6A A;  1B69 A;  4IZJ D;  4OO1 F;  2YZT A;  4M30 A;  1NEI A;  3THN A;  2JPA A;  2KOU A;  4DUZ I;  4DR2 I;  4R2E A;  4WUC A;  4DR1 I;  2EPM X;  4DV2 E;  2WNR A;  1N34 E;  2DRP A;  2C39 B;  2DSY A;  3BID A;  3H09 A;  3HTX A;  1MX0 A;  2EM6 A;  2YTI A;  2RS6 A;  3LML A;  3MSW A;  1XNQ E;  2C38 B;  5C0X F;  3K6Q A;  2V86 A;  2GHF A;  2O1V A;  1RMD A;  4RHB B;  4ED4 A;  2PRT A;  1Y4S A;  1GZ6 A;  2O3Z A;  1HNX E;  5KL6 A;  4KZS A;  3J81 C;  1YZ9 A;  4BMJ A;  2LE2 A;  5A6B D;  1IBM E;  2IES A;  1J5E I;  2E5L I;  1Z0C A;  4OZE A;  4LFB I;  3IWC A;  2L2N A;  4P7D A;  2J7K A;  4JI8 I;  1Z5C A;  2UUC I;  4LOM A;  4K0K I;  2WCC 3;  1N36 I;  4IJD A;  1EI1 A;  5AE3 A;  5LMU I;  4IFD A;  2L33 A;  1A1J A;  4JI3 E;  2GO4 A;  3DD6 A;  4NXM E;  3KRN A;  3TQM A;  2EN8 A;  3H1C A;  3DF6 A;  2N8X A;  4LCF A;  2DEJ A;  4WUB A;  1IQS A;  2EOH A;  3M99 B;  2O1U A;  4GKK I;  2UXB I;  1N33 I;  4LF6 E;  2CZ9 A;  1ZR9 A;  3EPK A;  5LLQ A;  2UUA E;  1Z5B A;  5K36 F;  4B3T I;  2J7J A;  4F9B B;  1MEY C;  1HK7 A;  1VI7 A;  4MU0 A;  4FW5 A;  2JYA A;  2I9I A;  4ZYG A;  1P42 A;  4DR4 I;  2M4I A;  2VF3 A;  2EOO A;  2I13 A;  3JAM Q;  2EQ3 A;  2UXC I;  5DNX A;  4BC7 A;  1LLM C;  4LF7 E;  1PVG A;  2EMB A;  1HNZ I;  2Z5B B;  1DAR A;  5K36 B;  5IXM B;  3KZY A;  3P1X A;  4X8W A;  1PIE A;  2B7T A;  3MHH C;  3THO B;  3EPJ A;  2JEB B;  1FJG E;  4FW7 A;  2DEI A;  1UDN A;  4FWD A;  4LFA E;  2WP8 A;  2V8P A;  2EZ6 A;  1YH8 A;  4X65 I;  4GQU A;  5DRR A;  4JI1 E;  4FW6 A;  5IWA E;  4AQY I;  1YPN A;  2Q8U A;  2EOQ A;  2ELY A;  1SR9 A;  2KHX A;  4JI4 E;  2ZM6 I;  3J7Y p;  1T38 A;  2NN6 F;  2UUB I;  4B3M E;  4XTJ A;  1Y4U A;  4DPX A;  1A1L A;  2E1R A;  4IZK A;  4WX9 A;  1EH7 A;  2BA1 G;  4ZYE A;  4DR6 E;  3L00 A;  1FWK A;  3GLL A;  1WXR A;  4FWH A;  4BHB A;  2EPU A;  1Y6Z A;  2NN6 B;  5LMN I;  2BA0 G;  2WBS A;  5JEA D;  4KWY A;  5BR8 I;  2F1D A;  4Z7Y A;  1YYO A;  1MGT A;  3LTO A;  3J81 Q;  2PO0 A;  2YTG A;  2JE6 A;  2EE8 A;  4HEI A;  2LJU A;  2YSP A;  3ECR A;  1WJP A;  2MDG A;  4F6M A;  1XMO E;  1KTV A;  2NUG A;  3WU6 A;  4DXL A;  2IOP A;  4DPT A;  3K85 A;  3IWD A;  2WBT A;  1H73 A;  3BF2 A;  3JU0 A;  1ZXN A;  2WW4 A;  2V83 A;  3VYY A;  2X36 A;  2V2Q A;  4MLQ A;  2JVA A;  2VRD A;  