2UUAM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uuaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uuaM02
4JI4M 4X62M 5ITYA 3JR5A 3JR4A 3DOAA 1IBKM 3U6QA 3GPUA 3TWKA 1N36M 1PJIA 4LF5M 1Z5CA 1HNWM 2UXCM 2F5NA 1XMOM 4AQYM 1Q3CA 4GKKM 1MX0A 3SAWA 1R2ZA 2F5PA 3GPPA 5IWAM 3SATA 1TDZA 1I94M 3GQ3A 4B3RM 4DR5M 3T1HM 5BR8M 1XC8A 2XZFA 3SAUA 1NNJA 4LF9M 4LFAM 2F4VM 1L1TA 4KHPM 3TWMA 4PDGA 1L2BA 1N32M 3C58A 3VK8A 4DR6M 1EE8A 1FJGM 5LMNM 4B3TM 2ZBKB 4JI0M 2UUCM 1XNQM 3J80S 3GPYA 4G4QA 1PM5A 1R2YA 1L2CA 2HHHM 4DR4M 3GQ4A 5ITXE 2UXBM 4DV3M 4DV6M 5LMUM 3A42A 4DV5M 5A2QS 4DR2M 4LF4M 4B3MM 4JYAM 1HNZM 2UXDM 2EA0A 1N34M 4B3SM 4LFBM 4MB7A 1PJJA 4G4OA 1Z59A 2Q2EB 4OX9M 4K0KM 1Z5AA 1XNRM 4DUZM 4DV2M 2UU9M 4LF8M 2F5OA 4DV1M 1K3WA 1HNXM 3U6CA 3VK7A 3TWLA 3GP1A 1IBLM 3T1YM 4NRVA 3OTOM 2HKJA 4DR1M 5FLXS 4LF6M 4JI2M 4ITQA 4X64M 3W0FA 3U6LA 4X66M 4NXMM 4X65M 4DUYM 4JV5M 4JI6M 1N33M 3GPXA 3U6EA 4JI7M 4G4NA 1Q39A 5ITTA 3A45A 4JI8M 5ITQA 4LF7M 2VQEM 4JI1M 2OPFA 4DR7M 4NXNM 4G4RA 2F5QA 3GO8A 4DV7M 3U6PA 4YHHM 4PD2A 1XMQM 4PDIA 2VQFM 1TDHA 3SASA 3JAMS 4YY3M 5ITUA 3A46A 2F5SA 4DV0M 4LFCM 1J5EM 4DR3M 1KFVA 3J81S 1HR0M 4GKJM 1Q3BA 3U6SA 4JI3M 3GQ5A 3U6DA 3U6OA 1MU5A 4DV4M 2UUAM 2ZM6M 3SAVA 1Z5BA 3SARA 1K82A 3U6MA 4PCZA 4JI5M 5IT9S 1L1ZA 1K3XA 2OQ4A 2XZUA 3SBJA 3J7AS 4NRWA 2UUBM 1L2DA 5ITXA 4CISA 2E5LM 1IBMM 5ITRA
chains in the Genus database with same CATH superfamily
2WSEF 3K9PA 1QAOA 1J7KA 1PRBA 1VQ1A 1WIVA 1IBKM 4M9SA 1N36M 2Z8YM 3NBIA 2R62A 3R8FA 1PJIA 3CF6E 1QUTA 3I51A 4QHTA 5C18A 1XMOM 4IBFA 1AUAA 1R2ZA 3D8LA 4BLCA 3GPPA 2DAIA 3UGJA 3L26A 4GEWA 4LGMA 3GLHB 1XXHB 3ZH9B 4DR5M 2DVWB 2C9OA 1G71A 2CP8A 1NHGC 1XC8A 4IBDA 4LGYA 1DGGA 4LFAM 3ZC7B 1WJ7A 1OIZA 2BJVA 4Y28F 4CJ6A 1IXSA 2JZ1A 3Q8XA 2CWBA 3K2LA 2I7NA 3VK8A 4FWHA 1EE8A 5EXXA 2HL7A 3HHXA 5DYIA 2EO2A 5LMNM 4B3TM 3QYBA 2LHCA 2LVPC 3SC3A 8CATA 3MMPA 3GRYA 1XNQM 2X8AA 3GPYA 1R2YA 4DBGB 4P17A 1PM5A 1L2CA 2HHHM 1V33A 3FTDA 5F3WA 2FNAA 1OIPA 2P5TA 3KW6A 4QOZC 1D0MA 5GKNA 4JYAM 3SHFA 4B3MM 1JQJC 5EXSA 2UXDM 2QBYA 1C1KA 1N34M 4WW0A 2RGOA 3FTCA 3E9SA 2MJ5B 4I5SA 1Z5AA 4GITA 4W5WA 3SHGB 1IN8A 3J27B 2KRKA 4NSOB 1XWIA 2C5RA 5EJCA 4DV1M 2K9DA 4IBEA 3GRVA 3U6CA 3VDUA 1VG5A 3FD9A 3TWLA 1K3WA 1HNXM 3C3EA 3T1YM 4LJ5A 1HT1E 3U61A 5FLXS 1UFZA 2DAKA 3MHVC 4L6V6 4ITQA 2YFQA 5FTKA 1KSFX 2DWZB 2EKKA 4G3OA 1T6OA 1YSYA 2R0IA 4X66M 1SXJA 3AKZA 2FS1A 1QZEA 4DUYM 2CV1A 4JI6M 3K9OA 2L7IA 2G8LA 1AIPC 4D82A 3GLFB 2KHHA 1QAQA 4LF7M 1GVNA 1NY5A 4AZFA 2KXEA 1NV8A 4L4UA 4DR7M 1TF0B 2Z4SA 2X49A 4TUWA 4KT0F 2C99A 2DZLA 2LHGA 2L7HA 2F5QA 4YHHM 3KVWA 3AOEA 2Y21A 4FD2A 1JR3D 1TDHA 2CFOA 5C1BA 3A46A 2KZUA 2XF3A 2F5SA 5BPVA 4DR3M 3K8ZA 2FE8A 4IBCA 3B89A 3H4MA 1KFVA 1DO0A 2LVQD 1OAOC 1DV0A 3GLIB 2O01F 1N75A 2DZNB 2QPAA 4B7GA 4KLNA 3WHLA 3U6OA 2EJSA 3A98B 4IBIA 4MM3B 3UMMA 1MN3A 2R6FA 4DV4M 2ZM6M 4QOSA 3U6MA 1TH4A 1OQYA 4R7GA 3W0LB 1IN4A 5IT9S 2L4EA 4LRTA 1K3XA 4M9XA 5EP2A 3E21A 1NVMA 1L2DA 2L2DA 2ZANA 1IBMM 1NJFA 4IJFA 2LH0A 4KODA 4X62M 4IIWA 3JR5A 1SXJE 1SG9A 3DOAA 2Y20A 1SXJC 4CHTB 3FRIA 2JA2A 4IBJA 3ILKA 1NV9A 3KOYE 2HWJA 3TQSA 4AI6A 4AQYM 1IN7A 1IN6A 1MX0A 3PNVA 4HL4A 3SAWA 1G41A 3FTFA 1N78A 3LVVA 2R18A 1G8PA 3RGPA 3SATA 3AJIB 1GKIA 1TTEA 2WZJA 4JXJA 3GQ3A 4I4LA 3AOEC 3I4YA 3HJSA 3T1HM 5BR8M 2VIIA 1VEGA 3I01M 3L28A 2F4VM 3KFUG 3T6PA 2WSCF 4GIPA 7CATA 1BVSA 3MJ5A 4JN6A 4DR6M 1IXZA 3BBZA 3HWSA 3PXGA 3FTEA 1E94E 3SYLA 2CUZA 4JI0M 2N35A 4OU7A 4G4QA 4ANRA 2FOIC 4L78A 2X4AA 4IBGA 3GQ4A 4REZA 2UXBM 4DV3M 2QZ4A 1Y8GA 3B7ZA 3PVSA 2MROB 4LJAA 3A42A 3M6AA 5DFLA 4DR2M 2XSZD 4FCWA 3HX3A 4LRSA 4LY6A 3HHZA 4RF0A 3SMPA 4B3SM 3L2AA 4MH0E 4F2LA 2DI0A 2GNOA 1XNRM 2I7PA 4EIWA 4DUZM 2QENA 4DV2M 2UU9M 1PJTA 3PNYA 1QVRA 2H5XA 4LF8M 1DGBA 3HJQA 1IY0A 1EFUB 2F5OA 2VF8A 2HAKA 4M0DA 1R4GA 1PGYA 4NRVA 5H37D 3OTOM 2KRUA 4Q7JA 2R4EA 3I04M 4IBBA 1NY6A 3KOWE 4X64M 3W0FA 