2UUAQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaQ00
1L1OC 3KFUA 3I4MH 4GKJL 4A93G 4DV4Q 2F4VL 1P8LA 1XMQQ 1VQNA 4DV2L 4X66L 3HOVG 4JC0A 5IWAQ 2R7ZH 4DR4Q 2B63H 2AKWB 5JJKA 1YJWA 2VQFQ 1EWIA 3H0GH 4R4QA 4R4TA 3FP9A 3CCSA 1VQ5A 4X6AH 3GTMH 1HJPA 4DK6C 2NVTH 3FKIH 1X9NA 3EBEA 4YHHQ 1VQFA 4PMWA 5BR8Q 1BBWA 5FLMG 1R9TH 1KQSA 2BH2A 2VW9A 1EYGA 3AEVA 2OTJA 1EIFA 1X3GA 4BY1G 5K36G 3S1NH 2D0OA 2NN6G 4A3FG 1GM5A 2JA7H 4H02A 1YHQA 4IPCA 3HFZB 4A3JH 2K75A 3RN2A 1PHJA 1CKOA 2ZJPA 4JI5L 1TXYA 3AQQA 4A3MG 4UP8A 4GLAC 1LUZA 2NZHA 1Q7YC 1TWGH 2N8NA 5IY0A 1VQ7A 3BU2A 4UP9A 4MTNA 2YTVA 5H1SE 5LMUQ 1CSQA 2D0PA 4DUZQ 1IBKQ 1K73C 3GTPH 3OW2A 4DV1Q 2E5LQ 2WB1G 1QVCA 5M5XH 4Y7NH 4LF4Q 1B7YB 4HJ8A 3GTQH 4GLXA 4IFDI 4DUYL 3J81i 4B3ML 3KJOA 4MNOA 2R7DA 4A3GG 3HKZG 1EQQA 1YHAA 4TQUS 1M90C 1MKHA 3A5ZB 3SGIA 3WWVA 4A3BH 2L15A 2QGQA 4DR2Q 2I5LX 3AFPA 2YU9H 1XNQL 4C3IH 3BZKA 2NVQH 1V9PA 1A63A 3NBHB 2BH8A 5C3EG 3S17H 1YEZA 1UE7A 2OQKA 3CW2C 4LWCA 4HIOA 2KHJA 1N34Q 2UUCQ 1YITA 2HHHQ 2D62A 3JAMi 5JEAG 2WB1E 3HOWH 3PIPA 1HR0L 4GOPB 4IPGA 4JI7L 1IL2A 3HOXH 3KJPA 1Y1WH 1Q82C 1LYLA 2JQOA 4JI8Q 1IBLQ 2CWAA 2JA6H 4Y52H 3S1MH 4P73A 4A3CH 1VQDA 3M4PA 2CWPA 3HKZE 4J15A 4OXPA 2JEBI 4BY7G 4DV2Q 4X66Q 1TWCH 4YCWA 1N8RC 4GN4B 4B3SL 4OX9L 1KAWA 3STBD 1Y14B 2MO1A 3RR5A 4R4OA 3TS0A 4OO1G 1VQIA 5C0XJ 1WYDA 3CMEA 3L7ZC 1L0WA 2JA8H 3HOUH 4UP7A 2EXDA 3JC66 2VY3A 3EIVA 3CCEA 3H15A 1VQPA 4UY8C 5GROA 1MJCA 3PCOB 5HY6A 4A3LG 4C2MH 5DLQE 1HZ9A 1DGSA 2ZTEA 3KDFA 1WCMH 4K0KL 3HOZG 4LUOA 1YNXA 3KF6A 2QA4A 3NEMA 3OTOL 4LF5L 2ASBA 1G291 2R92G 4BA2I 5M3MH 1E3PA 4GN5A 3F2DA 4HIDA 3UDXA 4DR3L 1YZ6A 2IX0A 4A93H 4NPSA 3L2PA 4IJLA 4P75A 4JI3L 1Q1EA 4DUYQ 1JMCA 4JV5L 1X3FA 4LUZA 4QL5A 5IP7G 2HQLA 2Q2HA 2YYZA 3I2ZA 4AIMA 3S1QH 2YV5A 3LGJA 4X65Q 4JG2A 4KHPL 4BBSH 4YCVA 1Y1VH 4RG1A 1YVCA 3RLOA 3UDGA 4AQYL 5IP9H 3M7NA 4A3EH 1QUQB 3ULLA 5FLMH 1AE2A 1XNQQ 3RZOH 2NVXH 1J5EL 3FHWA 3DM3A 4BY1H 5J3BA 4L5SA 1KD1C 4A3FH 4L5RC 1KL9A 2Z0SA 2JEAI 4R4IA 2N49A 3DLLA 4QGUA 4A3DG 2UU9Q 4LF6L 3CPWA 3KYHC 2HIXA 1PV4A 1HZCA 1EFWA 4DV7L 3KLWA 4L5QA 4NXML 2ZTDA 4DV6L 4A3IG 2VQEL 3BJUA 4A3MH 2LXJA 4YWLA 2AWOA 2CCZA 4LF9L 4DR7L 1VS0A 1K3RA 5IYDG 4A3KG 1SFOH 4JI6L 5IYCG 3CF5A 2GN5A 4OX9Q 4B3SQ 4NXNL 4OO1I 2PQAB 1Q8KA 3H3VI 2IY5B 2IT1A 1I94L 5AJ3L 1KC8C 1OXTA 1HNZL 2I5HA 1AH9A 4KHZA 3GTGH 2UUAL 5FJ8G 3CCUA 4YWKA 1N36L 4OONA 2KENA 2F3IA 3J7ZC 3PIOA 1VQHA 2RHSB 2YTXA 1C0AA 4JI2Q 1K83H 1KRSA 3M85A 3PO2G 4GNXC 1W3SA 1OXUA 4LFAL 2R93H 3CCQA 1WI5A 3UE0A 2VL6A 1Q81C 1E1TA 5M3FH 4XIGS 4IPDA 2E2JH 4DV3Q 2UXCL 3J81j 1C7YA 4LF5Q 1JT8A 2AHOB 3MXNB 4DR6Q 1XMOL 1X54A 3M9BA 3U58A 1V1QA 2MNAA 3RN5A 4GNXB 2WFWA 3B6YA 1XTDA 5ELOA 1RIPA 3M4QA 4HJ9A 1PH3A 3AFQA 1FJGL 2ID0A 4DR3Q 3CMAA 2ZJQA 1Q1BA 3PO3H 4LFBL 2JA5H 3W1BA 1IYJB 4A4IA 3F2CA 2OWOA 1EOVA 5C4XH 4JI3Q 2KBNA 4O0AA 1YHBA 2IHEA 4JV5Q 5M5YH 1EUJA 1D8LA 3I55A 4KHPQ 4A76A 5IYBH 3H3VH 2RHQB 4GOPC 1JJ2A 1CKNA 4B3TL 4WJ3M 1UEBA 1Q12A 5GQOA 1W2BA 4BXXG 5C44H 1J5EQ 4PG3A 2NZOA 3KF8B 1PH1A 4WJ4A 1XPOA 3I4MG 2A1AA 1HR0W 1Q46A 1HZAA 1PH4A 4LF6Q 2K5HA 1PYSB 2CFMA 2UUBL 1MJEA 4DV7Q 2R7ZG 2LXKA 4NXMQ 4IFDJ 1XPUA 4DR5L 2VQEQ 3H0GG 2E8GA 1YJNA 5FLXc 3EN2A 4JBWA 3CC2A 1S3OA 2H5XA 4GKJQ 2V1CC 4JYAL 2VUMG 2VS1A 2Q2IA 2Z6KA 2F4VQ 1HNWQ 4PZ6A 3AYHB 1Z9FA 1I94Q 3GO5A 1JB7A 5AJ3Q 1K8GA 4C3HH 2WAQG 1B8AA 1B70B 3Q8DA 4LUVA 5LMNL 3GTLH 1L1OA 5JJLA 1VQLA 1TWFH 3M3YH 3UE1A 5IP7H 3CC7A 1I6HH 2N3SA 1MIUA 3GTKH 2PI2A 4JI1L 2NN6I 4QIWE 3A0JA 1X65A 1P16A 4JBJA 2Q2TA 1PVOA 1NMFA 1GD7A 3U4VA 2UU9L 2XTIA 1WOCA 3RLFA 4JI5Q 1OXVA 3S16H 3PF4A 3M4OH 1XMOQ 1K8AC 1EQRA 2OTLA 1XMQL 4LF7L 1VQAA 1XNRL 4DR4L 2WAQE 5M5WH 3T1HL 3A5UA 1KXLA 1M1KC 3RNUA 1N32L 3TREA 1VQJA 4IOCA 4YHHL 1SMXA 4JCVE 4A3KH 4IPHA 4BBRG 3GDEA 1QVGA 1ASYA 2K50A 3L0OA 4GN3B 2EIFA 3NELA 3D0FA 4B3MQ 1CSPA 3HOVH 2PMZE 1VQ6A 4B3TQ 3HOWG 3U50C 2GVAA 3ULJA 1NJIC 1H95A 3CD6A 4B3RL 2K52A 3CPFA 2ATWA 2UXBL 4HJ5A 1Y1WG 2I5MX 3PUVA 4IOAA 1FL0A 2K4KA 4A3CG 4NB3A 1VQ8A 1SN8A 5IE8A 1O7IA 3J7A5 1VQKA 2OCEA 1S72A 1QZHA 3I4NG 2F52A 4DAMA 4GOPA 4DUZL 4JOIC 5C4JH 2UUBQ 1HR0Q 2K5NA 3S24A 1IBKL 4JI7Q 1GO3E 1HH2P 1LM0A 4FDBA 3STBC 4DV1L 1PH2A 2E5LL 1JJGA 5GADC 3PGZA 4LF4L 4HIMA 1X55A 3HOUG 4YCUA 4UPAA 4XTCS 2PNHA 3A74A 4JYAQ 4HIKA 3ICEA 4IO9A 3S2DH 4O2DA 3CC4A 2FXQA 2HIVA 2WP8J 1PH5A 5JEAJ 1A0IA 3K7UC 1X56A 5LMNQ 4LF8L 2A8VA 2MQHA 3F1ZA 4DPGA 1I3QH 3GTJH 2YTYA 3F2BA 3OYYA 1EIYB 3T1YL 1VQCA 2UUCL 3TRZA 2BA1A 1I5FA 3D31A 4DNIA 4HJAA 1N34L 1U0LA 1KHIA 4A3GH 4ME3A 4QQBX 1IXRA 3HOYG 5C0XG 2DGYA 1N33L 4YY3L 4JI0L 4BXXH 1CKMA 1VQ9A 4JI8L 1XPRA 4JBMA 4R4CA 4PZ7A 1JE5A 2RF4A 3U4ZA 5C3EH 1X3EA 1BKBA 4K0KQ 2KCMA 1IBML 1TWHH 3OTOQ 4LF7Q 1GVPA 2JK8A 1XNRQ 1VQEA 4TVAB 2R7FA 3T1HQ 1SROA 3ZJYC 4OWXB 1PH8A 1N32Q 4X62L 2MO0A 4DR1L 4BBSG 1Y1VG 2A19A 3PUWA 2N78A 4L5TA 4POFA 3CP0A 5IP9G 1L1OB 4A3EG 4GS3A 3PF5A 2ZTCA 1E22A 1VCIA 1X6OA 5HGQA 4DV5L 3RZDH 2VUMH 4BY7H 1BVSA 1SRUA 1NMGA 4LFCL 1FVIA 3E0EA 1IZ6A 3ERSX 3CCRA 3GD7A 3PUYA 2UXDL 4B3RQ 1YJ9A 2QEXA 1QUQA 2UXBQ 1WJJA 5ELNA 4AQYQ 3W1GA 4OWWB 1KRTA 3KDFB 4EQ5A 1ASZA 1NTGA 3F8TA 3I7FA 3KF6B 2XGTA 4AYBG 3TQYA 1D7QA 1BBUA 1SLJA 3CCJA 1VQBA 1HNXL 2ZJRA 1RL2A 3GTOH 3S15H 4A3LH 1JJCB 4HJ7A 1S40A 2B63G 4DV6Q 1NE3A 2ES2A 3PV0A 1TWAH 1PH7A 3G48A 3HOZH 4GKKL 1T9HA 3E9HA 3G4SA 5EAYA 4POGA 2R92H 3FKIG 2JE6I 3ER0A 4X64L 4P74A 4LF9Q 4JI6Q 4DR7Q 1CUKA 3HKSA 1PFSA 4JOIA 2I0QA 4X65L 2CKZB 2PQAA 5IT9c 3KOJA 1HZBA 2E2HH 4NXNQ 3W5OA 5LMNW 2R93G 3TEHB 1I50H 2JA9A 2Y0SG 4LF8Q 2JA7G 1K9MC 1HNZQ 3IRBA 3E9IA 2UUAQ 4A3JG 3I56A 3G6EA 4BBRH 3T1YQ 5M3FG 4AYBE 1N36Q 4AH6A 3K8AA 3K80C 5C0XI 1NBWA 1Q86C 1A62A 3PSIA 1E7ZA 4PZ8A 3S1RH 1A8VA 5JJIA 1N33Q 4YY3Q 3G71A 4DV0L 4LFAQ 4JI0Q 1XJVA 4JI4L 4JBKA 1E1OA 2ZM6L 5GAHC 3PO3G 2JA5G 3NENA 3S14H 2LSSA 2NVYH 1YIJA 1IBMQ 3S2HH 3I4NH 2UXCQ 5C4XG 2VZAA 3J80c 4DV4L 4A3DH 2Y0SE 1N9WA 3CQZH 3PUXA 4MZ9A 4GNXA 5IWAL 2CQOA 4X62Q 2K5VA 4DR1Q 4A3IH 5IYBG 1J6QA 1V43A 4QY7A 1FJGQ 2VQFL 2VNUD 3CCLA 1OXSC 4LFBQ 2EQSA 1YI2A 4A3BG 2OQ0A 5C44G 4DV5Q 1K0RA 5IYDH 4KLKA 4RMFA 5IYCH 5BR8L 4C3JH 1HNWL 2AWNA 4LFCQ 4OWTB 4JI2L 4LW1A 3CXCA 2PI2E 1VQGA 1PH6A 1VQ4A 1L2FA 4APVA 2BA0A 1VQOA 5E7NA 3BZCA 5GAGC 5FJ8H 1OXXK 1PYBA 1PA6A 3UDIA 3HOXG 1G6PA 4DV3L 4DR6L 2JA6G 2AMCB 3HOYH 4IJHA 4P71A 3PO2H 4YWMA 1SE8A 1HNXQ 3UDFA 1GKHA 1FGUA 2K14A 3CAMA 5LMUL 4DKAC 3MEFA 4DR5Q 4GKKQ 1E24A 4GLVB 3K81C 4R1JA 3RLNA 2JJQA 1SR3A 2RCNA 2B29A 4LNQA 3PUZA 2Q2UA 4X64Q 2E2IH 2JA8G 2UXDQ 2IHFA 4EX5A 1C9OA 1UWVA 4DK3C 1QZGA 2ALYB 2MFIA 2R6GA 1WFQA 2KHIA 4IFDG 1YBYA 1QVFA 3K7AH 1UE5A 1VQMA 3I4OA 2C35B 4DAYB 1CKNB 1OTCA 3J81c 1AE3A 4DR2L 4ALPA 1UE1A 1KIXA 3TS2A 4A75A 1PH9A 3K0XA 3CCVA 1WCMG 4QJFA 1LTLA 2GVBA 1UE6A 2B3GA 1Z47A 4JI1Q 5GAEC 3CCMA 2Z6KC 2HHHL 2IX1A 4DV0Q 4JI4Q 5M3MG 2ZM6Q 1NY4A 4KI0A 4P72A 2KCTA 3J80i 1U5KA 3ULPA 3VDYA 4BA1I 3JAMc 2HT1A 1IBLL 2DUDA 1G51A
chains in the Genus database with same CATH superfamily
1SE4A 3SK5A 1W6JA 3A56A 4GKJL 4DV4Q 3RD4A 4X66L 1EYDA 4DR4Q 1JB3A 2AKWB 1TU2B 5M3FB 3A54A 3H0GH 4R4QA 3SK8A 1S4ZA 5DNFA 2Q8IB 4DK6C 3EBEA 4PMWA 5BR8Q 1BBWA 1S5BD 3AEVA 4BY1G 4FF4A 5K36G 2NN6G 2WIIB 2JA7H 4DNTB 1YHQA 1CT1D 1F77A 1SDFA 1KDCA 2K75A 3RN2A 1PHJA 1SBBB 1TS3A 2XIWA 3TDQA 1KTKA 1II3A 2AQ1B 5E3FA 2I46A 1TWGH 2BOSA 3BU2A 4DUZQ 3CHBD 5G3LD 3GTPH 2D0PA 2RA4A 4LK1C 1K73C 1AZQA 3KBXA 1QVCA 4M8AA 3H91A 1SYDA 2WKDA 4HJ8A 3GTQH 4GLXA 4IFDI 1I4HA 4DUYL 1H9JA 1EQQA 1MKHA 2QGQA 2NVQH 2DNCA 3BZKA 2BH8A 1YEZA 1UE7A 2UUCQ 1N34Q 1SYFA 3A8IE 2D62A 3JAMi 2WB1E 4MIUA 3HOXH 3HRZC 5BN4A 3KJPA 1I6HB 4QB4A 4TKOB 4JI8Q 1Q82C 1BO0A 2F0LA 3M4PA 1JWSD 1WTRA 4JVZA 4OX9L 3STBD 1Y14B 2MO1A 3RR5A 4OO1G 3C46A 1VQIA 4JW0A 3M4OB 3HOUH 1TT2A 2HD3A 3JC66 4H44C 3OIQA 4A3IB 4OGQC 4U673 1B44D 3PCOB 2XWJB 3NQTA 4A3LG 4ME5A 4DN4M 4HMJA 4KD3A 2ZTEA 1HFGA 1XXGA 3NEMA 4Q0FA 1G291 4BA2I 4IZ8A 2CH4A 2QW7A 3ITPA 4GN5A 4X3SA 5ELDA 2QEJC 3DUZA 2IWHA 4PMBA 1VDZA 4DR3L 1YZ6A 4U68A 3TBIB 1A3VA 1SE3A 4DNRB 5IGGA 3L2PA 4KK7A 1JE4A 1BCPB 5C4JB 3S1QH 1EY6A 2YV5A 4X65Q 1DD2A 1Y69U 1Y1VH 3J81E 4AQYL 5EPKA 3M7NA 3QG1A 3ULLA 1AE2A 3K6OA 4HAEA 5I9PA 5FKAC 3FHWA 5KNBA 3DM3A 2EVBA 1X3PA 2XNAC 4A3FH 1JWUD 2OT2A 4L5RC 1DOLA 3VYRA 4R4IA 2N49A 4A3DG 4LF6L 1SNDA 2O5IC 3HS0C 3BJUA 1EU3A 4A3MH 3EVQA 4YWLA 2K5DA 1LTAD 1SFOH 4JI6L 4JPBW 4C3JG 1MD2D 4KY5A 2B2TA 1Q8KA 2AUKA 2IT1A 1AH9A 1HNZL 2JXMB 4KHZA 3GTGH 2UUAL 3CCUA 1N36L 2KENA 3PIOA 2G9HD 2YTXA 1C0AA 2K7VA 1KRSA 4GNXC 5E4WC 2HT1A 4XQNA 3SXHA 2VUMB 3ZYYX 3DEPA 2E2JH 2UXCL 3R3OA 5JEAH 1PTOB 2WAQB 1X54A 1V1QA 1LT4D 4G57A 3NXWA 4C56C 4J8QA 2WFWA 5ELOA 2MNAA 4HJ9A 1RIPA 3RN5A 1FJGL 3CMAA 2JA5H 3W1BA 3LWUA 2OWOA 2KBNA 3KLRA 4O0AA 5KYLA 1YHBA 4OHJA 3S15B 2B2UA 3URYA 4KKTA 4CHTB 4A76A 3BZDB 3H3VH 3T53B 1JJ2A 1QG7A 1CK1A 1STGA 1UEBA 2B2WA 4RFBA 3BDCA 1EQTA 1MSGA 2A6EC 1PH1A 1TY0A 2E2HB 1LTSD 3T13A 1I50B 3I70A 2K5HA 2E75C 2RCFA 3VYUA 4E6IA 5KRUA 4DV7Q 4NXMQ 1LLRD 4QUCA 4ZUIA 1KDAA 2VQEQ 3H0GG 2Q8TA 1KLUD 1SNPA 5FLXc 1HTPA 3K57A 1CHPD 2KHSA 2V1CC 4JYAL 4UDUC 4QF4A 1FYCA 2F4VQ 4PZ6A 5AJ3Q 4C3HH 3S2HB 1SJHD 1L1OA 2NB0A 5CC4A 1TWFH 3NTKA 3UE1A 2XSCA 3CQZB 5IP7H 2PZUA 2NN6I 1STEA 1X65A 1WTOA 2Q2TA 2IPKD 4J6HA 1VF7A 1NMFA 3I90A 2CHBD 2XTIA 1LTRD 4TSSA 5CBAE 3S16H 1GUGA 1PDQA 