4YY3 E;  4FK5 C;  1MU5 A;  4FN5 A;  2EM4 A;  4IS9 A;  4NBQ A;  2IHR 1;  3C6K A;  2V89 A;  2PO1 B;  1JK2 A;  1UDS A;  2EOZ A;  4TUG A;  3M6A A;  1N34 I;  1UIL A;  1X49 A;  4BA2 A;  4O4K A;  4AIM A;  3L7Z A;  2RPC A;  2E72 A;  1XNQ I;  1GQE A;  2LRS A;  2LMZ A;  1BB8 A;  2EOI A;  1EA6 A;  4LPF A;  5KL7 A;  2JT2 A;  1UN6 B;  5JEA A;  1T4O A;  4DU8 A;  2PNZ A;  2A25 A;  4DR3 E;  3HJC A;  5TSE A;  1KVK A;  5AC5 A;  4WXD A;  1T4N A;  2Z5E A;  2YRK A;  5A2Q C;  2LUQ A;  2V8Q B;  4R8O A;  5AC4 A;  5T6J A;  4RH8 A;  4JI3 I;  2FV4 B;  2UU9 E;  4DV0 E;  2HK2 A;  1YSA C;  4LF4 E;  1I94 I;  3LNU A;  3RMP A;  2UUA I;  1X6H A;  4ZYD A;  2YU5 A;  4LF5 E;  1XXE A;  2EQ1 A;  2EML A;  2KON A;  4NXN E;  1WHN A;  4JYA E;  1IBK E;  3OML A;  2RS7 A;  3CDI A;  3WU5 A;  1N32 E;  3HKM A;  2EN7 A;  4X64 E;  4IFD D;  4DV4 E;  2O1T A;  2V34 A;  1UDQ A;  1TF3 A;  2CT1 A;  4LF7 I;  5DNY A;  1ZM3 A;  3WU4 A;  2CGE A;  4WFT A;  4R2R A;  4HAC B;  4NHR A;  1PJT A;  2VE7 C;  2EMC A;  2K7I A;  2IOQ A;  4PRV A;  1PKP A;  5KL5 A;  4DV5 E;  4X62 E;  2ENC A;  2NUE A;  4WXC A;  1YUI A;  2EOE A;  3BGH A;  3M7N D;  4R2S A;  2YTJ A;  2ZBK B;  4R2P A;  4KHP E;  2BM0 A;  2Z5C A;  4LFA I;  1YYW A;  2F4V E;  2ZIT A;  2LT7 A;  3PS2 A;  2EM8 A;  3QT7 A;  4IZJ B;  2EL6 A;  4JI1 I;  5FWK A;  1KKH A;  4IFD C;  2NA2 A;  4GKJ E;  2PNM A;  2GPI A;  4ZYH A;  4LF9 E;  2HC5 A;  2L3C A;  3J7A M;  4O43 A;  4YHH E;  2BA1 D;  5IV8 B;  4DV7 E;  4IFD E;  2LVH A;  1ELO A;  2AJ4 A;  4AID A;  2EOR A;  4LCG A;  2EM7 A;  2EOF A;  2BA0 D;  5C0X D;  2BBG A;  2EPN A;  1X3C A;  2L2M A;  5LL6 R;  4DU7 A;  1T4L B;  3AUZ A;  4X9J A;  3HPZ A;  1Z0T A;  2EN2 A;  5KL3 A;  2EN1 A;  1RR9 A;  1WUU A;  2X7I A;  2YSO A;  2EM3 A;  1A1H A;  1ZBT A;  4M2Z A;  2BR2 B;  2WP8 B;  4DV1 I;  4JI5 E;  4P7A A;  1A1F A;  4DMI A;  1E3P A;  1H74 A;  1Z59 A;  1RRE A;  1YUJ A;  1X47 A;  2HKJ A;  2Q2E B;  1D6T A;  3QG5 C;  3K17 A;  2EPP A;  1RQ0 A;  4MDT A;  2ENA A;  5ADZ A;  4IZK B;  1DI2 A;  2C38 A;  4OO1 A;  3ZZU A;  3PRY A;  2YTQ A;  3T1H E;  4F6N A;  4PRX A;  4P52 A;  3M7N G;  1FKA E;  4DV6 E;  2C37 B;  3CDJ A;  4DR7 I;  4B3R I;  4NZV A;  1OYS A;  4BCA A;  2EOM A;  3HUL A;  3VK6 A;  3P3G A;  5C0X A;  2DGC A;  2B3T B;  5A6J