2UUAQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaQ00
4LF4Q 1QUQA 1L1OC 2N8NA 3HOWH 4GN5A 1JJ2A 2WP8J 1YIJA 3S16H 4DR6Q 4DR7Q 1Y14B 1PV4A 3S1MH 4A3KH 4JYAL 5H1SE 4LF8Q 4GN3B 4DV3L 1Q1BA 1VQDA 4A3BH 3A5ZB 5LMNQ 4DUYL 1BKBA 2NN6G 1IBLL 4GLAC 4GLVB 1L0WA 4ME3A 1EUJA 4P75A 3J81c 1Q7YC 4YHHQ 1SE8A 3B6YA 4DV0L 1QZHA 3GTOH 3M7NA 2UXBQ 2AHOB 3L0OA 4BY7G 2OWOA 1XMQL 5IWAL 4JYAQ 2Q2HA 1LYLA 2KENA 4KI0A 3CAMA 3T1YL 4XIGS 3S14H 3M3YH 4DR5L 3RNUA 5GROA 2F52A 2HHHQ 4A3LH 1OTCA 5IP7G 2HHHL 2ASBA 1S3OA 4HJ9A 4IOCA 4A3GG 4JBJA 4IPCA 2F4VL 4YY3Q 1VCIA 4L5SA 2N49A 4BXXG 3CCVA 1T9HA 4BXXH 1H95A 1NJIC 1CUKA 4AQYQ 4A3MH 2R92G 4X62L 2YYZA 4GNXC 1XPUA 1VQGA 1YNXA 3RR5A 5IP7H 3S1RH 1XJVA 3S2HH 3STBD 2HT1A 1S40A 2HIVA 4A3EG 1YBYA 1Q1EA 1CKNA 5HGQA 4A3JH 1EOVA 1G51A 4OO1I 2NZOA 2YTYA 4P72A 2V1CC 2D62A 1IBKL 4GLXA 2JA9A 2N78A 1WCMG 3K81C 4R4OA 1IXRA 5C4JH 3WWVA 1E7ZA 3DLLA 1PFSA 4HJ7A 3ICEA 3UDIA 2OTLA 2R7ZH 4MTNA 3DM3A 5GQOA 1CSQA 4IFDI 2UUBQ 4YWLA 3K7UC 4HIDA 1KD1C 3PUWA 3ERSX 3CD6A 5DLQE 4DR3Q 1PH9A 1CSPA 3T1HQ 3HOUH 1OXUA 1WOCA 1EYGA 3D31A 1Q46A 1KRTA 2WAQE 4A3CG 2LSSA 1UE5A 5AJ3L 4GN4B 1PH7A 2B63G 4LFBQ 3PGZA 1N33Q 1N9WA 1UEBA 1X6OA 3EBEA 5IYCG 5M3FH 1JB7A 1N34L 2CWPA 3E9HA 2R93G 4JI8L 4UP7A 4A3FG 4GOPB 4DR1L 2Z6KC 5K36G 5JJKA 2OQKA 1HNZL 5M3FG 3JC66 4DUZL 3RLFA 2Q2UA 1K0RA 2E8GA 4A3IG 2JA7G 1N36L 4A3CH 4X66Q 1GO3E 2KBNA 2ZTEA 1PVOA 2LXKA 1XTDA 1PHJA 3GTPH 2ZJPA 2NVXH 5HY6A 5BR8L 1VQAA 2I5HA 2JA5H 1OXVA 4DV6L 4K0KL 1WYDA 2ES2A 1PH3A 5LMUL 1IYJB 4ALPA 4X66L 5C4XH 1KAWA 3PIOA 1YJNA 1NMFA 3MXNB 2R7ZG 1N36Q 2Z6KA 2I5MX 3ER0A 2I5LX 3M4QA 3OTOL 3KF8B 1EWIA 4BBRH 2PMZE 4JBMA 3J7A5 4DUYQ 1HNWQ 2JQOA 5FLXc 1V9PA 4DR4Q 2RCNA 4DPGA 3TREA 1MJCA 3OW2A 3H0GG 2VL6A 3F2BA 4A3MG 1GD7A 4MZ9A 3K7AH 4Y52H 4PMWA 1WCMH 3J81j 4QGUA 1Q82C 2JA7H 4AYBE 4EQ5A 1A0IA 1E1TA 2RF4A 