2UUAI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
molecule tags Ribosome
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uuaI00
1DARA 3D4JA 1NHHA 4GKJE 3GONA 1N34I 4USKA 1MG7A 1XNQI 4HY1A 3F0NA 2UUCI 4FWHA 2BM1A 3T1HE 3QT5A 1PVGA 4HACB 3M6AA 1XHKA 4X65I 4NXME 4NXNE 1Z0CA 4DV5E 1B63A 2HKEA 1J5EE 4DV4I 3H4LA 4K0KI 1N36I 4LFCE 3ZZTA 3OTOI 2WW4A 2UXBE 3WU6A 2UUCE 1XMOI 4K0KE 4B3ME 2VF3A 1N36E 4X65E 3K1JA 2ZM6I 4B3TI 2V2VA 1N34E 4LFBE 4DUYE 1KIJA 3LNUA 1FWKA 4XTJA 2E5LI 4GKKI 2XEXA 5LMUI 2BM0A 4DV3I 4DR7I 4NXMI 1A6FA 1N33I 1B62A 4LFBI 3J80Q 2HHHE 4LF5I 4HYMA 1HNZI 3ZKDA 4DR5E 4PRVA 4B3MI 3B82A 4LFCI 1KVKA 1Z0WA 3HULA 2X7IA 3LPSA 5FLXQ 1XNRE 4X62E 4DV1E 4B3RE 5IWAI 1Z0GA 4B3SI 3V5RA 3J81Q 3J81C 1HNWI 1Z0VA 1Z5CA 4DUZI 5FLXC 3PYGA 4AQYE 3PYDA 4JI4I 1Z0TA 1ELOA 5IWAE 4DPUA 3K17A 3LTOA 4JI7E 1PKPA 2HK3A 2LJPA 4GKJI 1H73A 4YY3I 1HNXI 1ZXMA 4KHPI 4Z7CA 1VISA 3J80C 3PYFA 4JI7I 4DR2I 4DUZE 3QT8A 2UU9E 1MX0A 4JI6E 4AQYI 4JG4A 4X64I 4LF7I 4PU9A 4DPWA 2F4VE 3B78A 2HK2A 4YY3E 3QT7A 1KTVA 1EA6A 1HNXE 2VQEE 4JI0I 1HR0I 1NHIA 4P7AA 2UUAE 2UUBE 4DV0I 1FNMA 1I94I 4DR3I 4B3TE 1XMQI 4Z7YA 4LF5E 4DV7E 4LF4E 4OX9I 4LF7E 4FN5A 3ZM7A 4DV6E 4MYTA 4JI3E 4DU8A 1N33E 5GMDA 1IBLI 4JYAI 4DR4I 3WU3A 1U2RA 3B8HA 4R1FA 4LF4I 2E1RA 2UUBI 3CWVA 2Q2EB 1XMQE 4X66E 3J7AG 4M1KA 1D6TA 2UXDE 1HR0E 3PYEA 4DV1I 4B3RI 1Z59A 3T1YE 4JI1E 1I94E 4DR3E 4LF8E 3QT6A 1FKAE 3OTOE 1ZM2A 2R3VA 2AJ4A 3V2UC 3WU5A 4FWDA 2ZITA 1J5EI 1NZ0A 5BR8I 4YHHE 5LMNI 2UXCI 1Z0BA 4JI1I 2BV3A 3T1YI 2V2ZA 4DR2E 2HFSA 1H72C 4UTGA 4WUDA 1FWLA 3ZKBA 1EI1A 2A2DA 4DR5I 3T1HI 2V34A 4DV3E 2DEJA 4ED4A 4DR7E 4LFAE 1PIEA 4X66I 1NHJA 4URLA 4MYUA 2GS8A 1S16A 3J7AM 4DR1I 1H74A 1ZM9A 4HXZA 4NXNI 2VQFI 5LL6R 1XNQE 2R42A 5GMEA 1H7UA 4DV7I 1HNZE 4JI4E 1N32E 2EFGA 3Q1QA 4DV0E 4WUCA 4USMA 1Z0EA 4DUYI 1FJGI 1IBLE 4JYAE 4DR4E 1XNRI 4DR1E 4DV4E 2E5LE 4JI2E 3WU4A 2CZ9A 1K47A 4JI3I 4LF6E 4LF9I 4WUBA 1N0VC 1Z5AA 5IT9Q 1FI4A 4DR6I 1FJGE 1BKNA 2UXDI 2UU9I 4JI6I 1RREA 1OJ4A 1XMOE 1RR9A 2J7KA 4JI8I 2HKJA 1S4EA 4JI5I 4DXLA 5BR8E 4JI2I 1ZM4A 2VQEI 1QZRA 5IT9C 1N32I 5LMUE 2HFUA 5L3JA 4LF8I 4DV5I 4DR6E 4JI8E 4UT4A 1UEKA 4P52A 4FWGA 2UUAI 4PRXA 4JV5I 4FW9A 1HNWE 1ZXNA 4LF6I 4EMDA 4LF9E 2UXBI 4ZVIA 4KHPE 4JI0E 2DEIA 2ZM6E 1IBMI 4DPXA 4JI5E 1Z5BA 4LFAI 2OI2A 2X36A 3JAMQ 4X64E 4JV5E 1IBME 1WUUA 2HHHI 2VQFE 1H7SA 3ZZUA 5A2QQ 3ZZ0A 4DV2I 4HACA 1MU5A 4GKKE 1N0UA 4DU7A 2ZBKB 2F4VI 2V2QA 2A2CA 2V8PA 1IBKE 4DPYA 2NPFA 4I3HA 5A2QC 4OX9E 4KQVA 4RPFA 4B3SE 2UXCE 4DPTA 1ZM3A 1IBKI 1KKHA 4DV2E 3JAMC 4YHHI 5LMNE 4X62I 4DV6I
chains in the Genus database with same CATH superfamily