1ZMUA 2LWXA 4I81A 4D81A 3B74A 3L27A 3NWLA 4M9ZA 1R5LA 3GPXA 1VDDA 1LTMA 1HJPA 5FSWA 3U6EA 1YLAA 1Q39A 3CF0A 4G4NA 1IN5A 4JI8M 4AG5A 4MGHA 2VQEM 4JI1M 4HEOA 3SMSA 1XXHA 4LJ4A 2OPFA 1DGHB 4LJ8A 4NXNM 2R45A 1IY1A 2QQ8A 3U6PA 3U61B 4I8OA 4XK8F 5IREB 2KNVA 4PDIA 3SASA 2GQFA 2B3TA 2M60A 1OJLA 4DV0M 4OW0A 1NJGA 3KXEC 1OTRA 1DO2A 1GL6A 4R3DA 3J81S 4GC5A 1F4IA 4AKHA 4HLQA 4LG2A 1Q3BA 3VFDA 3U6SA 1ZQ9A 3EIHA 4JI3M 3VKGA 1QUSA 3U6DA 1G3IA 2APLA 1PJQA 2CHVA 3LCUA 1UM8A 2QCUA 3SAVA 1WHCA 1Z5BA 3KS4A 3SARA 2BWEA 2L6OA 4PCZA 2LBCA 1L1ZA 4BBAA 5FTJA 2XZUA 2D7HA 3HZJA 3QYEA 3VDPA 1TR8A 4CISA 2J7OA 1VEJA 2J7NA 1NHWC 2XH9A 5ITXA 2E5LM 3LMMA 1IFYA 4RKUF 5ITRA 4Z6YA 4JI4M 3HKPA 1RU3A 2QNJA 4XBOA 2XEPA 5ITYA 5KPZA 1MJGM 3JR4A 1GABA 1GL7A 3U6QA 3GLGA 2L09A 3TWKA 1HQYE 4PT5A 1WGNA 2JY7A 4LF5M 1OFHA 1WXQA 1Z5CA 2OO9A 4LJ6A 2LVOC 4GRIA 1E9SA 3V76A 2LTUA 1TH3A 4B7HA 3FE3A 1W5TA 1Q3CA 1XXHE 3MK6A 3U60A 2C98A 3LCVB 1JB0F 2ERCA 2F5PA 2BJWA 2VDBB 4B3RM 4WURA 2DENA 1ZAEA 1JR3A 3RFWA 4BB9A 1W5SA 2KDLA 2EUCA 3NBXX 4XGIA 3TL4X 3SAUA 1NNJA 2RGHA 3UJNA 4LF9M 4NSRA 4OVZA 3GRRA 4MGYE 5EP1A 1L1TA 4PDGA 5KPRA 3KOXE 3C58A 3M7GA 1X37A 4AKGA 1FJGM 3TE6A 3U5ZB 2RRUA 3I4VA 3CTWB 3BXWA 1G4AE 4WP2A 1D0KA 2JXNA 3M0EA 3H4JA 2UUCM 4NOOB 2ZTCA 4D80A 3VLFB 4DR4M 4L16A 1HT2E 2K47A 3W67A 4R71A 1IM2A 5ITXE 4LZJA 4DV6M 3J7AS 2FFJA 2QSFX 3GLIA 2JY6B 4DV5M 2DHRA 1NSFA 4LJ9A 4LF4M 1Z6TA 3GLGE 2KNZA 2J5YA 1QAMA 1QZMA 2K0BX 1Z59A 3ZCBB 4GH9A 4OX9M 4K0KM 2M5ZA 2Z4RA 2R44A 4UN2B 3DA1A 3KDSE 2CEAA 3BOSA 4P16A 1VDLA 3VK7A 3GP1A 3EIEA 3WHKA 3K1JA 4MGIE 2HKJA 1IQPA 1D2NA 1JR3E 2FH0A 1XHBA 2JZ0A 4DR1M 1IY2A 1YUBA 1GLNA 1ZMWA 1ZMVA 4X65M 4AKIA 2MGWA 2YQZA 1QDTA 1R7RA 4QHSA 1J09A 1N33M 4G6ZA 1C7YA 5EXPA 2K6BA 4GMQA 3SYKA 4JI7M 1LV7A 4QNRA 3A45A 5ITTA 1IXSB 5ITQA 2Y0TA 2D7EA 2Z7JA 4M0WA 4NC6A 1GJTA 2HCBA 4G4RA 2DXIA 5FTNA 4Z8XA 5KQ8A 5KPTA 3IG5A 3CGWA 1HQCA 3FUUA 4PD2A 3GRUA 2OOAA 1E9RA 2CV0A 4YY3M 5ITUA 3PFIA 2DWLA 1ORYB 3GLIE 1CUKA 1FNNA 2D7GA 1V34A 4GC9A 1HR0M 2KW0A 1XB2B 2XSZA 5FTLA 1TH2A 3AFHA 3T15A 3HY5A 2JY8A 2KZSA 3SFZA 3FUVA 3FKEA 1MU5A 1DGFA 2UUAM 3HGIA 2QBYB 1K82A 1QDRA 2W82A 3F92A 4MGZE 4JI5M 2NQ8C 1ZV1A 2EKFA 3D8BA 3HU2A 2L4FA 4GHLA 3ZQJA 3W68A 3SBJA 3HU1A 4NRWA 2UUBM 2V6ZM 2H1RA 2OOBA 2DAEA 2QHOB 2C9CA 3GLHA 2RKOA 3J7BA 3IG8A 2ZTDA 3R9XB 3HHYA 2LVAA 3KP1E 5DYGA 3E4RA 4GHAA 2DKLA 2R65A 4II7A 1Q02A 3GPUA 3FUWA 5EXTA 3UZUA 3HJ8A 3LQRA 4AW4A 1TGUA 4RF1A 1SXJB 1HNWM 1WGLA 3KS8A 2F5NA 2UXCM 4GKKM 2G3QA 2R46A 2WSFF 3QWLA 2KEBA 2CHGA 3J2PB 4KO8A 2JWSA 2DWNA 2CHQA 3LVWA 5IWAM 2JP7A 1TDZA 2BNKA 1I94M 2DAMA 4CIZA 3AOGA 3C9PA 3RGSA 1GJSA 1L8QA 2CE7A 2XZFA 2XFSA 4FWGA 1SXJD 5EP4A 3GLGB 1PJSA 4B08A 2A5YB 5EQTA 3TWMA 4KHPM 3DZDA 1L2BA 2CV2A 3KSXA 3TPZA 1N32M 3QAUA 1DGHA 3K92A 3T38A 1S3SA 4F1IA 3U60B 4FWDA 4RNAA 3DFZA 2Z3XA 2ZBKB 2DAGA 2KA6B 3J80S 3LW5F 5KO3A 3VKHA 1IXRC 4L8RC 3FYCA 2V1UA 3GLHE 2DHYA 1E32A 2KNAA 5LMUM 1G59A 1N77A 3THGA 2YR0A 2CRUA 2ZAOA 4OVZB 1T43A 5A2QS 3E46A 3KOZE 1HNZM 2EA0A 4LFBM 1GO5A 2DZOB 4MB7A 1PJJA 4LZZA 4G4OA 2Q2EB 3GLFA 4IBKA 3L25A 1OFIA 2O25A 4CGYB 2JNHA 3IHPA 4FCTA 2JY5A 1VEKA 2XLJA 1IBLM 1WR1B 3L29A 5L8RF 2G5GX 3FYDA 1T3TA 4LF6M 1NNUC 2R4JA 3HU3A 1NO1A 3UK6A 4JI2M 4AG6A 2XFTA 1A5TA 5JI2E 5IZ7D 3FUTA 3U6LA 4NXMM 2QP9X 1QANA 3AV0A 2DWMA 2MH8A 4JV5M 4L15A 3LQQA 5DNYA 3AL0C 3IECA 4MGKE 2LNHC 5E6JA 5FTMA 1R6BX 1I4WA 4FCVA 5KQDA 1D0LA 3C3DA 4QNMA 2Y0QA 1OKSA 4S12A 3GO8A 4DV7M 1YE9A 5JI3E 1P3QQ 1KYIA 1XMQM 2VQFM 2ZAMA 5E26A 3KSJA 3JAMS 3FUXA 2DNAA 1QQWA 2JUJA 2MR9A 2O5RA 3B9PA 4FVMA 4IJEA 4LCBA 4LJ7A 4NL4H 1V92A 1J5EM 4FW9A 4LFCM 5EP3A 2BWBA 4GKJM 1EIJA 3KP0E 3Q8GA 3U5ZA 3GQ5A 3GLFE 2VF7A 4A3VB 2XGNA 3FRHA 2C96A 2V1CA 2AHMA 3CF2A 2LXEA 3RE8A 3B7NA 4ZPXA 4B7FA 2OQ4A 3HHWA 2YNMD 3B7QA 1OAIA 1QYRA 1H6UA 2LVNC
chains in the Genus database with same CATH topology