A;  2EOY A;  2LUP B;  2ELZ A;  1OYR A;  2LTS A;  2LV2 A;  3Q6M A;  4M9V C;  2EN4 A;  3C6M A;  2YTE A;  3OTO I;  4O24 A;  2EOX A;  4GZN C;  2ADR A;  4JV5 E;  4DR2 E;  1XNR E;  1ZM9 A;  2JWO A;  4J3D A;  2JXP A;  4WSG A;  4DR1 E;  1F2I G;  2J65 A;  3NZK A;  4DV0 I;  2VQF E;  4DPY A;  1ZM4 A;  1NCS A;  1X5W A;  1H7S A;  1S4E A;  1XMQ E;  1EH6 A;  2V2Z A;  2R42 A;  2R1F A;  4UT4 A;  2EM5 A;  1HNW I;  4LF5 I;  4BA2 B;  4LFC E;  3EPH A;  2V2V A;  2B7V A;  4IS1 C;  2FGG A;  4JYA I;  1IBK I;  1U2R A;  4DUY I;  2L3J A;  2NN6 D;  3UHM A;  4JI7 E;  2JP9 A;  3M85 G;  5K36 A;  2Z5B A;  4MU4 A;  2NUF A;  5JEA B;  4F9C B;  4LFB E;  1J5E E;  2MC6 A;  3P76 A;  3LLH A;  2UU9 I;  1S16 A;  5CFF E;  1NHH A;  2PNZ B;  3HXL A;  2EL5 A;  1A1K A;  2BV3 A;  4K0K E;  2LTR A;  4Z7C A;  2K4V A;  4DV2 I;  3ADL A;  4X62 I;  1PJS A;  5IT9 C;  2MKD A;  2M7Q A;  1G2D C;  5JEA C;  1IMU A;  1YHC A;  3EPL A;  4KHP I;  2EMX A;  1WRJ A;  2F4V I;  1UHZ A;  2D9H A;  4GKK E;  2EMH A;  3VHT B;  2PO2 B;  4DPW A;  1A1I A;  1J26 A;  2R76 A;  2EN6 A;  1H7U A;  4B3T E;  3ZKB A;  5JEA E;  1GTK A;  2A2C A;  2OI2 A;  1HNX I;  2A2D A;  4R1F A;  4U3B A;  2H36 X;  1IBM I;  2M1S A;  4GEQ B;  4P78 A;  4YHH I;  2EQ0 A;  2DMY A;  4M0V A;  2UXC E;  3P3E A;  1Z1B A;  4LCH A;  2EPK X;  3F6H A;  2HK3 A;  2ENH A;  4DV7 I;  2UXD E;  1Z0E A;  2NN6 A;  3F0N A;  4URL A;  2N3H A;  2EMW A;  2YRM A;  1HR0 E;  1Z0G A;  4PU9 A;  1B63 A;  4NXM I;  2YWQ A;  4I8O A;  2HGH A;  2CTD A;  4DV3 E;  1Z0V A;  2WNR B;  3QT5 A;  4WSP A;  4LF6 I;  2MC5 A;  3B8H A;  4M1K A;  4DR5 E;  4X65 E;  3QT6 A;  3CWV A;  1KYQ A;  4LTY A;  2Z5C B;  3P3C A;  4BA1 A;  1X6E A;  5AE2 A;  4JI5 I;  2AE8 A;  2ZM6 E;  2GO3 A;  4OX9 E;  4X66 E;  2UUB E;  4F54 A;  4BBY A;  4IFD F;  4HYM A;  1IQO A;  1AH5 A;  4MYT A;  5F3W A;  1Z5A A;  2EOJ A;  3J80 C;  2EL4 A;  4QNJ A;  4MLV A;  2EPC A;  1FJG I;  2YRH A;  4BS9 A;  4JI2 E;  5EL9 A;  3T1H I;  1R6M A;  3F6G A;  2GS8 A;  4JI6 E;  2JEA A;  3U1K A;  3ZZT A;  1JK1 A;  4DV6 I;  1IBL E;  4IFD B;  3ADG A;  5FLX C;  3HPS A;  1USV A;  2EMK A;  4FW9 A;  2LBS B;  4USM A;  2F8B A;  5IWA I;  2VQE E;  1ZXM A;  4JI4 I;  1AAY A;  2YTD A;  2YT4 A;  3PYD A;  3AV0 A;  2EMG A;  4R2Q A;  4B3M I;  5IT9 Q;  4OO1 