2PO2B 1R6MA 1DARA 3D4JA 1NHHA 4GKJE 3GONA 1N34I 3U1YA 4USKA 1MG7A 2O1WA 1XNQI 4HY1A 3F0NA 2UUCI 4FWHA 2BM1A 1USUA 3T1HE 3QT5A 4IFDD 1PVGA 4HACB 3M6AA 1XHKA 4AIDA 4X65I 4NXME 2VESA 2BA1D 4OZEA 4NXNE 1E3HA 5JEAB 1VI7A 5K36D 1Z0CA 4DV5E 1B63A 4LOMA 4BA2B 2HKEA 1J5EE 4DV4I 3H4LA 4K0KI 4GQUA 1N36I 4LFCE 1UDNA 4LCGA 3ZZTA 3OTOI 2WW4A 2UXBE 3L7ZA 3PS3A 3WU6A 2UUCE 1XMOI 4K0KE 4J3DA 4B3ME 4MQYA 2IESA 4FW3A 4MU0A 2VF3A 3PRYA 1N36E 4X65E 3GCMA 3K1JA 2ZM6I 4B3TI 3P3GA 3H1CA 2V2VA 4QNJA 1N34E 4LFBE 2IOQA 2PO1A 1R6LA 4DUYE 1KIJA 3LNUA 1FWKA 4XTJA 2E5LI 2PNLA 4GKKI 3Q6NA 2XEXA 5LMUI 2BM0A 1USVA 4DV3I 4DR7I 4NXMI 1A6FA 1N33I 2BR2A 5EKWA 1B62A 4LFBI 3J80Q 2HHHE 4LF5I 4FW5A 4HYMA 1HNZI 3ZKDA 4DR5E 4PRVA 4B3MI 3B82A 2WNRB 4LFCI 1KVKA 1Z0WA 4BA2A 3HULA 2X7IA 3LPSA 5FLXQ 1XNRE 4U3DA 1UDSA 4FW6A 4X62E 4DV1E 4B3RE 2O1TA 5IWAI 1Z0GA 4BA1B 4B3SI 3V5RA 3J81Q 3J81C 1HNWI 1Z0VA 2Z5CB 5JEAD 1Z5CA 2JT2A 4DUZI 5JEAE 2PO2A 5FLXC 3PYGA 4AQYE 3PYDA 4JI4I 1Z0TA 1ELOA 5IWAE 4DPUA 5K36F 3K17A 2C37A 3LTOA 4JI7E 1PKPA 2HK3A 2LJPA 4GKJI 1H73A 4IZJB 4NBQA 2BA0G 4YY3I 1HNXI 1ZXMA 4KHPI 4Z7CA 1VISA 2C38A 3J80C 3PS1A 3PYFA 4JI7I 4DR2I 1UDQA 3NZKA 4DUZE 3QT8A 2UU9E 1MX0A 4JI6E 4AQYI 4QNKA 5DRRA 4JG4A 4X64I 4IFDC 3CDIA 4LF7I 3M7NG 4PU9A 3B4TA 4DPWA 2NN6D 4OO1D 2F4VE 3B78A 3M85G 2HK2A 4YY3E 3QT7A 1KTVA 2NN6C 1EA6A 1HNXE 2PNZA 2VQEE 4JI0I 1HR0I 1NHIA 4P7AA 2UUAE 2UUBE 4DV0I 1FNMA 2O3ZA 1I94I 4DR3I 4B3TE 5K36A 1XMQI 4Z7YA 4LF5E 3P3CA 4DV7E 2GO3A 3M85D 5K36C 4LF4E 4OX9I 5ELWA 4LF7E 4FN5A 3ZM7A 4FW4A 4DV6E 2CG9A 4ISAA 4MYTA 4JI3E 3U1KA 3HKMA 3P76A 4DU8A 1N33E 5GMDA 4IZJA 1OYSA 1IBLI 4JYAI 4DR4I 3WU3A 1U2RA 2Z5BA 3B8HA 4R1FA 4LF4I 1Y4SA 2E1RA 4OKGA 5C0XD 2UUBI 3CWVA 2Q2EB 2JE6A 1HK7A 4IFDA 1XMQE 2J65A 4IZJD 2BA1G 4X66E 3J7AG 1Y5YA 2Z5CA 4M1KA 1D6TA 2BA0D 2UXDE 4U3BA 1OYPA 1HR0E 3PS2A 3PYEA 4DV1I 4B3RI 4OO1E 1Z59A 3P06A 3T1YE 4JI1E 1I94E 4DR3E 4LF8E 3QT6A 1FKAE 3OTOE 5C0XC 1ZM2A 2R3VA 4MU3A 4LCHA 5EL9A 2AJ4A 3V2UC 3WU5A 4FWDA 2ZITA 1J5EI 1NZ0A 5BR8I 4YHHE 5LMNI 1OYRA 2C38B 2UXCI 2NN6A 1Z0BA 4JI1I 2BV3A 3T1YI 2V2ZA 2NN6B 4OO1B 4DR2E 2HFSA 1H72C 4UTGA 4WUDA 4IZKB 1FWLA 5DROA 3ZKBA 5K36E 1EI1A 2A2DA 2JEBA 4DR5I 3T1HI 2V34A 2WNRA 3DD6A 4DV3E 2DEJA 4ED4A 4DR7E 4LFAE 1UDOA 1PIEA 4X66I 1RHYA 2GQ0A 1NHJA 4URLA 4MYUA 2GS8A 1S16A 3J7AM 2WP8B 4DR1I 2IOPA 3CDJA 1H74A 4BA1A 1ZM9A 4HXZA 4NXNI 2VQFI 3M7ND 5LL6R 3L7ZB 1XNQE 2R42A 5GMEA 1H7UA 4DV7I 4IFDE 5FWKA 1HNZE 5DNXA 1Y60A 4MU4A 4JI4E 5C0XB 1N32E 2EFGA 3Q1QA 1Y4UA 4DV0E 4OO1F 1E3PA 2NN6F 4WUCA 4USMA 4IS9A 1Z0EA 4DUYI 3Q6MA 1FJGI 1IBLE 4LPFA 4DR4E 4JYAE 1XNRI 4DR1E 4DV4E 2E5LE 2CGEA 4JI2E 3HJCA 3WU4A 2CZ9A 1K47A 4LCFA 4JI3I 4LF6E 4LF9I 5DRQA 4WUBA 1N0VC 1Z5AA 5IT9Q 1FI4A 2O1UA 2PNZB 5JEAA 4DR6I 1FJGE 1BKNA 2UXDI 2GO4A 2UU9I 4JI6I 1RREA 1OJ4A 1XMOE 1RR9A 2J7KA 4JI8I 5JEAC 2HKJA 1S4EA 4JI5I 4DXLA 5BR8E 4JI2I 1ZM4A 4FW7A 2VQEI 1QZRA 1Y6ZA 5IT9C 1N32I 1YH8A 5LMUE 2CVEA 3GLLA 5JEAF 2HFUA 5L3JA 