1XMOQ 4B9XA 1TR5A 1UEAB 3E5SA 4LF7L 1XNRL 4DR4L 2WAQE 3SK4A 1I4GA 3QB3A 3TREA 3E3XA 1BF4A 3T56B 3K5OA 2JSOA 1GOZA 2M2LA 4IPHA 4BBRG 1NR4A 4MN3A 3HOVH 3L0OA 2VNUD 2NBFA 1VQ6A 5C5MA 4FF3A 3U50C 1EEID 4B3RL 2ATWA 3KBGA 4RGMA 1FNUA 5JVH3 1VQ8A 3K7AB 1O7IA 2H4OA 3I4NG 1QZHA 4GOPA 1ILQA 4DUZL 1HR0Q 4K5VA 3S24A 4JI7Q 4FDBA 4CBVA 3DM1A 3I73A 5GADC 1L0YB 2F4IA 4OEMB 2A74C 2EYMA 1HUNA 1X55A 2L5TA 3KUPA 3HOUG 3GV6A 1PLFA 3A74A 1ILPA 4IO9A 1DXMA 1U4RA 3S2DH 4GZYC 3FPUB 1IHZA 2FXQA 1O80A 3S1NB 1H9RA 1G91A 1X56A 2A8VA 2MQHA 4DPGA 4AYBB 2YTYA 5COYA 2UUCL 2R7ZB 1N34L 2XN9C 3D31A 4QQBX 3KLSA 4LJZC 1PRTF 4YY3L 1B4OA 4RCNA 2A6ED 4JI8L 4FP5D 2LS01 4PZ7A 4XXEA 3VR3A 2Y0SB 1W6KA 3SDZA 4TVAB 2HCCA 1SROA 3AU7A 4R8IA 1Y1VG 3S9WA 3PUWA 4L5TA 1OO9B 2F0NA 1JR0D 3LNNA 2ZTCA 1VCIA 4KY7A 2RDFA 4BY7H 1BVSA 1SRUA 2JN4A 4LFCL 1AP0A 3PO3B 3MXPA 3GD7A 3OWEB 2QEXA 4OWWB 3U9SA 3F8TA 1LT5D 3KF6B 3Q0AA 1BBUA 2F0GA 4A3BB 1H9SB 1JWMD 4N9PA 2NTSA 2B63G 4DV6Q 3S17B 3G48A 3HOZH 1T9HA 3E9HA 3FKIG 4DR7Q 1CUKA 3HKSA 4X65L 2CKZB 2PQAA 4IALA 1HZBA 3G6JB 1K9MC 5I2YA 3E9IA 3MFYA 4A3JG 3I56A 3G6EA 4N8FA 3T1YQ 4AYBE 1A2UA 2A6HC 3D3RA 5C0XI 1NBWA 1E7ZA 1YNJD 3FDTA 5LL6X 4JBKA 4DV0L 4LFAQ 3SE0A 2B2YA 3NBIA 2JA5G 3S14H 3MXNA 1I4QA 2VZAA 4I65A 5L37A 2VXWA 2Y0SE 5EKIA 1N9WA 1WCMB 3RUZA 3NP8A 1Y8OB 3V96A 4DK1A 4ZYSA 1YI2A 2OQ0A 5IYCH 4EQNA 4HSVA 1CQFA 3T51B 1LTGD 1VQOA 4X3KA 4UHVA 2QCPX 1C4QA 5FJ8H 4CDCC 3KF8A 3VR2A 4K5XA 2JA6G 2PQEA 2K6AA 2B2UC 4YWMA 1SE8A 2MHVA 3NPPA 3UDFA 2KEDA 1FGUA 5EJWA 5LMUL 4O42A 4DR5Q 2B2WC 2LMCB 4BY1B 3K81C 2AUJD 2E2IH 2JA8G 1PXUA 1O7LA 4DK3C 2MFIA 4IFDG 1WFQA 5ELCA 1JQYD 3FEWX 1AE3A 4DR2L 1UE1A 1GJXA 4F88A 1PH9A 3K0XA 2K1BA 5JOBA 1UE6A 3RMHA 2B3GA 4JI1Q 4RH6A 2IX1A 5M3MG 5DAUA 2KCTA 3GQBA 1IBLL 2DUDA 1L1OC 3KFUA 1PZID 4P2CB 4X3TA 4A93G 3J7AF 1B9MA 4H13C 2F4VL 1SE2A 1XMQQ 4DV2L 3HOVG 1QNKA 5IWAQ 3SK6A 1YJWA 2VQFQ 1EWIA 4OL7A 5T1IA 4X6AH 2NZ1D 1HJPA 2A68C 3IKJA 1HUMA 2Z8LA 1YNNC 1VQFA 5FLMG 1R9TH 2IW3A 2BH2A 3TP5A 1EYGA 1I4PA 1ENCA 5JPNC 1EIFA 1GM5A 2KOLA 1B3QA 1IL8A 5DEHA 1MSHA 3ERQA 4IPCA 1DM0B 2A6HD 1IYVA 3AQQA 2SDFA 4UP8A 4GLAC 2NZHA 2KA7A 5KNCA 5IY0A 1VQ7A 4UP9A 4MTNA 1CSQA 5C44B 1Z7TA 1M4VA 5M5XH 4Y7NH 3CRKC 3QOLA 1U9RA 3SHLA 5JJZA 3KJOA 1EU4A 2PO4A 2C9OA 3AFPA 1XNQL 1T5EA 2K01A 1A63A 2F0MA 3F2UA 2OQKA 2RBMA 2KHJA 4XYOA 2HHHQ 5D3DA 3L3OC 4K2KA 1HR0L 1AZPA 4IPGA 4JI7L 1IL2A 4I7ZC 3M3YB 1Y1WH 1LYLA 1E2VA 3V2TA 3GTKB 4P73A 1EWHA 5HURA 3S1RB 4A3CH 1PRTC 3J80E 4J15A 4BY7G 3OPOA 4K8IA 4HMIA 4GN4B 4B3SL 1V1PB 1SNQA 4R4OA 4KKUA 4JK1C 1EFID 2CW0D 1WYDA 3CMEA 3L7ZC 3TSSA 4IUNA 3KK7A 4HR7B 2EXDA 2VY3A 5EQ0A 5FLXL 2J4XA 1QOHA 2NYZD 3KDFA 3HOZG 3K5MA 3D6CA 2Z4IA 2ASBA 3A8KE 4H7BA 4NPSA 4P75A 4JI3L 4LAAA 1Q1EA 1JMCA 2ZXPA 4LUZA 4QL5A 2BDOA 4KN4C 2MP1A 2OF1A 2A68D 2QILA 2WV6D 1DJRD 4KHPL 1O7ZA 1YVCA 3C1EA 4WJWA 3MXGA 3RZOH 1J5EL 1ML0D 5J3BA 1H9MA 1KL9A 3DLLA 3OOCA 4QGUA 3I4LA 3C2PA 2WKCA 1I3QB 1EFWA 4L5QA 1A6XA 2ZTDA 4DV6L 2F0PA 2D5DA 4XQQA 4DR7L 4A3KG 1RODA 5IYCG 2GN5A 3HGBA 1X3QA 3H3VI 1I6VC 5C3EB 1XX8A 2B2YC 4RKLA 3BG3A 5FJ8G 3P1HA 4YWKA 4RKBA 4ZK9B 2R3ZA 3J7ZC 2OXPA 4JI2Q 3M85A 1J9OA 1W3SA 4LFAL 1Q81C 3RZDB 5M3FH 3C3LA 4XIGS 1TQOA 1RD9D 4DV3Q 3J81j 3H6MA 4LF5Q 4DR6Q 2EYPA 2LFNA 2MJ8A 1UNSA 1PH3A 2ID0A 2ZJQA 1PRTD 2G5DA 1IYJB 1IW7C 3K0YA 3QIAA 5CYUA 1EOTA 1I4RA 4K5WA 4JV5Q 2DY8A 3GTOB 1EUJA 3BYTB 1D8LA 3CRLC 3K5NA 1TWAB 2RHQB 1CKNA 2DY7A 4NP5A 4CJ0B 1Q12A 4QUFA 5GQOA 2R92B 4BXXG 2L0CA 4ILWA 3DXJC 4PQXA 5I4DA 1Q46A 2F0EA 3KLSX 1XPUA 4BBRB 4DR5L 1BUVT 2E8GA 4JBWA 2H5XA 5ELEA 2L55A 4KTAA 3TP8A 3AYHB 1I94Q 1JB7A 1WD1A 3DWAA 1B70B 3Q8DA 5LMNL 3I4NB 5JJLA 1VQLA 3CC7A 1I6HH 3EJIA 2Z6BA 5CV8A 4JI1L 2V4DA 4JBJA 2WINB 1B1ZA 1SAPA 4BWGB 3RLFA 4JI5Q 4CKEA 5DM63 3M4OH 1EQRA 2X6GA 4EQOA 1XMQL 1Q90A 4QMGA 3IFDA 3A5UA 2EYOA 3RNUA 2A69C 3PO2B 4G7HC 2PNRC 5CGKA 2EIFA 1A3UA 4B3MQ 2HDMA 1CSPA 4ZUJA 1WTQA 3K58A 1SYCA 4B3TQ 1H95A 3ULJA 2O4XA 1FD7D 4RAUC 1Y1WG 3PUVA 4ABNA 4IOAA 4A3CG 1G8ZD 1SN8A 5IE8A 5T1GA 2F52A 4DAMA 2UUBQ 2IX3A 4JOIC 5C4JH 2FHTA 3U9OA 1GO3E 2AQ3B 1CM9A 1H9KA 1NUCA 1K8MA 4HIKA 2CVRA 5D14A 1LV9A 3CC4A 1IW7D 2B8GA 4LF8L 3I4MB 1HA6A 3F2BA 3OYYA 1EIYB 1RDPD 2EY5A 2QF7A 5J22A 1I4XA 1I5FA 4DNIA 2B63B 1U0LA 2LY7A 4DXFA 4ME3A 2XWBB 2KQ3A 1IXRA 3HOYG 5C0XG 3GTMB 2DGYA 1N33L 2NVTB 3FKIB 1SYBA 1XPRA 4JBMA 3OHXC 1IBML 1GVPA 5IOCA 2F0WA 4A3JB 3T1HQ 1WD0A 1N32Q 5BN5A 2N78A 4CDDC 2GA4B 3MAQA 1L1OB 1G2SA 4GS3A 2EZVA 2VUMH 5HGQA 1E0BA 1NMGA 3ERSX 4Z9CB 1PTOH 4DAYA 2N88A 1BXTA 2UXBQ 2NTTA 4BS9A 1KRTA 2EY2A 1GUSA 4K14A 4EQ5A 1NTGA 5A2QL 3I7FA 1SEBD 2O2LD 1EY5A 3TQYA 1SLJA 3CCJA 3S15H 2ZJRA 1RL2A 4C3IB 1JJCB 2KUMA 1NE3A 2ES2A 1PH7A 4FNFA 4GKKL 5BN3A 2F0TA 3BVGA 4KJNA 4FXDA 2JE6I 3ER0A 4LF9Q 3HOWB 2UXDL 1JJGA 1PFSA 4XT3B 3KOJA 2E2HH 4NXNQ 3W5OA 5CBEE 4L6TB 2JA6B 2A69D 2JA7G 1I50H 3S1MB 4HCEA 3IRBA 3HZXA 5M3FG 2EY1A 3FVQA 1TWCB 4AH6A 1EZ8A 3PSIA 1A8VA 3G71A 4JI0Q 2JA8B 5CR3A 2ZM6L 1B9NA 1KDBA 2LSSA 5IT9L 3S2HH 4DV4L 4C2MB 3CQZH 4S3SA 4X62Q 4DR1Q 1V43A 2K33A 1OXSC 4RGOS 4LFBQ 2EQSA 1PRTB 4DV5Q 1X32A 5M3MB 5IYDH 3K5LA 3GV3A 5BR8L 4FVMA 4OWTB 4JI2L 3CXCA 1VQGA 1PH6A 1L2FA 4APVA 4A93B 5E7NA 5GAGC 3MZ5A 1LO5D 1OXXK 2L1BA 3HG9A 1PA6A 2XRSD 3HOXG 4B9WA 4DV3L 4N8X1 5IGBA 4DR6L 2N55A 3CKIB 4BBSB 4P71A 4G7OC 1HNXQ 1GKHA 4A3EB 1F9RA 3CAMA 1Y8PB 2NVXB 2XVSA 3MEFA 1RF2D 4GLVB 1RJTA 5CMDA 1SR3A 2RCNA 4LNQA 2Q2UA 4X64Q 1STAA 1E2ZA 1QCBD 1UWVA 4RA8A 2ALYB 4EX5A 4ZCKA 3OWFA 1NNXA 1YBYA 1QVFA 3K7AH 1VQMA 3I4OA 1OTCA 3J81c 3IAYA 1KIXA 2PZWA 3TS2A 4A75A 3WOFA 1DONA 5EPJA 3A7LA 1LTBD 1L0XB 3CCMA 2J0TD 4QCLA 4JI4Q 3TN2A 1ZEQX 1QJOA 3R2TA 4V0BA 5FK9C 4DF7A 5F2DA 3S1NH 2UU9Q 1RHPA 1W2BA 1K83B 4NDXA 2R93B 5A2QE 1P8LA 1VQNA 4JC0A 2R7ZH 3G7LA 5JJKA 3I91A 4R4TA 3CCSA 3FP9A 1TKWB 1VQ5A 1SYEA 2BDNA 1X9NA 3FPPA 4YHHQ 2RVLA 2E2DC 1KQSA 1HNWQ 4ID6A 3PMFA 2MGSA 1X3GA 2FJ2A 1F9SA 1KABA 2D0OA 2CQAA 4A3FG 3D6WA 3JAML 1EQVA 4H02A 4PV1C 3HFZB 3W3AA 2F3WA 2ZJPA 2HQEA 4JI5L 5M5YB 3MVVA 1F9PA 1TXYA 5NUCA 4A3MG 1JOKA 1SXTA 3QOJA 2E5LQ 1ZYRC 1GUTA 4LF4Q 1B7YB 4FXKC 1ESFA 4DU9A 5IT9E 3J81i 4B3ML 5EPLA 2Z9HA 2R7DA 3HKZG 3A5ZB 4A3GB 3SGIA 3WWVA 4A3BH 2L15A 2YU9H 2I5LX 4Q5VA 4V190 1JCKB 4OELB 4KMUC 4IQZA 3NBHB 3S17H 4HIOA 4LWCA 5LL6S 5JEAG 4CKCA 3GTLB 3WOEA 4NW2A 1SNMA 2B2TC 1CZGA 2DJFC 2JQOA 1SMYC 2CWAA 1JOQA 4ZKCB 2CWPA 4OXPA 4CJ2C 4X66Q 4YCWA 1N8RC 3EFXD 5FOBB 4G7ZC 5JVG3 3P75A 1EY8A 2RQXA 4HEDA 1L0WA 1SJED 2G9DA 2EOTA 3EIVA 5M5WB 3CCEA 3H15A 1VQPA 4UY8C 3MEHA 2EYLA 5HY6A 3QO2A 5EKLA 5DLQE 4A3KB 1Q8IA 4HCSA 2PW5A 1WCMH 1YNXA 3KF6A 1BCPC 1GUOA 3DWQA 1JC7A 2AQ2B 1H9SA 4IUPA 4HIDA 1AW7A 4K8JA 4C3HG 3QJYA 4DUYQ 1PFMA 1X3FA 5IP7G 2Q2HA 3A55A 3I2ZA 4AIMA 4JG2A 4RG1A 3UDGA 1QUQB 1Q3LA 4BY1H 2F0JA 4L5SA 5K36H 3EROA 1KD1C 1WTHA 1UUPA 3EA6A 2SNMA 3CPWA 5M9OA 3GTJB 2HIXA 1PV4A 1HZCA 3LWEA 1WTVA 4DV7L 3KLWA 4NXML 1G6ZA 3BDOA 3JAME 1C8CA 3NWSA 2VQEL 2EXZA 2CCZA 5IGDA 5IIFA 4LF9L 2PYKA 1VS0A 2K05A 1K3RA 5IYDG 1CQVA 3CF5A 2EYFA 4OX9Q 1VMCA 2J7ZA 4NXNL 2IY5B 5AJ3L 1KC8C 2I5HA 1TWHB 1G2TA 2KECA 1VQHA 1PTOC 2F0VA 3X3MA 3H3VC 3D4DA 3NK9A 3BS1A 1OXUA 3UE0A 2VL6A 1E1TA 1HQMC 4WFN3 4RGTA 1JT8A 1FR3A 1C7YA 1LTTD 1XMOL 2FMCA 3P20A 4CKBA 3M9BA 1ZKOA 2B39A 1JOOA 3MC0B 4GNXB 3TRZA 4DR3Q 1Q1BA 4XDXA 4G4KA 4LFBL 4OIJA 5C4XH 1AEXA 4IN3A 3VYSA 4HTHA 4GOPC 1VMPA 2MUYA 5C44H 3DHQA 2NZOA 3VR6A 4WJ4A 4HSPA 1XPOA 2A1AA 4KN7C 1K8OA 4LF6Q 1ZXTA 1PYSB 2R7ZG 4IFDJ 1B50A 2PZTA 4MTKA 1TS4A 2TSSA 4KV6A 5C6AA 1V8QA 3CC2A 1GUNA 1T5XD 3OIPA 1CFMA 1HPCA 2Q2IA 4L63B 1FNWA 1Z9FA 3GO5A 5AFWA 1K8GA 2NVYB 1B8AA 4LUVA 4DK0A 1R4PB 4A3DB 3M3YH 2N3SA 1MIUA 3HEJA 3OMCA 3GTKH 1HFNA 2DJGC 2PI2A 1DCZA 4EVOA 5KIXA 1LT6D 3M7GA 3J7YW 1GD7A 5CORA 3R93A 2IL8A 1HHVA 2UU9L 2C5CA 2KVMA 4C3JB 2F0HA 3I72A 3PF4A 1K8AC 3AMUA 2OTLA 1VQAA 4ZKBB 3PIP3 5DM73 1KXLA 4CDFC 1STBA 3HOYB 2P5ZX 4YHHL 1SMXA 4FF2A 2M00A 3GDEA 3ONAB 1ASYA 4GN3B 1K0SA 3NELA 1Y8NB 2DN8A 2PMZE 3MXUA 2B8FA 1EEFD 3DEOA 1EYCA 1YNND 2I5MX 2K4KA 4FO2A 1ENFA 3VR4A 2QKIC 1VQKA 3J7A5 1UAPA 4IUTA 2K5NA 1LM0A 1EY7A 2E5LL 3STBC 1PH2A 2HCIA 2E74C 4LF4L 1CHQD 4HIMA 2PNHA 4JYAQ 5IGEA 3ICEA 1U4MA 1TVXA 1CA5A 1V1PA 4O2DA 4F7XA 2HIVA 4NKLA 1A0IA 1D5XC 1U4PA 3K7UC 3F1ZA 1I3QH 4PMCA 3T1YL 1VQCA 2BE5C 1O78A 2BA1A 4HJAA 2EJGC 1IKMA 1KHIA 4A3GH 1D1IA 1ET6A 3H0GB 2B2VA 1D6EC 1CKMA 5KGUA 3Q6SA 1WVLA 4R4CA 4K0KQ 5C3EH 1XWEA 2RF4A 1X3EA 2KCMA 2JA7B 3OTOQ 3MA2B 4LF7Q 1F2ZA 3J81L 1XNRQ 1VQEA 2LKVA 3T16A 3ZJYC 4EQPA 2MO0A 3NSWA 1EYAA 5D3IB 1WTPA 1NCVA 1F2MA 3PF5A 1TWGB 1E22A 1SSOA 3RZDH 4KJOA 2O5JC 3GTPB 1FVIA 4WORA 3MHBA 2F0KA 1IZ6A 5CV4A 2HDLA 4CDEC 1E2WA 1XTCD 3CCRA 1KLGD 3PUYA 4B3RQ 1YJ9A 3GTQB 1BOSA 3A7AB 5ELNA 2F0DA 1DZ1A 3W1GA 2X6LA 1ASZA 2K5QA 3QR8A 2RSNA 2EJMA 2XGTA 1VQBA 3GTOH 2NVQB 2VB3X 1S5CD 5FLXE 3PV0A 1TWAH 1F2YA 2R92H 1WTXA 4P74A 4EGVA 2I0QA 4J1MA 3HOXB 3FMCA 1D2BA 3TEHB 2JA9A 5I9OA 4NMZA 2ZXOA 3W2DA 4BBRH 1VF5C 3AB9A 3K80C 1Q86C 5JJIA 4PZ8A 1BNZA 4YY3Q 2ZXRA 3HOUB 1ENAA 3V05A 1YIJA 3VA5A 5C4XG 3I4NH 1PMRA 3J80c 5CV5A 5IWAL 4A3IH 3Q24A 5FO9B 2VQFL 5C44G 4L8JA 1K0RA 3IFTA 4RMFA 2AWNA 4LFCQ 4LW1A 1VQ4A 3BVMA 2BA0A 3WDNA 2BE5D 2H1EA 2QDLA 3NUCA 1G6PA 3S1QB 1HRJA 2AMCB 2D2CC 1Y1VB 4IJHA 3PO2H 1PZJD 2K14A 2KEEA 5CV7A 4DKAC 1STYA 3P7JA 2JJQA 