3HOXG 1VQHA 4KHZA 4X64L 4A3JG 1U0LA 3U50C 1SRUA 1Q81C 1VQMA 2QGQA 3EN2A 2UXDQ 1NMGA 4FDBA 4TVAB 5C0XJ 2H5XA 4B3ML 1SMXA 2UU9L 2UUAL 4R4IA 2Q2TA 4BY7H 1QVCA 4OXPA 4LF6Q 1KRSA 4B3RQ 2CQOA 4JV5L 3EIVA 1X65A 3S15H 2NVYH 4DV1Q 2MNAA 1IZ6A 2E5LL 3K80C 2NZHA 1P8LA 3I4OA 4R4TA 2Y0SG 4JI7L 2FXQA 1QZGA 1X9NA 1B7YB 5M3MG 1L2FA 3UDGA 3CC2A 1I5FA 4B3SQ 1OXXK 1UE1A 2E2JH 4B3SL 4DV2L 4GOPC 2ATWA 3S1QH 2RHQB 3G71A 4DR1Q 4Y7NH 2EQSA 4LFAQ 4JCVE 4HIKA 2IY5B 1X55A 1YEZA 2K14A 3S1NH 1HJPA 1V43A 2K52A 3GTLH 4X6AH 1VS0A 4IFDJ 1Q12A 4X65Q 2CCZA 1XNQQ 2MQHA 2R93H 3RN5A 2VY3A 2AKWB 4DR3L 3HOWG 4JI4L 2JA6H 3RLNA 4LF5Q 1TWCH 3M9BA 1CKMA 1K73C 5J3BA 3AYHB 2B63H 4LF5L 1NTGA 2N3SA 3Q8DA 3CCQA 1XNRL 1K3RA 5IYDG 1MKHA 1XPOA 1J5EL 1IL2A 3HOUG 1VQ5A 1FJGL 3ULPA 1CKNB 2PQAA 4PZ7A 4R4QA 3PO2H 3HOZG 3GD7A 1PH8A 3U4ZA 4LFAL 2VUMG 1WFQA 2ZTDA 2IT1A 3FKIG 2GVBA 2UUCL 2AWNA 1KIXA 4YWKA 3OTOQ 4DR6L 5IYDH 2A1AA 2JEBI 4OWXB 1PH1A 3PUXA 1Y1WG 4A4IA 3U58A 1YHQA 4JI1Q 1HNWL 5FLMG 1VQFA 3CC7A 2ID0A 1D7QA 3CQZH 3PUVA 1A63A 5C3EG 1YITA 5M5XH 3BZCA 1PYBA 4DV5L 4YY3L 1VQOA 2Z0SA 3H3VH 4A3DH 3F2CA 2MFIA 1TXYA 5IP9H 4JI5Q 2ALYB 2HQLA 3BJUA 4QIWE 1O7IA 1OXSC 5FJ8H 1LTLA 4YWMA 5IWAQ 2ZJRA 1W3SA 2K5NA 1PA6A 4HJAA 1XMQQ 2Q2IA 1XNQL 3G4SA 1TWHH 3J7ZC 4LFCQ 1L1OA 4WJ4A 1B70B 1JE5A 2AWOA 2XTIA 4IPHA 3UE1A 4A75A 3M85A 3VDYA 2WB1G 2VS1A 2I0QA 3PIPA 1GVPA 3CCEA 3PO3G 4DK3C 1Y1VG 4HJ8A 2VNUD 3HFZB 2E5LQ 3CMEA 3E0EA 1HZAA 3PO3H 2EIFA 1VQIA 2ZTCA 3CPWA 4DV1L 3NEMA 4YCUA 3HKZE 3ZJYC 1D8LA 3G48A 2VQEQ 2BA1A 3A0JA 4OONA 1PH6A 1LM0A 4B3MQ 3KJPA 1NY4A 1KHIA 5IYBG 1YJWA 3G6EA 3RZDH 1L1OB 1NE3A 1G291 2K5VA 3FP9A 4O0AA 4QL5A 3RLOA 3CCSA 4DR2Q 4LF6L 3A74A 4IO9A 1XNRQ 1VQLA 1X56A 3CXCA 4LF7L 2YV5A 5ELOA 3HOYG 3CCJA 4YHHL 1YHAA 5C44G 5GAHC 1JJGA 3GTJH 1Q86C 4IFDG 1YVCA 1HZCA 4JI2L 3W5OA 1MIUA 1SLJA 4C3JH 1BVSA 2VQEL 