4LF8I 4DV5I 4DR6E 2BR2B 4JI8E 4UT4A 1UEKA 2F1DA 3UHMA 2Z5BB 4P52A 2JE6B 4FWGA 2UUAI 4PRXA 4JV5I 4FW9A 1HNWE 1ZXNA 4LF6I 4EMDA 4LF9E 2UXBI 4MDTA 2JEBB 2Z5EA 4ZVIA 4AIMA 4KHPE 4JI0E 4IFDB 2DEIA 2ZM6E 1IBMI 4DPXA 2PNMA 5C0XE 4JI5E 1Z5BA 4LFAI 2OI2A 5K36B 4OO1C 2X36A 5C0XF 1XXEA 3JAMQ 2O1VA 4X64E 4JV5E 2AE8A 4AM3A 3K85A 1IBME 1WUUA 2C39B 2HHHI 2VQFE 4N3OA 2PO0B 1H7SA 2PO1B 2PO0A 3ZZUA 1YHCA 5A2QQ 2JEAA 3ZZ0A 4DV2I 2C39A 4HACA 1MU5A 4GKKE 1N0UA 3GMEA 5C0XA 2IERA 4DU7A 2ZBKB 2F4VI 2V2QA 2JEAB 2A2CA 5DRPA 1P42A 4IZKA 2V8PA 1IBKE 4DPYA 5DNLA 4OO1A 2NPFA 4I3HA 5A2QC 4OX9E 4KQVA 4RPFA 4B3SE 2UXCE 3P3EA 4DPTA 2WP8A 1ZM3A 1IBKI 1KKHA 4IFDF 4DV2E 4MU1A 3JAMC 4YHHI 5LMNE 4X62I 3KRNA 4DV6I 2NN6E 2C37B
chains in the Genus database with same CATH topology
1DARA 3D4JA 1NHHA 4GKJE 3GONA 1N34I 4USKA 1MG7A 2O1WA 1XNQI 4HY1A 3F0NA 2UUCI 4FWHA 2BM1A 1USUA 3T1HE 3QT5A 1PVGA 4HACB 3M6AA 1XHKA 4X65I 4NXME 4NXNE 1Z0CA 4DV5E 1B63A 2HKEA 1J5EE 4DV4I 3H4LA 4K0KI 1N36I 4LFCE 3ZZTA 3OTOI 2WW4A 2UXBE 3WU6A 2UUCE 1XMOI 4K0KE 4B3ME 2VF3A 3PRYA 1N36E 4X65E 3K1JA 2ZM6I 4B3TI 2V2VA 1N34E 4LFBE 2IOQA 4DUYE 1KIJA 3LNUA 1FWKA 4XTJA 2E5LI 2PNLA 4GKKI 3Q6NA 2XEXA 5LMUI 2BM0A 1USVA 4DV3I 4DR7I 4NXMI 1A6FA 1N33I 1B62A 4LFBI 3J80Q 2HHHE 4LF5I 4HYMA 1HNZI 3ZKDA 4DR5E 4PRVA 4B3MI 3B82A 4LFCI 1KVKA 1Z0WA 3HULA 2X7IA 3LPSA 5FLXQ 1XNRE 4X62E 4DV1E 4B3RE 2O1TA 5IWAI 1Z0GA 4B3SI 3V5RA 3J81Q 3J81C 1HNWI 1Z0VA 2Z5CB 1Z5CA 4DUZI 5FLXC 3PYGA 4AQYE 3PYDA 4JI4I 1Z0TA 1ELOA 5IWAE 4DPUA 3K17A 3LTOA 4JI7E 1PKPA 2HK3A 2LJPA 4GKJI 1H73A 4IZJB 4YY3I 1HNXI 1ZXMA 4KHPI 4Z7CA 1VISA 3J80C 3PYFA 4JI7I 4DR2I 4DUZE 3QT8A 2UU9E 1MX0A 4JI6E 4AQYI 4JG4A 4X64I 4LF7I 4PU9A 4DPWA 2F4VE 3B78A 2HK2A 4YY3E 3QT7A 1KTVA 1EA6A 1HNXE 2VQEE 4JI0I 1HR0I 1NHIA 4P7AA 2UUAE 2UUBE 4DV0I 1FNMA 1I94I 4DR3I 4B3TE 1XMQI 4Z7YA 4LF5E 4DV7E 4LF4E 4OX9I 4LF7E 4FN5A 3ZM7A 4DV6E 2CG9A 4MYTA 4JI3E 4DU8A 1N33E 5GMDA 4IZJA 1IBLI 4JYAI 4DR4I 3WU3A 1U2RA 2Z5BA 3B8HA 4R1FA 4LF4I 1Y4SA 2E1RA 2UUBI 3CWVA 2Q2EB 1HK7A 1XMQE 4IZJD 4X66E 3J7AG 2Z5CA 4M1KA 1D6TA 2UXDE 1HR0E 3PYEA 4DV1I 4B3RI 1Z59A 3P06A 3T1YE 4JI1E 1I94E 4DR3E 4LF8E 3QT6A 1FKAE 3OTOE 1ZM2A 2R3VA 2AJ4A 3V2UC 3WU5A 4FWDA 2ZITA 1J5EI 1NZ0A 5BR8I 4YHHE 5LMNI 2UXCI 1Z0BA 4JI1I 2BV3A 3T1YI 2V2ZA 4DR2E 2HFSA 1H72C 4UTGA 4WUDA 4IZKB 1FWLA 3ZKBA 1EI1A 2A2DA 4DR5I 3T1HI 2V34A 4DV3E 2DEJA 4ED4A 4DR7E 4LFAE 1PIEA 4X66I 2GQ0A 1NHJA 4URLA 4MYUA 2GS8A 1S16A 3J7AM 4DR1I 2IOPA 1H74A 1ZM9A 4HXZA 4NXNI 2VQFI 5LL6R 1XNQE 2R42A 5GMEA 1H7UA 4DV7I 5FWKA 1HNZE 4JI4E 1N32E 2EFGA 3Q1QA 1Y4UA 4DV0E 4WUCA 4USMA 1Z0EA 4DUYI 3Q6MA 1FJGI 1IBLE 4JYAE 4DR4E 1XNRI 4DR1E 4DV4E 2E5LE 2CGEA 4JI2E 3HJCA 3WU4A 2CZ9A 1K47A 4JI3I 4LF6E 4LF9I 4WUBA 1N0VC 1Z5AA 5IT9Q 1FI4A 2O1UA 4DR6I 1FJGE 1BKNA 2UXDI 2UU9I 4JI6I 