2UUAI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uuaI00
2HFUA 4USMA 1S4EA 4DPUA 3QT5A 5LL6R 4Z7YA 4Z7CA 1Z0CA 3WU5A 4FWHA 4PRVA 4WUCA 2X7IA 1N0UA 1ZM9A 2UUBE 4DR2I 2OI2A 4LFBI 4DR2E 4HACA 4P52A 4LFBE 4DUYI 1DARA 4DUYE 5L3JA 2VQFI 3T1YI 4GKKI 1Z5CA 4DR6I 4AQYI 2VQFE 4JYAI 3T1YE 4GKKE 2UXCI 3CWVA 4DR6E 4AQYE 2UUCE 4JYAE 2UXCE 1Z5BA 2ZITA 2V8PA 4PU9A 4LF5I 2V2ZA 2J7KA 4JI6I 1MU5A 1FWLA 4JI6E 3F0NA 1Z59A 3JAMQ 1BKNA 3K1JA 1I94I 4DR4I 4DV5I 2ZM6I 1Z0VA 1H73A 2AJ4A 4DV5E 2ZM6E 2BM0A 5FLXQ 4LF9I 5A2QQ 1HNWI 1ZXNA 4LF9E 4X62I 5GMEA 4LF8I 2R42A 4NXMI 4JI0I 4X62E 4DPTA 5IT9Q 1EI1A 4NXME 2UXBI 1ELOA 3LTOA 1VISA 2HFSA 2HHHI 4JI5E 4B3SI 3J7AG 2HHHE 4DV2I 4B3SE 4DU7A 2V34A 2DEIA 1XMOI 2CZ9A 2HK2A 1XMOE 1N33E 4DU8A 1ZM2A 2UU9E 4URLA 1FWKA 4YY3I 4DPYA 4WUDA 1FI4A 1XNQI 2VF3A 4I3HA 1UEKA 5FLXC 4YY3E 1KKHA 5A2QC 1XNQE 1ZXMA 3J80Q 1NHJA 1H7UA 2UUBI 2V2VA 1Z0TA 4FWGA 2LJPA 4X65I 4DV7I 4X65E 3M6AA 2V2QA 4DV7E 1QZRA 1N34I 4DV0I 1A6FA 1WUUA 4GKJI 1N34E 4DV0E 1ZM3A 1IBMI 4LF4I 4GKJE 2UUAI 2UUCI 4DV3I 1IBME 4LF4E 3J81C 2UUAE 4DV3E 4X66I 1Z0WA 1PIEA 1KIJA 4X66E 3J80C 4K0KI 1XHKA 1RREA 4K0KE 3ZZTA 1FKAE 3B78A 2A2DA 2F4VI 3GONA 3V2UC 4EMDA 1J5EI 2F4VE 4HYMA 4DPWA 4JI7I 1PVGA 1J5EE 2EFGA 2X36A 3ZM7A 4JI7E 1EA6A 3ZZUA 1K47A 4DXLA 4YHHI 1IBKI 2VQEE 3LNUA 4YHHE 1IBKE 4FN5A 4DV6I 4JI5I 1Z0EA 3J7AM 4DV6E 1XNRI 1HNZI 4HY1A 3JAMC 1XNRE 2NPFA 1N33I 5IWAI 1HNZE 4B3MI 3V5RA 4LF6I 2A2CA 2UU9I 5IWAE 1HNXI 4B3ME 3OTOI 4LF6E 3B82A 3WU6A 4ED4A 1HNXE 4DR7I 1KVKA 2ZBKB 3OTOE 4DR3I 4B3TI 4JI3I 4DR7E 4LF7I 4DR3E 5LMNI 4B3TE 4DR1I 1B62A 4JI3E 4LF7E 1N32I 5LMNE 5LMUI 4DR1E 1N32E 1N36I 5IT9C 5LMUE 1H72C 1Z5AA 2R3VA 4LFAI 1N36E 1H7SA 1NHIA 4LFAE 4KHPI 4PRXA 4JI4I 4KHPE 4ZVIA 2DEJA 4B3RI 4JI1I 4JI4E 3QT6A 4B3RE 1KTVA 4JI1E 4JG4A 4MYUA 2BM1A 4M1KA 4FW9A 3WU3A 2HKEA 4WUBA 1Z0GA 5BR8I 3K17A 5BR8E 3ZZ0A 1FJGI 1IBLI 2GS8A 1FJGE 1FNMA 1NZ0A 1RR9A 4DPXA 1IBLE 4XTJA 4R1FA 3QT8A 4JV5I 3PYDA 4LFCI 4JV5E 3T1HI 4LF5E 4LFCE 3HULA 3T1HE 3B8HA 3WU4A 4KQVA 1OJ4A 4MYTA 4JI2I 3D4JA 4JI2E 4UT4A 4OX9I 1NHHA 4DV1I 2VQEI 3PYEA 4FWDA 4OX9E 1D6TA 4DV1E 1B63A 1I94E 3ZKBA 2UXDI 4X64I 4DR4E 2BV3A 1N0VC 1Z0BA 4DR5I 5GMDA 2UXDE 4X64E 3LPSA 3Q1QA 4DR5E 3H4LA 3PYGA 4DV4I 4HACB 3ZKDA 2HK3A 4USKA 1XMQI 4P7AA 1HNWE 2XEXA 3QT7A 4DV4E 3PYFA 1U2RA 4NXNI 4JI8I 1XMQE 4LF8E 4DUZI 4JI0E 1PKPA 4NXNE 4JI8E 4DUZE 2UXBE 1MG7A 1HR0I 1MX0A 1ZM4A 4DV2E 1S16A 1HR0E 1H74A 2E5LI 2HKJA 2WW4A 2E5LE 4HXZA 2E1RA 4RPFA 3J81Q 2Q2EB 4UTGA
chains in the Genus database with same CATH superfamily