D;  5GME A;  2EP3 A;  4DR6 I;  4DR7 E;  1Z0W A;  1XNR I;  1H72 C;  3Q1Q A;  1Z0B A;  3ZZ0 A;  3EQ1 A;  4FW3 A;  2L8T A;  2VQF I;  1USU A;  1X6F A;  4KQV A;  2B9D A;  2DLK A;  2JR1 A;  4JI0 E;  1XMQ I;  2YTF A;  2BM1 A;  2BB8 A;  3UK3 C;  2JY9 A;  1FNM A;  1ZU1 A;  1BBO A;  4WPY A;  4LFC I;  2L92 A;  5ELW A;  4B3S E;  2GQ0 A;  1T39 A;  2YTP A;  1XMO I;  4L8N A;  4R2C A;  5A2Q Q;  1ZBQ A;  4MU3 A;  2EPO A;  4JI7 I;  2EMI A;  3KZZ A;  2N3G A;  3T1Y E;  3M85 D;  4OO1 C;  2CPN A;  4HAC A;  4J8Z A;  3GCM A;  4O5G A;  1STU A;  1O0W A;  4TUI A;  2NAB A;  3D4J A;  4YY3 I;  5C0X B;  2LJP A;  2EJ4 A;  2C39 A;  5C0X C;  1SFE A;  2CVE A;  3KWR A;  3JTZ A;  1OYP A;  3ZM7 A;  1NHJ A;  4OO1 E;  1UDO A;  1VIS A;  3B78 A;  3V2U C;  2VF1 A;  2DMI A;  2EM2 A;  4IZJ A;  4HY1 A;  4RPF A;  4OO1 B;  5K36 D;  2GLI A;  2XEX A;  1I94 E;  4WUD A;  5EKW A;  4MQY A;  3ZKD A;  5C0X E;  3Q6N A;  4LF8 E;  5L3J A;  1XHK A;  2HFS A; 
#chains in the Genus database with same CATH homology
 1FWL A;  4DR3 I;  3J80 Q;  1A6F A;  1X48 A;  3C4T A;  2HHH E;  2V87 A;  1YYK A;  2DIX A;  2UXD I;  1UEK A;  1DQ3 A;  2PNL A;  4DUZ E;  2G7H A;  5FLX Q;  3ZOQ B;  1HR0 I;  3IWB A;  2UU9 I;  4FWG A;  2L2K B;  3ADI A;  3PYG A;  3PYF A;  4LF4 I;  4DV3 I;  1BKN A;  1N0U A;  3FIG A;  5AAS A;  1ZM2 A;  2O1W A;  4DR5 I;  2LJH A;  2L6M A;  4NXN I;  1N32 I;  1MG7 A;  3P06 A;  4X64 I;  4OX9 I;  4DV4 I;  4USK A;  2R3V A;  4X66 I;  4Q28 A;  5GMD A;  1EKZ A;  2JOX A;  2E5L E;  1NHI A;  2EWL A;  2HKE A;  2MDR A;  4JI8 E;  2UUC E;  2V85 A;  1N36 E;  4L5N C;  5LMU E;  3K1J A;  4UTG A;  3WU3 A;  4JI2 I;  2FTX B;  4JI6 I;  1RC7 A;  1QZR A;  1IBL I;  3ADJ A;  4HXZ A;  2UXB E;  4I3H A;  1N33 E;  1K47 A;  2VQE I;  3J7A G;  4GKJ I;  4LF9 I;  2ODR D;  4DV1 E;  4DR4 E;  2HFU A;  4OOG C;  4R03 A;  1KIJ A;  1HNZ E;  3PYE A;  4DPU A;  2JOB A;  1OJ4 A;  4F9A B;  3B82 A;  4JI0 I;  2EFG A;  1FI4 A;  4DKK A;  2RSM A;  5AE1 A;  2NPF A;  4B3S I;  1N0V C;  4B3R E;  3GON A;  3HQ1 A;  3QT8 A;  2ODR C;  3T1Y I;  2WZO A;  4AQY E;  3VYX A;  4LU9 A;  2V88 A;  4MYU A;  1WHQ A;  3OTO E;  4JG4 A;  3H4L A;  4EMD A;  3LPS A;  4BC9 A;  1B62 A;  3JAM C;  4WYQ B;  5LMN E;  3C4B A;  2CG9 A;  4ZVI A;  5BR8 E;  1HNW E;  2DB2 A;  