1QAOA 1J7KA 1IBKM 4M9SA 1N36M 3NBIA 2R62A 3R8FA 1PJIA 3CF6E 4QHTA 3I51A 5C18A 1XMOM 4IBFA 1R2ZA 3D8LA 4BLCA 3GPPA 3UGJA 3L26A 4LGMA 3GLHB 1XXHB 3ZH9B 4DR5M 2DVWB 2C9OA 1NHGC 1XC8A 4IBDA 4LGYA 1DGGA 4LFAM 3ZC7B 2BJVA 3Q8XA 3K2LA 2I7NA 3VK8A 4FWHA 1EE8A 5EXXA 2HL7A 3HHXA 5DYIA 2EO2A 5LMNM 4B3TM 3SC3A 8CATA 1XNQM 3GRYA 2X8AA 3GPYA 1R2YA 1PM5A 1L2CA 2HHHM 3FTDA 5F3WA 2FNAA 2P5TA 3KW6A 4QOZC 5GKNA 4JYAM 3SHFA 4B3MM 1JQJC 5EXSA 2UXDM 2QBYA 1C1KA 1N34M 4WW0A 2RGOA 3FTCA 3E9SA 4I5SA 1Z5AA 4GITA 4W5WA 3SHGB 1IN8A 3J27B 2KRKA 4NSOB 1XWIA 2C5RA 5EJCA 4DV1M 1K3WA 4IBEA 3GRVA 3U6CA 3VDUA 1HNXM 3FD9A 3TWLA 4AI6A 3T1YM 4LJ5A 1HT1E 3U61A 5FLXS 3MHVC 4ITQA 2YFQA 5FTKA 1KSFX 2DWZB 1YSYA 4X66M 1SXJA 3AKZA 4DUYM 2CV1A 4JI6M 2L7IA 2G8LA 4D82A 3GLFB 1QAQA 4LF7M 1GVNA 1NY5A 4AZFA 2KXEA 4L4UA 4DR7M 2Z4SA 2X49A 4TUWA 2F5QA 2C99A 2L7HA 4YHHM 3KVWA 3AOEA 2Y21A 4FD2A 1JR3D 1TDHA 2CFOA 5C1BA 3A46A 2KZUA 2XF3A 2F5SA 5BPVA 4DR3M 3K8ZA 2FE8A 4IBCA 3H4MA 1KFVA 1DO0A 3GLIB 4B7GA 1N75A 2DZNB 2QPAA 3U6OA 4KLNA 3WHLA 3A98B 4IBIA 4MM3B 3UMMA 4DV4M 2ZM6M 4QOSA 3U6MA 1TH4A 4R7GA 3W0LB 1IN4A 5IT9S 4LRTA 1K3XA 4M9XA 5EP2A 1NVMA 1L2DA 2ZANA 1IBMM 1NJFA 4IJFA 2LH0A 4KODA 4X62M 4IIWA 3JR5A 1SXJE 3DOAA 2Y20A 1SXJC 4CHTB 2JA2A 4IBJA 3ILKA 3KOYE 3TQSA 4AQYM 1IN7A 1IN6A 1MX0A 3PNVA 4HL4A 3SAWA 1G41A 3FTFA 1N78A 3LVVA 2R18A 1G8PA 3RGPA 3SATA 3AJIB 1GKIA 4JXJA 3GQ3A 4I4LA 3AOEC 3I4YA 3HJSA 3T1HM 5BR8M 2VIIA 3L28A 3KFUG 2F4VM 4GIPA 7CATA 3MJ5A 4JN6A 4DR6M 1IXZA 3HWSA 3PXGA 3FTEA 1E94E 3SYLA 2CUZA 4JI0M 4OU7A 4G4QA 2FOIC 4L78A 2X4AA 4IBGA 3GQ4A 4REZA 2UXBM 4DV3M 2QZ4A 3PVSA 4LJAA 3A42A 3M6AA 4DR2M 2XSZD 4FCWA 4LRSA 4LY6A 3HHZA 4RF0A 3SMPA 4B3SM 3L2AA 4MH0E 1XNRM 2I7PA 4EIWA 4DUZM 2QENA 4DV2M 2UU9M 3PNYA 1QVRA 4LF8M 1DGBA 3HJQA 1IY0A 2F5OA 4M0DA 4NRVA 5H37D 3OTOM 2KRUA 2R4EA 4IBBA 1NY6A 3KOWE 4X64M 3W0FA 2LWXA 4I81A 4D81A 3L27A 3NWLA 4M9ZA 3GPXA 1VDDA 5FSWA 3U6EA 4G4NA 1Q39A 3CF0A 1IN5A 4JI8M 4AG5A 4MGHA 2VQEM 4JI1M 3SMSA 2OPFA 1XXHA 4LJ4A 1DGHB 4LJ8A 4NXNM 2R45A 1IY1A 3U6PA 3U61B 4I8OA 5IREB 4PDIA 3SASA 2M60A 1OJLA 4DV0M 4OW0A 1NJGA 3KXEC 1DO2A 1GL6A 4R3DA 3J81S 4GC5A 4AKHA 4HLQA 4LG2A 1Q3BA 3VFDA 3U6SA 1ZQ9A 3EIHA 4JI3M 3VKGA 3U6DA 1G3IA 2CHVA 1UM8A 2QCUA 3SAVA 1Z5BA 3KS4A 3SARA 4PCZA 2L6OA 1L1ZA 4BBAA 5FTJA 2XZUA 2D7HA 3VDPA 3J7AS 4CISA 2J7OA 5ITXA 2J7NA 1NHWC 2XH9A 2E5LM 3LMMA 5ITRA 4Z6YA 4JI4M 3HKPA 4XBOA 2XEPA 5ITYA 5KPZA 3JR4A 1GL7A 3U6QA 3GLGA 2L09A 3TWKA 1HQYE 4PT5A 4LF5M 1OFHA 1WXQA 1Z5CA 4LJ6A 4GRIA 1E9SA 1TH3A 4B7HA 1W5TA 1Q3CA 3MK6A 3U60A 2C98A 2ERCA 2F5PA 2BJWA 4B3RM 4WURA 1ZAEA 1JR3A 3RFWA 4BB9A 1W5SA 2EUCA 4XGIA 3TL4X 3SAUA 1NNJA 2RGHA 3UJNA 4LF9M 4NSRA 4OVZA 3GRRA 4MGYE 5EP1A 1L1TA 4PDGA 5KPRA 3KOXE 3C58A 3M7GA 1X37A 4AKGA 1FJGM 3TE6A 3U5ZB 3I4VA 3CTWB 1G4AE 3M0EA 2UUCM 4NOOB 4D80A 3VLFB 4DR4M 4L16A 1HT2E 2K47A 5ITXE 1IM2A 4LZJA 4DV6M 2FFJA 3GLIA 4DV5M 2DHRA 1NSFA 4LJ9A 4LF4M 1Z6TA 1QAMA 1QZMA 1Z59A 3ZCBB 4GH9A 4OX9M 4K0KM 2M5ZA 2Z4RA 3DA1A 3KDSE 2CEAA 3BOSA 4P16A 3VK7A 3GP1A 3EIEA 3WHKA 3K1JA 4MGIE 1IQPA 1D2NA 2HKJA 4DR1M 1XHBA 1IY2A 1YUBA 1GLNA 4X65M 4AKIA 2YQZA 1R7RA 4QHSA 1J09A 1N33M 4G6ZA 5EXPA 4GMQA 3SYKA 4JI7M 1LV7A 4QNRA 3A45A 5ITTA 1IXSB 5ITQA 2Y0TA 2D7EA 2Z7JA 4M0WA 2HCBA 4G4RA 2DXIA 5FTNA 4Z8XA 5KQ8A 5KPTA 3IG5A 1HQCA 3FUUA 4PD2A 3GRUA 1E9RA 2CV0A 4YY3M 5ITUA 3PFIA 2DWLA 1ORYB 1FNNA 2D7GA 4GC9A 1HR0M 2KW0A 2XSZA 5FTLA 1TH2A 3AFHA 3T15A 2KZSA 3SFZA 3FUVA 3FKEA 1MU5A 1DGFA 2UUAM 3HGIA 2QBYB 1K82A 2W82A 4MGZE 4JI5M 2NQ8C 3D8BA 3HU2A 4GHLA 3SBJA 3HU1A 4NRWA 2UUBM 2V6ZM 2H1RA 3GLHA 2C9CA 3J7BA 2RKOA 3IG8A 3R9XB 3HHYA 3KP1E 5DYGA 3E4RA 4GHAA 2R65A 4II7A 3GPUA 3FUWA 5EXTA 3UZUA 3HJ8A 3LQRA 4AW4A 1TGUA 4RF1A 1SXJB 1HNWM 3KS8A 2F5NA 2UXCM 4GKKM 2R46A 4KO8A 3QWLA 2KEBA 2CHGA 3J2PB 2DWNA 2CHQA 3LVWA 5IWAM 1TDZA 2BNKA 1I94M 3AOGA 3RGSA 1L8QA 2CE7A 2XZFA 2XFSA 4FWGA 1SXJD 5EP4A 3GLGB 4B08A 2A5YB 5EQTA 3TWMA 