2HFUA 1YH8A 4USMA 1S4EA 3DD6A 4DPUA 5DRRA 2GO4A 3QT5A 2IOPA 5LL6R 4NBQA 4Z7YA 4Z7CA 1Z0CA 3WU5A 4FWHA 5DRQA 4PRVA 2WNRA 4WUCA 5JEAD 4MU1A 4MU0A 2X7IA 4AM3A 3GLLA 1N0UA 2NN6E 1ZM9A 2UUBE 1VI7A 1YHCA 4DR2I 4IS9A 2OI2A 4LFBI 3P06A 4DR2E 4HACA 4AIMA 4P52A 2C37B 4OO1A 4LFBE 4DUYI 1DARA 2NN6D 4LOMA 5DNXA 4DUYE 5L3JA 2VQFI 3T1YI 4GKKI 1Z5CA 3P3GA 4DR6I 4AQYI 2VQFE 4JYAI 3T1YE 4GKKE 5DROA 2UXCI 3CWVA 4DR6E 4AQYE 2UUCE 4JYAE 2UXCE 1Z5BA 4IFDF 5JEAB 2ZITA 2V8PA 3PS2A 4PU9A 4LF5I 2V2ZA 2J7KA 2BA1D 4JI6I 1MU5A 1FWLA 4JI6E 1P42A 3L7ZB 3F0NA 1Z59A 2IESA 5EL9A 3JAMQ 2BR2B 5JEAC 2NN6B 1BKNA 3K1JA 1I94I 4DR4I 3P3EA 4DV5I 2ZM6I 1Z0VA 2JT2A 3M85D 1H73A 2AJ4A 3UHMA 4DV5E 2ZM6E 2O1TA 2BM0A 1OYRA 5FLXQ 4LF9I 5A2QQ 1Y4SA 1HNWI 3PRYA 1ZXNA 2NN6C 4LF9E 4X62I 4FW6A 2GO3A 5GMEA 4LF8I 2R42A 2IOQA 4NXMI 4JI0I 4X62E 2PNZB 4DPTA 5IT9Q 1EI1A 4MU4A 4NXME 2UXBI 4MQYA 1ELOA 3LTOA 1VISA 3K85A 2HFSA 2HHHI 4JI5E 2PO1A 4B3SI 3P3CA 3J7AG 1USUA 2HHHE 4DV2I 4B3SE 4DU7A 2V34A 2DEIA 1XMOI 1OYSA 2CZ9A 2HK2A 2PNMA 1XMOE 1N33E 4DU8A 1ZM2A 5C0XE 2UU9E 4URLA 1Y6ZA 1FWKA 2JEBA 4YY3I 4OKGA 4DPYA 4WUDA 1FI4A 1XNQI 2VF3A 4I3HA 1UEKA 5FLXC 4YY3E 1KKHA 5A2QC 2Z5CA 4GQUA 2IERA 1XNQE 1ZXMA 1XXEA 4AIDA 3J80Q 5C0XD 1NHJA 1H7UA 2C38B 4IZKB 2UUBI 1HK7A 3PS1A 2V2VA 1Z0TA 5K36E 2VESA 4FWGA 4FW7A 2LJPA 4X65I 2JE6A 2CG9A 4DV7I 4X65E 3M6AA 2V2QA 4DV7E 1QZRA 4LPFA 1N34I 4FW5A 4DV0I 1A6FA 1WUUA 3CDIA 2CVEA 3HJCA 4GKJI 4IFDA 1N34E 4DV0E 1ZM3A 4IZJA 1IBMI 4LF4I 2JEAA 4GKJE 2UUAI 2UUCI 4DV3I 2PO2A 1IBME 2O1UA 4LF4E 3J81C 2UUAE 2C39B 4DV3E 2Z5BA 4X66I 1Z0WA 4BA1B 1PIEA 3KRNA 1Y60A 5EKWA 1KIJA 4X66E 3J80C 2PO0A 4K0KI 3M7NG 1XHKA 5ELWA 1RREA 4K0KE 3Q6MA 3ZZTA 4MDTA 4OO1E 1FKAE 4LCFA 3B78A 2A2DA 4IFDE 2F4VI 3GONA 3V2UC 4EMDA 1J5EI 2F4VE 4HYMA 4DPWA 4JI7I 3U1YA 1PVGA 1J5EE 2EFGA 2X36A 3ZM7A 4OO1D 4JI7E 4LCGA 2C38A 1EA6A 4IZKA 4BA2B 2Z5EA 3ZZUA 1K47A 4DXLA 4YHHI 3P76A 1IBKI 2VQEE 2WNRB 3LNUA 4YHHE 1IBKE 2BA0G 4FN5A 3U1KA 2C37A 4DV6I 4JI5I 3CDJA 1Z0EA 3J7AM 4DV6E 1XNRI 1HNZI 4HY1A 3JAMC 1XNRE 2NPFA 4OO1B 1N33I 5IWAI 1HNZE 4B3MI 3V5RA 2C39A 4LF6I 2A2CA 1UDNA 5JEAA 2UU9I 5IWAE 1HNXI 4U3DA 4B3ME 1R6LA 3OTOI 4LF6E 3B82A 3WU6A 4ED4A 1HNXE 3Q6NA 4ISAA 1KVKA 4DR7I 2ZBKB 3OTOE 1UDOA 4DR3I 4B3TI 5JEAF 4JI3I 4DR7E 3L7ZA 4LF7I 4DR3E 1OYPA 2BA0D 5LMNI 4B3TE 4DR1I 1B62A 4JI3E 4OO1C 4LF7E 1N32I 5LMNE 5LMUI 2BR2A 4DR1E 2NN6A 1N32E 1N36I 5IT9C 5LMUE 1H72C 1Z5AA 2R3VA 4LFAI 1N36E 1H7SA 1NHIA 4LFAE 2NN6F 4KHPI 4PRXA 4JI4I 1Y4UA 2PNLA 4KHPE 4ZVIA 2DEJA 4B3RI 4BA2A 4JI1I 4JI4E 3QT6A 4B3RE 1KTVA 4JI1E 4JG4A 2PNZA 5K36D 4MYUA 3PS3A 2BM1A 2GQ0A 2BA1G 5C0XB 4M1KA 4FW9A 3WU3A 2HKEA 4WUBA 1Z0GA 5BR8I 3K17A 4MU3A 4N3OA 5BR8E 3ZZ0A 1FJGI 4U3BA 2PO1B 1IBLI 2GS8A 1FJGE 1FNMA 1NZ0A 3GCMA 1RR9A 5C0XC 4DPXA 1IBLE 4XTJA 4R1FA 4OO1F 3M85G 3QT8A 5K36B 1RHYA 4JV5I 3GMEA 3PYDA 4LFCI 4JV5E 4FW3A 3T1HI 4LF5E 4LFCE 3HULA 2JEBB 2AE8A 3T1HE 2WP8B 3B8HA 3WU4A 5DNLA 4KQVA 1OJ4A 4MYTA 4JI2I 2Z5CB 2F1DA 4IFDD 3D4JA 4IZJD 1UDSA 4JI2E 4UT4A 3M7ND 4OX9I 1NHHA 