1U4LA 4A3FB 4TRDA 3PUZA 4DAPA 4RGNA 3DWPA 5FO8B 1QZGA 3VR5A 5JPMC 1TY2A 1IKLA 2A73B 1UE5A 4A3MB 2C35B 4DAYB 5EBCA 1RTNA 1SFOB 5C4HA 5C3WA 3OW7A 1XYIA 1LTLA 4ZLTF 1S5FD 1J8IA 5GAEC 1Z47A 2HHHL 2QDBA 4DV0Q 3GTGB 4IUVA 1QE6A 1AN8A 4KI0A 1K28A 3J80i 1U5KA 4BA1I 3HKZB 3NWTA 3I4MH 1D5MC 3TMEA 2B63H 1HTLD 1EY4A 1QB5D 1DYQA 2E2JB 3GTMH 2NVTH 1CA6A 2KCCA 3FKIH 3TZDA 3VA7A 2VW9A 2OTJA 5KEEA 2F1MA 2EJFC 3UI2A 2HUGA 2JA5B 1EWCA 4A3JH 1BCPF 1TS2A 4IUQA 1CKOA 2F0SA 1HXYD 5I6YA 1LUZA 1Q7YC 2N8NA 1KNAA 5H1SE 2YTVA 5LMUQ 1IBKQ 3OW2A 4DV1Q 1LT3D 1NR2A 1QWYA 2WB1G 4FF1A 1BDOA 3NQIA 2F3VA 2F0IA 1ICFB 4MNOA 1SYGA 1STNA 4A3GG 1PZKD 1YHAA 4TQUS 1M90C 3O13A 4H0LC 4DR2Q 4C3IH 3VYTA 1V9PA 3I3CA 3R8BA 1RTOA 3D4WA 5C3EG 3CW2C 4DXGA 1YITA 2EDGA 4C3HB 1D5ZC 3HOWH 3PIPA 4GOPB 1CI3M 4ZRZA 1TWFB 1KNEA 1IBLQ 4Y52H 2JA6H 3S1MH 1VQDA 1EZ6A 3SR1A 2BCOA 1FGBD 3HKZE 4R9WA 4RWSC 2JEBI 4DV2Q 1LABA 1TWCH 4HN7A 1KAWA 3TS0A 2B2VC 3S16B 5C0XJ 1PTOF 2XRQD 1GHKA 2JA8H 4UP7A 1K3BC 3M4YA 1F9QA 4ZQ3A 4IFDH 2E76C 5GROA 1A2TA 1MJCA 3HP3A 4DAVA 4C2MH 1TIID 1B3AA 5KNDA 1HZ9A 1DGSA 2PCFB 4K0KL 3HOVB 1MBYA 1SNCA 4XYQA 4LUOA 3NTIA 2TMPA 2QA4A 3OTOL 4LF5L 2L9HA 2R92G 5M3MH 1E3PA 2F0UA 3ND8A 5LHY1 5EBDA 3F2DA 3UDXA 2ICEC 1C48A 2IX0A 4A93H 4IJLA 1FNVA 4JV5L 2HQLA 2YYZA 4K6LA 3LGJA 1B53A 4DA2A 4BBSH 4YCVA 2Z1CA 1YNJC 3QWNA 3BVZA 3RLOA 5IP9H 4A3EH 1XNQQ 2JP1A 1ESRA 5FLMH 2NVXH 1DOKA 5J1ZA 3S2DB 2DNEA 1PYWD 2Z0SA 2JEAI 1Z6HA 4MHEA 3KYHC 5EGTA 1SNOA 4A3IG 1DOMA 3I8ZA 4F87A 2PW7A 4KY6A 2LXJA 4LMQD 1QILA 2AWOA 1EL0A 4B3SQ 4M1UB 4OO1I 2PQAB 5I2XA 3CU7A 2PPBC 1I94L 4XT1B 1OXTA 1S5DD 2L12A 3D4RA 4OONA 2F3IA 1GHJA 4QIWB 5A35A 3Q22A 2RHSB 5G3LF 3MFGA 2VB2X 1K83H 3PO2G 2R93H 3CCQA 1WI5A 2ENBA 4BY7B 3E6ZX 5IODA 1BQQT 4IPDA 1PFBA 2AHOB 3EQLC 1QNUA 3MXNB 4B08A 1JORA 3DMUA 3U58A 2SOBA 3B6YA 1XTDA 4I7AA 1PFNA 3M4QA 3AFQA 1F2LA 3PO3H 3X3NA 3F2CA 3L9AX 4A4IA 1EOVA 5E1FA 4ODGA 4JI3Q 2IHEA 5M5YH 5FO7B 3I55A 4KHPQ 5IYBH 3HOZB 4B3TL 5IGCA 2SNSA 4WRDA 4WJ3M 2IJ0A 1MI2A 5TSSA 2FMMA 2Z4HA 1J5EQ 4PG3A 3KF8B 2Q8RE 3I4MG 4ZAIA 2RDGA 1HR0W 1HZAA 1PH4A 2YU9B 2WACA 2CFMA 3BYYB 1MJEA 2UUBL 3Q23A 2LXKA 3NE5B 1EIGA 4PNYA 1YJNA 1A3TA 3EN2A 5CV6A 1S3OA 2SEBD 4GKJQ 1LACA 2VUMG 5IGFA 2VS1A 2Z6KA 2M9VA 1CZWA 3N6RA 3S14B 2WAQG 3GTLH 1RCVD 4C1NI 4C1NK 1HCZA 1S5ED 4R8NA 3IL8A 3TP7A 1HQRD 4QIWE 3A0JA 1PVOA 1P16A 1B2TA 5C4ZA 3U4VA 1WOCA 4DGZA 1OXVA 4RHRA 5C3XA 2K04A 2MPMA 5M5WH 3T1HL 1M1KC 1N32L 1VQJA 3N52A 4IOCA 1HA5A 4A3KH 1EY0A 4JCVE 4C3IG 1A15A 1QVGA 2K50A 3R2IA 3MTSA 4XQJA 3D0FA 2A5HA 5JAVA 3SVMA 3HOWG 2GVAA 1NJIC 3CD6A 2K52A 3CPFA 3J80L 2E2IB 3H09A 2UXBL 4HJ5A 3TZUA 3NBHA 1FL0A 2EY6A 3GP7A 4NB3A 1EY9A 1TS5A 2FFKB 2OCEA 2NN6H 1S72A 1ONLA 2KCNA 1R4QB 2F0FA 2K32A 1IBKL 1HH2P 4DV1L 2RSOA 5I6WA 2RKSA 3K59A 3PGZA 2CW0C 4YCUA 4UPAA 4XTCS 3C1FA 4KKSA 4FYDA 1PH5A 2WP8J 5JEAJ 1ZYRD 4YIJA 3MWYW 5LMNQ 4N9TA 3GTJH 1GUWA 3D8GA 1JICA 2CH4W 3NTHA 3E0JA 3A8JE 5ELFA 1ICWA 4RHSA 4JI0L 4BXXH 1VQ9A 1R9TB 2K28A 5HGTA 2EPBA 1JE5A 3U4ZA 1D1KA 1BKBA 2JYOA 5ISRA 1TWHH 2F0OA 1NSNS 2NUCA 5CV9A 3NHHA 2JK8A 4RCOA 2R7FA 1PH8A 4OWXB 4KD4A 4X62L 4DR1L 4BBSG 1SMYD 2A19A 2K03A 4POFA 3CP0A 5IP9G 4A3EG 2K5WA 4DV5L 1X6OA 1LTID 1RKNA 4X3UA 2PMZB 3E0EA 3SEBA 4OO1H 5M5XB 5C4XB 4Y7NB 1QUQA 1WJJA 4AQYQ 1STHA 3KDFB 2I07B 3J7AV 1MGSA 3PIO3 3LX0A 4AYBG 1D7QA 3H94A 1HNXL 2L11A 4K2LA 4KHVA 5K5PA 3ND9A 4A3LH 5E4XA 4HJ7A 1KAAA 1S40A 1GXDC 1BCPD 3G4SA 5EKKA 5EAYA 4POGA 4X64L 4JI6Q 4JOIA 1EIHA 1M8AA 4OIKA 5IT9c 1ET9A 1Y1WB 5LMNW 2R93G 2Y0SG 4LF8Q 1HNZQ 2UUAQ 4ULLA 1N36Q 4K6DA 4UAIA 3K8AA 1NAPA 2D9UA 1A62A 3S1RH 1N33Q 3BDLA 4JI4L 1XJVA 1E1OA 1O7YA 4FXGC 4O1NA 5GAHC 3PQIA 4IUUA 3PO3G 3NENA 5KYIA 2NVYH 2UXCQ 1IBMQ 4A3DH 4F8MA 3PUXA 4MZ9A 4GNXA 2CQOA 5J39A 2K5VA 5IYBG 1J6QA 2F03A 4QY7A 1FJGQ 2OEOA 1WTWA 3CCLA 1BBXC 4A3BG 2ICIA 4KLKA 1HNWL 4C3JH 1CTMA 2NWGA 3OMGA 2L4NA 2ZT9C 2PI2E 4CJ1B 3OSOA 3BZCA 3TP6A 1PYBA 3UDIA 1PTOD 1MHWC 3HOYH 5C0XH 1V1OA 2RDHA 3RZOB 2EE1A 4GKKQ 1E24A 4R1JA 3RLNA 2B29A 4CGYB 4IURA 1AFPA 1IYUA 3T4AC 2UXDQ 2EYHA 2IHFA 1C9OA 2R6GA 2KHIA 2EYJA 2X69A 5D65A 2F0QA 1BR9A 1CKNB 4ALPA 5ELBA 3CCVA 1WCMG 4QJFA 2KJXA 2GVBA 2WB1B 2Z6KC 2ZM6Q 1NY4A 4P72A 2FINB 4DFAA 3ULPA 3VDYA 3JAMc 2R61A 5C5LA 3FRPB 1G51A
chains in the Genus database with same CATH topology
1L1OC 3KFUA 3I4MH 4GKJL 4A93G 4DV4Q 2F4VL 1P8LA 1XMQQ 1VQNA 4DV2L 4X66L 3HOVG 4JC0A 5IWAQ 2R7ZH 4DR4Q 2B63H 2AKWB 5JJKA 1YJWA 2VQFQ 1EWIA 3H0GH 4R4QA 4R4TA 3FP9A 3CCSA 1VQ5A 4X6AH 3GTMH 1HJPA 4DK6C 2NVTH 3FKIH 1X9NA 3EBEA 4YHHQ 1VQFA 4PMWA 5BR8Q 1BBWA 5FLMG 1R9TH 1KQSA 2BH2A 2VW9A 1EYGA 3AEVA 2OTJA 1EIFA 1X3GA 4BY1G 5K36G 3S1NH 2D0OA 2NN6G 4A3FG 1GM5A 2JA7H 4H02A 1YHQA 4IPCA 3HFZB 4A3JH 2K75A 3RN2A 1PHJA 1CKOA 2ZJPA 4JI5L 1TXYA 3AQQA 4A3MG 4UP8A 4GLAC 1LUZA 2NZHA 1Q7YC 1TWGH 2N8NA 5IY0A 1VQ7A 3BU2A 4UP9A 4MTNA 2YTVA 5H1SE 5LMUQ 1CSQA 2D0PA 4DUZQ 1IBKQ 1K73C 3GTPH 3OW2A 4DV1Q 2E5LQ 2WB1G 1QVCA 5M5XH 4Y7NH 4LF4Q 1B7YB 4HJ8A 3GTQH 4GLXA 4IFDI 4DUYL 3J81i 4B3ML 3KJOA 4MNOA 2R7DA 4A3GG 3HKZG 1EQQA 1YHAA 4TQUS 1M90C 1MKHA 3A5ZB 3SGIA 3WWVA 4A3BH 2L15A 2QGQA 4DR2Q 2I5LX 3AFPA 2YU9H 1XNQL 4C3IH 3BZKA 2NVQH 1V9PA 1A63A 3NBHB 2BH8A 5C3EG 3S17H 1YEZA 1UE7A 2OQKA 3CW2C 4LWCA 4HIOA 2KHJA 1N34Q 2UUCQ 1YITA 2HHHQ 2D62A 3JAMi 5JEAG 2WB1E 3HOWH 3PIPA 1HR0L 4GOPB 4IPGA 4JI7L 1IL2A 3HOXH 3KJPA 1Y1WH 1Q82C 1LYLA 2JQOA 4JI8Q 1IBLQ 2CWAA 2JA6H 4Y52H 3S1MH 4P73A 4A3CH 1VQDA 3M4PA 2CWPA 3HKZE 4J15A 4OXPA 2JEBI 4BY7G 4DV2Q 4X66Q 1TWCH 4YCWA 1N8RC 4GN4B 4B3SL 4OX9L 1KAWA 3STBD 1Y14B 2MO1A 3RR5A 4R4OA 3TS0A 4OO1G 1VQIA 5C0XJ 1WYDA 3CMEA 3L7ZC 1L0WA 2JA8H 3HOUH 4UP7A 2EXDA 3JC66 2VY3A 3EIVA 3CCEA 3H15A 1VQPA 4UY8C 5GROA 1MJCA 3PCOB 5HY6A 4A3LG 4C2MH 5DLQE 1HZ9A 1DGSA 2ZTEA 3KDFA 1WCMH 4K0KL 3HOZG 4LUOA 1YNXA 3KF6A 2QA4A 3NEMA 3OTOL 4LF5L 2ASBA 1G291 2R92G 4BA2I 5M3MH 1E3PA 4GN5A 3F2DA 4HIDA 3UDXA 4DR3L 1YZ6A 2IX0A 4A93H 4NPSA 3L2PA 4IJLA 4P75A 4JI3L 1Q1EA 4DUYQ 1JMCA 4JV5L 1X3FA 4LUZA 4QL5A 5IP7G 2HQLA 2Q2HA 2YYZA 3I2ZA 4AIMA 3S1QH 2YV5A 3LGJA 4X65Q 4JG2A 4KHPL 4BBSH 4YCVA 1Y1VH 4RG1A 1YVCA 3RLOA 3UDGA 4AQYL 5IP9H 3M7NA 4A3EH 1QUQB 3ULLA 5FLMH 1AE2A 1XNQQ 3RZOH 2NVXH 1J5EL 3FHWA 3DM3A 4BY1H 5J3BA 4L5SA 1KD1C 4A3FH 4L5RC 1KL9A 2Z0SA 2JEAI 4R4IA 2N49A 3DLLA 4QGUA 4A3DG 2UU9Q 4LF6L 3CPWA 3KYHC 2HIXA 1PV4A 1HZCA 1EFWA 4DV7L 3KLWA 4L5QA 4NXML 2ZTDA 4DV6L 4A3IG 2VQEL 3BJUA 4A3MH 2LXJA 4YWLA 2AWOA 2CCZA 4LF9L 4DR7L 1VS0A 1K3RA 5IYDG 4A3KG 1SFOH 4JI6L 5IYCG 3CF5A 2GN5A 4OX9Q 4B3SQ 4NXNL 4OO1I 2PQAB 1Q8KA 3H3VI 2IY5B 2IT1A 1I94L 5AJ3L 1KC8C 1OXTA 1HNZL 2I5HA 1AH9A 4KHZA 3GTGH 2UUAL 5FJ8G 3CCUA 4YWKA 1N36L 4OONA 2KENA 2F3IA 3J7ZC 3PIOA 1VQHA 2RHSB 2YTXA 1C0AA 4JI2Q 1K83H 1KRSA 3M85A 3PO2G 4GNXC 1W3SA 1OXUA 4LFAL 2R93H 3CCQA 1WI5A 3UE0A 2VL6A 1Q81C 1E1TA 5M3FH 4XIGS 4IPDA 2E2JH 4DV3Q 2UXCL 3J81j 1C7YA 4LF5Q 1JT8A 2AHOB 3MXNB 4DR6Q 1XMOL 1X54A 3M9BA 3U58A 1V1QA 2MNAA 3RN5A 4GNXB 2WFWA 3B6YA 1XTDA 5ELOA 1RIPA 3M4QA 4HJ9A 1PH3A 3AFQA 1FJGL 2ID0A 4DR3Q 3CMAA 2ZJQA 1Q1BA 3PO3H 4LFBL 2JA5H 3W1BA 1IYJB 4A4IA 3F2CA 2OWOA 1EOVA 5C4XH 4JI3Q 2KBNA 4O0AA 1YHBA 2IHEA 4JV5Q 5M5YH 1EUJA 1D8LA 3I55A 4KHPQ 4A76A 5IYBH 3H3VH 2RHQB 4GOPC 1JJ2A 1CKNA 4B3TL 4WJ3M 1UEBA 1Q12A 5GQOA 1W2BA 4BXXG 5C44H 1J5EQ 4PG3A 2NZOA 3KF8B 1PH1A 4WJ4A 1XPOA 3I4MG 2A1AA 1HR0W 1Q46A 1HZAA 1PH4A 4LF6Q 2K5HA 1PYSB 2CFMA 2UUBL 1MJEA 4DV7Q 2R7ZG 2LXKA 4NXMQ 4IFDJ 1XPUA 4DR5L 2VQEQ 3H0GG 2E8GA 1YJNA 5FLXc 3EN2A 4JBWA 3CC2A 1S3OA 2H5XA 4GKJQ 2V1CC 4JYAL 2VUMG 2VS1A 2Q2IA 2Z6KA 2F4VQ 1HNWQ 4PZ6A 3AYHB 1Z9FA 1I94Q 3GO5A 1JB7A 5AJ3Q 1K8GA 4C3HH 2WAQG 1B8AA 1B70B 3Q8DA 4LUVA 5LMNL 3GTLH 1L1OA 5JJLA 1VQLA 1TWFH 3M3YH 3UE1A 5IP7H 3CC7A 1I6HH 2N3SA 1MIUA 3GTKH 2PI2A 4JI1L 2NN6I 4QIWE 3A0JA 1X65A 1P16A 4JBJA 2Q2TA 1PVOA 1NMFA 1GD7A 3U4VA 2UU9L 2XTIA 1WOCA 3RLFA 4JI5Q 1OXVA 3S16H 3PF4A 3M4OH 1XMOQ 1K8AC 1EQRA 2OTLA 1XMQL 4LF7L 1VQAA 1XNRL 4DR4L 2WAQE 5M5WH 3T1HL 3A5UA 1KXLA 1M1KC 3RNUA 1N32L 3TREA 1VQJA 4IOCA 4YHHL 1SMXA 4JCVE 4A3KH 4IPHA 4BBRG 3GDEA 1QVGA 1ASYA 2K50A 3L0OA 4GN3B 2EIFA 3NELA 3D0FA 4B3MQ 1CSPA 3HOVH 2PMZE 1VQ6A 4B3TQ 3HOWG 3U50C 2GVAA 3ULJA 1NJIC 1H95A 3CD6A 4B3RL 2K52A 3CPFA 2ATWA 2UXBL 4HJ5A 1Y1WG 2I5MX 3PUVA 4IOAA 1FL0A 2K4KA 4A3CG 4NB3A 1VQ8A 1SN8A 5IE8A 1O7IA 3J7A5 1VQKA 2OCEA 1S72A 1QZHA 3I4NG 2F52A 4DAMA 4GOPA 4DUZL 4JOIC 5C4JH 2UUBQ 1HR0Q 2K5NA 3S24A 1IBKL 4JI7Q 1GO3E 1HH2P 1LM0A 4FDBA 3STBC 4DV1L 1PH2A 2E5LL 1JJGA 5GADC 3PGZA 4LF4L 4HIMA 1X55A 3HOUG 4YCUA 4UPAA 4XTCS 2PNHA 3A74A 4JYAQ 4HIKA 3ICEA 4IO9A 3S2DH 4O2DA 3CC4A 2FXQA 2HIVA 2WP8J 1PH5A 5JEAJ 1A0IA 3K7UC 1X56A 5LMNQ 4LF8L 2A8VA 2MQHA 3F1ZA 4DPGA 1I3QH 3GTJH 2YTYA 3F2BA 3OYYA 1EIYB 3T1YL 1VQCA 2UUCL 3TRZA 2BA1A 1I5FA 3D31A 4DNIA 4HJAA 1N34L 1U0LA 1KHIA 4A3GH 4ME3A 4QQBX 1IXRA 3HOYG 5C0XG 2DGYA 1N33L 4YY3L 4JI0L 4BXXH 1CKMA 1VQ9A 4JI8L 1XPRA 4JBMA 4R4CA 4PZ7A 1JE5A 2RF4A 3U4ZA 5C3EH 1X3EA 1BKBA 4K0KQ 2KCMA 1IBML 1TWHH 3OTOQ 4LF7Q 1GVPA 2JK8A 1XNRQ 1VQEA 4TVAB 2R7FA 3T1HQ 1SROA 3ZJYC 4OWXB 1PH8A 1N32Q 4X62L 2MO0A 4DR1L 4BBSG 1Y1VG 2A19A 3PUWA 2N78A 4L5TA 4POFA 3CP0A 5IP9G 1L1OB 4A3EG 4GS3A 3PF5A 2ZTCA 1E22A 1VCIA 1X6OA 5HGQA 4DV5L 3RZDH 2VUMH 4BY7H 1BVSA 1SRUA 1NMGA 4LFCL 1FVIA 3E0EA 1IZ6A 3ERSX 3CCRA 3GD7A 3PUYA 2UXDL 