1RREA 1OJ4A 1XMOE 1RR9A 2J7KA 4JI8I 2HKJA 1S4EA 4JI5I 4DXLA 5BR8E 4JI2I 1ZM4A 2VQEI 1QZRA 1Y6ZA 5IT9C 1N32I 5LMUE 2HFUA 5L3JA 4LF8I 4DV5I 4DR6E 4JI8E 4UT4A 1UEKA 2Z5BB 4P52A 4FWGA 2UUAI 4PRXA 4JV5I 4FW9A 1HNWE 1ZXNA 4LF6I 4EMDA 4LF9E 2UXBI 2Z5EA 4ZVIA 4KHPE 4JI0E 2DEIA 2ZM6E 1IBMI 4DPXA 2PNMA 4JI5E 1Z5BA 4LFAI 2OI2A 2X36A 3JAMQ 2O1VA 4X64E 4JV5E 3K85A 1IBME 1WUUA 2HHHI 2VQFE 4N3OA 1H7SA 3ZZUA 5A2QQ 3ZZ0A 4DV2I 4HACA 1MU5A 4GKKE 1N0UA 4DU7A 2ZBKB 2F4VI 2V2QA 2A2CA 4IZKA 2V8PA 1IBKE 4DPYA 2NPFA 4I3HA 5A2QC 4OX9E 4KQVA 4RPFA 4B3SE 2UXCE 4DPTA 1ZM3A 1IBKI 1KKHA 4DV2E 3JAMC 4YHHI 5LMNE 4X62I 4DV6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DAR A;  3D4J A;  1NHH A;  4GKJ E;  3GON A;  1N34 I;  4USK A;  1MG7 A;  1XNQ I;  4HY1 A;  3F0N A;  2UUC I;  4FWH A;  2BM1 A;  3T1H E;  3QT5 A;  1PVG A;  4HAC B;  3M6A A;  1XHK A;  4X65 I;  4NXM E;  4NXN E;  1Z0C A;  4DV5 E;  1B63 A;  2HKE A;  1J5E E;  4DV4 I;  3H4L A;  4K0K I;  1N36 I;  4LFC E;  3ZZT A;  3OTO I;  2WW4 A;  2UXB E;  3WU6 A;  2UUC E;  1XMO I;  4K0K E;  4B3M E;  2VF3 A;  1N36 E;  4X65 E;  3K1J A;  2ZM6 I;  4B3T I;  2V2V A;  1N34 E;  4LFB E;  4DUY E;  1KIJ A;  3LNU A;  1FWK A;  4XTJ A;  2E5L I;  4GKK I;  2XEX A;  5LMU I;  2BM0 A;  4DV3 I;  4DR7 I;  4NXM I;  1A6F A;  1N33 I;  1B62 A;  4LFB I;  3J80 Q;  2HHH E;  4LF5 I;  4HYM A;  1HNZ I;  3ZKD A;  4DR5 E;  4PRV A;  4B3M I;  3B82 A;  4LFC I;  1KVK A;  1Z0W A;  3HUL A;  2X7I A;  3LPS A;  5FLX Q;  1XNR E;  4X62 E;  4DV1 E;  4B3R E;  5IWA I;  1Z0G A;  4B3S I;  3V5R A;  3J81 Q;  3J81 C;  1HNW I;  1Z0V A;  1Z5C A;  4DUZ I;  5FLX C;  3PYG A;  4AQY E;  3PYD A;  4JI4 I;  1Z0T A;  1ELO A;  5IWA E;  4DPU A;  3K17 A;  3LTO A;  4JI7 E;  1PKP A;  2HK3 A;  2LJP A;  4GKJ I;  1H73 A;  4YY3 I;  1HNX I;  1ZXM A;  4KHP I;  4Z7C A;  1VIS A;  3J80 C;  3PYF A;  4JI7 I;  4DR2 I;  4DUZ E;  3QT8 A;  2UU9 E;  1MX0 A;  4JI6 E;  4AQY I;  4JG4 A;  4X64 I;  4LF7 I;  4PU9 A;  4DPW A;  2F4V E;  3B78 A;  2HK2 A;  4YY3 E;  3QT7 A;  1KTV A;  1EA6 A;  1HNX E;  2VQE E;  4JI0 I;  1HR0 I;  1NHI A;  4P7A A;  2UUA E;  2UUB E;  4DV0 I;  1FNM A;  1I94 I;  4DR3 I;  4B3T E;  1XMQ I;  4Z7Y A;  4LF5 E;  4DV7 E;  4LF4 E;  4OX9 I;  4LF7 E;  4FN5 A;  3ZM7 A;  4DV6 E;  4MYT A;  4JI3 E;  4DU8 A;  1N33 E;  5GMD A;  1IBL I;  4JYA I;  4DR4 I;  3WU3 A;  1U2R A;  3B8H A;  4R1F A;  4LF4 I;  2E1R A;  2UUB I;  3CWV A;  2Q2E B;  1XMQ E;  4X66 E;  3J7A G;  4M1K A;  1D6T A;  2UXD E;  1HR0 E;  3PYE A;  4DV1 I;  4B3R I;  1Z59 A;  3T1Y E;  4JI1 E;  1I94 E;  4DR3 E;  4LF8 E;  3QT6 A;  1FKA E;  3OTO E;  1ZM2 A;  2R3V A;  2AJ4 A;  3V2U C;  3WU5 A;  4FWD A;  2ZIT A;  1J5E I;  1NZ0 A;  5BR8 I;  4YHH E;  5LMN I;  2UXC I;  1Z0B A;  4JI1 I;  2BV3 A;  3T1Y I;  2V2Z A;  4DR2 E;  2HFS A;  1H72 C;  4UTG