4DV1I 5K36C 2VQEI 3PYEA 1USVA 4FWDA 4OX9E 1D6TA 4DV1E 1E3PA 1B63A 1I94E 3ZKBA 2UXDI 4X64I 4DR4E 3HKMA 2BV3A 1N0VC 1Z0BA 4DR5I 5GMDA 2UXDE 2J65A 2JE6B 4X64E 4OZEA 3LPSA 3Q1QA 4DR5E 4J3DA 3H4LA 3PYGA 4DV4I 5C0XA 4HACB 5DRPA 3ZKDA 2HK3A 4USKA 1XMQI 2O1VA 4P7AA 1HNWE 2XEXA 3QT7A 4DV4E 3PYFA 1U2RA 4NXNI 4JI8I 1XMQE 4LF8E 2CGEA 4BA1A 4IFDB 4FW4A 4IZJB 4DUZI 4JI0E 1PKPA 3NZKA 4JI8E 4NXNE 5C0XF 2JEAB 2PO2B 4DUZE 2UXBE 1UDQA 5FWKA 2Z5BB 1Y5YA 2O3ZA 4QNKA 1MG7A 1HR0I 1MX0A 2PO0B 1ZM4A 4DV2E 1S16A 1HR0E 5K36A 4IFDC 3B4TA 1H74A 2O1WA 1E3HA 4QNJA 2E5LI 2HKJA 2WW4A 5K36F 2WP8A 5JEAE 2E5LE 4HXZA 1R6MA 2E1RA 3H1CA 4LCHA 4RPFA 3J81Q 2Q2EB 4UTGA
chains in the Genus database with same CATH topology
2HFUA 4USMA 1S4EA 4DPUA 3QT5A 2IOPA 5LL6R 4Z7YA 4Z7CA 1Z0CA 3WU5A 4FWHA 4PRVA 4WUCA 2X7IA 1N0UA 1ZM9A 2UUBE 4DR2I 2OI2A 4LFBI 3P06A 4DR2E 4HACA 4P52A 4LFBE 4DUYI 1DARA 4DUYE 5L3JA 2VQFI 3T1YI 4GKKI 1Z5CA 4DR6I 4AQYI 2VQFE 4JYAI 3T1YE 4GKKE 2UXCI 3CWVA 4DR6E 4AQYE 2UUCE 4JYAE 2UXCE 1Z5BA 2ZITA 2V8PA 4PU9A 4LF5I 2V2ZA 2J7KA 4JI6I 1MU5A 1FWLA 4JI6E 3F0NA 1Z59A 3JAMQ 1BKNA 3K1JA 1I94I 4DR4I 4DV5I 2ZM6I 1Z0VA 1H73A 2AJ4A 4DV5E 2ZM6E 2O1TA 2BM0A 5FLXQ 4LF9I 5A2QQ 1Y4SA 1HNWI 3PRYA 1ZXNA 4LF9E 4X62I 5GMEA 4LF8I 2R42A 2IOQA 4NXMI 4JI0I 4X62E 4DPTA 5IT9Q 1EI1A 4NXME 2UXBI 1ELOA 3LTOA 1VISA 3K85A 2HFSA 2HHHI 4JI5E 4B3SI 3J7AG 1USUA 2HHHE 4DV2I 4B3SE 4DU7A 2V34A 2DEIA 1XMOI 2CZ9A 2HK2A 2PNMA 1XMOE 1N33E 4DU8A 1ZM2A 2UU9E 4URLA 1Y6ZA 1FWKA 4YY3I 4DPYA 4WUDA 1FI4A 1XNQI 2VF3A 4I3HA 1UEKA 5FLXC 4YY3E 1KKHA 5A2QC 2Z5CA 1XNQE 1ZXMA 3J80Q 1NHJA 1H7UA 4IZKB 2UUBI 1HK7A 2V2VA 1Z0TA 4FWGA 2LJPA 4X65I 2CG9A 4DV7I 4X65E 3M6AA 2V2QA 4DV7E 1QZRA 1N34I 4DV0I 1A6FA 1WUUA 3HJCA 4GKJI 1N34E 4DV0E 1ZM3A 4IZJA 1IBMI 4LF4I 4GKJE 2UUAI 2UUCI 4DV3I 1IBME 2O1UA 4LF4E 3J81C 2UUAE 4DV3E 2Z5BA 4X66I 1Z0WA 1PIEA 1KIJA 4X66E 3J80C 4K0KI 1XHKA 1RREA 4K0KE 3Q6MA 3ZZTA 1FKAE 3B78A 2A2DA 2F4VI 3GONA 3V2UC 4EMDA 1J5EI 2F4VE 4HYMA 4DPWA 4JI7I 1PVGA 1J5EE 2EFGA 2X36A 3ZM7A 4JI7E 1EA6A 4IZKA 2Z5EA 3ZZUA 1K47A 4DXLA 4YHHI 1IBKI 2VQEE 3LNUA 4YHHE 1IBKE 4FN5A 4DV6I 4JI5I 1Z0EA 3J7AM 4DV6E 1XNRI 1HNZI 4HY1A 3JAMC 1XNRE 2NPFA 1N33I 5IWAI 1HNZE 4B3MI 3V5RA 4LF6I 2A2CA 2UU9I 5IWAE 1HNXI 4B3ME 3OTOI 4LF6E 3B82A 3WU6A 4ED4A 1HNXE 3Q6NA 4DR7I 1KVKA 2ZBKB 3OTOE 4DR3I 4B3TI 4JI3I 4DR7E 4LF7I 4DR3E 5LMNI 4B3TE 4DR1I 1B62A 4JI3E 4LF7E 1N32I 5LMNE 5LMUI 4DR1E 1N32E 1N36I 5IT9C 5LMUE 1H72C 1Z5AA 2R3VA 4LFAI 1N36E 1H7SA 1NHIA 4LFAE 4KHPI 4PRXA 4JI4I 1Y4UA 2PNLA 4KHPE 4ZVIA 2DEJA 4B3RI 4JI1I 4JI4E 3QT6A 4B3RE 1KTVA 4JI1E 4JG4A 4MYUA 2BM1A 2GQ0A 4M1KA 4FW9A 3WU3A 2HKEA 4WUBA 1Z0GA 5BR8I 3K17A 4N3OA 5BR8E 3ZZ0A 1FJGI 1IBLI 2GS8A 1FJGE 1FNMA 1NZ0A 1RR9A 4DPXA 1IBLE 4XTJA 4R1FA 3QT8A 4JV5I 3PYDA 4LFCI 4JV5E 