4B3RQ 1YJ9A 2QEXA 1QUQA 2UXBQ 1WJJA 5ELNA 4AQYQ 3W1GA 4OWWB 1KRTA 3KDFB 4EQ5A 1ASZA 1NTGA 3F8TA 3I7FA 3KF6B 2XGTA 4AYBG 3TQYA 1D7QA 1BBUA 1SLJA 3CCJA 1VQBA 1HNXL 2ZJRA 1RL2A 3GTOH 3S15H 4A3LH 1JJCB 4HJ7A 1S40A 2B63G 4DV6Q 1NE3A 2ES2A 3PV0A 1TWAH 1PH7A 3G48A 3HOZH 4GKKL 1T9HA 3E9HA 3G4SA 5EAYA 4POGA 2R92H 3FKIG 2JE6I 3ER0A 4X64L 4P74A 4LF9Q 4JI6Q 4DR7Q 1CUKA 3HKSA 1PFSA 4JOIA 2I0QA 4X65L 2CKZB 2PQAA 5IT9c 3KOJA 1HZBA 2E2HH 4NXNQ 3W5OA 5LMNW 2R93G 3TEHB 1I50H 2JA9A 2Y0SG 4LF8Q 2JA7G 1K9MC 1HNZQ 3IRBA 3E9IA 2UUAQ 4A3JG 3I56A 3G6EA 4BBRH 3T1YQ 5M3FG 4AYBE 1N36Q 4AH6A 3K8AA 3K80C 5C0XI 1NBWA 1Q86C 1A62A 3PSIA 1E7ZA 4PZ8A 3S1RH 1A8VA 5JJIA 1N33Q 4YY3Q 3G71A 4DV0L 4LFAQ 4JI0Q 1XJVA 4JI4L 4JBKA 1E1OA 2ZM6L 5GAHC 3PO3G 2JA5G 3NENA 3S14H 2LSSA 2NVYH 1YIJA 1IBMQ 3S2HH 3I4NH 2UXCQ 5C4XG 2VZAA 3J80c 4DV4L 4A3DH 2Y0SE 1N9WA 3CQZH 3PUXA 4MZ9A 4GNXA 5IWAL 2CQOA 4X62Q 2K5VA 4DR1Q 4A3IH 5IYBG 1J6QA 1V43A 4QY7A 1FJGQ 2VQFL 2VNUD 3CCLA 1OXSC 4LFBQ 2EQSA 1YI2A 4A3BG 2OQ0A 5C44G 4DV5Q 1K0RA 5IYDH 4KLKA 4RMFA 5IYCH 5BR8L 4C3JH 1HNWL 2AWNA 4LFCQ 4OWTB 4JI2L 4LW1A 3CXCA 2PI2E 1VQGA 1PH6A 1VQ4A 1L2FA 4APVA 2BA0A 1VQOA 5E7NA 3BZCA 5GAGC 5FJ8H 1OXXK 1PYBA 1PA6A 3UDIA 3HOXG 1G6PA 4DV3L 4DR6L 2JA6G 2AMCB 3HOYH 4IJHA 4P71A 3PO2H 4YWMA 1SE8A 1HNXQ 3UDFA 1GKHA 1FGUA 2K14A 3CAMA 5LMUL 4DKAC 3MEFA 4DR5Q 4GKKQ 1E24A 4GLVB 3K81C 4R1JA 3RLNA 2JJQA 1SR3A 2RCNA 2B29A 4LNQA 3PUZA 2Q2UA 4X64Q 2E2IH 2JA8G 2UXDQ 2IHFA 4EX5A 1C9OA 1UWVA 4DK3C 1QZGA 2ALYB 2MFIA 2R6GA 1WFQA 2KHIA 4IFDG 1YBYA 1QVFA 3K7AH 1UE5A 1VQMA 3I4OA 2C35B 4DAYB 1CKNB 1OTCA 3J81c 1AE3A 4DR2L 4ALPA 1UE1A 1KIXA 3TS2A 4A75A 1PH9A 3K0XA 3CCVA 1WCMG 4QJFA 1LTLA 2GVBA 1UE6A 2B3GA 1Z47A 4JI1Q 5GAEC 3CCMA 2Z6KC 2HHHL 2IX1A 4DV0Q 4JI4Q 5M3MG 2ZM6Q 1NY4A 4KI0A 4P72A 2KCTA 3J80i 1U5KA 3ULPA 3VDYA 4BA1I 3JAMc 2HT1A 1IBLL 2DUDA 1G51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  3KFU A;  3I4M H;  4GKJ L;  4A93 G;  4DV4 Q;  2F4V L;  1P8L A;  1XMQ Q;  1VQN A;  4DV2 L;  4X66 L;  3HOV G;  4JC0 A;  5IWA Q;  2R7Z H;  4DR4 Q;  2B63 H;  2AKW B;  5JJK A;  1YJW A;  2VQF Q;  1EWI A;  3H0G H;  4R4Q A;  4R4T A;  3FP9 A;  3CCS A;  1VQ5 A;  4X6A H;  3GTM H;  1HJP A;  4DK6 C;  2NVT H;  3FKI H;  1X9N A;  3EBE A;  4YHH Q;  1VQF A;  4PMW A;  5BR8 Q;  1BBW A;  5FLM G;  1R9T H;  1KQS A;  2BH2 A;  2VW9 A;  1EYG A;  3AEV A;  2OTJ A;  1EIF A;  1X3G A;  4BY1 G;  5K36 G;  3S1N H;  2D0O A;  2NN6 G;  4A3F G;  1GM5 A;  2JA7 H;  4H02 A;  1YHQ A;  4IPC A;  3HFZ B;  4A3J H;  2K75 A;  3RN2 A;  1PHJ A;  1CKO A;  2ZJP A;  4JI5 L;  1TXY A;  3AQQ A;  4A3M G;  4UP8 A;  4GLA C;  1LUZ A;  2NZH A;  1Q7Y C;  1TWG H;  2N8N A;  5IY0 A;  1VQ7 A;  3BU2 A;  4UP9 A;  4MTN A;  2YTV A;  5H1S E;  5LMU Q;  1CSQ A;  2D0P A;  4DUZ Q;  1IBK Q;  1K73 C;  3GTP H;  3OW2 A;  4DV1 Q;  2E5L Q;  2WB1 G;  1QVC A;  5M5X H;  4Y7N H;  4LF4 Q;  1B7Y B;  4HJ8 A;  3GTQ H;  4GLX A;  4IFD I;  4DUY L;  3J81 i;  4B3M L;  3KJO A;  4MNO A;  2R7D A;  4A3G G;  3HKZ G;  1EQQ A;  1YHA A;  4TQU S;  1M90 C;  1MKH A;  3A5Z B;  3SGI A;  3WWV A;  4A3B H;  2L15 A;  2QGQ A;  4DR2 Q;  2I5L X;  3AFP A;  2YU9 H;  1XNQ L;  4C3I H;  3BZK A;  2NVQ H;  1V9P A;  1A63 A;  3NBH B;  2BH8 A;  5C3E G;  3S17 H;  1YEZ A;  1UE7 A;  2OQK A;  3CW2 C;  4LWC A;  4HIO A;  2KHJ A;  1N34 Q;  2UUC Q;  1YIT A;  2HHH Q;  2D62 A;  3JAM i;  5JEA G;  2WB1 E;  3HOW H;  3PIP A;  1HR0 L;  4GOP B;  4IPG A;  4JI7 L;  1IL2 A;  3HOX H;  3KJP A;  1Y1W H;  1Q82 C;  1LYL A;  2JQO A;  4JI8 Q;  1IBL Q;  2CWA A;  2JA6 H;  4Y52 H;  3S1M H;  4P73 A;  4A3C H;  1VQD A;  3M4P A;  2CWP A;  3HKZ E;  4J15 A;  4OXP A;  2JEB I;  4BY7 G;  4DV2 Q;  4X66 Q;  1TWC H;  4YCW A;  1N8R C;  4GN4 B;  4B3S L;  4OX9 L;  1KAW A;  3STB D;  1Y14 B;  2MO1 A;  3RR5 A;  4R4O A;  3TS0 A;  4OO1 G;  1VQI A;  5C0X J;  1WYD A;  3CME A;  3L7Z C;  1L0W A;  2JA8 H;  3HOU H;  4UP7 A;  2EXD A;  3JC6 6;  2VY3 A;  3EIV A;  3CCE A;  3H15 A;  1VQP A;  4UY8 C;  5GRO A;  1MJC A;  3PCO B;  5HY6 A;  4A3L G;  4C2M H;  5DLQ E;  1HZ9 A;  1DGS A;  2ZTE A;  3KDF A;  1WCM H;  4K0K L;  3HOZ G;  4LUO A;  1YNX A;  3KF6 A;  2QA4 A;  3NEM A;  3OTO L;  4LF5 L;  2ASB A;  1G29 1;  2R92 G;  4BA2 I;  5M3M H;  1E3P A;  4GN5 A;  3F2D A;  4HID A;  3UDX A;  4DR3 L;  1YZ6 A;  2IX0 A;  4A93 H;  4NPS A;  3L2P A;  4IJL A;  4P75 A;  4JI3 L;  1Q1E A;  4DUY Q;  1JMC A;  4JV5 L;  1X3F A;  4LUZ A;  4QL5 A;  5IP7 G;  2HQL A;  2Q2H A;  2YYZ A;  3I2Z A;  4AIM A;  3S1Q H;  2YV5 A;  3LGJ A;  4X65 Q;  4JG2 A;  4KHP L;  4BBS H;  4YCV A;  1Y1V H;  4RG1 A;  1YVC A;  3RLO A;  3UDG A;  4AQY L;  5IP9 H;  3M7N A;  4A3E H;  1QUQ B;  3ULL A;  5FLM H;  1AE2 A;  1XNQ Q;  3RZO H;  2NVX H;  1J5E L;  3FHW A;  3DM3 A;  4BY1 H;  5J3B A;  4L5S A;  1KD1 C;  4A3F H;  4L5R C;  1KL9 A;  2Z0S A;  2JEA I;  4R4I A;  2N49 A;  3DLL A;  4QGU A;  4A3D G;  2UU9 Q;  4LF6 L;  3CPW A;  3KYH C;  2HIX A;  1PV4 A;  1HZC A;  1EFW A;  4DV7 L;  3KLW A;  4L5Q A;  4NXM L;  2ZTD A;  4DV6 L;  4A3I G;  2VQE L;  3BJU A;  4A3M H;  2LXJ A;  4YWL A;  2AWO A;  2CCZ A;  4LF9 L;  4DR7 L;  1VS0 A;  1K3R A;  5IYD G;  4A3K G;  1SFO H;  4JI6 L;  5IYC G;  3CF5 A;  2GN5 A;  4OX9 Q;  4B3S Q;  4NXN L;  4OO1 I;  2PQA B;  1Q8K A;  3H3V I;  2IY5 B;  2IT1 A;  1I94 L;  5AJ3 L;  1KC8 C;  1OXT A;  1HNZ L;  2I5H A;  1AH9 A;  4KHZ A;  3GTG H;  2UUA L;  5FJ8 G;  3CCU A;  4YWK A;  1N36 L;  4OON A;  2KEN A;  2F3I A;  3J7Z C;  3PIO A;  1VQH A;  2RHS B;  2YTX A;  1C0A A;  4JI2 Q;  1K83 H;  1KRS A;  3M85 A;  3PO2 G;  4GNX C;  1W3S A;  1OXU A;  4LFA L;  2R93 H;  3CCQ A;  1WI5 A;  3UE0 A;  2VL6 A;  1Q81 C;  1E1T A;  5M3F H;  4XIG S;  4IPD A;  2E2J H;  4DV3 Q;  2UXC L;  3J81 j;  1C7Y A;  4LF5 Q;  1JT8 A;  2AHO B;  3MXN B;  4DR6 Q;  1XMO L;  1X54 A;  3M9B A;  3U58 A;  1V1Q A;  2MNA A;  3RN5 A;  4GNX B;  2WFW A;  3B6Y A;  1XTD A;  5ELO A;  1RIP A;  3M4Q A;  4HJ9 A;  1PH3 A;  3AFQ A;  1FJG L;  2ID0 A;  4DR3 Q;  3CMA A;  2ZJQ A;  1Q1B A;  3PO3 H;  4LFB L;  2JA5 H;  3W1B A;  1IYJ B;  4A4I A;  3F2C A;  2OWO A;  1EOV A;  5C4X H;  4JI3 Q;  2KBN A;  4O0A A;  1YHB A;  2IHE A;  4JV5 Q;  5M5Y H;  1EUJ A;  1D8L A;  3I55 A;  4KHP Q;  4A76 A;  5IYB H;  3H3V H;  2RHQ B;  4GOP C;  1JJ2 A;  1CKN A;  4B3T L;  4WJ3 M;  1UEB A;  1Q12 A;  5GQO A;  1W2B A;  4BXX G;  5C44 H;  1J5E Q;  4PG3 A;  2NZO A;  3KF8 B;  1PH1 A;  4WJ4 A;  1XPO A;  3I4M G;  2A1A A;  1HR0 W;  1Q46 A;  1HZA A;  1PH4 A;  4LF6 Q;  2K5H A;  1PYS B;  2CFM A;  2UUB L;  1MJE A;  4DV7 Q;  2R7Z G;  2LXK A;  4NXM Q;  4IFD J;  1XPU A;  4DR5 L;  2VQE Q;  3H0G G;  2E8G A;  1YJN A;  5FLX c;  3EN2 A;  4JBW A;  3CC2 A;  1S3O A;  2H5X A;  4GKJ Q;  2V1C C;  4JYA L;  2VUM G;  2VS1 A;  2Q2I A;  2Z6K A;  2F4V Q;  1HNW Q;  4PZ6 A;  3AYH B;  1Z9F A;  1I94 Q;  3GO5 A;  1JB7 A;  5AJ3 Q;  1K8G A;  4C3H H;  2WAQ G;  1B8A A;  1B70 B;  3Q8D A;  4LUV A;  5LMN L;  3GTL H;  1L1O A;  5JJL A;  1VQL A;  1TWF H;  3M3Y H;  3UE1 A;  5IP7 H;  3CC7 A;  1I6H H;  2N3S A;  1MIU A;  3GTK H;  2PI2 A;  4JI1 L;  2NN6 I;  4QIW E;  3A0J A;  1X65 A;  1P16 A;  4JBJ A;  2Q2T A;  1PVO A;  1NMF A;  1GD7 A;  3U4V A;  2UU9 L;  2XTI A;  1WOC A;  3RLF A;  4JI5 Q;  1OXV A;  3S16 H;  3PF4 A;  3M4O H;  1XMO Q;  1K8A C;  1EQR A;  2OTL A;  1XMQ L;  4LF7 L;  1VQA A;  1XNR L;  4DR4 L;  2WAQ E;  5M5W H;  3T1H L;  3A5U A;  1KXL A;  1M1K C;  3RNU A;  1N32 L;  3TRE A;  1VQJ A;  4IOC A;  4YHH L;  1SMX A;  4JCV E;  4A3K H;  4IPH A;  4BBR G;  3GDE A;  1QVG A;  1ASY A;  2K50 A;  3L0O A;  4GN3 B;  2EIF A;  3NEL A;  3D0F A;  4B3M Q;  1CSP A;  3HOV H;  2PMZ E;  1VQ6 A;  4B3T Q;  3HOW G;  3U50 C;  2GVA A;  3ULJ A;  1NJI C;  1H95 A;  3CD6 A;  4B3R L;  2K52 A;  3CPF A;  2ATW A;  2UXB L;  4HJ5 A;  1Y1W G;  2I5M X;  3PUV A;  4IOA A;  1FL0 A;  2K4K A;  4A3C G;  4NB3 A;  1VQ8 A;  1SN8 A;  5IE8 A;  1O7I A;  3J7A 5;  1VQK A;  2OCE A;  1S72 A;  1QZH A;  3I4N G;  2F52 A;  4DAM A;  4GOP A;  4DUZ L;  4JOI C;  5C4J H;  2UUB Q;  1HR0 Q;  2K5N A;  3S24 A;  1IBK L;  4JI7 Q;  1GO3 E;  1HH2 P;  1LM0 A;  4FDB A;  3STB C;  4DV1 L;  1PH2 A;  2E5L L;  1JJG A;  5GAD C;  3PGZ A;  4LF4 L;  4HIM A;  1X55 A;  3HOU G;  4YCU A;  4UPA A;  4XTC S;  2PNH A;  3A74 A;  4JYA Q;  4HIK A;  3ICE A;  4IO9 A;  3S2D H;  4O2D A;  3CC4 A;  2FXQ A;  2HIV A;  2WP8 J;  1PH5 A;  5JEA J;  1A0I A;  3K7U C;  1X56 A;  5LMN Q;  4LF8 L;  2A8V A;  2MQH A;  3F1Z A;  4DPG A;  1I3Q H;  3GTJ H;  2YTY A;  3F2B A;  3OYY A;  1EIY B;  3T1Y L;  1VQC A;  2UUC L;  3TRZ A;  2BA1 A;  1I5F A;  3D31 A;  4DNI A;  4HJA A;  1N34 L;  1U0L A;  1KHI A;  4A3G H;  4ME3 A;  4QQB X;  1IXR A;  3HOY G;  5C0X G;  2DGY A;  1N33 L;  4YY3 L;  4JI0 L;  4BXX H;  1CKM A;  1VQ9 A;  4JI8 L;  1XPR A;  4JBM A;  4R4C A;  4PZ7 A;  1JE5 A;  2RF4 A;  3U4Z A;  5C3E H;  1X3E A;  1BKB A;  4K0K Q;  2KCM A;  1IBM L;  1TWH H;  3OTO Q;  4LF7 Q;  1GVP A;  2JK8 A;  1XNR Q;  1VQE A;  4TVA B;  2R7F A;  3T1H Q;  1SRO A;  3ZJY C;  4OWX B;  1PH8 A;  1N32 Q;  4X62 L;  2MO0 A;  4DR1 L;  4BBS G;  1Y1V G;  2A19 A;  3PUW A;  2N78 A;  4L5T A;  4POF A;  3CP0 A;  5IP9 G;  1L1O B;  4A3E G;  4GS3 A;  3PF5 A;  2ZTC A;  1E22 A;  1VCI A;  1X6O A;  5HGQ A;  4DV5 L;  3RZD H;  2VUM H;  4BY7 H;  1BVS A;  1SRU A;  1NMG A;  