A;  4WUD A;  1FWL A;  3ZKB A;  1EI1 A;  2A2D A;  4DR5 I;  3T1H I;  2V34 A;  4DV3 E;  2DEJ A;  4ED4 A;  4DR7 E;  4LFA E;  1PIE A;  4X66 I;  1NHJ A;  4URL A;  4MYU A;  2GS8 A;  1S16 A;  3J7A M;  4DR1 I;  1H74 A;  1ZM9 A;  4HXZ A;  4NXN I;  2VQF I;  5LL6 R;  1XNQ E;  2R42 A;  5GME A;  1H7U A;  4DV7 I;  1HNZ E;  4JI4 E;  1N32 E;  2EFG A;  3Q1Q A;  4DV0 E;  4WUC A;  4USM A;  1Z0E A;  4DUY I;  1FJG I;  1IBL E;  4JYA E;  4DR4 E;  1XNR I;  4DR1 E;  4DV4 E;  2E5L E;  4JI2 E;  3WU4 A;  2CZ9 A;  1K47 A;  4JI3 I;  4LF6 E;  4LF9 I;  4WUB A;  1N0V C;  1Z5A A;  5IT9 Q;  1FI4 A;  4DR6 I;  1FJG E;  1BKN A;  2UXD I;  2UU9 I;  4JI6 I;  1RRE A;  1OJ4 A;  1XMO E;  1RR9 A;  2J7K A;  4JI8 I;  2HKJ A;  1S4E A;  4JI5 I;  4DXL A;  5BR8 E;  4JI2 I;  1ZM4 A;  2VQE I;  1QZR A;  5IT9 C;  1N32 I;  5LMU E;  2HFU A;  5L3J A;  4LF8 I;  4DV5 I;  4DR6 E;  4JI8 E;  4UT4 A;  1UEK A;  4P52 A;  4FWG A;  2UUA I;  4PRX A;  4JV5 I;  4FW9 A;  1HNW E;  1ZXN A;  4LF6 I;  4EMD A;  4LF9 E;  2UXB I;  4ZVI A;  4KHP E;  4JI0 E;  2DEI A;  2ZM6 E;  1IBM I;  4DPX A;  4JI5 E;  1Z5B A;  4LFA I;  2OI2 A;  2X36 A;  3JAM Q;  4X64 E;  4JV5 E;  1IBM E;  1WUU A;  2HHH I;  2VQF E;  1H7S A;  3ZZU A;  5A2Q Q;  3ZZ0 A;  4DV2 I;  4HAC A;  1MU5 A;  4GKK E;  1N0U A;  4DU7 A;  2ZBK B;  2F4V I;  2V2Q A;  2A2C A;  2V8P A;  1IBK E;  4DPY A;  2NPF A;  4I3H A;  5A2Q C;  4OX9 E;  4KQV A;  4RPF A;  4B3S E;  2UXC E;  4DPT A;  1ZM3 A;  1IBK I;  1KKH A;  4DV2 E;  3JAM C;  4YHH I;  5LMN E;  4X62 I;  4DV6 I; 
#chains in the Genus database with same CATH topology
 2PO2 B;  1R6M A;  1DAR A;  3D4J A;  1NHH A;  4GKJ E;  3GON A;  1N34 I;  3U1Y A;  4USK A;  1MG7 A;  2O1W A;  1XNQ I;  4HY1 A;  3F0N A;  2UUC I;  4FWH A;  2BM1 A;  1USU A;  3T1H E;  3QT5 A;  4IFD D;  1PVG A;  4HAC B;  3M6A A;  1XHK A;  4AID A;  4X65 I;  4NXM E;  2VES A;  2BA1 D;  4OZE A;  4NXN E;  1E3H A;  5JEA B;  1VI7 A;  5K36 D;  1Z0C A;  4DV5 E;  1B63 A;  4LOM A;  4BA2 B;  2HKE A;  1J5E E;  4DV4 I;  3H4L A;  4K0K I;  4GQU A;  1N36 I;  4LFC E;  1UDN A;  4LCG A;  3ZZT A;  3OTO I;  2WW4 A;  2UXB E;  3L7Z A;  3PS3 A;  3WU6 A;  2UUC E;  1XMO I;  4K0K E;  4J3D A;  4B3M E;  4MQY A;  2IES A;  4FW3 A;  4MU0 A;  2VF3 A;  3PRY A;  1N36 E;  4X65 E;  3GCM A;  3K1J A;  2ZM6 I;  4B3T I;  3P3G A;  3H1C A;  2V2V A;  4QNJ A;  1N34 E;  4LFB E;  2IOQ A;  2PO1 A;  1R6L A;  4DUY E;  1KIJ A;  3LNU A;  1FWK A;  4XTJ A;  2E5L I;  2PNL A;  4GKK I;  3Q6N A;  2XEX A;  5LMU I;  2BM0 A;  1USV A;  4DV3 I;  4DR7 I;  4NXM I;  1A6F A;  1N33 I;  2BR2 A;  5EKW A;  1B62 A;  4LFB I;  3J80 Q;  2HHH E;  4LF5 I;  4FW5 A;  4HYM A;  1HNZ I;  3ZKD A;  4DR5 E;  4PRV A;  4B3M I;  3B82 A;  2WNR B;  4LFC I;  1KVK A;  1Z0W A;  4BA2 A;  3HUL A;  2X7I A;  3LPS A;  5FLX Q;  1XNR E;  4U3D A;  