3T1HI 4LF5E 4LFCE 3HULA 3T1HE 3B8HA 3WU4A 4KQVA 1OJ4A 4MYTA 4JI2I 2Z5CB 3D4JA 4IZJD 4JI2E 4UT4A 4OX9I 1NHHA 4DV1I 2VQEI 3PYEA 1USVA 4FWDA 4OX9E 1D6TA 4DV1E 1B63A 1I94E 3ZKBA 2UXDI 4X64I 4DR4E 2BV3A 1N0VC 1Z0BA 4DR5I 5GMDA 2UXDE 4X64E 3LPSA 3Q1QA 4DR5E 3H4LA 3PYGA 4DV4I 4HACB 3ZKDA 2HK3A 4USKA 1XMQI 2O1VA 4P7AA 1HNWE 2XEXA 3QT7A 4DV4E 3PYFA 1U2RA 4NXNI 4JI8I 1XMQE 4LF8E 2CGEA 4IZJB 4DUZI 4JI0E 1PKPA 4NXNE 4JI8E 4DUZE 2UXBE 5FWKA 2Z5BB 1MG7A 1HR0I 1MX0A 1ZM4A 4DV2E 1S16A 1HR0E 1H74A 2O1WA 2E5LI 2HKJA 2WW4A 2E5LE 4HXZA 2E1RA 4RPFA 3J81Q 2Q2EB 4UTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFU A;  4USM A;  1S4E A;  4DPU A;  3QT5 A;  5LL6 R;  4Z7Y A;  4Z7C A;  1Z0C A;  3WU5 A;  4FWH A;  4PRV A;  4WUC A;  2X7I A;  1N0U A;  1ZM9 A;  2UUB E;  4DR2 I;  2OI2 A;  4LFB I;  4DR2 E;  4HAC A;  4P52 A;  4LFB E;  4DUY I;  1DAR A;  4DUY E;  5L3J A;  2VQF I;  3T1Y I;  4GKK I;  1Z5C A;  4DR6 I;  4AQY I;  2VQF E;  4JYA I;  3T1Y E;  4GKK E;  2UXC I;  3CWV A;  4DR6 E;  4AQY E;  2UUC E;  4JYA E;  2UXC E;  1Z5B A;  2ZIT A;  2V8P A;  4PU9 A;  4LF5 I;  2V2Z A;  2J7K A;  4JI6 I;  1MU5 A;  1FWL A;  4JI6 E;  3F0N A;  1Z59 A;  3JAM Q;  1BKN A;  3K1J A;  1I94 I;  4DR4 I;  4DV5 I;  2ZM6 I;  1Z0V A;  1H73 A;  2AJ4 A;  4DV5 E;  2ZM6 E;  2BM0 A;  5FLX Q;  4LF9 I;  5A2Q Q;  1HNW I;  1ZXN A;  4LF9 E;  4X62 I;  5GME A;  4LF8 I;  2R42 A;  4NXM I;  4JI0 I;  4X62 E;  4DPT A;  5IT9 Q;  1EI1 A;  4NXM E;  2UXB I;  1ELO A;  3LTO A;  1VIS A;  2HFS A;  2HHH I;  4JI5 E;  4B3S I;  3J7A G;  2HHH E;  4DV2 I;  4B3S E;  4DU7 A;  2V34 A;  2DEI A;  1XMO I;  2CZ9 A;  2HK2 A;  1XMO E;  1N33 E;  4DU8 A;  1ZM2 A;  2UU9 E;  4URL A;  1FWK A;  4YY3 I;  4DPY A;  4WUD A;  1FI4 A;  1XNQ I;  2VF3 A;  4I3H A;  1UEK A;  5FLX C;  4YY3 E;  1KKH A;  5A2Q C;  1XNQ E;  1ZXM A;  3J80 Q;  1NHJ A;  1H7U A;  2UUB I;  2V2V A;  1Z0T A;  4FWG A;  2LJP A;  4X65 I;  4DV7 I;  4X65 E;  3M6A A;  2V2Q A;  4DV7 E;  1QZR A;  1N34 I;  4DV0 I;  1A6F A;  1WUU A;  4GKJ I;  1N34 E;  4DV0 E;  1ZM3 A;  1IBM I;  4LF4 I;  4GKJ E;  2UUA I;  2UUC I;  4DV3 I;  1IBM E;  4LF4 E;  3J81 C;  2UUA E;  4DV3 E;  4X66 I;  1Z0W A;  1PIE A;  1KIJ A;  4X66 E;  3J80 C;  4K0K I;  1XHK A;  1RRE A;  4K0K E;  3ZZT A;  1FKA E;  3B78 A;  2A2D A;  2F4V I;  3GON A;  3V2U C;  4EMD A;  1J5E I;  2F4V E;  4HYM A;  4DPW A;  4JI7 I;  1PVG A;  1J5E E;  2EFG A;  2X36 A;  3ZM7 A;  4JI7 E;  1EA6 A;  3ZZU A;  1K47 A;  4DXL A;  4YHH I;  1IBK I;  2VQE E;  3LNU A;  4YHH E;  1IBK E;  4FN5 A;  4DV6 I;  4JI5 I;  1Z0E A;  3J7A M;  4DV6 E;  1XNR I;  1HNZ I;  4HY1 A;  3JAM C;  1XNR E;  2NPF A;  1N33 I;  5IWA I;  1HNZ E;  4B3M I;  3V5R A;  4LF6 I;  2A2C A;  2UU9 I;  5IWA E;  1HNX I;  4B3M E;  3OTO I;  4LF6 E;  3B82 A;  3WU6 A;  4ED4 A;  1HNX E;  