4KHPM 3DZDA 1L2BA 2CV2A 3KSXA 3TPZA 1N32M 3QAUA 1DGHA 3K92A 3T38A 1S3SA 3U60B 4FWDA 4RNAA 3DFZA 2Z3XA 2ZBKB 2KA6B 3J80S 5KO3A 3VKHA 1IXRC 4L8RC 3FYCA 2V1UA 1E32A 5LMUM 1G59A 1N77A 3THGA 2YR0A 5A2QS 2ZAOA 4OVZB 3KOZE 1HNZM 2EA0A 4LFBM 2DZOB 4MB7A 1PJJA 4LZZA 4G4OA 2Q2EB 3GLFA 4IBKA 3L25A 1OFIA 4CGYB 4FCTA 2XLJA 1IBLM 3L29A 2G5GX 3FYDA 1T3TA 4LF6M 1NNUC 2R4JA 3HU3A 3UK6A 4JI2M 4AG6A 2XFTA 5JI2E 5IZ7D 3FUTA 3U6LA 4NXMM 2QP9X 1QANA 3AV0A 2DWMA 4JV5M 4L15A 3LQQA 5DNYA 3AL0C 4MGKE 2LNHC 5E6JA 5FTMA 1R6BX 1I4WA 4FCVA 5KQDA 4QNMA 2Y0QA 4S12A 3GO8A 4DV7M 1YE9A 5JI3E 1KYIA 1XMQM 2VQFM 2ZAMA 5E26A 3KSJA 3JAMS 3FUXA 2O5RA 1QQWA 4FVMA 4IJEA 4NL4H 3B9PA 4LJ7A 4LFCM 4LCBA 1J5EM 4FW9A 5EP3A 4GKJM 3KP0E 3U5ZA 3GQ5A 4A3VB 2XGNA 2C96A 2V1CA 2AHMA 3CF2A 2LXEA 3RE8A 4ZPXA 4B7FA 2OQ4A 3HHWA 2YNMD 1QYRA 1H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 M;  4X62 M;  5ITY A;  3JR5 A;  3JR4 A;  3DOA A;  1IBK M;  3U6Q A;  3GPU A;  3TWK A;  1N36 M;  1PJI A;  4LF5 M;  1Z5C A;  1HNW M;  2UXC M;  2F5N A;  1XMO M;  4AQY M;  1Q3C A;  4GKK M;  1MX0 A;  3SAW A;  1R2Z A;  2F5P A;  3GPP A;  5IWA M;  3SAT A;  1TDZ A;  1I94 M;  3GQ3 A;  4B3R M;  4DR5 M;  3T1H M;  5BR8 M;  1XC8 A;  2XZF A;  3SAU A;  1NNJ A;  4LF9 M;  4LFA M;  2F4V M;  1L1T A;  4KHP M;  3TWM A;  4PDG A;  1L2B A;  1N32 M;  3C58 A;  3VK8 A;  4DR6 M;  1EE8 A;  1FJG M;  5LMN M;  4B3T M;  2ZBK B;  4JI0 M;  2UUC M;  1XNQ M;  3J80 S;  3GPY A;  4G4Q A;  1PM5 A;  1R2Y A;  1L2C A;  2HHH M;  4DR4 M;  3GQ4 A;  5ITX E;  2UXB M;  4DV3 M;  4DV6 M;  5LMU M;  3A42 A;  4DV5 M;  5A2Q S;  4DR2 M;  4LF4 M;  4B3M M;  4JYA M;  1HNZ M;  2UXD M;  2EA0 A;  1N34 M;  4B3S M;  4LFB M;  4MB7 A;  1PJJ A;  4G4O A;  1Z59 A;  2Q2E B;  4OX9 M;  4K0K M;  1Z5A A;  1XNR M;  4DUZ M;  4DV2 M;  2UU9 M;  4LF8 M;  2F5O A;  4DV1 M;  1K3W A;  1HNX M;  3U6C A;  3VK7 A;  3TWL A;  3GP1 A;  1IBL M;  3T1Y M;  4NRV A;  3OTO M;  2HKJ A;  4DR1 M;  5FLX S;  4LF6 M;  4JI2 M;  4ITQ A;  4X64 M;  3W0F A;  3U6L A;  4X66 M;  4NXM M;  4X65 M;  4DUY M;  4JV5 M;  4JI6 M;  1N33 M;  3GPX A;  3U6E A;  4JI7 M;  4G4N A;  1Q39 A;  5ITT A;  3A45 A;  4JI8 M;  5ITQ A;  4LF7 M;  2VQE M;  4JI1 M;  2OPF A;  4DR7 M;  4NXN M;  4G4R A;  2F5Q A;  3GO8 A;  4DV7 M;  3U6P A;  4YHH M;  4PD2 A;  1XMQ M;  4PDI A;  2VQF M;  1TDH A;  3SAS A;  3JAM S;  4YY3 M;  5ITU A;  3A46 A;  2F5S A;  4DV0 M;  4LFC M;  1J5E M;  4DR3 M;  1KFV A;  3J81 S;  1HR0 M;  4GKJ M;  1Q3B A;  3U6S A;  4JI3 M;  3GQ5 A;  3U6D A;  3U6O A;  1MU5 A;  4DV4 M;  2UUA M;  2ZM6 M;  3SAV A;  1Z5B A;  3SAR A;  1K82 A;  3U6M A;  4PCZ A;  4JI5 M;  5IT9 S;  1L1Z A;  1K3X A;  2OQ4 A;  2XZU A;  3SBJ A;  3J7A S;  4NRW A;  2UUB M;  1L2D A;  5ITX A;  4CIS A;  2E5L M;  1IBM M;  5ITR A; 
#chains in the Genus database with same CATH topology
 2WSE F;  3K9P A;  1QAO A;  1J7K A;  1PRB A;  1VQ1 A;  1WIV A;  1IBK M;  4M9S A;  1N36 M;  2Z8Y M;  3NBI A;  2R62 A;  3R8F A;  1PJI A;  3CF6 E;  1QUT A;  3I51 A;  4QHT A;  5C18 A;  1XMO M;  4IBF A;  1AUA A;  1R2Z A;  3D8L A;  4BLC A;  3GPP A;  2DAI A;  3UGJ A;  3L26 A;  4GEW A;  4LGM A;  3GLH B;  1XXH B;  3ZH9 B;  4DR5 M;  2DVW B;  2C9O A;  1G71 A;  2CP8 A;  1NHG C;  1XC8 A;  4IBD A;  4LGY A;  1DGG A;  4LFA M;  3ZC7 B;  1WJ7 A;  1OIZ A;  2BJV A;  4Y28 F;  4CJ6 A;  1IXS A;  2JZ1 A;  3Q8X A;  2CWB A;  3K2L A;  2I7N A;  3VK8 A;  4FWH A;  1EE8 A;  5EXX A;  2HL7 A;  3HHX A;  5DYI A;  2EO2 A;  5LMN M;  4B3T M;  3QYB A;  2LHC A;  2LVP C;  3SC3 A;  8CAT A;  3MMP A;  3GRY A;  1XNQ M;  2X8A A;  3GPY A;  1R2Y A;  4DBG B;  4P17 A;  1PM5 A;  1L2C A;  2HHH M;  1V33 A;  3FTD A;  5F3W A;  2FNA A;  1OIP A;  2P5T A;  3KW6 A;  4QOZ C;  1D0M A;  5GKN A;  4JYA M;  3SHF A;  4B3M M;  1JQJ C;  5EXS A;  2UXD M;  2QBY A;  1C1K A;  1N34 M;  4WW0 A;  2RGO A;  3FTC A;  3E9S A;  2MJ5 B;  4I5S A;  1Z5A A;  4GIT A;  4W5W A;  3SHG B;  