1UDS A;  4FW6 A;  4X62 E;  4DV1 E;  4B3R E;  2O1T A;  5IWA I;  1Z0G A;  4BA1 B;  4B3S I;  3V5R A;  3J81 Q;  3J81 C;  1HNW I;  1Z0V A;  2Z5C B;  5JEA D;  1Z5C A;  2JT2 A;  4DUZ I;  5JEA E;  2PO2 A;  5FLX C;  3PYG A;  4AQY E;  3PYD A;  4JI4 I;  1Z0T A;  1ELO A;  5IWA E;  4DPU A;  5K36 F;  3K17 A;  2C37 A;  3LTO A;  4JI7 E;  1PKP A;  2HK3 A;  2LJP A;  4GKJ I;  1H73 A;  4IZJ B;  4NBQ A;  2BA0 G;  4YY3 I;  1HNX I;  1ZXM A;  4KHP I;  4Z7C A;  1VIS A;  2C38 A;  3J80 C;  3PS1 A;  3PYF A;  4JI7 I;  4DR2 I;  1UDQ A;  3NZK A;  4DUZ E;  3QT8 A;  2UU9 E;  1MX0 A;  4JI6 E;  4AQY I;  4QNK A;  5DRR A;  4JG4 A;  4X64 I;  4IFD C;  3CDI A;  4LF7 I;  3M7N G;  4PU9 A;  3B4T A;  4DPW A;  2NN6 D;  4OO1 D;  2F4V E;  3B78 A;  3M85 G;  2HK2 A;  4YY3 E;  3QT7 A;  1KTV A;  2NN6 C;  1EA6 A;  1HNX E;  2PNZ A;  2VQE E;  4JI0 I;  1HR0 I;  1NHI A;  4P7A A;  2UUA E;  2UUB E;  4DV0 I;  1FNM A;  2O3Z A;  1I94 I;  4DR3 I;  4B3T E;  5K36 A;  1XMQ I;  4Z7Y A;  4LF5 E;  3P3C A;  4DV7 E;  2GO3 A;  3M85 D;  5K36 C;  4LF4 E;  4OX9 I;  5ELW A;  4LF7 E;  4FN5 A;  3ZM7 A;  4FW4 A;  4DV6 E;  2CG9 A;  4ISA A;  4MYT A;  4JI3 E;  3U1K A;  3HKM A;  3P76 A;  4DU8 A;  1N33 E;  5GMD A;  4IZJ A;  1OYS A;  1IBL I;  4JYA I;  4DR4 I;  3WU3 A;  1U2R A;  2Z5B A;  3B8H A;  4R1F A;  4LF4 I;  1Y4S A;  2E1R A;  4OKG A;  5C0X D;  2UUB I;  3CWV A;  2Q2E B;  2JE6 A;  1HK7 A;  4IFD A;  1XMQ E;  2J65 A;  4IZJ D;  2BA1 G;  4X66 E;  3J7A G;  1Y5Y A;  2Z5C A;  4M1K A;  1D6T A;  2BA0 D;  2UXD E;  4U3B A;  1OYP A;  1HR0 E;  3PS2 A;  3PYE A;  4DV1 I;  4B3R I;  4OO1 E;  1Z59 A;  3P06 A;  3T1Y E;  4JI1 E;  1I94 E;  4DR3 E;  4LF8 E;  3QT6 A;  1FKA E;  3OTO E;  5C0X C;  1ZM2 A;  2R3V A;  4MU3 A;  4LCH A;  5EL9 A;  2AJ4 A;  3V2U C;  3WU5 A;  4FWD A;  2ZIT A;  1J5E I;  1NZ0 A;  5BR8 I;  4YHH E;  5LMN I;  1OYR A;  2C38 B;  2UXC I;  2NN6 A;  1Z0B A;  4JI1 I;  2BV3 A;  3T1Y I;  2V2Z A;  2NN6 B;  4OO1 B;  4DR2 E;  2HFS A;  1H72 C;  4UTG A;  4WUD A;  4IZK B;  1FWL A;  5DRO A;  3ZKB A;  5K36 E;  1EI1 A;  2A2D A;  2JEB A;  4DR5 I;  3T1H I;  2V34 A;  2WNR A;  3DD6 A;  4DV3 E;  2DEJ A;  4ED4 A;  4DR7 E;  4LFA E;  1UDO A;  1PIE A;  4X66 I;  1RHY A;  2GQ0 A;  1NHJ A;  4URL A;  4MYU A;  2GS8 A;  1S16 A;  3J7A M;  2WP8 B;  4DR1 I;  2IOP A;  3CDJ A;  1H74 A;  4BA1 A;  1ZM9 A;  4HXZ A;  4NXN I;  2VQF I;  3M7N D;  5LL6 R;  3L7Z B;  1XNQ E;  2R42 A;  5GME A;  1H7U A;  4DV7 I;  4IFD E;  5FWK A;  1HNZ E;  5DNX A;  1Y60 A;  4MU4 A;  4JI4 E;  5C0X B;  1N32 E;  2EFG A;  3Q1Q A;  1Y4U A;  4DV0 E;  4OO1 F;  1E3P A;  2NN6 F;  4WUC A;  4USM A;  4IS9 A;  1Z0E A;  4DUY I;  3Q6M A;  1FJG I;  1IBL E;  4LPF A;  4DR4 E;  4JYA E;  1XNR I;  4DR1 E;  4DV4 E;  2E5L E;  2CGE A;  4JI2 E;  3HJC A;  3WU4 A;  2CZ9 A;  1K47 A;  4LCF A;  4JI3 I;  