4LFC L;  1FVI A;  3E0E A;  1IZ6 A;  3ERS X;  3CCR A;  3GD7 A;  3PUY A;  2UXD L;  4B3R Q;  1YJ9 A;  2QEX A;  1QUQ A;  2UXB Q;  1WJJ A;  5ELN A;  4AQY Q;  3W1G A;  4OWW B;  1KRT A;  3KDF B;  4EQ5 A;  1ASZ A;  1NTG A;  3F8T A;  3I7F A;  3KF6 B;  2XGT A;  4AYB G;  3TQY A;  1D7Q A;  1BBU A;  1SLJ A;  3CCJ A;  1VQB A;  1HNX L;  2ZJR A;  1RL2 A;  3GTO H;  3S15 H;  4A3L H;  1JJC B;  4HJ7 A;  1S40 A;  2B63 G;  4DV6 Q;  1NE3 A;  2ES2 A;  3PV0 A;  1TWA H;  1PH7 A;  3G48 A;  3HOZ H;  4GKK L;  1T9H A;  3E9H A;  3G4S A;  5EAY A;  4POG A;  2R92 H;  3FKI G;  2JE6 I;  3ER0 A;  4X64 L;  4P74 A;  4LF9 Q;  4JI6 Q;  4DR7 Q;  1CUK A;  3HKS A;  1PFS A;  4JOI A;  2I0Q A;  4X65 L;  2CKZ B;  2PQA A;  5IT9 c;  3KOJ A;  1HZB A;  2E2H H;  4NXN Q;  3W5O A;  5LMN W;  2R93 G;  3TEH B;  1I50 H;  2JA9 A;  2Y0S G;  4LF8 Q;  2JA7 G;  1K9M C;  1HNZ Q;  3IRB A;  3E9I A;  2UUA Q;  4A3J G;  3I56 A;  3G6E A;  4BBR H;  3T1Y Q;  5M3F G;  4AYB E;  1N36 Q;  4AH6 A;  3K8A A;  3K80 C;  5C0X I;  1NBW A;  1Q86 C;  1A62 A;  3PSI A;  1E7Z A;  4PZ8 A;  3S1R H;  1A8V A;  5JJI A;  1N33 Q;  4YY3 Q;  3G71 A;  4DV0 L;  4LFA Q;  4JI0 Q;  1XJV A;  4JI4 L;  4JBK A;  1E1O A;  2ZM6 L;  5GAH C;  3PO3 G;  2JA5 G;  3NEN A;  3S14 H;  2LSS A;  2NVY H;  1YIJ A;  1IBM Q;  3S2H H;  3I4N H;  2UXC Q;  5C4X G;  2VZA A;  3J80 c;  4DV4 L;  4A3D H;  2Y0S E;  1N9W A;  3CQZ H;  3PUX A;  4MZ9 A;  4GNX A;  5IWA L;  2CQO A;  4X62 Q;  2K5V A;  4DR1 Q;  4A3I H;  5IYB G;  1J6Q A;  1V43 A;  4QY7 A;  1FJG Q;  2VQF L;  2VNU D;  3CCL A;  1OXS C;  4LFB Q;  2EQS A;  1YI2 A;  4A3B G;  2OQ0 A;  5C44 G;  4DV5 Q;  1K0R A;  5IYD H;  4KLK A;  4RMF A;  5IYC H;  5BR8 L;  4C3J H;  1HNW L;  2AWN A;  4LFC Q;  4OWT B;  4JI2 L;  4LW1 A;  3CXC A;  2PI2 E;  1VQG A;  1PH6 A;  1VQ4 A;  1L2F A;  4APV A;  2BA0 A;  1VQO A;  5E7N A;  3BZC A;  5GAG C;  5FJ8 H;  1OXX K;  1PYB A;  1PA6 A;  3UDI A;  3HOX G;  1G6P A;  4DV3 L;  4DR6 L;  2JA6 G;  2AMC B;  3HOY H;  4IJH A;  4P71 A;  3PO2 H;  4YWM A;  1SE8 A;  1HNX Q;  3UDF A;  1GKH A;  1FGU A;  2K14 A;  3CAM A;  5LMU L;  4DKA C;  3MEF A;  4DR5 Q;  4GKK Q;  1E24 A;  4GLV B;  3K81 C;  4R1J A;  3RLN A;  2JJQ A;  1SR3 A;  2RCN A;  2B29 A;  4LNQ A;  3PUZ A;  2Q2U A;  4X64 Q;  2E2I H;  2JA8 G;  2UXD Q;  2IHF A;  4EX5 A;  1C9O A;  1UWV A;  4DK3 C;  1QZG A;  2ALY B;  2MFI A;  2R6G A;  1WFQ A;  2KHI A;  4IFD G;  1YBY A;  1QVF A;  3K7A H;  1UE5 A;  1VQM A;  3I4O A;  2C35 B;  4DAY B;  1CKN B;  1OTC A;  3J81 c;  1AE3 A;  4DR2 L;  4ALP A;  1UE1 A;  1KIX A;  3TS2 A;  4A75 A;  1PH9 A;  3K0X A;  3CCV A;  1WCM G;  4QJF A;  1LTL A;  2GVB A;  1UE6 A;  2B3G A;  1Z47 A;  4JI1 Q;  5GAE C;  3CCM A;  2Z6K C;  2HHH L;  2IX1 A;  4DV0 Q;  4JI4 Q;  5M3M G;  2ZM6 Q;  1NY4 A;  4KI0 A;  4P72 A;  2KCT A;  3J80 i;  1U5K A;  3ULP A;  3VDY A;  4BA1 I;  3JAM c;  2HT1 A;  1IBL L;  2DUD A;  1G51 A; 
#chains in the Genus database with same CATH topology
 1SE4 A;  3SK5 A;  1W6J A;  3A56 A;  4GKJ L;  4DV4 Q;  3RD4 A;  4X66 L;  1EYD A;  4DR4 Q;  1JB3 A;  2AKW B;  1TU2 B;  5M3F B;  3A54 A;  3H0G H;  4R4Q A;  3SK8 A;  1S4Z A;  5DNF A;  2Q8I B;  4DK6 C;  3EBE A;  4PMW A;  5BR8 Q;  1BBW A;  1S5B D;  3AEV A;  4BY1 G;  4FF4 A;  5K36 G;  2NN6 G;  2WII B;  2JA7 H;  4DNT B;  1YHQ A;  1CT1 D;  1F77 A;  1SDF A;  1KDC A;  2K75 A;  3RN2 A;  1PHJ A;  1SBB B;  1TS3 A;  2XIW A;  3TDQ A;  1KTK A;  1II3 A;  2AQ1 B;  5E3F A;  2I46 A;  1TWG H;  2BOS A;  3BU2 A;  4DUZ Q;  3CHB D;  5G3L D;  3GTP H;  2D0P A;  2RA4 A;  4LK1 C;  1K73 C;  1AZQ A;  3KBX A;  1QVC A;  4M8A A;  3H91 A;  1SYD A;  2WKD A;  4HJ8 A;  3GTQ H;  4GLX A;  4IFD I;  1I4H A;  4DUY L;  1H9J A;  1EQQ A;  1MKH A;  2QGQ A;  2NVQ H;  2DNC A;  3BZK A;  2BH8 A;  1YEZ A;  1UE7 A;  2UUC Q;  1N34 Q;  1SYF A;  3A8I E;  2D62 A;  3JAM i;  2WB1 E;  4MIU A;  3HOX H;  3HRZ C;  5BN4 A;  3KJP A;  1I6H B;  4QB4 A;  4TKO B;  4JI8 Q;  1Q82 C;  1BO0 A;  2F0L A;  3M4P A;  1JWS D;  1WTR A;  4JVZ A;  4OX9 L;  3STB D;  1Y14 B;  2MO1 A;  3RR5 A;  4OO1 G;  3C46 A;  1VQI A;  4JW0 A;  3M4O B;  3HOU H;  1TT2 A;  2HD3 A;  3JC6 6;  4H44 C;  3OIQ A;  4A3I B;  4OGQ C;  4U67 3;  1B44 D;  3PCO B;  2XWJ B;  3NQT A;  4A3L G;  4ME5 A;  4DN4 M;  4HMJ A;  4KD3 A;  2ZTE A;  1HFG A;  1XXG A;  3NEM A;  4Q0F A;  1G29 1;  4BA2 I;  4IZ8 A;  2CH4 A;  2QW7 A;  3ITP A;  4GN5 A;  4X3S A;  5ELD A;  2QEJ C;  3DUZ A;  2IWH A;  4PMB A;  1VDZ A;  4DR3 L;  1YZ6 A;  4U68 A;  3TBI B;  1A3V A;  1SE3 A;  4DNR B;  5IGG A;  3L2P A;  4KK7 A;  1JE4 A;  1BCP B;  5C4J B;  3S1Q H;  1EY6 A;  2YV5 A;  4X65 Q;  1DD2 A;  1Y69 U;  1Y1V H;  3J81 E;  4AQY L;  5EPK A;  3M7N A;  3QG1 A;  3ULL A;  1AE2 A;  3K6O A;  4HAE A;  5I9P A;  5FKA C;  3FHW A;  5KNB A;  3DM3 A;  2EVB A;  1X3P A;  2XNA C;  4A3F H;  1JWU D;  2OT2 A;  4L5R C;  1DOL A;  3VYR A;  4R4I A;  2N49 A;  4A3D G;  4LF6 L;  1SND A;  2O5I C;  3HS0 C;  3BJU A;  1EU3 A;  4A3M H;  3EVQ A;  4YWL A;  2K5D A;  1LTA D;  1SFO H;  4JI6 L;  4JPB W;  4C3J G;  1MD2 D;  4KY5 A;  2B2T A;  1Q8K A;  2AUK A;  2IT1 A;  1AH9 A;  1HNZ L;  2JXM B;  4KHZ A;  3GTG H;  2UUA L;  3CCU A;  1N36 L;  2KEN A;  3PIO A;  2G9H D;  2YTX A;  1C0A A;  2K7V A;  1KRS A;  4GNX C;  5E4W C;  2HT1 A;  4XQN A;  3SXH A;  2VUM B;  3ZYY X;  3DEP A;  2E2J H;  2UXC L;  3R3O A;  5JEA H;  1PTO B;  2WAQ B;  1X54 A;  1V1Q A;  1LT4 D;  4G57 A;  3NXW A;  4C56 C;  4J8Q A;  2WFW A;  5ELO A;  2MNA A;  4HJ9 A;  1RIP A;  3RN5 A;  1FJG L;  3CMA A;  2JA5 H;  3W1B A;  3LWU A;  2OWO A;  2KBN A;  3KLR A;  4O0A A;  5KYL A;  1YHB A;  4OHJ A;  3S15 B;  2B2U A;  3URY A;  4KKT A;  4CHT B;  4A76 A;  3BZD B;  3H3V H;  3T53 B;  1JJ2 A;  1QG7 A;  1CK1 A;  1STG A;  1UEB A;  2B2W A;  4RFB A;  3BDC A;  1EQT A;  1MSG A;  2A6E C;  1PH1 A;  1TY0 A;  2E2H B;  1LTS D;  3T13 A;  1I50 B;  3I70 A;  2K5H A;  2E75 C;  2RCF A;  3VYU A;  4E6I A;  5KRU A;  4DV7 Q;  4NXM Q;  1LLR D;  4QUC A;  4ZUI A;  1KDA A;  2VQE Q;  3H0G G;  2Q8T A;  1KLU D;  1SNP A;  5FLX c;  1HTP A;  3K57 A;  1CHP D;  2KHS A;  2V1C C;  4JYA L;  4UDU C;  4QF4 A;  1FYC A;  2F4V Q;  4PZ6 A;  5AJ3 Q;  4C3H H;  3S2H B;  1SJH D;  1L1O A;  2NB0 A;  5CC4 A;  1TWF H;  3NTK A;  3UE1 A;  2XSC A;  3CQZ B;  5IP7 H;  2PZU A;  2NN6 I;  1STE A;  1X65 A;  1WTO A;  2Q2T A;  2IPK D;  4J6H A;  1VF7 A;  1NMF A;  3I90 A;  2CHB D;  2XTI A;  1LTR D;  4TSS A;  5CBA E;  3S16 H;  1GUG A;  1PDQ A;  1XMO Q;  4B9X A;  1TR5 A;  1UEA B;  3E5S A;  4LF7 L;  1XNR L;  4DR4 L;  2WAQ E;  3SK4 A;  1I4G A;  3QB3 A;  3TRE A;  3E3X A;  1BF4 A;  3T56 B;  3K5O A;  2JSO A;  1GOZ A;  2M2L A;  4IPH A;  4BBR G;  1NR4 A;  4MN3 A;  3HOV H;  3L0O A;  2VNU D;  2NBF A;  1VQ6 A;  5C5M A;  4FF3 A;  3U50 C;  1EEI D;  4B3R L;  2ATW A;  3KBG A;  4RGM A;  1FNU A;  5JVH 3;  1VQ8 A;  3K7A B;  1O7I A;  2H4O A;  3I4N G;  1QZH A;  4GOP A;  1ILQ A;  4DUZ L;  1HR0 Q;  4K5V A;  3S24 A;  4JI7 Q;  4FDB A;  4CBV A;  3DM1 A;  3I73 A;  5GAD C;  1L0Y B;  2F4I A;  4OEM B;  2A74 C;  2EYM A;  1HUN A;  1X55 A;  2L5T A;  3KUP A;  3HOU G;  3GV6 A;  1PLF A;  3A74 A;  1ILP A;  4IO9 A;  1DXM A;  1U4R A;  3S2D H;  4GZY C;  3FPU B;  1IHZ A;  2FXQ A;  1O80 A;  3S1N B;  1H9R A;  1G91 A;  1X56 A;  2A8V A;  2MQH A;  4DPG A;  4AYB B;  2YTY A;  5COY A;  2UUC L;  2R7Z B;  1N34 L;  2XN9 C;  3D31 A;  4QQB X;  3KLS A;  4LJZ C;  1PRT F;  4YY3 L;  1B4O A;  4RCN A;  2A6E D;  4JI8 L;  4FP5 D;  2LS0 1;  4PZ7 A;  4XXE A;  3VR3 A;  2Y0S B;  1W6K A;  3SDZ A;  4TVA B;  2HCC A;  1SRO A;  3AU7 A;  4R8I A;  1Y1V G;  3S9W A;  3PUW A;  4L5T A;  1OO9 B;  2F0N A;  1JR0 D;  3LNN A;  2ZTC A;  1VCI A;  4KY7 A;  2RDF A;  4BY7 H;  1BVS A;  1SRU A;  2JN4 A;  4LFC L;  1AP0 A;  3PO3 B;  3MXP A;  3GD7 A;  3OWE B;  2QEX A;  4OWW B;  3U9S A;  3F8T A;  1LT5 D;  3KF6 B;  3Q0A A;  1BBU A;  2F0G A;  4A3B B;  1H9S B;  1JWM D;  4N9P A;  2NTS A;  2B63 G;  4DV6 Q;  3S17 B;  3G48 A;  3HOZ H;  1T9H A;  3E9H A;  3FKI G;  4DR7 Q;  1CUK A;  3HKS A;  4X65 L;  2CKZ B;  2PQA A;  4IAL A;  1HZB A;  3G6J B;  1K9M C;  5I2Y A;  3E9I A;  3MFY A;  4A3J G;  3I56 A;  3G6E A;  4N8F A;  3T1Y Q;  4AYB E;  1A2U A;  2A6H C;  3D3R A;  5C0X I;  1NBW A;  1E7Z A;  1YNJ D;  3FDT A;  5LL6 X;  4JBK A;  4DV0 L;  4LFA Q;  3SE0 A;  2B2Y A;  3NBI A;  2JA5 G;  3S14 H;  3MXN A;  1I4Q A;  2VZA A;  4I65 A;  5L37 A;  2VXW A;  2Y0S E;  5EKI A;  1N9W A;  1WCM B;  3RUZ A;  3NP8 A;  1Y8O B;  3V96 A;  4DK1 A;  4ZYS A;  1YI2 A;  2OQ0 A;  5IYC H;  4EQN A;  4HSV A;  1CQF A;  3T51 B;  1LTG D;  1VQO A;  4X3K A;  4UHV A;  2QCP X;  1C4Q A;  5FJ8 H;  4CDC C;  3KF8 A;  3VR2 A;  4K5X A;  2JA6 G;  2PQE A;  2K6A A;  2B2U C;  4YWM A;  1SE8 A;  2MHV A;  3NPP A;  3UDF A;  2KED A;  1FGU A;  5EJW A;  5LMU L;  4O42 A;  4DR5 Q;  2B2W C;  2LMC B;  4BY1 B;  3K81 C;  2AUJ D;  2E2I H;  2JA8 G;  1PXU A;  1O7L A;  4DK3 C;  2MFI A;  4IFD G;  1WFQ A;  5ELC A;  1JQY D;  3FEW X;  1AE3 A;  4DR2 L;  1UE1 A;  1GJX A;  4F88 A;  1PH9 A;  3K0X A;  2K1B A;  5JOB A;  1UE6 A;  3RMH A;  2B3G A;  4JI1 Q;  4RH6 A;  2IX1 A;  5M3M G;  5DAU A;  2KCT A;  3GQB A;  1IBL L;  2DUD A;  1L1O C;  3KFU A;  1PZI D;  4P2C B;  4X3T A;  4A93 G;  3J7A F;  1B9M A;  4H13 C;  2F4V L;  1SE2 A;  1XMQ Q;  4DV2 L;  3HOV G;  1QNK A;  5IWA Q;  3SK6 