1IN8 A;  3J27 B;  2KRK A;  4NSO B;  1XWI A;  2C5R A;  5EJC A;  4DV1 M;  2K9D A;  4IBE A;  3GRV A;  3U6C A;  3VDU A;  1VG5 A;  3FD9 A;  3TWL A;  1K3W A;  1HNX M;  3C3E A;  3T1Y M;  4LJ5 A;  1HT1 E;  3U61 A;  5FLX S;  1UFZ A;  2DAK A;  3MHV C;  4L6V 6;  4ITQ A;  2YFQ A;  5FTK A;  1KSF X;  2DWZ B;  2EKK A;  4G3O A;  1T6O A;  1YSY A;  2R0I A;  4X66 M;  1SXJ A;  3AKZ A;  2FS1 A;  1QZE A;  4DUY M;  2CV1 A;  4JI6 M;  3K9O A;  2L7I A;  2G8L A;  1AIP C;  4D82 A;  3GLF B;  2KHH A;  1QAQ A;  4LF7 M;  1GVN A;  1NY5 A;  4AZF A;  2KXE A;  1NV8 A;  4L4U A;  4DR7 M;  1TF0 B;  2Z4S A;  2X49 A;  4TUW A;  4KT0 F;  2C99 A;  2DZL A;  2LHG A;  2L7H A;  2F5Q A;  4YHH M;  3KVW A;  3AOE A;  2Y21 A;  4FD2 A;  1JR3 D;  1TDH A;  2CFO A;  5C1B A;  3A46 A;  2KZU A;  2XF3 A;  2F5S A;  5BPV A;  4DR3 M;  3K8Z A;  2FE8 A;  4IBC A;  3B89 A;  3H4M A;  1KFV A;  1DO0 A;  2LVQ D;  1OAO C;  1DV0 A;  3GLI B;  2O01 F;  1N75 A;  2DZN B;  2QPA A;  4B7G A;  4KLN A;  3WHL A;  3U6O A;  2EJS A;  3A98 B;  4IBI A;  4MM3 B;  3UMM A;  1MN3 A;  2R6F A;  4DV4 M;  2ZM6 M;  4QOS A;  3U6M A;  1TH4 A;  1OQY A;  4R7G A;  3W0L B;  1IN4 A;  5IT9 S;  2L4E A;  4LRT A;  1K3X A;  4M9X A;  5EP2 A;  3E21 A;  1NVM A;  1L2D A;  2L2D A;  2ZAN A;  1IBM M;  1NJF A;  4IJF A;  2LH0 A;  4KOD A;  4X62 M;  4IIW A;  3JR5 A;  1SXJ E;  1SG9 A;  3DOA A;  2Y20 A;  1SXJ C;  4CHT B;  3FRI A;  2JA2 A;  4IBJ A;  3ILK A;  1NV9 A;  3KOY E;  2HWJ A;  3TQS A;  4AI6 A;  4AQY M;  1IN7 A;  1IN6 A;  1MX0 A;  3PNV A;  4HL4 A;  3SAW A;  1G41 A;  3FTF A;  1N78 A;  3LVV A;  2R18 A;  1G8P A;  3RGP A;  3SAT A;  3AJI B;  1GKI A;  1TTE A;  2WZJ A;  4JXJ A;  3GQ3 A;  4I4L A;  3AOE C;  3I4Y A;  3HJS A;  3T1H M;  5BR8 M;  2VII A;  1VEG A;  3I01 M;  3L28 A;  2F4V M;  3KFU G;  3T6P A;  2WSC F;  4GIP A;  7CAT A;  1BVS A;  3MJ5 A;  4JN6 A;  4DR6 M;  1IXZ A;  3BBZ A;  3HWS A;  3PXG A;  3FTE A;  1E94 E;  3SYL A;  2CUZ A;  4JI0 M;  2N35 A;  4OU7 A;  4G4Q A;  4ANR A;  2FOI C;  4L78 A;  2X4A A;  4IBG A;  3GQ4 A;  4REZ A;  2UXB M;  4DV3 M;  2QZ4 A;  1Y8G A;  3B7Z A;  3PVS A;  2MRO B;  4LJA A;  3A42 A;  3M6A A;  5DFL A;  4DR2 M;  2XSZ D;  4FCW A;  3HX3 A;  4LRS A;  4LY6 A;  3HHZ A;  4RF0 A;  3SMP A;  4B3S M;  3L2A A;  4MH0 E;  4F2L A;  2DI0 A;  2GNO A;  1XNR M;  2I7P A;  4EIW A;  4DUZ M;  2QEN A;  4DV2 M;  2UU9 M;  1PJT A;  3PNY A;  1QVR A;  2H5X A;  4LF8 M;  1DGB A;  3HJQ A;  1IY0 A;  1EFU B;  2F5O A;  2VF8 A;  2HAK A;  4M0D A;  1R4G A;  1PGY A;  4NRV A;  5H37 D;  3OTO M;  2KRU A;  4Q7J A;  2R4E A;  3I04 M;  4IBB A;  1NY6 A;  3KOW E;  4X64 M;  3W0F A;  1ZMU A;  2LWX A;  4I81 A;  4D81 A;  3B74 A;  3L27 A;  3NWL A;  4M9Z A;  1R5L A;  3GPX A;  1VDD A;  1LTM A;  1HJP A;  5FSW A;  3U6E A;  1YLA A;  1Q39 A;  3CF0 A;  4G4N A;  1IN5 A;  4JI8 M;  4AG5 A;  4MGH A;  2VQE M;  4JI1 M;  4HEO A;  3SMS A;  1XXH A;  4LJ4 A;  2OPF A;  1DGH B;  4LJ8 A;  4NXN M;  2R45 A;  1IY1 A;  2QQ8 A;  3U6P A;  3U61 B;  4I8O A;  4XK8 F;  5IRE B;  2KNV A;  4PDI A;  3SAS A;  2GQF A;  2B3T A;  2M60 A;  1OJL A;  4DV0 M;  4OW0 A;  1NJG A;  3KXE C;  1OTR A;  1DO2 A;  1GL6 A;  4R3D A;  3J81 S;  4GC5 A;  1F4I A;  4AKH A;  4HLQ A;  4LG2 A;  1Q3B A;  3VFD A;  3U6S A;  1ZQ9 A;  3EIH A;  4JI3 M;  3VKG A;  1QUS A;  3U6D A;  1G3I A;  2APL A;  1PJQ A;  2CHV A;  3LCU A;  1UM8 A;  2QCU A;  3SAV A;  1WHC A;  1Z5B A;  3KS4 A;  3SAR A;  2BWE A;  2L6O A;  4PCZ A;  2LBC A;  1L1Z A;  4BBA A;  5FTJ A;  2XZU A;  2D7H A;  3HZJ A;  3QYE A;  3VDP A;  1TR8 A;  4CIS A;  2J7O A;  1VEJ A;  2J7N A;  1NHW C;  2XH9 A;  5ITX A;  2E5L M;  3LMM A;  1IFY A;  4RKU F;  5ITR A;  4Z6Y A;  4JI4 M;  3HKP A;  1RU3 A;  2QNJ A;  4XBO A;  2XEP A;  5ITY A;  5KPZ A;  1MJG M;  3JR4 A;  1GAB A;  1GL7 A;  3U6Q A;  3GLG A;  2L09 A;  3TWK A;  1HQY E;  4PT5 A;  1WGN A;  2JY7 A;  4LF5 M;  1OFH A;  1WXQ A;  1Z5C A;  2OO9 A;  4LJ6 A;  2LVO C;  