4DR7 I;  1KVK A;  2ZBK B;  3OTO E;  4DR3 I;  4B3T I;  4JI3 I;  4DR7 E;  4LF7 I;  4DR3 E;  5LMN I;  4B3T E;  4DR1 I;  1B62 A;  4JI3 E;  4LF7 E;  1N32 I;  5LMN E;  5LMU I;  4DR1 E;  1N32 E;  1N36 I;  5IT9 C;  5LMU E;  1H72 C;  1Z5A A;  2R3V A;  4LFA I;  1N36 E;  1H7S A;  1NHI A;  4LFA E;  4KHP I;  4PRX A;  4JI4 I;  4KHP E;  4ZVI A;  2DEJ A;  4B3R I;  4JI1 I;  4JI4 E;  3QT6 A;  4B3R E;  1KTV A;  4JI1 E;  4JG4 A;  4MYU A;  2BM1 A;  4M1K A;  4FW9 A;  3WU3 A;  2HKE A;  4WUB A;  1Z0G A;  5BR8 I;  3K17 A;  5BR8 E;  3ZZ0 A;  1FJG I;  1IBL I;  2GS8 A;  1FJG E;  1FNM A;  1NZ0 A;  1RR9 A;  4DPX A;  1IBL E;  4XTJ A;  4R1F A;  3QT8 A;  4JV5 I;  3PYD A;  4LFC I;  4JV5 E;  3T1H I;  4LF5 E;  4LFC E;  3HUL A;  3T1H E;  3B8H A;  3WU4 A;  4KQV A;  1OJ4 A;  4MYT A;  4JI2 I;  3D4J A;  4JI2 E;  4UT4 A;  4OX9 I;  1NHH A;  4DV1 I;  2VQE I;  3PYE A;  4FWD A;  4OX9 E;  1D6T A;  4DV1 E;  1B63 A;  1I94 E;  3ZKB A;  2UXD I;  4X64 I;  4DR4 E;  2BV3 A;  1N0V C;  1Z0B A;  4DR5 I;  5GMD A;  2UXD E;  4X64 E;  3LPS A;  3Q1Q A;  4DR5 E;  3H4L A;  3PYG A;  4DV4 I;  4HAC B;  3ZKD A;  2HK3 A;  4USK A;  1XMQ I;  4P7A A;  1HNW E;  2XEX A;  3QT7 A;  4DV4 E;  3PYF A;  1U2R A;  4NXN I;  4JI8 I;  1XMQ E;  4LF8 E;  4DUZ I;  4JI0 E;  1PKP A;  4NXN E;  4JI8 E;  4DUZ E;  2UXB E;  1MG7 A;  1HR0 I;  1MX0 A;  1ZM4 A;  4DV2 E;  1S16 A;  1HR0 E;  1H74 A;  2E5L I;  2HKJ A;  2WW4 A;  2E5L E;  4HXZ A;  2E1R A;  4RPF A;  3J81 Q;  2Q2E B;  4UTG A; 
#chains in the Genus database with same CATH topology
 2HFU A;  1YH8 A;  4USM A;  1S4E A;  3DD6 A;  4DPU A;  5DRR A;  2GO4 A;  3QT5 A;  2IOP A;  5LL6 R;  4NBQ A;  4Z7Y A;  4Z7C A;  1Z0C A;  3WU5 A;  4FWH A;  5DRQ A;  4PRV A;  2WNR A;  4WUC A;  5JEA D;  4MU1 A;  4MU0 A;  2X7I A;  4AM3 A;  3GLL A;  1N0U A;  2NN6 E;  1ZM9 A;  2UUB E;  1VI7 A;  1YHC A;  4DR2 I;  4IS9 A;  2OI2 A;  4LFB I;  3P06 A;  4DR2 E;  4HAC A;  4AIM A;  4P52 A;  2C37 B;  4OO1 A;  4LFB E;  4DUY I;  1DAR A;  2NN6 D;  4LOM A;  5DNX A;  4DUY E;  5L3J A;  2VQF I;  3T1Y I;  4GKK I;  1Z5C A;  3P3G A;  4DR6 I;  4AQY I;  2VQF E;  4JYA I;  3T1Y E;  4GKK E;  5DRO A;  2UXC I;  3CWV A;  4DR6 E;  4AQY E;  2UUC E;  4JYA E;  2UXC E;  1Z5B A;  4IFD F;  5JEA B;  2ZIT A;  2V8P A;  3PS2 A;  4PU9 A;  4LF5 I;  2V2Z A;  2J7K A;  2BA1 D;  4JI6 I;  1MU5 A;  1FWL A;  4JI6 E;  1P42 A;  3L7Z B;  3F0N A;  1Z59 A;  2IES A;  5EL9 A;  3JAM Q;  2BR2 B;  5JEA C;  2NN6 B;  1BKN A;  3K1J A;  1I94 I;  4DR4 I;  3P3E A;  4DV5 I;  2ZM6 I;  1Z0V A;  2JT2 A;  3M85 D;  1H73 A;  2AJ4 A;  3UHM A;  4DV5 E;  2ZM6 E;  2O1T A;  2BM0 A;  1OYR A;  5FLX Q;  4LF9 I;  5A2Q Q;  1Y4S A;  1HNW I;  3PRY A;  1ZXN A;  2NN6 C;  4LF9 E;  4X62 I;  4FW6 A;  2GO3 A;  5GME A;  4LF8 I;  2R42 A;  2IOQ A;  4NXM I;  4JI0 I;  4X62 