A;  1YJW A;  2VQF Q;  1EWI A;  4OL7 A;  5T1I A;  4X6A H;  2NZ1 D;  1HJP A;  2A68 C;  3IKJ A;  1HUM A;  2Z8L A;  1YNN C;  1VQF A;  5FLM G;  1R9T H;  2IW3 A;  2BH2 A;  3TP5 A;  1EYG A;  1I4P A;  1ENC A;  5JPN C;  1EIF A;  1GM5 A;  2KOL A;  1B3Q A;  1IL8 A;  5DEH A;  1MSH A;  3ERQ A;  4IPC A;  1DM0 B;  2A6H D;  1IYV A;  3AQQ A;  2SDF A;  4UP8 A;  4GLA C;  2NZH A;  2KA7 A;  5KNC A;  5IY0 A;  1VQ7 A;  4UP9 A;  4MTN A;  1CSQ A;  5C44 B;  1Z7T A;  1M4V A;  5M5X H;  4Y7N H;  3CRK C;  3QOL A;  1U9R A;  3SHL A;  5JJZ A;  3KJO A;  1EU4 A;  2PO4 A;  2C9O A;  3AFP A;  1XNQ L;  1T5E A;  2K01 A;  1A63 A;  2F0M A;  3F2U A;  2OQK A;  2RBM A;  2KHJ A;  4XYO A;  2HHH Q;  5D3D A;  3L3O C;  4K2K A;  1HR0 L;  1AZP A;  4IPG A;  4JI7 L;  1IL2 A;  4I7Z C;  3M3Y B;  1Y1W H;  1LYL A;  1E2V A;  3V2T A;  3GTK B;  4P73 A;  1EWH A;  5HUR A;  3S1R B;  4A3C H;  1PRT C;  3J80 E;  4J15 A;  4BY7 G;  3OPO A;  4K8I A;  4HMI A;  4GN4 B;  4B3S L;  1V1P B;  1SNQ A;  4R4O A;  4KKU A;  4JK1 C;  1EFI D;  2CW0 D;  1WYD A;  3CME A;  3L7Z C;  3TSS A;  4IUN A;  3KK7 A;  4HR7 B;  2EXD A;  2VY3 A;  5EQ0 A;  5FLX L;  2J4X A;  1QOH A;  2NYZ D;  3KDF A;  3HOZ G;  3K5M A;  3D6C A;  2Z4I A;  2ASB A;  3A8K E;  4H7B A;  4NPS A;  4P75 A;  4JI3 L;  4LAA A;  1Q1E A;  1JMC A;  2ZXP A;  4LUZ A;  4QL5 A;  2BDO A;  4KN4 C;  2MP1 A;  2OF1 A;  2A68 D;  2QIL A;  2WV6 D;  1DJR D;  4KHP L;  1O7Z A;  1YVC A;  3C1E A;  4WJW A;  3MXG A;  3RZO H;  1J5E L;  1ML0 D;  5J3B A;  1H9M A;  1KL9 A;  3DLL A;  3OOC A;  4QGU A;  3I4L A;  3C2P A;  2WKC A;  1I3Q B;  1EFW A;  4L5Q A;  1A6X A;  2ZTD A;  4DV6 L;  2F0P A;  2D5D A;  4XQQ A;  4DR7 L;  4A3K G;  1ROD A;  5IYC G;  2GN5 A;  3HGB A;  1X3Q A;  3H3V I;  1I6V C;  5C3E B;  1XX8 A;  2B2Y C;  4RKL A;  3BG3 A;  5FJ8 G;  3P1H A;  4YWK A;  4RKB A;  4ZK9 B;  2R3Z A;  3J7Z C;  2OXP A;  4JI2 Q;  3M85 A;  1J9O A;  1W3S A;  4LFA L;  1Q81 C;  3RZD B;  5M3F H;  3C3L A;  4XIG S;  1TQO A;  1RD9 D;  4DV3 Q;  3J81 j;  3H6M A;  4LF5 Q;  4DR6 Q;  2EYP A;  2LFN A;  2MJ8 A;  1UNS A;  1PH3 A;  2ID0 A;  2ZJQ A;  1PRT D;  2G5D A;  1IYJ B;  1IW7 C;  3K0Y A;  3QIA A;  5CYU A;  1EOT A;  1I4R A;  4K5W A;  4JV5 Q;  2DY8 A;  3GTO B;  1EUJ A;  3BYT B;  1D8L A;  3CRL C;  3K5N A;  1TWA B;  2RHQ B;  1CKN A;  2DY7 A;  4NP5 A;  4CJ0 B;  1Q12 A;  4QUF A;  5GQO A;  2R92 B;  4BXX G;  2L0C A;  4ILW A;  3DXJ C;  4PQX A;  5I4D A;  1Q46 A;  2F0E A;  3KLS X;  1XPU A;  4BBR B;  4DR5 L;  1BUV T;  2E8G A;  4JBW A;  2H5X A;  5ELE A;  2L55 A;  4KTA A;  3TP8 A;  3AYH B;  1I94 Q;  1JB7 A;  1WD1 A;  3DWA A;  1B70 B;  3Q8D A;  5LMN L;  3I4N B;  5JJL A;  1VQL A;  3CC7 A;  1I6H H;  3EJI A;  2Z6B A;  5CV8 A;  4JI1 L;  2V4D A;  4JBJ A;  2WIN B;  1B1Z A;  1SAP A;  4BWG B;  3RLF A;  4JI5 Q;  4CKE A;  5DM6 3;  3M4O H;  1EQR A;  2X6G A;  4EQO A;  1XMQ L;  1Q90 A;  4QMG A;  3IFD A;  3A5U A;  2EYO A;  3RNU A;  2A69 C;  3PO2 B;  4G7H C;  2PNR C;  5CGK A;  2EIF A;  1A3U A;  4B3M Q;  2HDM A;  1CSP A;  4ZUJ A;  1WTQ A;  3K58 A;  1SYC A;  4B3T Q;  1H95 A;  3ULJ A;  2O4X A;  1FD7 D;  4RAU C;  1Y1W G;  3PUV A;  4ABN A;  4IOA A;  4A3C G;  1G8Z D;  1SN8 A;  5IE8 A;  5T1G A;  2F52 A;  4DAM A;  2UUB Q;  2IX3 A;  4JOI C;  5C4J H;  2FHT A;  3U9O A;  1GO3 E;  2AQ3 B;  1CM9 A;  1H9K A;  1NUC A;  1K8M A;  4HIK A;  2CVR A;  5D14 A;  1LV9 A;  3CC4 A;  1IW7 D;  2B8G A;  4LF8 L;  3I4M B;  1HA6 A;  3F2B A;  3OYY A;  1EIY B;  1RDP D;  2EY5 A;  2QF7 A;  5J22 A;  1I4X A;  1I5F A;  4DNI A;  2B63 B;  1U0L A;  2LY7 A;  4DXF A;  4ME3 A;  2XWB B;  2KQ3 A;  1IXR A;  3HOY G;  5C0X G;  3GTM B;  2DGY A;  1N33 L;  2NVT B;  3FKI B;  1SYB A;  1XPR A;  4JBM A;  3OHX C;  1IBM L;  1GVP A;  5IOC A;  2F0W A;  4A3J B;  3T1H Q;  1WD0 A;  1N32 Q;  5BN5 A;  2N78 A;  4CDD C;  2GA4 B;  3MAQ A;  1L1O B;  1G2S A;  4GS3 A;  2EZV A;  2VUM H;  5HGQ A;  1E0B A;  1NMG A;  3ERS X;  4Z9C B;  1PTO H;  4DAY A;  2N88 A;  1BXT A;  2UXB Q;  2NTT A;  4BS9 A;  1KRT A;  2EY2 A;  1GUS A;  4K14 A;  4EQ5 A;  1NTG A;  5A2Q L;  3I7F A;  1SEB D;  2O2L D;  1EY5 A;  3TQY A;  1SLJ A;  3CCJ A;  3S15 H;  2ZJR A;  1RL2 A;  4C3I B;  1JJC B;  2KUM A;  1NE3 A;  2ES2 A;  1PH7 A;  4FNF A;  4GKK L;  5BN3 A;  2F0T A;  3BVG A;  4KJN A;  4FXD A;  2JE6 I;  3ER0 A;  4LF9 Q;  3HOW B;  2UXD L;  1JJG A;  1PFS A;  4XT3 B;  3KOJ A;  2E2H H;  4NXN Q;  3W5O A;  5CBE E;  4L6T B;  2JA6 B;  2A69 D;  2JA7 G;  1I50 H;  3S1M B;  4HCE A;  3IRB A;  3HZX A;  5M3F G;  2EY1 A;  3FVQ A;  1TWC B;  4AH6 A;  1EZ8 A;  3PSI A;  1A8V A;  3G71 A;  4JI0 Q;  2JA8 B;  5CR3 A;  2ZM6 L;  1B9N A;  1KDB A;  2LSS A;  5IT9 L;  3S2H H;  4DV4 L;  4C2M B;  3CQZ H;  4S3S A;  4X62 Q;  4DR1 Q;  1V43 A;  2K33 A;  1OXS C;  4RGO S;  4LFB Q;  2EQS A;  1PRT B;  4DV5 Q;  1X32 A;  5M3M B;  5IYD H;  3K5L A;  3GV3 A;  5BR8 L;  4FVM A;  4OWT B;  4JI2 L;  3CXC A;  1VQG A;  1PH6 A;  1L2F A;  4APV A;  4A93 B;  5E7N A;  5GAG C;  3MZ5 A;  1LO5 D;  1OXX K;  2L1B A;  3HG9 A;  1PA6 A;  2XRS D;  3HOX G;  4B9W A;  4DV3 L;  4N8X 1;  5IGB A;  4DR6 L;  2N55 A;  3CKI B;  4BBS B;  4P71 A;  4G7O C;  1HNX Q;  1GKH A;  4A3E B;  1F9R A;  3CAM A;  1Y8P B;  2NVX B;  2XVS A;  3MEF A;  1RF2 D;  4GLV B;  1RJT A;  5CMD A;  1SR3 A;  2RCN A;  4LNQ A;  2Q2U A;  4X64 Q;  1STA A;  1E2Z A;  1QCB D;  1UWV A;  4RA8 A;  2ALY B;  4EX5 A;  4ZCK A;  3OWF A;  1NNX A;  1YBY A;  1QVF A;  3K7A H;  1VQM A;  3I4O A;  1OTC A;  3J81 c;  3IAY A;  1KIX A;  2PZW A;  3TS2 A;  4A75 A;  3WOF A;  1DON A;  5EPJ A;  3A7L A;  1LTB D;  1L0X B;  3CCM A;  2J0T D;  4QCL A;  4JI4 Q;  3TN2 A;  1ZEQ X;  1QJO A;  3R2T A;  4V0B A;  5FK9 C;  4DF7 A;  5F2D A;  3S1N H;  2UU9 Q;  1RHP A;  1W2B A;  1K83 B;  4NDX A;  2R93 B;  5A2Q E;  1P8L A;  1VQN A;  4JC0 A;  2R7Z H;  3G7L A;  5JJK A;  3I91 A;  4R4T A;  3CCS A;  3FP9 A;  1TKW B;  1VQ5 A;  1SYE A;  2BDN A;  1X9N A;  3FPP A;  4YHH Q;  2RVL A;  2E2D C;  1KQS A;  1HNW Q;  4ID6 A;  3PMF A;  2MGS A;  1X3G A;  2FJ2 A;  1F9S A;  1KAB A;  2D0O A;  2CQA A;  4A3F G;  3D6W A;  3JAM L;  1EQV A;  4H02 A;  4PV1 C;  3HFZ B;  3W3A A;  2F3W A;  2ZJP A;  2HQE A;  4JI5 L;  5M5Y B;  3MVV A;  1F9P A;  1TXY A;  5NUC A;  4A3M G;  1JOK A;  1SXT A;  3QOJ A;  2E5L Q;  1ZYR C;  1GUT A;  4LF4 Q;  1B7Y B;  4FXK C;  1ESF A;  4DU9 A;  5IT9 E;  3J81 i;  4B3M L;  5EPL A;  2Z9H A;  2R7D A;  3HKZ G;  3A5Z B;  4A3G B;  3SGI A;  3WWV A;  4A3B H;  2L15 A;  2YU9 H;  2I5L X;  4Q5V A;  4V19 0;  1JCK B;  4OEL B;  4KMU C;  4IQZ A;  3NBH B;  3S17 H;  4HIO A;  4LWC A;  5LL6 S;  5JEA G;  4CKC A;  3GTL B;  3WOE A;  4NW2 A;  1SNM A;  2B2T C;  1CZG A;  2DJF C;  2JQO A;  1SMY C;  2CWA A;  1JOQ A;  4ZKC B;  2CWP A;  4OXP A;  4CJ2 C;  4X66 Q;  4YCW A;  1N8R C;  3EFX D;  5FOB B;  4G7Z C;  5JVG 3;  3P75 A;  1EY8 A;  2RQX A;  4HED A;  1L0W A;  1SJE D;  2G9D A;  2EOT A;  3EIV A;  5M5W B;  3CCE A;  3H15 A;  1VQP A;  4UY8 C;  3MEH A;  2EYL A;  5HY6 A;  3QO2 A;  5EKL A;  5DLQ E;  4A3K B;  1Q8I A;  4HCS A;  2PW5 A;  1WCM H;  1YNX A;  3KF6 A;  1BCP C;  1GUO A;  3DWQ A;  1JC7 A;  2AQ2 B;  1H9S A;  4IUP A;  4HID A;  1AW7 A;  4K8J A;  4C3H G;  3QJY A;  4DUY Q;  1PFM A;  1X3F A;  5IP7 G;  2Q2H A;  3A55 A;  3I2Z A;  4AIM A;  4JG2 A;  4RG1 A;  3UDG A;  1QUQ B;  1Q3L A;  4BY1 H;  2F0J A;  4L5S A;  5K36 H;  3ERO A;  1KD1 C;  1WTH A;  1UUP A;  3EA6 A;  2SNM A;  3CPW A;  5M9O A;  3GTJ B;  2HIX A;  1PV4 A;  1HZC A;  3LWE A;  1WTV A;  4DV7 L;  3KLW A;  4NXM L;  1G6Z A;  3BDO A;  3JAM E;  1C8C A;  3NWS A;  2VQE L;  2EXZ A;  2CCZ A;  5IGD A;  5IIF A;  4LF9 L;  2PYK A;  1VS0 A;  2K05 A;  1K3R A;  5IYD G;  1CQV A;  3CF5 A;  2EYF A;  4OX9 Q;  1VMC A;  2J7Z A;  4NXN L;  2IY5 B;  5AJ3 L;  1KC8 C;  2I5H A;  1TWH B;  1G2T A;  2KEC A;  1VQH A;  1PTO C;  2F0V A;  3X3M A;  3H3V C;  3D4D A;  3NK9 A;  3BS1 A;  1OXU A;  3UE0 A;  2VL6 A;  1E1T A;  1HQM C;  4WFN 3;  4RGT A;  1JT8 A;  1FR3 A;  1C7Y A;  1LTT D;  1XMO L;  2FMC A;  3P20 A;  4CKB A;  3M9B A;  1ZKO A;  2B39 A;  1JOO A;  3MC0 B;  4GNX B;  3TRZ A;  4DR3 Q;  1Q1B A;  4XDX A;  4G4K A;  4LFB L;  4OIJ A;  5C4X H;  1AEX A;  4IN3 A;  3VYS A;  4HTH A;  4GOP C;  1VMP A;  2MUY A;  5C44 H;  3DHQ A;  2NZO A;  3VR6 A;  4WJ4 A;  4HSP A;  1XPO A;  2A1A A;  4KN7 C;  1K8O A;  4LF6 Q;  1ZXT A;  1PYS B;  2R7Z G;  4IFD J;  1B50 A;  2PZT A;  4MTK A;  1TS4 A;  2TSS A;  4KV6 A;  5C6A A;  1V8Q A;  3CC2 A;  1GUN A;  1T5X D;  3OIP A;  1CFM A;  1HPC A;  2Q2I A;  4L63 B;  1FNW A;  1Z9F A;  3GO5 A;  5AFW A;  1K8G A;  2NVY B;  1B8A A;  4LUV A;  4DK0 A;  1R4P B;  4A3D B;  3M3Y H;  2N3S A;  1MIU A;  3HEJ A;  3OMC A;  3GTK H;  1HFN A;  2DJG C;  2PI2 A;  1DCZ A;  4EVO A;  5KIX A;  1LT6 D;  3M7G A;  3J7Y W;  1GD7 A;  5COR A;  3R93 A;  2IL8 A;  1HHV A;  2UU9 L;  2C5C A;  2KVM A;  4C3J B;  2F0H A;  3I72 A;  3PF4 A;  1K8A C;  3AMU A;  2OTL A;  1VQA A;  4ZKB B;  3PIP 3;  5DM7 3;  1KXL A;  4CDF C;  1STB A;  3HOY B;  2P5Z X;  4YHH L;  1SMX A;  4FF2 A;  2M00 A;  3GDE A;  3ONA B;  1ASY A;  4GN3 B;  1K0S A;  3NEL A;  1Y8N B;  2DN8 A;  2PMZ E;  3MXU A;  2B8F A;  1EEF D;  3DEO A;  1EYC A;  1YNN D;  2I5M X;  2K4K A;  4FO2 A;  1ENF A;  3VR4 A;  2QKI C;  1VQK A;  3J7A 5;  1UAP A;  4IUT A;  2K5N A;  1LM0 A;  1EY7 A;  2E5L L;  3STB C;  