4GRI A;  1E9S A;  3V76 A;  2LTU A;  1TH3 A;  4B7H A;  3FE3 A;  1W5T A;  1Q3C A;  1XXH E;  3MK6 A;  3U60 A;  2C98 A;  3LCV B;  1JB0 F;  2ERC A;  2F5P A;  2BJW A;  2VDB B;  4B3R M;  4WUR A;  2DEN A;  1ZAE A;  1JR3 A;  3RFW A;  4BB9 A;  1W5S A;  2KDL A;  2EUC A;  3NBX X;  4XGI A;  3TL4 X;  3SAU A;  1NNJ A;  2RGH A;  3UJN A;  4LF9 M;  4NSR A;  4OVZ A;  3GRR A;  4MGY E;  5EP1 A;  1L1T A;  4PDG A;  5KPR A;  3KOX E;  3C58 A;  3M7G A;  1X37 A;  4AKG A;  1FJG M;  3TE6 A;  3U5Z B;  2RRU A;  3I4V A;  3CTW B;  3BXW A;  1G4A E;  4WP2 A;  1D0K A;  2JXN A;  3M0E A;  3H4J A;  2UUC M;  4NOO B;  2ZTC A;  4D80 A;  3VLF B;  4DR4 M;  4L16 A;  1HT2 E;  2K47 A;  3W67 A;  4R71 A;  1IM2 A;  5ITX E;  4LZJ A;  4DV6 M;  3J7A S;  2FFJ A;  2QSF X;  3GLI A;  2JY6 B;  4DV5 M;  2DHR A;  1NSF A;  4LJ9 A;  4LF4 M;  1Z6T A;  3GLG E;  2KNZ A;  2J5Y A;  1QAM A;  1QZM A;  2K0B X;  1Z59 A;  3ZCB B;  4GH9 A;  4OX9 M;  4K0K M;  2M5Z A;  2Z4R A;  2R44 A;  4UN2 B;  3DA1 A;  3KDS E;  2CEA A;  3BOS A;  4P16 A;  1VDL A;  3VK7 A;  3GP1 A;  3EIE A;  3WHK A;  3K1J A;  4MGI E;  2HKJ A;  1IQP A;  1D2N A;  1JR3 E;  2FH0 A;  1XHB A;  2JZ0 A;  4DR1 M;  1IY2 A;  1YUB A;  1GLN A;  1ZMW A;  1ZMV A;  4X65 M;  4AKI A;  2MGW A;  2YQZ A;  1QDT A;  1R7R A;  4QHS A;  1J09 A;  1N33 M;  4G6Z A;  1C7Y A;  5EXP A;  2K6B A;  4GMQ A;  3SYK A;  4JI7 M;  1LV7 A;  4QNR A;  3A45 A;  5ITT A;  1IXS B;  5ITQ A;  2Y0T A;  2D7E A;  2Z7J A;  4M0W A;  4NC6 A;  1GJT A;  2HCB A;  4G4R A;  2DXI A;  5FTN A;  4Z8X A;  5KQ8 A;  5KPT A;  3IG5 A;  3CGW A;  1HQC A;  3FUU A;  4PD2 A;  3GRU A;  2OOA A;  1E9R A;  2CV0 A;  4YY3 M;  5ITU A;  3PFI A;  2DWL A;  1ORY B;  3GLI E;  1CUK A;  1FNN A;  2D7G A;  1V34 A;  4GC9 A;  1HR0 M;  2KW0 A;  1XB2 B;  2XSZ A;  5FTL A;  1TH2 A;  3AFH A;  3T15 A;  3HY5 A;  2JY8 A;  2KZS A;  3SFZ A;  3FUV A;  3FKE A;  1MU5 A;  1DGF A;  2UUA M;  3HGI A;  2QBY B;  1K82 A;  1QDR A;  2W82 A;  3F92 A;  4MGZ E;  4JI5 M;  2NQ8 C;  1ZV1 A;  2EKF A;  3D8B A;  3HU2 A;  2L4F A;  4GHL A;  3ZQJ A;  3W68 A;  3SBJ A;  3HU1 A;  4NRW A;  2UUB M;  2V6Z M;  2H1R A;  2OOB A;  2DAE A;  2QHO B;  2C9C A;  3GLH A;  2RKO A;  3J7B A;  3IG8 A;  2ZTD A;  3R9X B;  3HHY A;  2LVA A;  3KP1 E;  5DYG A;  3E4R A;  4GHA A;  2DKL A;  2R65 A;  4II7 A;  1Q02 A;  3GPU A;  3FUW A;  5EXT A;  3UZU A;  3HJ8 A;  3LQR A;  4AW4 A;  1TGU A;  4RF1 A;  1SXJ B;  1HNW M;  1WGL A;  3KS8 A;  2F5N A;  2UXC M;  4GKK M;  2G3Q A;  2R46 A;  2WSF F;  3QWL A;  2KEB A;  2CHG A;  3J2P B;  4KO8 A;  2JWS A;  2DWN A;  2CHQ A;  3LVW A;  5IWA M;  2JP7 A;  1TDZ A;  2BNK A;  1I94 M;  2DAM A;  4CIZ A;  3AOG A;  3C9P A;  3RGS A;  1GJS A;  1L8Q A;  2CE7 A;  2XZF A;  2XFS A;  4FWG A;  1SXJ D;  5EP4 A;  3GLG B;  1PJS A;  4B08 A;  2A5Y B;  5EQT A;  3TWM A;  4KHP M;  3DZD A;  1L2B A;  2CV2 A;  3KSX A;  3TPZ A;  1N32 M;  3QAU A;  1DGH A;  3K92 A;  3T38 A;  1S3S A;  4F1I A;  3U60 B;  4FWD A;  4RNA A;  3DFZ A;  2Z3X A;  2ZBK B;  2DAG A;  2KA6 B;  3J80 S;  3LW5 F;  5KO3 A;  3VKH A;  1IXR C;  4L8R C;  3FYC A;  2V1U A;  3GLH E;  2DHY A;  1E32 A;  2KNA A;  5LMU M;  1G59 A;  1N77 A;  3THG A;  2YR0 A;  2CRU A;  2ZAO A;  4OVZ B;  1T43 A;  5A2Q S;  3E46 A;  3KOZ E;  1HNZ M;  2EA0 A;  4LFB M;  1GO5 A;  2DZO B;  4MB7 A;  1PJJ A;  4LZZ A;  4G4O A;  2Q2E B;  3GLF A;  4IBK A;  3L25 A;  1OFI A;  2O25 A;  4CGY B;  2JNH A;  3IHP A;  4FCT A;  2JY5 A;  1VEK A;  2XLJ A;  1IBL M;  1WR1 B;  3L29 A;  5L8R F;  2G5G X;  3FYD A;  1T3T A;  4LF6 M;  1NNU C;  2R4J A;  3HU3 A;  1NO1 A;  3UK6 A;  4JI2 M;  4AG6 A;  2XFT A;  1A5T A;  5JI2 E;  5IZ7 D;  3FUT A;  3U6L A;  4NXM M;  2QP9 X;  1QAN A;  3AV0 A;  2DWM A;  2MH8 A;  4JV5 M;  4L15 A;  3LQQ A;  5DNY A;  3AL0 C;  3IEC A;  4MGK E;  2LNH C;  5E6J A;  5FTM A;  1R6B X;  1I4W A;  4FCV A;  5KQD A;  1D0L A;  3C3D A;  4QNM A;  2Y0Q A;  1OKS A;  4S12 A;  3GO8 A;  4DV7 M;  1YE9 A;  5JI3 E;  1P3Q Q;  1KYI A;  1XMQ M;  2VQF M;  2ZAM A;  5E26 A;  3KSJ A;  3JAM S;  3FUX A;  2DNA A;  1QQW A;  2JUJ A;  2MR9 A;  2O5R A;  3B9P A;  4FVM A;  4IJE A;  4LCB A;  4LJ7 A;  4NL4 H;  1V92 A;  1J5E M;  4FW9 A;  4LFC M;  5EP3 A;  2BWB A;  4GKJ M;  1EIJ A;  3KP0 E;  3Q8G A;  3U5Z A;  3GQ5 A;  3GLF E;  2VF7 A;  4A3V B;  2XGN A;  3FRH A;  2C96 A;  2V1C A;  2AHM A;  3CF2 A;  2LXE A;  3RE8 A;  3B7N A;  4ZPX A;  4B7F A;  2OQ4 A;  3HHW A;  2YNM D;  3B7Q A;  1OAI A;  1QYR A;  1H6U A;  2LVN C; 