E;  2PNZ B;  4DPT A;  5IT9 Q;  1EI1 A;  4MU4 A;  4NXM E;  2UXB I;  4MQY A;  1ELO A;  3LTO A;  1VIS A;  3K85 A;  2HFS A;  2HHH I;  4JI5 E;  2PO1 A;  4B3S I;  3P3C A;  3J7A G;  1USU A;  2HHH E;  4DV2 I;  4B3S E;  4DU7 A;  2V34 A;  2DEI A;  1XMO I;  1OYS A;  2CZ9 A;  2HK2 A;  2PNM A;  1XMO E;  1N33 E;  4DU8 A;  1ZM2 A;  5C0X E;  2UU9 E;  4URL A;  1Y6Z A;  1FWK A;  2JEB A;  4YY3 I;  4OKG A;  4DPY A;  4WUD A;  1FI4 A;  1XNQ I;  2VF3 A;  4I3H A;  1UEK A;  5FLX C;  4YY3 E;  1KKH A;  5A2Q C;  2Z5C A;  4GQU A;  2IER A;  1XNQ E;  1ZXM A;  1XXE A;  4AID A;  3J80 Q;  5C0X D;  1NHJ A;  1H7U A;  2C38 B;  4IZK B;  2UUB I;  1HK7 A;  3PS1 A;  2V2V A;  1Z0T A;  5K36 E;  2VES A;  4FWG A;  4FW7 A;  2LJP A;  4X65 I;  2JE6 A;  2CG9 A;  4DV7 I;  4X65 E;  3M6A A;  2V2Q A;  4DV7 E;  1QZR A;  4LPF A;  1N34 I;  4FW5 A;  4DV0 I;  1A6F A;  1WUU A;  3CDI A;  2CVE A;  3HJC A;  4GKJ I;  4IFD A;  1N34 E;  4DV0 E;  1ZM3 A;  4IZJ A;  1IBM I;  4LF4 I;  2JEA A;  4GKJ E;  2UUA I;  2UUC I;  4DV3 I;  2PO2 A;  1IBM E;  2O1U A;  4LF4 E;  3J81 C;  2UUA E;  2C39 B;  4DV3 E;  2Z5B A;  4X66 I;  1Z0W A;  4BA1 B;  1PIE A;  3KRN A;  1Y60 A;  5EKW A;  1KIJ A;  4X66 E;  3J80 C;  2PO0 A;  4K0K I;  3M7N G;  1XHK A;  5ELW A;  1RRE A;  4K0K E;  3Q6M A;  3ZZT A;  4MDT A;  4OO1 E;  1FKA E;  4LCF A;  3B78 A;  2A2D A;  4IFD E;  2F4V I;  3GON A;  3V2U C;  4EMD A;  1J5E I;  2F4V E;  4HYM A;  4DPW A;  4JI7 I;  3U1Y A;  1PVG A;  1J5E E;  2EFG A;  2X36 A;  3ZM7 A;  4OO1 D;  4JI7 E;  4LCG A;  2C38 A;  1EA6 A;  4IZK A;  4BA2 B;  2Z5E A;  3ZZU A;  1K47 A;  4DXL A;  4YHH I;  3P76 A;  1IBK I;  2VQE E;  2WNR B;  3LNU A;  4YHH E;  1IBK E;  2BA0 G;  4FN5 A;  3U1K A;  2C37 A;  4DV6 I;  4JI5 I;  3CDJ A;  1Z0E A;  3J7A M;  4DV6 E;  1XNR I;  1HNZ I;  4HY1 A;  3JAM C;  1XNR E;  2NPF A;  4OO1 B;  1N33 I;  5IWA I;  1HNZ E;  4B3M I;  3V5R A;  2C39 A;  4LF6 I;  2A2C A;  1UDN A;  5JEA A;  2UU9 I;  5IWA E;  1HNX I;  4U3D A;  4B3M E;  1R6L A;  3OTO I;  4LF6 E;  3B82 A;  3WU6 A;  4ED4 A;  1HNX E;  3Q6N A;  4ISA A;  1KVK A;  4DR7 I;  2ZBK B;  3OTO E;  1UDO A;  4DR3 I;  4B3T I;  5JEA F;  4JI3 I;  4DR7 E;  3L7Z A;  4LF7 I;  4DR3 E;  1OYP A;  2BA0 D;  5LMN I;  4B3T E;  4DR1 I;  1B62 A;  4JI3 E;  4OO1 C;  4LF7 E;  1N32 I;  5LMN E;  5LMU I;  2BR2 A;  4DR1 E;  2NN6 A;  1N32 E;  1N36 I;  5IT9 C;  5LMU E;  1H72 C;  1Z5A A;  2R3V A;  4LFA I;  1N36 E;  1H7S A;  1NHI A;  4LFA E;  2NN6 F;  4KHP I;  4PRX A;  4JI4 I;  1Y4U A;  2PNL A;  4KHP E;  4ZVI A;  2DEJ A;  4B3R I;  4BA2 A;  4JI1 I;  4JI4 E;  3QT6 A;  4B3R E;  1KTV A;  4JI1 E;  4JG4 A;  2PNZ A;  5K36 D;  4MYU A;  3PS3 A;  2BM1 A;  2GQ0 A;  2BA1 G;  5C0X B;  4M1K A;  4FW9 A;  3WU3 A;  2HKE A;  4WUB A;  1Z0G A;  5BR8 I;  3K17 A;  4MU3 A;  4N3O A;  5BR8 E;  