1PH2 A;  2HCI A;  2E74 C;  4LF4 L;  1CHQ D;  4HIM A;  2PNH A;  4JYA Q;  5IGE A;  3ICE A;  1U4M A;  1TVX A;  1CA5 A;  1V1P A;  4O2D A;  4F7X A;  2HIV A;  4NKL A;  1A0I A;  1D5X C;  1U4P A;  3K7U C;  3F1Z A;  1I3Q H;  4PMC A;  3T1Y L;  1VQC A;  2BE5 C;  1O78 A;  2BA1 A;  4HJA A;  2EJG C;  1IKM A;  1KHI A;  4A3G H;  1D1I A;  1ET6 A;  3H0G B;  2B2V A;  1D6E C;  1CKM A;  5KGU A;  3Q6S A;  1WVL A;  4R4C A;  4K0K Q;  5C3E H;  1XWE A;  2RF4 A;  1X3E A;  2KCM A;  2JA7 B;  3OTO Q;  3MA2 B;  4LF7 Q;  1F2Z A;  3J81 L;  1XNR Q;  1VQE A;  2LKV A;  3T16 A;  3ZJY C;  4EQP A;  2MO0 A;  3NSW A;  1EYA A;  5D3I B;  1WTP A;  1NCV A;  1F2M A;  3PF5 A;  1TWG B;  1E22 A;  1SSO A;  3RZD H;  4KJO A;  2O5J C;  3GTP B;  1FVI A;  4WOR A;  3MHB A;  2F0K A;  1IZ6 A;  5CV4 A;  2HDL A;  4CDE C;  1E2W A;  1XTC D;  3CCR A;  1KLG D;  3PUY A;  4B3R Q;  1YJ9 A;  3GTQ B;  1BOS A;  3A7A B;  5ELN A;  2F0D A;  1DZ1 A;  3W1G A;  2X6L A;  1ASZ A;  2K5Q A;  3QR8 A;  2RSN A;  2EJM A;  2XGT A;  1VQB A;  3GTO H;  2NVQ B;  2VB3 X;  1S5C D;  5FLX E;  3PV0 A;  1TWA H;  1F2Y A;  2R92 H;  1WTX A;  4P74 A;  4EGV A;  2I0Q A;  4J1M A;  3HOX B;  3FMC A;  1D2B A;  3TEH B;  2JA9 A;  5I9O A;  4NMZ A;  2ZXO A;  3W2D A;  4BBR H;  1VF5 C;  3AB9 A;  3K80 C;  1Q86 C;  5JJI A;  4PZ8 A;  1BNZ A;  4YY3 Q;  2ZXR A;  3HOU B;  1ENA A;  3V05 A;  1YIJ A;  3VA5 A;  5C4X G;  3I4N H;  1PMR A;  3J80 c;  5CV5 A;  5IWA L;  4A3I H;  3Q24 A;  5FO9 B;  2VQF L;  5C44 G;  4L8J A;  1K0R A;  3IFT A;  4RMF A;  2AWN A;  4LFC Q;  4LW1 A;  1VQ4 A;  3BVM A;  2BA0 A;  3WDN A;  2BE5 D;  2H1E A;  2QDL A;  3NUC A;  1G6P A;  3S1Q B;  1HRJ A;  2AMC B;  2D2C C;  1Y1V B;  4IJH A;  3PO2 H;  1PZJ D;  2K14 A;  2KEE A;  5CV7 A;  4DKA C;  1STY A;  3P7J A;  2JJQ A;  1U4L A;  4A3F B;  4TRD A;  3PUZ A;  4DAP A;  4RGN A;  3DWP A;  5FO8 B;  1QZG A;  3VR5 A;  5JPM C;  1TY2 A;  1IKL A;  2A73 B;  1UE5 A;  4A3M B;  2C35 B;  4DAY B;  5EBC A;  1RTN A;  1SFO B;  5C4H A;  5C3W A;  3OW7 A;  1XYI A;  1LTL A;  4ZLT F;  1S5F D;  1J8I A;  5GAE C;  1Z47 A;  2HHH L;  2QDB A;  4DV0 Q;  3GTG B;  4IUV A;  1QE6 A;  1AN8 A;  4KI0 A;  1K28 A;  3J80 i;  1U5K A;  4BA1 I;  3HKZ B;  3NWT A;  3I4M H;  1D5M C;  3TME A;  2B63 H;  1HTL D;  1EY4 A;  1QB5 D;  1DYQ A;  2E2J B;  3GTM H;  2NVT H;  1CA6 A;  2KCC A;  3FKI H;  3TZD A;  3VA7 A;  2VW9 A;  2OTJ A;  5KEE A;  2F1M A;  2EJF C;  3UI2 A;  2HUG A;  2JA5 B;  1EWC A;  4A3J H;  1BCP F;  1TS2 A;  4IUQ A;  1CKO A;  2F0S A;  1HXY D;  5I6Y A;  1LUZ A;  1Q7Y C;  2N8N A;  1KNA A;  5H1S E;  2YTV A;  5LMU Q;  1IBK Q;  3OW2 A;  4DV1 Q;  1LT3 D;  1NR2 A;  1QWY A;  2WB1 G;  4FF1 A;  1BDO A;  3NQI A;  2F3V A;  2F0I A;  1ICF B;  4MNO A;  1SYG A;  1STN A;  4A3G G;  1PZK D;  1YHA A;  4TQU S;  1M90 C;  3O13 A;  4H0L C;  4DR2 Q;  4C3I H;  3VYT A;  1V9P A;  3I3C A;  3R8B A;  1RTO A;  3D4W A;  5C3E G;  3CW2 C;  4DXG A;  1YIT A;  2EDG A;  4C3H B;  1D5Z C;  3HOW H;  3PIP A;  4GOP B;  1CI3 M;  4ZRZ A;  1TWF B;  1KNE A;  1IBL Q;  4Y52 H;  2JA6 H;  3S1M H;  1VQD A;  1EZ6 A;  3SR1 A;  2BCO A;  1FGB D;  3HKZ E;  4R9W A;  4RWS C;  2JEB I;  4DV2 Q;  1LAB A;  1TWC H;  4HN7 A;  1KAW A;  3TS0 A;  2B2V C;  3S16 B;  5C0X J;  1PTO F;  2XRQ D;  1GHK A;  2JA8 H;  4UP7 A;  1K3B C;  3M4Y A;  1F9Q A;  4ZQ3 A;  4IFD H;  2E76 C;  5GRO A;  1A2T A;  1MJC A;  3HP3 A;  4DAV A;  4C2M H;  1TII D;  1B3A A;  5KND A;  1HZ9 A;  1DGS A;  2PCF B;  4K0K L;  3HOV B;  1MBY A;  1SNC A;  4XYQ A;  4LUO A;  3NTI A;  2TMP A;  2QA4 A;  3OTO L;  4LF5 L;  2L9H A;  2R92 G;  5M3M H;  1E3P A;  2F0U A;  3ND8 A;  5LHY 1;  5EBD A;  3F2D A;  3UDX A;  2ICE C;  1C48 A;  2IX0 A;  4A93 H;  4IJL A;  1FNV A;  4JV5 L;  2HQL A;  2YYZ A;  4K6L A;  3LGJ A;  1B53 A;  4DA2 A;  4BBS H;  4YCV A;  2Z1C A;  1YNJ C;  3QWN A;  3BVZ A;  3RLO A;  5IP9 H;  4A3E H;  1XNQ Q;  2JP1 A;  1ESR A;  5FLM H;  2NVX H;  1DOK A;  5J1Z A;  3S2D B;  2DNE A;  1PYW D;  2Z0S A;  2JEA I;  1Z6H A;  4MHE A;  3KYH C;  5EGT A;  1SNO A;  4A3I G;  1DOM A;  3I8Z A;  4F87 A;  2PW7 A;  4KY6 A;  2LXJ A;  4LMQ D;  1QIL A;  2AWO A;  1EL0 A;  4B3S Q;  4M1U B;  4OO1 I;  2PQA B;  5I2X A;  3CU7 A;  2PPB C;  1I94 L;  4XT1 B;  1OXT A;  1S5D D;  2L12 A;  3D4R A;  4OON A;  2F3I A;  1GHJ A;  4QIW B;  5A35 A;  3Q22 A;  2RHS B;  5G3L F;  3MFG A;  2VB2 X;  1K83 H;  3PO2 G;  2R93 H;  3CCQ A;  1WI5 A;  2ENB A;  4BY7 B;  3E6Z X;  5IOD A;  1BQQ T;  4IPD A;  1PFB A;  2AHO B;  3EQL C;  1QNU A;  3MXN B;  4B08 A;  1JOR A;  3DMU A;  3U58 A;  2SOB A;  3B6Y A;  1XTD A;  4I7A A;  1PFN A;  3M4Q A;  3AFQ A;  1F2L A;  3PO3 H;  3X3N A;  3F2C A;  3L9A X;  4A4I A;  1EOV A;  5E1F A;  4ODG A;  4JI3 Q;  2IHE A;  5M5Y H;  5FO7 B;  3I55 A;  4KHP Q;  5IYB H;  3HOZ B;  4B3T L;  5IGC A;  2SNS A;  4WRD A;  4WJ3 M;  2IJ0 A;  1MI2 A;  5TSS A;  2FMM A;  2Z4H A;  1J5E Q;  4PG3 A;  3KF8 B;  2Q8R E;  3I4M G;  4ZAI A;  2RDG A;  1HR0 W;  1HZA A;  1PH4 A;  2YU9 B;  2WAC A;  2CFM A;  3BYY B;  1MJE A;  2UUB L;  3Q23 A;  2LXK A;  3NE5 B;  1EIG A;  4PNY A;  1YJN A;  1A3T A;  3EN2 A;  5CV6 A;  1S3O A;  2SEB D;  4GKJ Q;  1LAC A;  2VUM G;  5IGF A;  2VS1 A;  2Z6K A;  2M9V A;  1CZW A;  3N6R A;  3S14 B;  2WAQ G;  3GTL H;  1RCV D;  4C1N I;  4C1N K;  1HCZ A;  1S5E D;  4R8N A;  3IL8 A;  3TP7 A;  1HQR D;  4QIW E;  3A0J A;  1PVO A;  1P16 A;  1B2T A;  5C4Z A;  3U4V A;  1WOC A;  4DGZ A;  1OXV A;  4RHR A;  5C3X A;  2K04 A;  2MPM A;  5M5W H;  3T1H L;  1M1K C;  1N32 L;  1VQJ A;  3N52 A;  4IOC A;  1HA5 A;  4A3K H;  1EY0 A;  4JCV E;  4C3I G;  1A15 A;  1QVG A;  2K50 A;  3R2I A;  3MTS A;  4XQJ A;  3D0F A;  2A5H A;  5JAV A;  3SVM A;  3HOW G;  2GVA A;  1NJI C;  3CD6 A;  2K52 A;  3CPF A;  3J80 L;  2E2I B;  3H09 A;  2UXB L;  4HJ5 A;  3TZU A;  3NBH A;  1FL0 A;  2EY6 A;  3GP7 A;  4NB3 A;  1EY9 A;  1TS5 A;  2FFK B;  2OCE A;  2NN6 H;  1S72 A;  1ONL A;  2KCN A;  1R4Q B;  2F0F A;  2K32 A;  1IBK L;  1HH2 P;  4DV1 L;  2RSO A;  5I6W A;  2RKS A;  3K59 A;  3PGZ A;  2CW0 C;  4YCU A;  4UPA A;  4XTC S;  3C1F A;  4KKS A;  4FYD A;  1PH5 A;  2WP8 J;  5JEA J;  1ZYR D;  4YIJ A;  3MWY W;  5LMN Q;  4N9T A;  3GTJ H;  1GUW A;  3D8G A;  1JIC A;  2CH4 W;  3NTH A;  3E0J A;  3A8J E;  5ELF A;  1ICW A;  4RHS A;  4JI0 L;  4BXX H;  1VQ9 A;  1R9T B;  2K28 A;  5HGT A;  2EPB A;  1JE5 A;  3U4Z A;  1D1K A;  1BKB A;  2JYO A;  5ISR A;  1TWH H;  2F0O A;  1NSN S;  2NUC A;  5CV9 A;  3NHH A;  2JK8 A;  4RCO A;  2R7F A;  1PH8 A;  4OWX B;  4KD4 A;  4X62 L;  4DR1 L;  4BBS G;  1SMY D;  2A19 A;  2K03 A;  4POF A;  3CP0 A;  5IP9 G;  4A3E G;  2K5W A;  4DV5 L;  1X6O A;  1LTI D;  1RKN A;  4X3U A;  2PMZ B;  3E0E A;  3SEB A;  4OO1 H;  5M5X B;  5C4X B;  4Y7N B;  1QUQ A;  1WJJ A;  4AQY Q;  1STH A;  3KDF B;  2I07 B;  3J7A V;  1MGS A;  3PIO 3;  3LX0 A;  4AYB G;  1D7Q A;  3H94 A;  1HNX L;  2L11 A;  4K2L A;  4KHV A;  5K5P A;  3ND9 A;  4A3L H;  5E4X A;  4HJ7 A;  1KAA A;  1S40 A;  1GXD C;  1BCP D;  3G4S A;  5EKK A;  5EAY A;  4POG A;  4X64 L;  4JI6 Q;  4JOI A;  1EIH A;  1M8A A;  4OIK A;  5IT9 c;  1ET9 A;  1Y1W B;  5LMN W;  2R93 G;  2Y0S G;  4LF8 Q;  1HNZ Q;  2UUA Q;  4ULL A;  1N36 Q;  4K6D A;  4UAI A;  3K8A A;  1NAP A;  2D9U A;  1A62 A;  3S1R H;  1N33 Q;  3BDL A;  4JI4 L;  1XJV A;  1E1O A;  1O7Y A;  4FXG C;  4O1N A;  5GAH C;  3PQI A;  4IUU A;  3PO3 G;  3NEN A;  5KYI A;  2NVY H;  2UXC Q;  1IBM Q;  4A3D H;  4F8M A;  3PUX A;  4MZ9 A;  4GNX A;  2CQO A;  5J39 A;  2K5V A;  5IYB G;  1J6Q A;  2F03 A;  4QY7 A;  1FJG Q;  2OEO A;  1WTW A;  3CCL A;  1BBX C;  4A3B G;  2ICI A;  4KLK A;  1HNW L;  4C3J H;  1CTM A;  2NWG A;  3OMG A;  2L4N A;  2ZT9 C;  2PI2 E;  4CJ1 B;  3OSO A;  3BZC A;  3TP6 A;  1PYB A;  3UDI A;  1PTO D;  1MHW C;  3HOY H;  5C0X H;  1V1O A;  2RDH A;  3RZO B;  2EE1 A;  4GKK Q;  1E24 A;  4R1J A;  3RLN A;  2B29 A;  4CGY B;  4IUR A;  1AFP A;  1IYU A;  3T4A C;  2UXD Q;  2EYH A;  2IHF A;  1C9O A;  2R6G A;  2KHI A;  2EYJ A;  2X69 A;  5D65 A;  2F0Q A;  1BR9 A;  1CKN B;  4ALP A;  5ELB A;  3CCV A;  1WCM G;  4QJF A;  2KJX A;  2GVB A;  2WB1 B;  2Z6K C;  2ZM6 Q;  1NY4 A;  4P72 A;  2FIN B;  4DFA A;  3ULP A;  3VDY A;  3JAM c;  2R61 A;  5C5L A;  3FRP B;  1G51 A; 
#chains in the Genus database with same CATH homology