#chains in the Genus database with same CATH homology
 1QAO A;  1J7K A;  1IBK M;  4M9S A;  1N36 M;  3NBI A;  2R62 A;  3R8F A;  1PJI A;  3CF6 E;  4QHT A;  3I51 A;  5C18 A;  1XMO M;  4IBF A;  1R2Z A;  3D8L A;  4BLC A;  3GPP A;  3UGJ A;  3L26 A;  4LGM A;  3GLH B;  1XXH B;  3ZH9 B;  4DR5 M;  2DVW B;  2C9O A;  1NHG C;  1XC8 A;  4IBD A;  4LGY A;  1DGG A;  4LFA M;  3ZC7 B;  2BJV A;  3Q8X A;  3K2L A;  2I7N A;  3VK8 A;  4FWH A;  1EE8 A;  5EXX A;  2HL7 A;  3HHX A;  5DYI A;  2EO2 A;  5LMN M;  4B3T M;  3SC3 A;  8CAT A;  1XNQ M;  3GRY A;  2X8A A;  3GPY A;  1R2Y A;  1PM5 A;  1L2C A;  2HHH M;  3FTD A;  5F3W A;  2FNA A;  2P5T A;  3KW6 A;  4QOZ C;  5GKN A;  4JYA M;  3SHF A;  4B3M M;  1JQJ C;  5EXS A;  2UXD M;  2QBY A;  1C1K A;  1N34 M;  4WW0 A;  2RGO A;  3FTC A;  3E9S A;  4I5S A;  1Z5A A;  4GIT A;  4W5W A;  3SHG B;  1IN8 A;  3J27 B;  2KRK A;  4NSO B;  1XWI A;  2C5R A;  5EJC A;  4DV1 M;  1K3W A;  4IBE A;  3GRV A;  3U6C A;  3VDU A;  1HNX M;  3FD9 A;  3TWL A;  4AI6 A;  3T1Y M;  4LJ5 A;  1HT1 E;  3U61 A;  5FLX S;  3MHV C;  4ITQ A;  2YFQ A;  5FTK A;  1KSF X;  2DWZ B;  1YSY A;  4X66 M;  1SXJ A;  3AKZ A;  4DUY M;  2CV1 A;  4JI6 M;  2L7I A;  2G8L A;  4D82 A;  3GLF B;  1QAQ A;  4LF7 M;  1GVN A;  1NY5 A;  4AZF A;  2KXE A;  4L4U A;  4DR7 M;  2Z4S A;  2X49 A;  4TUW A;  2F5Q A;  2C99 A;  2L7H A;  4YHH M;  3KVW A;  3AOE A;  2Y21 A;  4FD2 A;  1JR3 D;  1TDH A;  2CFO A;  5C1B A;  3A46 A;  2KZU A;  2XF3 A;  2F5S A;  5BPV A;  4DR3 M;  3K8Z A;  2FE8 A;  4IBC A;  3H4M A;  1KFV A;  1DO0 A;  3GLI B;  4B7G A;  1N75 A;  2DZN B;  2QPA A;  3U6O A;  4KLN A;  3WHL A;  3A98 B;  4IBI A;  4MM3 B;  3UMM A;  4DV4 M;  2ZM6 M;  4QOS A;  3U6M A;  1TH4 A;  4R7G A;  3W0L B;  1IN4 A;  5IT9 S;  4LRT A;  1K3X A;  4M9X A;  5EP2 A;  1NVM A;  1L2D A;  2ZAN A;  1IBM M;  1NJF A;  4IJF A;  2LH0 A;  4KOD A;  4X62 M;  4IIW A;  3JR5 A;  1SXJ E;  3DOA A;  2Y20 A;  1SXJ C;  4CHT B;  2JA2 A;  4IBJ A;  3ILK A;  3KOY E;  3TQS A;  4AQY M;  1IN7 A;  1IN6 A;  1MX0 A;  3PNV A;  4HL4 A;  3SAW A;  1G41 A;  3FTF A;  1N78 A;  3LVV A;  2R18 A;  1G8P A;  3RGP A;  3SAT A;  3AJI B;  1GKI A;  4JXJ A;  3GQ3 A;  4I4L A;  3AOE C;  3I4Y A;  3HJS A;  3T1H M;  5BR8 M;  2VII A;  3L28 A;  3KFU G;  2F4V M;  4GIP A;  7CAT A;  3MJ5 A;  4JN6 A;  4DR6 M;  1IXZ A;  3HWS A;  3PXG A;  3FTE A;  1E94 E;  3SYL A;  2CUZ A;  4JI0 M;  4OU7 A;  4G4Q A;  2FOI C;  4L78 A;  2X4A A;  4IBG A;  3GQ4 A;  4REZ A;  2UXB M;  4DV3 M;  2QZ4 A;  3PVS A;  4LJA A;  3A42 A;  3M6A A;  4DR2 M;  2XSZ D;  4FCW A;  4LRS A;  4LY6 A;  3HHZ A;  4RF0 A;  3SMP A;  4B3S M;  3L2A A;  4MH0 E;  1XNR M;  2I7P A;  4EIW A;  4DUZ M;  2QEN A;  4DV2 M;  2UU9 M;  3PNY A;  1QVR A;  4LF8 M;  1DGB A;  3HJQ A;  1IY0 A;  2F5O A;  4M0D A;  4NRV A;  5H37 D;  3OTO M;  2KRU A;  2R4E A;  4IBB A;  1NY6 A;  3KOW E;  4X64 M;  3W0F A;  2LWX A;  4I81 A;  4D81 A;  3L27 A;  3NWL A;  4M9Z A;  3GPX A;  1VDD A;  5FSW A;  3U6E A;  4G4N A;  1Q39 A;  3CF0 A;  1IN5 A;  4JI8 M;  4AG5 A;  4MGH A;  2VQE M;  4JI1 M;  3SMS A;  2OPF A;  1XXH A;  4LJ4 A;  1DGH B;  4LJ8 A;  4NXN M;  2R45 A;  1IY1 A;  3U6P A;  3U61 B;  4I8O A;  5IRE B;  4PDI A;  3SAS A;  2M60 A;  1OJL A;  4DV0 M;  4OW0 A;  1NJG A;  3KXE C;  1DO2 A;  1GL6 A;  4R3D A;  3J81 S;  4GC5 A;  4AKH A;  4HLQ A;  4LG2 A;  1Q3B A;  3VFD A;  3U6S A;  1ZQ9 A;  3EIH