4LF6 E;  4LF9 I;  5DRQ A;  4WUB A;  1N0V C;  1Z5A A;  5IT9 Q;  1FI4 A;  2O1U A;  2PNZ B;  5JEA A;  4DR6 I;  1FJG E;  1BKN A;  2UXD I;  2GO4 A;  2UU9 I;  4JI6 I;  1RRE A;  1OJ4 A;  1XMO E;  1RR9 A;  2J7K A;  4JI8 I;  5JEA C;  2HKJ A;  1S4E A;  4JI5 I;  4DXL A;  5BR8 E;  4JI2 I;  1ZM4 A;  4FW7 A;  2VQE I;  1QZR A;  1Y6Z A;  5IT9 C;  1N32 I;  1YH8 A;  5LMU E;  2CVE A;  3GLL A;  5JEA F;  2HFU A;  5L3J A;  4LF8 I;  4DV5 I;  4DR6 E;  2BR2 B;  4JI8 E;  4UT4 A;  1UEK A;  2F1D A;  3UHM A;  2Z5B B;  4P52 A;  2JE6 B;  4FWG A;  2UUA I;  4PRX A;  4JV5 I;  4FW9 A;  1HNW E;  1ZXN A;  4LF6 I;  4EMD A;  4LF9 E;  2UXB I;  4MDT A;  2JEB B;  2Z5E A;  4ZVI A;  4AIM A;  4KHP E;  4JI0 E;  4IFD B;  2DEI A;  2ZM6 E;  1IBM I;  4DPX A;  2PNM A;  5C0X E;  4JI5 E;  1Z5B A;  4LFA I;  2OI2 A;  5K36 B;  4OO1 C;  2X36 A;  5C0X F;  1XXE A;  3JAM Q;  2O1V A;  4X64 E;  4JV5 E;  2AE8 A;  4AM3 A;  3K85 A;  1IBM E;  1WUU A;  2C39 B;  2HHH I;  2VQF E;  4N3O A;  2PO0 B;  1H7S A;  2PO1 B;  2PO0 A;  3ZZU A;  1YHC A;  5A2Q Q;  2JEA A;  3ZZ0 A;  4DV2 I;  2C39 A;  4HAC A;  1MU5 A;  4GKK E;  1N0U A;  3GME A;  5C0X A;  2IER A;  4DU7 A;  2ZBK B;  2F4V I;  2V2Q A;  2JEA B;  2A2C A;  5DRP A;  1P42 A;  4IZK A;  2V8P A;  1IBK E;  4DPY A;  5DNL A;  4OO1 A;  2NPF A;  4I3H A;  5A2Q C;  4OX9 E;  4KQV A;  4RPF A;  4B3S E;  2UXC E;  3P3E A;  4DPT A;  2WP8 A;  1ZM3 A;  1IBK I;  1KKH A;  4IFD F;  4DV2 E;  4MU1 A;  3JAM C;  4YHH I;  5LMN E;  4X62 I;  3KRN A;  4DV6 I;  2NN6 E;  2C37 B; 
#chains in the Genus database with same CATH homology
 1DAR A;  3D4J A;  1NHH A;  4GKJ E;  3GON A;  1N34 I;  4USK A;  1MG7 A;  2O1W A;  1XNQ I;  4HY1 A;  3F0N A;  2UUC I;  4FWH A;  2BM1 A;  1USU A;  3T1H E;  3QT5 A;  1PVG A;  4HAC B;  3M6A A;  1XHK A;  4X65 I;  4NXM E;  4NXN E;  1Z0C A;  4DV5 E;  1B63 A;  2HKE A;  1J5E E;  4DV4 I;  3H4L A;  4K0K I;  1N36 I;  4LFC E;  3ZZT A;  3OTO I;  2WW4 A;  2UXB E;  3WU6 A;  2UUC E;  1XMO I;  4K0K E;  4B3M E;  2VF3 A;  3PRY A;  1N36 E;  4X65 E;  3K1J A;  2ZM6 I;  4B3T I;  2V2V A;  1N34 E;  4LFB E;  2IOQ A;  4DUY E;  1KIJ A;  3LNU A;  1FWK A;  4XTJ A;  2E5L I;  2PNL A;  4GKK I;  3Q6N A;  2XEX A;  5LMU I;  2BM0 A;  1USV A;  4DV3 I;  4DR7 I;  4NXM I;  1A6F A;  1N33 I;  1B62 A;  4LFB I;  3J80 Q;  2HHH E;  4LF5 I;  4HYM A;  1HNZ I;  3ZKD A;  4DR5 E;  4PRV A;  4B3M I;  3B82 A;  4LFC I;  1KVK A;  1Z0W A;  3HUL A;  2X7I A;  3LPS A;  5FLX Q;  1XNR E;  4X62 E;  4DV1 E;  4B3R E;  2O1T A;  5IWA I;  1Z0G A;  4B3S I;  3V5R A;  3J81 Q;  3J81 C;  1HNW I;  1Z0V A;  2Z5C B;  1Z5C A;  4DUZ I;  5FLX C;  3PYG A;  4AQY E;  3PYD A;  4JI4 I;  1Z0T A;  1ELO A;  5IWA E;  4DPU A;  3K17 A;  3LTO A;  4JI7 E;  1PKP A;  2HK3 A;  2LJP A;  4GKJ I;  1H73 A;  4IZJ B;  4YY3 I;  1HNX I;  1ZXM A;  4KHP I;  