3ZZ0 A;  1FJG I;  4U3B A;  2PO1 B;  1IBL I;  2GS8 A;  1FJG E;  1FNM A;  1NZ0 A;  3GCM A;  1RR9 A;  5C0X C;  4DPX A;  1IBL E;  4XTJ A;  4R1F A;  4OO1 F;  3M85 G;  3QT8 A;  5K36 B;  1RHY A;  4JV5 I;  3GME A;  3PYD A;  4LFC I;  4JV5 E;  4FW3 A;  3T1H I;  4LF5 E;  4LFC E;  3HUL A;  2JEB B;  2AE8 A;  3T1H E;  2WP8 B;  3B8H A;  3WU4 A;  5DNL A;  4KQV A;  1OJ4 A;  4MYT A;  4JI2 I;  2Z5C B;  2F1D A;  4IFD D;  3D4J A;  4IZJ D;  1UDS A;  4JI2 E;  4UT4 A;  3M7N D;  4OX9 I;  1NHH A;  4DV1 I;  5K36 C;  2VQE I;  3PYE A;  1USV A;  4FWD A;  4OX9 E;  1D6T A;  4DV1 E;  1E3P A;  1B63 A;  1I94 E;  3ZKB A;  2UXD I;  4X64 I;  4DR4 E;  3HKM A;  2BV3 A;  1N0V C;  1Z0B A;  4DR5 I;  5GMD A;  2UXD E;  2J65 A;  2JE6 B;  4X64 E;  4OZE A;  3LPS A;  3Q1Q A;  4DR5 E;  4J3D A;  3H4L A;  3PYG A;  4DV4 I;  5C0X A;  4HAC B;  5DRP A;  3ZKD A;  2HK3 A;  4USK A;  1XMQ I;  2O1V A;  4P7A A;  1HNW E;  2XEX A;  3QT7 A;  4DV4 E;  3PYF A;  1U2R A;  4NXN I;  4JI8 I;  1XMQ E;  4LF8 E;  2CGE A;  4BA1 A;  4IFD B;  4FW4 A;  4IZJ B;  4DUZ I;  4JI0 E;  1PKP A;  3NZK A;  4JI8 E;  4NXN E;  5C0X F;  2JEA B;  2PO2 B;  4DUZ E;  2UXB E;  1UDQ A;  5FWK A;  2Z5B B;  1Y5Y A;  2O3Z A;  4QNK A;  1MG7 A;  1HR0 I;  1MX0 A;  2PO0 B;  1ZM4 A;  4DV2 E;  1S16 A;  1HR0 E;  5K36 A;  4IFD C;  3B4T A;  1H74 A;  2O1W A;  1E3H A;  4QNJ A;  2E5L I;  2HKJ A;  2WW4 A;  5K36 F;  2WP8 A;  5JEA E;  2E5L E;  4HXZ A;  1R6M A;  2E1R A;  3H1C A;  4LCH A;  4RPF A;  3J81 Q;  2Q2E B;  4UTG A; 
#chains in the Genus database with same CATH homology
 2HFU A;  4USM A;  1S4E A;  4DPU A;  3QT5 A;  2IOP A;  5LL6 R;  4Z7Y A;  4Z7C A;  1Z0C A;  3WU5 A;  4FWH A;  4PRV A;  4WUC A;  2X7I A;  1N0U A;  1ZM9 A;  2UUB E;  4DR2 I;  2OI2 A;  4LFB I;  3P06 A;  4DR2 E;  4HAC A;  4P52 A;  4LFB E;  4DUY I;  1DAR A;  4DUY E;  5L3J A;  2VQF I;  3T1Y I;  4GKK I;  1Z5C A;  4DR6 I;  4AQY I;  2VQF E;  4JYA I;  3T1Y E;  4GKK E;  2UXC I;  3CWV A;  4DR6 E;  4AQY E;  2UUC E;  4JYA E;  2UXC E;  1Z5B A;  2ZIT A;  2V8P A;  4PU9 A;  4LF5 I;  2V2Z A;  2J7K A;  4JI6 I;  1MU5 A;  1FWL A;  4JI6 E;  3F0N A;  1Z59 A;  3JAM Q;  1BKN A;  3K1J A;  1I94 I;  4DR4 I;  4DV5 I;  2ZM6 I;  1Z0V A;  1H73 A;  2AJ4 A;  4DV5 E;  2ZM6 E;  2O1T A;  2BM0 A;  5FLX Q;  4LF9 I;  5A2Q Q;  1Y4S A;  1HNW I;  3PRY A;  1ZXN A;  4LF9 E;  4X62 I;  5GME A;  4LF8 I;  2R42 A;  2IOQ A;  4NXM I;  4JI0 I;  4X62 E;  4DPT A;  5IT9 Q;  1EI1 A;  4NXM E;  2UXB I;  1ELO A;  3LTO A;  1VIS A;  3K85 A;  2HFS A;  2HHH I;  4JI5 E;  4B3S I;  3J7A G;  1USU A;  2HHH E;  4DV2 I;  4B3S E;  4DU7 A;  2V34 A;  2DEI A;  1XMO I;  2CZ9 A;  2HK2 A;  2PNM A;  1XMO E;  1N33 E;  4DU8 A;  1ZM2 A;  2UU9 E;  4URL A;  1Y6Z A;  1FWK A;  4YY3 I;  4DPY A;  4WUD A;  1FI4 A;  1XNQ I;  2VF3 A;  4I3H A;  1UEK A;  