3CCUA 3M4PA 2VUMH 3TS0A 4RG1A 3HOZH 4DR4L 4L5QA 3GDEA 5FLMH 2IX0A 1SN8A 2K5HA 4LF9Q 3H15A 4L5TA 1FJGQ 1PYSB 1VQKA 4BY1G 1VQPA 4BY1H 5C4XG 2A19A 2R7FA 4LUVA 2VW9A 1YZ6A 2L15A 4LW1A 3I2ZA 2NVQH 2OCEA 1PH4A 3J81i 1BBUA 1C9OA 1A8VA 2E2IH 4BBSG 4K0KQ 5JJLA 4JI6L 4JI3Q 4UY8C 3PO2G 2WFWA 4OX9L 3PV0A 5LMUQ 1EQRA 1G6PA 4JOIC 4AIMA 3HKSA 1KQSA 1KC8C 2UXCQ 5C0XG 4IJHA 3AEVA 2JA6G 3BU2A 4JOIA 4HJ5A 3H3VI 1RIPA 4DV0Q 3KJOA 1I3QH 3CP0A 3IRBA 3UDXA 1AE2A 5IYBH 3J80c 4BA2I 3PCOB 1E1OA 3BZKA 3CMAA 3FHWA 3A5UA 4AH6A 1C7YA 2DGYA 1XMOQ 5ELNA 4WJ3M 5JEAJ 4DKAC 2UXBL 4IJLA 3PF4A 3TEHB 4JG2A 4TQUS 1I94Q 2MO0A 1HR0W 4PG3A 3M4OH 3I4MG 3L2PA 4LFCL 3NELA 4AYBG 1SR3A 3PF5A 3CPFA 1AH9A 4LFBL 3GO5A 4LF8L 4JV5Q 2UXCL 1TWFH 1RL2A 1YI2A 4QY7A 1IBMQ 3LGJA 1E3PA 2D0PA 3UDFA 5M5WH 1M1KC 3PUZA 1PH5A 4BA1I 2ZM6L 4LWCA 3KF6A 1J6QA 4P74A 4JBWA 4NXNQ 1HR0L 1C0AA 2JE6I 4KHPL 1TWAH 1QVFA 1Q8KA 1VQBA 1Y1VH 3NBHB 3F8TA 1VQNA 3HOVG 4DR5Q 3I4NG 1SFOH 4LF9L 2UUBL 1JT8A 1A62A 2BH8A 4BBRG 4A3EH 4IPDA 1CKOA 3ULLA 1Z47A 1Y1WH 1YJ9A 1MJEA 1PH2A 5M5YH 1VQCA 2PNHA 3PUYA 4DAMA 1HNZQ 2R92H 3I4MH 4YCVA 1XPRA 2JEAI 3E9IA 2QEXA 3GTGH 3SGIA 3FKIH 4JI7Q 2KHIA 2WB1E 4NXNL 1UE7A 3U4VA 1M90C 1HZBA 1VQ8A 3GTKH 3TRZA 4P71A 4C3IH 4JI4Q 3K8AA 2GN5A 4GKKQ 1HZ9A 3STBC 4MNOA 2YTXA 2QA4A 2RHSB 1N33L 2BH2A 5GAGC 3CCMA 4BBSH 2K75A 4B3RL 2DUDA 2JJQA 4DK6C 1JMCA 5LMNW 1S72A 2Y0SE 4A93H 4APVA 2YTVA 3T1HL 4GOPA 1FGUA 4A93G 3KDFA 1ASYA 4JI3L 1K9MC 1W2BA 4JI6Q 4NXML 1FL0A 5GADC 1VQJA 4GNXA 2IX1A 2CFMA 4PZ8A 1I94L 2WAQG 3CW2C 1JJCB 3I7FA 1X3FA 1BBWA 4DV3Q 3J80i 2YU9H 2GVAA 1HH2P 4H02A 4JBKA 1E22A 5C44H 4A3IH 1OXTA 4B3TQ 1QUQB 5IT9c 1WJJA 1X3GA 2K50A 1K83H 2VZAA 2ZJQA 2B29A 1AE3A 2R7DA 4J15A 2IHEA 3JAMc 4A3FH 3NENA 3CC4A 4OO1G 4YCWA 2NN6I 2BA0A 2C35B 2ZM6Q 4OX9Q 4IPGA 4GKKL 5IE8A 5IYCH 3HOVH 3I4NH 3CCRA 1HR0Q 5IY0A 1N32Q 