4Z7C A;  1VIS A;  3J80 C;  3PYF A;  4JI7 I;  4DR2 I;  4DUZ E;  3QT8 A;  2UU9 E;  1MX0 A;  4JI6 E;  4AQY I;  4JG4 A;  4X64 I;  4LF7 I;  4PU9 A;  4DPW A;  2F4V E;  3B78 A;  2HK2 A;  4YY3 E;  3QT7 A;  1KTV A;  1EA6 A;  1HNX E;  2VQE E;  4JI0 I;  1HR0 I;  1NHI A;  4P7A A;  2UUA E;  2UUB E;  4DV0 I;  1FNM A;  1I94 I;  4DR3 I;  4B3T E;  1XMQ I;  4Z7Y A;  4LF5 E;  4DV7 E;  4LF4 E;  4OX9 I;  4LF7 E;  4FN5 A;  3ZM7 A;  4DV6 E;  2CG9 A;  4MYT A;  4JI3 E;  4DU8 A;  1N33 E;  5GMD A;  4IZJ A;  1IBL I;  4JYA I;  4DR4 I;  3WU3 A;  1U2R A;  2Z5B A;  3B8H A;  4R1F A;  4LF4 I;  1Y4S A;  2E1R A;  2UUB I;  3CWV A;  2Q2E B;  1HK7 A;  1XMQ E;  4IZJ D;  4X66 E;  3J7A G;  2Z5C A;  4M1K A;  1D6T A;  2UXD E;  1HR0 E;  3PYE A;  4DV1 I;  4B3R I;  1Z59 A;  3P06 A;  3T1Y E;  4JI1 E;  1I94 E;  4DR3 E;  4LF8 E;  3QT6 A;  1FKA E;  3OTO E;  1ZM2 A;  2R3V A;  2AJ4 A;  3V2U C;  3WU5 A;  4FWD A;  2ZIT A;  1J5E I;  1NZ0 A;  5BR8 I;  4YHH E;  5LMN I;  2UXC I;  1Z0B A;  4JI1 I;  2BV3 A;  3T1Y I;  2V2Z A;  4DR2 E;  2HFS A;  1H72 C;  4UTG A;  4WUD A;  4IZK B;  1FWL A;  3ZKB A;  1EI1 A;  2A2D A;  4DR5 I;  3T1H I;  2V34 A;  4DV3 E;  2DEJ A;  4ED4 A;  4DR7 E;  4LFA E;  1PIE A;  4X66 I;  2GQ0 A;  1NHJ A;  4URL A;  4MYU A;  2GS8 A;  1S16 A;  3J7A M;  4DR1 I;  2IOP A;  1H74 A;  1ZM9 A;  4HXZ A;  4NXN I;  2VQF I;  5LL6 R;  1XNQ E;  2R42 A;  5GME A;  1H7U A;  4DV7 I;  5FWK A;  1HNZ E;  4JI4 E;  1N32 E;  2EFG A;  3Q1Q A;  1Y4U A;  4DV0 E;  4WUC A;  4USM A;  1Z0E A;  4DUY I;  3Q6M A;  1FJG I;  1IBL E;  4JYA E;  4DR4 E;  1XNR I;  4DR1 E;  4DV4 E;  2E5L E;  2CGE A;  4JI2 E;  3HJC A;  3WU4 A;  2CZ9 A;  1K47 A;  4JI3 I;  4LF6 E;  4LF9 I;  4WUB A;  1N0V C;  1Z5A A;  5IT9 Q;  1FI4 A;  2O1U A;  4DR6 I;  1FJG E;  1BKN A;  2UXD I;  2UU9 I;  4JI6 I;  1RRE A;  1OJ4 A;  1XMO E;  1RR9 A;  2J7K A;  4JI8 I;  2HKJ A;  1S4E A;  4JI5 I;  4DXL A;  5BR8 E;  4JI2 I;  1ZM4 A;  2VQE I;  1QZR A;  1Y6Z A;  5IT9 C;  1N32 I;  5LMU E;  2HFU A;  5L3J A;  4LF8 I;  4DV5 I;  4DR6 E;  4JI8 E;  4UT4 A;  1UEK A;  2Z5B B;  4P52 A;  4FWG A;  2UUA I;  4PRX A;  4JV5 I;  4FW9 A;  1HNW E;  1ZXN A;  4LF6 I;  4EMD A;  4LF9 E;  2UXB I;  2Z5E A;  4ZVI A;  4KHP E;  4JI0 E;  2DEI A;  2ZM6 E;  1IBM I;  4DPX A;  2PNM A;  4JI5 E;  1Z5B A;  4LFA I;  2OI2 A;  2X36 A;  3JAM Q;  2O1V A;  4X64 E;  4JV5 E;  3K85 A;  1IBM E;  1WUU A;  2HHH I;  2VQF E;  4N3O A;  1H7S A;  3ZZU A;  5A2Q Q;  3ZZ0 A;  4DV2 I;  4HAC A;  1MU5 A;  4GKK E;  1N0U A;  4DU7 A;  2ZBK B;  2F4V I;  2V2Q A;  2A2C A;  4IZK A;  2V8P A;  1IBK E;  4DPY A;  2NPF A;  4I3H A;  5A2Q C;  4OX9 E;  4KQV A;  4RPF A;  4B3S E;  2UXC E;  4DPT A;  1ZM3 A;  1IBK I;  1KKH A;  4DV2 E;  3JAM C;  4YHH I;  5LMN E;  4X62 I;  4DV6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...