3V5R A;  1NZ0 A;  2RTX A;  4LF8 I;  1QU6 A;  2E1M A;  3DJW A;  4DUY E;  4N3O A;  2HHH I;  4JV5 I;  4IZJ D;  2YZT A;  4M30 A;  4DUZ I;  4DR2 I;  2KOU A;  4WUC A;  4DR1 I;  4DV2 E;  1N34 E;  2DSY A;  3H09 A;  3HTX A;  1MX0 A;  3LML A;  2RS6 A;  3MSW A;  1XNQ E;  1D6T A;  3K6Q A;  2V86 A;  2O1V A;  4ED4 A;  1Y4S A;  1GZ6 A;  1HNX E;  4KZS A;  3J81 C;  1YZ9 A;  4BMJ A;  2LE2 A;  1IBM E;  2E5L I;  1J5E I;  4LFB I;  1Z0C A;  3IWC A;  2L2N A;  4P7D A;  2J7K A;  4JI8 I;  1Z5C A;  2UUC I;  4K0K I;  1N36 I;  1EI1 A;  5AE3 A;  5LMU I;  2L33 A;  4JI3 E;  4NXM E;  3DF6 A;  2DEJ A;  4WUB A;  4GKK I;  2O1U A;  2UXB I;  1N33 I;  4LF6 E;  2CZ9 A;  2UUA E;  1Z5B A;  4B3T I;  4F9B B;  1HK7 A;  4DR4 I;  2M4I A;  2VF3 A;  3JAM Q;  2UXC I;  4BC7 A;  4LF7 E;  1PVG A;  1HNZ I;  2Z5B B;  1DAR A;  3P1X A;  4X8W A;  1PIE A;  2B7T A;  1FJG E;  2DEI A;  4FWD A;  4LFA E;  4X65 I;  2V8P A;  2EZ6 A;  4JI1 E;  5IWA E;  4AQY I;  4JI4 E;  1SR9 A;  2KHX A;  2ZM6 I;  3J7Y p;  2UUB I;  4B3M E;  4XTJ A;  1Y4U A;  4DPX A;  2E1R A;  4IZK A;  1FWK A;  4DR6 E;  4FWH A;  1WXR A;  1Y6Z A;  5LMN I;  5BR8 I;  4Z7Y A;  1YYO A;  3LTO A;  3J81 Q;  1KTV A;  1XMO E;  2NUG A;  3WU6 A;  4DXL A;  2IOP A;  4DPT A;  3K85 A;  3IWD A;  1H73 A;  3JU0 A;  1ZXN A;  2WW4 A;  2V83 A;  3VYY A;  2X36 A;  2V2Q A;  2JVA A;  4YY3 E;  1MU5 A;  4FN5 A;  4DR7 I;  2IHR 1;  2V89 A;  4TUG A;  3M6A A;  1N34 I;  1UIL A;  1X49 A;  1XNQ I;  1GQE A;  2LRS A;  2LMZ A;  1EA6 A;  1T4O A;  4DU8 A;  4DR3 E;  3HJC A;  1KVK A;  2Z5E A;  1T4N A;  5A2Q C;  2LUQ A;  4R8O A;  2V8Q B;  5T6J A;  4JI3 I;  2FV4 B;  2UU9 E;  4DV0 E;  2HK2 A;  4LF4 E;  1I94 I;  3LNU A;  3RMP A;  2UUA I;  4LF5 E;  2KON A;  4NXN E;  1WHN A;  4JYA E;  1IBK E;  3OML A;  2RS7 A;  3WU5 A;  1N32 E;  4X64 E;  4DV4 E;  2O1T A;  2V34 A;  4LF7 I;  5DNY A;  1ZM3 A;  3WU4 A;  2CGE A;  4WFT A;  4HAC B;  2IOQ A;  2VE7 C;  4PRV A;  1PKP A;  4DV5 E;  4X62 E;  2NUE A;  2ZBK B;  4KHP E;  2BM0 A;  2Z5C A;  4LFA I;  1YYW A;  2F4V E;  2ZIT A;  5FWK A;  3QT7 A;  4IZJ B;  4JI1 I;  1KKH A;  2NA2 A;  4GKJ E;  2PNM A;  4LF9 E;  2L3C A;  3J7A M;  4YHH E;  4DV7 E;  1ELO A;  2AJ4 A;  2L2M A;  5LL6 R;  4DU7 A;  1T4L B;  3AUZ A;  3HPZ A;  1Z0T A;  1RR9 A;  1WUU A;  2X7I