5FLX C;  4YY3 E;  1KKH A;  5A2Q C;  2Z5C A;  1XNQ E;  1ZXM A;  3J80 Q;  1NHJ A;  1H7U A;  4IZK B;  2UUB I;  1HK7 A;  2V2V A;  1Z0T A;  4FWG A;  2LJP A;  4X65 I;  2CG9 A;  4DV7 I;  4X65 E;  3M6A A;  2V2Q A;  4DV7 E;  1QZR A;  1N34 I;  4DV0 I;  1A6F A;  1WUU A;  3HJC A;  4GKJ I;  1N34 E;  4DV0 E;  1ZM3 A;  4IZJ A;  1IBM I;  4LF4 I;  4GKJ E;  2UUA I;  2UUC I;  4DV3 I;  1IBM E;  2O1U A;  4LF4 E;  3J81 C;  2UUA E;  4DV3 E;  2Z5B A;  4X66 I;  1Z0W A;  1PIE A;  1KIJ A;  4X66 E;  3J80 C;  4K0K I;  1XHK A;  1RRE A;  4K0K E;  3Q6M A;  3ZZT A;  1FKA E;  3B78 A;  2A2D A;  2F4V I;  3GON A;  3V2U C;  4EMD A;  1J5E I;  2F4V E;  4HYM A;  4DPW A;  4JI7 I;  1PVG A;  1J5E E;  2EFG A;  2X36 A;  3ZM7 A;  4JI7 E;  1EA6 A;  4IZK A;  2Z5E A;  3ZZU A;  1K47 A;  4DXL A;  4YHH I;  1IBK I;  2VQE E;  3LNU A;  4YHH E;  1IBK E;  4FN5 A;  4DV6 I;  4JI5 I;  1Z0E A;  3J7A M;  4DV6 E;  1XNR I;  1HNZ I;  4HY1 A;  3JAM C;  1XNR E;  2NPF A;  1N33 I;  5IWA I;  1HNZ E;  4B3M I;  3V5R A;  4LF6 I;  2A2C A;  2UU9 I;  5IWA E;  1HNX I;  4B3M E;  3OTO I;  4LF6 E;  3B82 A;  3WU6 A;  4ED4 A;  1HNX E;  3Q6N A;  4DR7 I;  1KVK A;  2ZBK B;  3OTO E;  4DR3 I;  4B3T I;  4JI3 I;  4DR7 E;  4LF7 I;  4DR3 E;  5LMN I;  4B3T E;  4DR1 I;  1B62 A;  4JI3 E;  4LF7 E;  1N32 I;  5LMN E;  5LMU I;  4DR1 E;  1N32 E;  1N36 I;  5IT9 C;  5LMU E;  1H72 C;  1Z5A A;  2R3V A;  4LFA I;  1N36 E;  1H7S A;  1NHI A;  4LFA E;  4KHP I;  4PRX A;  4JI4 I;  1Y4U A;  2PNL A;  4KHP E;  4ZVI A;  2DEJ A;  4B3R I;  4JI1 I;  4JI4 E;  3QT6 A;  4B3R E;  1KTV A;  4JI1 E;  4JG4 A;  4MYU A;  2BM1 A;  2GQ0 A;  4M1K A;  4FW9 A;  3WU3 A;  2HKE A;  4WUB A;  1Z0G A;  5BR8 I;  3K17 A;  4N3O A;  5BR8 E;  3ZZ0 A;  1FJG I;  1IBL I;  2GS8 A;  1FJG E;  1FNM A;  1NZ0 A;  1RR9 A;  4DPX A;  1IBL E;  4XTJ A;  4R1F A;  3QT8 A;  4JV5 I;  3PYD A;  4LFC I;  4JV5 E;  3T1H I;  4LF5 E;  4LFC E;  3HUL A;  3T1H E;  3B8H A;  3WU4 A;  4KQV A;  1OJ4 A;  4MYT A;  4JI2 I;  2Z5C B;  3D4J A;  4IZJ D;  4JI2 E;  4UT4 A;  4OX9 I;  1NHH A;  4DV1 I;  2VQE I;  3PYE A;  1USV A;  4FWD A;  4OX9 E;  1D6T A;  4DV1 E;  1B63 A;  1I94 E;  3ZKB A;  2UXD I;  4X64 I;  4DR4 E;  2BV3 A;  1N0V C;  1Z0B A;  4DR5 I;  5GMD A;  2UXD E;  4X64 E;  3LPS A;  3Q1Q A;  4DR5 E;  3H4L A;  3PYG A;  4DV4 I;  4HAC B;  3ZKD A;  2HK3 A;  4USK A;  1XMQ I;  2O1V A;  4P7A A;  1HNW E;  2XEX A;  3QT7 A;  4DV4 E;  3PYF A;  1U2R A;  4NXN I;  4JI8 I;  1XMQ E;  4LF8 E;  2CGE A;  4IZJ B;  4DUZ I;  4JI0 E;  1PKP A;  4NXN E;  4JI8 E;  4DUZ E;  2UXB E;  5FWK A;  2Z5B B;  1MG7 A;  1HR0 I;  1MX0 A;  1ZM4 A;  4DV2 E;  1S16 A;  1HR0 E;  1H74 A;  2O1W A;  2E5L I;  2HKJ A;  2WW4 A;  2E5L E;  4HXZ A;  2E1R A;  4RPF A;  3J81 Q;  2Q2E B;  4UTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...