 1L1O C;  3KFU A;  3I4M H;  4GKJ L;  4A93 G;  4DV4 Q;  2F4V L;  1P8L A;  1XMQ Q;  1VQN A;  4DV2 L;  4X66 L;  3HOV G;  4JC0 A;  5IWA Q;  2R7Z H;  4DR4 Q;  2B63 H;  2AKW B;  5JJK A;  1YJW A;  2VQF Q;  1EWI A;  3H0G H;  4R4Q A;  4R4T A;  3FP9 A;  3CCS A;  1VQ5 A;  4X6A H;  3GTM H;  1HJP A;  4DK6 C;  2NVT H;  3FKI H;  1X9N A;  3EBE A;  4YHH Q;  1VQF A;  4PMW A;  5BR8 Q;  1BBW A;  5FLM G;  1R9T H;  1KQS A;  2BH2 A;  2VW9 A;  1EYG A;  3AEV A;  2OTJ A;  1EIF A;  1X3G A;  4BY1 G;  5K36 G;  3S1N H;  2D0O A;  2NN6 G;  4A3F G;  1GM5 A;  2JA7 H;  4H02 A;  1YHQ A;  4IPC A;  3HFZ B;  4A3J H;  2K75 A;  3RN2 A;  1PHJ A;  1CKO A;  2ZJP A;  4JI5 L;  1TXY A;  3AQQ A;  4A3M G;  4UP8 A;  4GLA C;  1LUZ A;  2NZH A;  1Q7Y C;  1TWG H;  2N8N A;  5IY0 A;  1VQ7 A;  3BU2 A;  4UP9 A;  4MTN A;  2YTV A;  5H1S E;  5LMU Q;  1CSQ A;  2D0P A;  4DUZ Q;  1IBK Q;  1K73 C;  3GTP H;  3OW2 A;  4DV1 Q;  2E5L Q;  2WB1 G;  1QVC A;  5M5X H;  4Y7N H;  4LF4 Q;  1B7Y B;  4HJ8 A;  3GTQ H;  4GLX A;  4IFD I;  4DUY L;  3J81 i;  4B3M L;  3KJO A;  4MNO A;  2R7D A;  4A3G G;  3HKZ G;  1EQQ A;  1YHA A;  4TQU S;  1M90 C;  1MKH A;  3A5Z B;  3SGI A;  3WWV A;  4A3B H;  2L15 A;  2QGQ A;  4DR2 Q;  2I5L X;  3AFP A;  2YU9 H;  1XNQ L;  4C3I H;  3BZK A;  2NVQ H;  1V9P A;  1A63 A;  3NBH B;  2BH8 A;  5C3E G;  3S17 H;  1YEZ A;  1UE7 A;  2OQK A;  3CW2 C;  4LWC A;  4HIO A;  2KHJ A;  1N34 Q;  2UUC Q;  1YIT A;  2HHH Q;  2D62 A;  3JAM i;  5JEA G;  2WB1 E;  3HOW H;  3PIP A;  1HR0 L;  4GOP B;  4IPG A;  4JI7 L;  1IL2 A;  3HOX H;  3KJP A;  1Y1W H;  1Q82 C;  1LYL A;  2JQO A;  4JI8 Q;  1IBL Q;  2CWA A;  2JA6 H;  4Y52 H;  3S1M H;  4P73 A;  4A3C H;  1VQD A;  3M4P A;  2CWP A;  3HKZ E;  4J15 A;  4OXP A;  2JEB I;  4BY7 G;  4DV2 Q;  4X66 Q;  1TWC H;  4YCW A;  1N8R C;  4GN4 B;  4B3S L;  4OX9 L;  1KAW A;  3STB D;  1Y14 B;  2MO1 A;  3RR5 A;  4R4O A;  3TS0 A;  4OO1 G;  1VQI A;  5C0X J;  1WYD A;  3CME A;  3L7Z C;  1L0W A;  2JA8 H;  3HOU H;  4UP7 A;  2EXD A;  3JC6 6;  2VY3 A;  3EIV A;  3CCE A;  3H15 A;  1VQP A;  4UY8 C;  5GRO A;  1MJC A;  3PCO B;  5HY6 A;  4A3L G;  4C2M H;  5DLQ E;  1HZ9 A;  1DGS A;  2ZTE A;  3KDF A;  1WCM H;  4K0K L;  3HOZ G;  4LUO A;  1YNX A;  3KF6 A;  2QA4 A;  3NEM A;  3OTO L;  4LF5 L;  2ASB A;  1G29 1;  2R92 G;  4BA2 I;  5M3M H;  1E3P A;  4GN5 A;  3F2D A;  4HID A;  3UDX A;  4DR3 L;  1YZ6 A;  2IX0 A;  4A93 H;  4NPS A;  3L2P A;  4IJL A;  4P75 A;  4JI3 L;  1Q1E A;  4DUY Q;  1JMC A;  4JV5 L;  1X3F A;  4LUZ A;  4QL5 A;  5IP7 G;  2HQL A;  2Q2H A;  2YYZ A;  3I2Z A;  4AIM A;  3S1Q H;  2YV5 A;  3LGJ A;  4X65 Q;  4JG2 A;  4KHP L;  4BBS H;  4YCV A;  1Y1V H;  4RG1 A;  1YVC A;  3RLO A;  3UDG A;  4AQY L;  5IP9 H;  3M7N A;  4A3E H;  1QUQ B;  3ULL A;  5FLM H;  1AE2 A;  1XNQ Q;  3RZO H;  2NVX H;  1J5E L;  3FHW A;  3DM3 A;  4BY1 H;  5J3B A;  4L5S A;  1KD1 C;  4A3F H;  4L5R C;  1KL9 A;  2Z0S A;  2JEA I;  4R4I A;  2N49 A;  3DLL A;  4QGU A;  4A3D G;  2UU9 Q;  4LF6 L;  3CPW A;  3KYH C;  2HIX A;  1PV4 A;  1HZC A;  1EFW A;  4DV7 L;  3KLW A;  4L5Q A;  4NXM L;  2ZTD A;  4DV6 L;  4A3I G;  2VQE L;  3BJU A;  4A3M H;  2LXJ A;  4YWL A;  2AWO A;  2CCZ A;  4LF9 L;  4DR7 L;  1VS0 A;  1K3R A;  5IYD G;  4A3K G;  1SFO H;  4JI6 L;  5IYC G;  3CF5 A;  2GN5 A;  4OX9 Q;  4B3S Q;  4NXN L;  4OO1 I;  2PQA B;  1Q8K A;  3H3V I;  2IY5 B;  2IT1 A;  1I94 L;  5AJ3 L;  1KC8 C;  1OXT A;  1HNZ L;  2I5H A;  1AH9 A;  4KHZ A;  3GTG H;  2UUA L;  5FJ8 G;  3CCU A;  4YWK A;  1N36 L;  4OON A;  2KEN A;  2F3I A;  3J7Z C;  3PIO A;  1VQH A;  2RHS B;  2YTX A;  1C0A A;  4JI2 Q;  1K83 H;  1KRS A;  3M85 A;  3PO2 G;  4GNX C;  1W3S A;  1OXU A;  4LFA L;  2R93 H;  3CCQ A;  1WI5 A;  3UE0 A;  2VL6 A;  1Q81 C;  1E1T A;  5M3F H;  4XIG S;  4IPD A;  2E2J H;  4DV3 Q;  2UXC L;  3J81 j;  1C7Y A;  4LF5 Q;  1JT8 A;  2AHO B;  3MXN B;  4DR6 Q;  1XMO L;  1X54 A;  3M9B A;  3U58 A;  1V1Q A;  2MNA A;  3RN5 A;  4GNX B;  2WFW A;  3B6Y A;  1XTD A;  5ELO A;  1RIP A;  3M4Q A;  4HJ9 A;  1PH3 A;  3AFQ A;  1FJG L;  2ID0 A;  4DR3 Q;  3CMA A;  2ZJQ A;  1Q1B A;  3PO3 H;  4LFB L;  2JA5 H;  3W1B A;  1IYJ B;  4A4I A;  3F2C A;  2OWO A;  1EOV A;  5C4X H;  4JI3 Q;  2KBN A;  4O0A A;  1YHB A;  2IHE A;  4JV5 Q;  5M5Y H;  1EUJ A;  1D8L A;  3I55 A;  4KHP Q;  4A76 A;  5IYB H;  3H3V H;  2RHQ B;  4GOP C;  1JJ2 A;  1CKN A;  4B3T L;  4WJ3 M;  1UEB A;  1Q12 A;  5GQO A;  1W2B A;  4BXX G;  5C44 H;  1J5E Q;  4PG3 A;  2NZO A;  3KF8 B;  1PH1 A;  4WJ4 A;  1XPO A;  3I4M G;  2A1A A;  1HR0 W;  1Q46 A;  1HZA A;  1PH4 A;  4LF6 Q;  2K5H A;  1PYS B;  2CFM A;  2UUB L;  1MJE A;  4DV7 Q;  2R7Z G;  2LXK A;  4NXM Q;  4IFD J;  1XPU A;  4DR5 L;  2VQE Q;  3H0G G;  2E8G A;  1YJN A;  5FLX c;  3EN2 A;  4JBW A;  3CC2 A;  1S3O A;  2H5X A;  4GKJ Q;  2V1C C;  4JYA L;  2VUM G;  2VS1 A;  2Q2I A;  2Z6K A;  2F4V Q;  1HNW Q;  4PZ6 A;  3AYH B;  1Z9F A;  1I94 Q;  3GO5 A;  1JB7 A;  5AJ3 Q;  1K8G A;  4C3H H;  2WAQ G;  1B8A A;  1B70 B;  3Q8D A;  4LUV A;  5LMN L;  3GTL H;  1L1O A;  5JJL A;  1VQL A;  1TWF H;  3M3Y H;  3UE1 A;  5IP7 H;  3CC7 A;  1I6H H;  2N3S A;  1MIU A;  3GTK H;  2PI2 A;  4JI1 L;  2NN6 I;  4QIW E;  3A0J A;  1X65 A;  1P16 A;  4JBJ A;  2Q2T A;  1PVO A;  1NMF A;  1GD7 A;  3U4V A;  2UU9 L;  2XTI A;  1WOC A;  3RLF A;  4JI5 Q;  1OXV A;  3S16 H;  3PF4 A;  3M4O H;  1XMO Q;  1K8A C;  1EQR A;  2OTL A;  1XMQ L;  4LF7 L;  1VQA A;  1XNR L;  4DR4 L;  2WAQ E;  5M5W H;  3T1H L;  3A5U A;  1KXL A;  1M1K C;  3RNU A;  1N32 L;  3TRE A;  1VQJ A;  4IOC A;  4YHH L;  1SMX A;  4JCV E;  4A3K H;  4IPH A;  4BBR G;  3GDE A;  1QVG A;  1ASY A;  2K50 A;  3L0O A;  4GN3 B;  2EIF A;  3NEL A;  3D0F A;  4B3M Q;  1CSP A;  3HOV H;  2PMZ E;  1VQ6 A;  4B3T Q;  3HOW G;  3U50 C;  2GVA A;  3ULJ A;  1NJI C;  1H95 A;  3CD6 A;  4B3R L;  2K52 A;  3CPF A;  2ATW A;  2UXB L;  4HJ5 A;  1Y1W G;  2I5M X;  3PUV A;  4IOA A;  1FL0 A;  2K4K A;  4A3C G;  4NB3 A;  1VQ8 A;  1SN8 A;  5IE8 A;  1O7I A;  3J7A 5;  1VQK A;  2OCE A;  1S72 A;  1QZH A;  3I4N G;  2F52 A;  4DAM A;  4GOP A;  4DUZ L;  4JOI C;  5C4J H;  2UUB Q;  1HR0 Q;  2K5N A;  3S24 A;  1IBK L;  4JI7 Q;  1GO3 E;  1HH2 P;  1LM0 A;  4FDB A;  3STB C;  4DV1 L;  1PH2 A;  2E5L L;  1JJG A;  5GAD C;  3PGZ A;  4LF4 L;  4HIM A;  1X55 A;  3HOU G;  4YCU A;  4UPA A;  4XTC S;  2PNH A;  3A74 A;  4JYA Q;  4HIK A;  3ICE A;  4IO9 A;  3S2D H;  4O2D A;  3CC4 A;  2FXQ A;  2HIV A;  2WP8 J;  1PH5 A;  5JEA J;  1A0I A;  3K7U C;  1X56 A;  5LMN Q;  4LF8 L;  2A8V A;  2MQH A;  3F1Z A;  4DPG A;  1I3Q H;  3GTJ H;  2YTY A;  3F2B A;  3OYY A;  1EIY B;  3T1Y L;  1VQC A;  2UUC L;  3TRZ A;  2BA1 A;  1I5F A;  3D31 A;  4DNI A;  4HJA A;  1N34 L;  1U0L A;  1KHI A;  4A3G H;  4ME3 A;  4QQB X;  1IXR A;  3HOY G;  5C0X G;  2DGY A;  1N33 L;  4YY3 L;  4JI0 L;  4BXX H;  1CKM A;  1VQ9 A;  4JI8 L;  1XPR A;  4JBM A;  4R4C A;  4PZ7 A;  1JE5 A;  2RF4 A;  3U4Z A;  5C3E H;  1X3E A;  1BKB A;  4K0K Q;  2KCM A;  1IBM L;  1TWH H;  3OTO Q;  4LF7 Q;  1GVP A;  2JK8 A;  1XNR Q;  1VQE A;  4TVA B;  2R7F A;  3T1H Q;  1SRO A;  3ZJY C;  4OWX B;  1PH8 A;  1N32 Q;  4X62 L;  2MO0 A;  4DR1 L;  4BBS G;  1Y1V G;  2A19 A;  3PUW A;  2N78 A;  4L5T A;  4POF A;  3CP0 A;  5IP9 G;  1L1O B;  4A3E G;  4GS3 A;  3PF5 A;  2ZTC A;  1E22 A;  1VCI A;  1X6O A;  5HGQ A;  4DV5 L;  3RZD H;  2VUM H;  4BY7 H;  1BVS A;  1SRU A;  1NMG A;  4LFC L;  1FVI A;  3E0E A;  1IZ6 A;  3ERS X;  3CCR A;  3GD7 A;  3PUY A;  2UXD L;  4B3R Q;  1YJ9 A;  2QEX A;  1QUQ A;  2UXB Q;  1WJJ A;  5ELN A;  4AQY Q;  3W1G A;  4OWW B;  1KRT A;  3KDF B;  4EQ5 A;  1ASZ A;  1NTG A;  3F8T A;  3I7F A;  3KF6 B;  2XGT A;  4AYB G;  3TQY A;  1D7Q A;  1BBU A;  1SLJ A;  3CCJ A;  1VQB A;  1HNX L;  2ZJR A;  1RL2 A;  3GTO H;  3S15 H;  4A3L H;  1JJC B;  4HJ7 A;  1S40 A;  2B63 G;  4DV6 Q;  1NE3 A;  2ES2 A;  3PV0 A;  1TWA H;  1PH7 A;  3G48 A;  3HOZ H;  4GKK L;  1T9H A;  3E9H A;  3G4S A;  5EAY A;  4POG A;  2R92 H;  3FKI G;  2JE6 I;  3ER0 A;  4X64 L;  4P74 A;  4LF9 Q;  4JI6 Q;  4DR7 Q;  1CUK A;  3HKS A;  1PFS A;  4JOI A;  2I0Q A;  4X65 L;  2CKZ B;  2PQA A;  5IT9 c;  3KOJ A;  1HZB A;  2E2H H;  4NXN Q;  3W5O A;  5LMN W;  2R93 G;  3TEH B;  1I50 H;  2JA9 A;  2Y0S G;  4LF8 Q;  2JA7 G;  1K9M C;  1HNZ Q;  3IRB A;  3E9I A;  2UUA Q;  4A3J G;  3I56 A;  3G6E A;  4BBR H;  3T1Y Q;  5M3F G;  4AYB E;  1N36 Q;  4AH6 A;  3K8A A;  3K80 C;  5C0X I;  1NBW A;  1Q86 C;  1A62 A;  3PSI A;  1E7Z A;  4PZ8 A;  3S1R H;  1A8V A;  5JJI A;  1N33 Q;  4YY3 Q;  3G71 A;  4DV0 L;  4LFA Q;  4JI0 Q;  1XJV A;  4JI4 L;  4JBK A;  1E1O A;  2ZM6 L;  5GAH C;  3PO3 G;  2JA5 G;  3NEN A;  3S14 H;  2LSS A;  2NVY H;  1YIJ A;  1IBM Q;  3S2H H;  3I4N H;  2UXC Q;  5C4X G;  2VZA A;  3J80 c;  4DV4 L;  4A3D H;  2Y0S E;  1N9W A;  3CQZ H;  3PUX A;  4MZ9 A;  4GNX A;  5IWA L;  2CQO A;  4X62 Q;  2K5V A;  4DR1 Q;  4A3I H;  5IYB G;  1J6Q A;  1V43 A;  4QY7 A;  1FJG Q;  2VQF L;  2VNU D;  3CCL A;  1OXS C;  4LFB Q;  2EQS A;  1YI2 A;  4A3B G;  2OQ0 A;  5C44 G;  4DV5 Q;  1K0R A;  5IYD H;  4KLK A;  4RMF A;  5IYC H;  5BR8 L;  4C3J H;  1HNW L;  2AWN A;  4LFC Q;  4OWT B;  4JI2 L;  4LW1 A;  3CXC A;  2PI2 E;  1VQG A;  1PH6 A;  1VQ4 A;  1L2F A;  4APV A;  2BA0 A;  1VQO A;  5E7N A;  3BZC A;  5GAG C;  5FJ8 H;  1OXX K;  1PYB A;  1PA6 A;  3UDI A;  3HOX G;  1G6P A;  4DV3 L;  4DR6 L;  2JA6 G;  2AMC B;  3HOY H;  4IJH A;  4P71 A;  3PO2 H;  4YWM A;  1SE8 A;  1HNX Q;  3UDF A;  1GKH A;  1FGU A;  2K14 A;  3CAM A;  5LMU L;  4DKA C;  3MEF A;  4DR5 Q;  4GKK Q;  1E24 A;  4GLV B;  3K81 C;  4R1J A;  3RLN A;  2JJQ A;  1SR3 A;  2RCN A;  2B29 A;  4LNQ A;  3PUZ A;  2Q2U A;  4X64 Q;  2E2I H;  2JA8 G;  2UXD Q;  2IHF A;  4EX5 A;  1C9O A;  1UWV A;  4DK3 C;  1QZG A;  2ALY B;  2MFI A;  2R6G A;  1WFQ A;  2KHI A;  4IFD G;  1YBY A;  1QVF A;  3K7A H;  1UE5 A;  1VQM A;  3I4O A;  2C35 B;  4DAY B;  1CKN B;  1OTC A;  3J81 c;  1AE3 A;  4DR2 L;  4ALP A;  1UE1 A;  1KIX A;  3TS2 A;  4A75 A;  1PH9 A;  3K0X A;  3CCV A;  1WCM G;  4QJF A;  1LTL A;  2GVB A;  1UE6 A;  2B3G A;  1Z47 A;  4JI1 Q;  5GAE C;  3CCM A;  2Z6K C;  2HHH L;  2IX1 A;  4DV0 Q;  4JI4 Q;  5M3M G;  2ZM6 Q;  1NY4 A;  4KI0 A;  4P72 A;  2KCT A;  3J80 i;  1U5K A;  3ULP A;  3VDY A;  4BA1 I;  3JAM c;  2HT1 A;  1IBL L;  2DUD A;  1G51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...