A;  4M2Z A;  1ZBT A;  4DV1 I;  4JI5 E;  4P7A A;  4DMI A;  1H74 A;  1Z59 A;  1RRE A;  2HKJ A;  1X47 A;  2Q2E B;  3K17 A;  1RQ0 A;  5ADZ A;  4IZK B;  1DI2 A;  3ZZU A;  3PRY A;  3T1H E;  4PRX A;  4P52 A;  1FKA E;  4DV6 E;  4B3R I;  4BCA A;  3HUL A;  3VK6 A;  2B3T B;  2LUP B;  2LTS A;  3Q6M A;  3OTO I;  4JV5 E;  4DR2 E;  1XNR E;  1ZM9 A;  2JWO A;  4DR1 E;  4DV0 I;  2VQF E;  4DPY A;  1ZM4 A;  1H7S A;  1S4E A;  1XMQ E;  2V2Z A;  2R42 A;  4UT4 A;  1HNW I;  4LF5 I;  4LFC E;  2V2V A;  2B7V A;  2FGG A;  4JYA I;  1IBK I;  1U2R A;  4DUY I;  2L3J A;  4JI7 E;  2Z5B A;  2NUF A;  4F9C B;  4LFB E;  1J5E E;  2MC6 A;  3LLH A;  1S16 A;  5CFF E;  1NHH A;  3HXL A;  2BV3 A;  4K0K E;  2LTR A;  4Z7C A;  2K4V A;  4DV2 I;  3ADL A;  4X62 I;  4DV5 I;  5IT9 C;  2M7Q A;  4KHP I;  2F4V I;  1UHZ A;  4GKK E;  4DPW A;  1J26 A;  1H7U A;  4B3T E;  3ZKB A;  2A2C A;  2OI2 A;  1HNX I;  2A2D A;  4R1F A;  2H36 X;  1IBM I;  2M1S A;  4GEQ B;  4P78 A;  4YHH I;  2DMY A;  4M0V A;  2UXC E;  3F6H A;  2HK3 A;  4DV7 I;  2UXD E;  1Z0E A;  3F0N A;  4URL A;  2N3H A;  1HR0 E;  1Z0G A;  4PU9 A;  1B63 A;  4NXM I;  4I8O A;  4DV3 E;  1Z0V A;  3QT5 A;  4WSP A;  4LF6 I;  2MC5 A;  3B8H A;  4M1K A;  4DR5 E;  4X65 E;  3QT6 A;  3CWV A;  4LTY A;  2Z5C B;  5AE2 A;  4JI5 I;  2ZM6 E;  4OX9 E;  4X66 E;  2UUB E;  4F54 A;  4BBY A;  4HYM A;  4MYT A;  5F3W A;  1Z5A A;  3J80 C;  1FJG I;  4BS9 A;  3T1H I;  4JI2 E;  3F6G A;  2GS8 A;  4JI6 E;  3ZZT A;  4DV6 I;  1IBL E;  3ADG A;  5FLX C;  3HPS A;  1USV A;  4FW9 A;  2LBS B;  4USM A;  2F8B A;  5IWA I;  2VQE E;  1ZXM A;  4JI4 I;  2YT4 A;  3PYD A;  3AV0 A;  5IT9 Q;  4B3M I;  5GME A;  4DR6 I;  4DR7 E;  1Z0W A;  1XNR I;  1H72 C;  3Q1Q A;  1Z0B A;  3ZZ0 A;  2L8T A;  2VQF I;  1USU A;  4KQV A;  2B9D A;  1XMQ I;  2JR1 A;  4JI0 E;  2BM1 A;  2JY9 A;  1FNM A;  4WPY A;  4LFC I;  2L92 A;  4B3S E;  2GQ0 A;  1XMO I;  4L8N A;  5A2Q Q;  1ZBQ A;  4JI7 I;  3T1Y E;  2N3G A;  2CPN A;  4HAC A;  4J8Z A;  4TUI A;  1STU A;  1O0W A;  3D4J A;  4YY3 I;  2LJP A;  3KWR A;  3JTZ A;  3ZM7 A;  1NHJ A;  1VIS A;  3B78 A;  3V2U C;  2VF1 A;  4IZJ A;  4HY1 A;  4RPF A;  2XEX A;  1I94 E;  4WUD A;  3ZKD A;  3Q6N A;  4LF8 E;  5L3J A;  1XHK A;  2HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...