A;  4JI3 M;  3VKG A;  3U6D A;  1G3I A;  2CHV A;  1UM8 A;  2QCU A;  3SAV A;  1Z5B A;  3KS4 A;  3SAR A;  4PCZ A;  2L6O A;  1L1Z A;  4BBA A;  5FTJ A;  2XZU A;  2D7H A;  3VDP A;  3J7A S;  4CIS A;  2J7O A;  5ITX A;  2J7N A;  1NHW C;  2XH9 A;  2E5L M;  3LMM A;  5ITR A;  4Z6Y A;  4JI4 M;  3HKP A;  4XBO A;  2XEP A;  5ITY A;  5KPZ A;  3JR4 A;  1GL7 A;  3U6Q A;  3GLG A;  2L09 A;  3TWK A;  1HQY E;  4PT5 A;  4LF5 M;  1OFH A;  1WXQ A;  1Z5C A;  4LJ6 A;  4GRI A;  1E9S A;  1TH3 A;  4B7H A;  1W5T A;  1Q3C A;  3MK6 A;  3U60 A;  2C98 A;  2ERC A;  2F5P A;  2BJW A;  4B3R M;  4WUR A;  1ZAE A;  1JR3 A;  3RFW A;  4BB9 A;  1W5S A;  2EUC A;  4XGI A;  3TL4 X;  3SAU A;  1NNJ A;  2RGH A;  3UJN A;  4LF9 M;  4NSR A;  4OVZ A;  3GRR A;  4MGY E;  5EP1 A;  1L1T A;  4PDG A;  5KPR A;  3KOX E;  3C58 A;  3M7G A;  1X37 A;  4AKG A;  1FJG M;  3TE6 A;  3U5Z B;  3I4V A;  3CTW B;  1G4A E;  3M0E A;  2UUC M;  4NOO B;  4D80 A;  3VLF B;  4DR4 M;  4L16 A;  1HT2 E;  2K47 A;  5ITX E;  1IM2 A;  4LZJ A;  4DV6 M;  2FFJ A;  3GLI A;  4DV5 M;  2DHR A;  1NSF A;  4LJ9 A;  4LF4 M;  1Z6T A;  1QAM A;  1QZM A;  1Z59 A;  3ZCB B;  4GH9 A;  4OX9 M;  4K0K M;  2M5Z A;  2Z4R A;  3DA1 A;  3KDS E;  2CEA A;  3BOS A;  4P16 A;  3VK7 A;  3GP1 A;  3EIE A;  3WHK A;  3K1J A;  4MGI E;  1IQP A;  1D2N A;  2HKJ A;  4DR1 M;  1XHB A;  1IY2 A;  1YUB A;  1GLN A;  4X65 M;  4AKI A;  2YQZ A;  1R7R A;  4QHS A;  1J09 A;  1N33 M;  4G6Z A;  5EXP A;  4GMQ A;  3SYK A;  4JI7 M;  1LV7 A;  4QNR A;  3A45 A;  5ITT A;  1IXS B;  5ITQ A;  2Y0T A;  2D7E A;  2Z7J A;  4M0W A;  2HCB A;  4G4R A;  2DXI A;  5FTN A;  4Z8X A;  5KQ8 A;  5KPT A;  3IG5 A;  1HQC A;  3FUU A;  4PD2 A;  3GRU A;  1E9R A;  2CV0 A;  4YY3 M;  5ITU A;  3PFI A;  2DWL A;  1ORY B;  1FNN A;  2D7G A;  4GC9 A;  1HR0 M;  2KW0 A;  2XSZ A;  5FTL A;  1TH2 A;  3AFH A;  3T15 A;  2KZS A;  3SFZ A;  3FUV A;  3FKE A;  1MU5 A;  1DGF A;  2UUA M;  3HGI A;  2QBY B;  1K82 A;  2W82 A;  4MGZ E;  4JI5 M;  2NQ8 C;  3D8B A;  3HU2 A;  4GHL A;  3SBJ A;  3HU1 A;  4NRW A;  2UUB M;  2V6Z M;  2H1R A;  3GLH A;  2C9C A;  3J7B A;  2RKO A;  3IG8 A;  3R9X B;  3HHY A;  3KP1 E;  5DYG A;  3E4R A;  4GHA A;  2R65 A;  4II7 A;  3GPU A;  3FUW A;  5EXT A;  3UZU A;  3HJ8 A;  3LQR A;  4AW4 A;  1TGU A;  4RF1 A;  1SXJ B;  1HNW M;  3KS8 A;  2F5N A;  2UXC M;  4GKK M;  2R46 A;  4KO8 A;  3QWL A;  2KEB A;  2CHG A;  3J2P B;  2DWN A;  2CHQ A;  3LVW A;  5IWA M;  1TDZ A;  2BNK A;  1I94 M;  3AOG A;  3RGS A;  1L8Q A;  2CE7 A;  2XZF A;  2XFS A;  4FWG A;  1SXJ D;  5EP4 A;  3GLG B;  4B08 A;  2A5Y B;  5EQT A;  3TWM A;  4KHP M;  3DZD A;  1L2B A;  2CV2 A;  3KSX A;  3TPZ A;  1N32 M;  3QAU A;  1DGH A;  3K92 A;  3T38 A;  1S3S A;  3U60 B;  4FWD A;  4RNA A;  3DFZ A;  2Z3X A;  2ZBK B;  2KA6 B;  3J80 S;  5KO3 A;  3VKH A;  1IXR C;  4L8R C;  3FYC A;  2V1U A;  1E32 A;  5LMU M;  1G59 A;  1N77 A;  3THG A;  2YR0 A;  5A2Q S;  2ZAO A;  4OVZ B;  3KOZ E;  1HNZ M;  2EA0 A;  4LFB M;  2DZO B;  4MB7 A;  1PJJ A;  4LZZ A;  4G4O A;  2Q2E B;  3GLF A;  4IBK A;  3L25 A;  1OFI A;  4CGY B;  4FCT A;  2XLJ A;  1IBL M;  3L29 A;  2G5G X;  3FYD A;  1T3T A;  4LF6 M;  1NNU C;  2R4J A;  3HU3 A;  3UK6 A;  4JI2 M;  4AG6 A;  2XFT A;  5JI2 E;  5IZ7 D;  3FUT A;  3U6L A;  4NXM M;  2QP9 X;  1QAN A;  3AV0 A;  2DWM A;  4JV5 M;  4L15 A;  3LQQ A;  5DNY A;  3AL0 C;  4MGK E;  2LNH C;  5E6J A;  5FTM A;  1R6B X;  1I4W A;  4FCV A;  5KQD A;  4QNM A;  2Y0Q A;  4S12 A;  3GO8 A;  4DV7 M;  1YE9 A;  5JI3 E;  1KYI A;  1XMQ M;  2VQF M;  2ZAM A;  5E26 A;  3KSJ A;  3JAM S;  3FUX A;  2O5R A;  1QQW A;  4FVM A;  4IJE A;  4NL4 H;  3B9P A;  4LJ7 A;  4LFC M;  4LCB A;  1J5E M;  4FW9 A;  5EP3 A;  4GKJ M;  3KP0 E;  3U5Z A;  3GQ5 A;  4A3V B;  2XGN A;  2C96 A;  2V1C A;  2AHM A;  3CF2 A;  2LXE A;  3RE8 A;  4ZPX A;  4B7F A;  2OQ4 A;  3HHW A;  2YNM D;  1QYR A;  1H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...