1KL9A 2K4KA 2XGTA 4OWWB 3F1ZA 4UPAA 4DV4Q 3CF5A 3KOJA 3ULJA 4DV7Q 2F4VQ 4JI1L 2KCMA 2VQFL 4GKJQ 1I6HH 3CCLA 3I56A 5BR8Q 2JA8H 4OWTB 1VQ9A 4DAYB 2KCTA 4LUZA 1IBML 5M3MH 5E7NA 3T1YQ 2OTJA 1Z9FA 3HOXH 3S2DH 1I50H 3TS2A 1X54A 3KYHC 4POGA 3HKZG 1EIFA 4O2DA 1KXLA 1LUZA 1XMOL 3TQYA 4JI2Q 2A8VA 1HNXQ 4DUZQ 3S24A 4NXMQ 1HNXL 3MEFA 1EIYB 4POFA 3KLWA 3OYYA 1J5EQ 3I55A 2AMCB 1YHBA 1X3EA 4GS3A 5JEAG 5GAEC 3F2DA 1DGSA 5JJIA 4LF7Q 4AQYL 1NBWA 4A3GH 3KFUA 3KF6B 4JI8Q 2CWAA 4DV6Q 5IP9G 4DR2L 1VQ6A 2LXJA 1N34Q 1K8AC 2B3GA 3GTQH 2EXDA 4X65L 1QVGA 4LF4L 1WI5A 5C3EH 3RN2A 5AJ3Q 3S17H 4QJFA 1VQEA 2R6GA 4C2MH 1K8GA 3RZOH 1FVIA 3AQQA 4UP8A 2UXDL 4LNQA 2IHFA 3H0GH 1N8RC 1ASZA 5FJ8G 2KHJA 1P16A 4EX5A 4C3HH 1R9TH 4X64Q 2PI2E 4DV2Q 1EQQA 3K0XA 2PI2A 4LUOA 4RMFA 4GNXB 4A3LG 4A3DG 1EFWA 1IBLQ 4NB3A 5LMNL 2F3IA 1SROA 2CKZB 5C0XI 4A3KG 4IOAA 4QQBX 4L5RC 4P73A 4B3TL 3GTMH 2E2HH 3AFQA 1GM5A 2JA8G 1E24A 1B8AA 1V1QA 4NPSA 1VQ4A 2UUCQ 4DR7L 4KLKA 1UWVA 2D0OA 3AFPA 1IBKQ 2OQ0A 4A3BG 4KHPQ 2JK8A 1UE6A 4JC0A 4DV7L 2JA5G 3W1BA 4R4CA 4R1JA 4HIMA 4PZ6A 4HIOA 4A76A 2UUAQ 2UU9Q 1GKHA 1N32L 4JI5L 3L7ZC 5EAYA 4JI0Q 4X62Q 3KDFB 4DNIA 2VQFQ 3W1GA 1TWGH 2MO1A 3PSIA 4JI0L 3UE0A 4DV4L 4GKJL 4UP9A 4DV5Q 3D0FA 1VQ7A 2HIXA 2NVTH 3JAMi 3HOYH 2PQAB 4XTCS 1U5KA
chains in the Genus database with same CATH superfamily
4LF4Q 1EFID 2NYZD 2N8NA 1BR9A 1TQOA 4DR6Q 2NTTA 3S16H 1IW7C 2AQ1B 1ZXTA 4A3KH 2Z8LA 4LF8Q 4BBSB 3HKZB 3QO2A 1Q1BA 4A3BH 5LMNQ 1BKBA 1PZKD 3TZUA 4ME3A 4P75A 3WDNA 3J81c 1LTSD 2QDLA 3GTOH 3B6YA 1QZHA 3J81E 1RJTA 5IWAL 4JYAQ 3CAMA 4Q0FA 1I4QA 4XDXA 4DR5L 5IP7G 2ASBA 4C3HG 3GV6A 2NB0A 1DOKA 4HSVA 4BXXH 2HQEA 5EPLA 3OW7A 5IP7H 3KBXA 1CQFA 5C3EB 1CKNA 1MI2A 1G51A 1ML0D 1U4PA 3KBGA 4GLXA 1WCMG 1X3QA 3H0GB 4CDEC 4HJ7A 2OTLA 4K2LA 1Y8OB 1EIHA 1J9OA 4MTNA 3DM3A 1CSQA 4IFDI 3SK6A 3DWQA 4XQNA 1H9SA 1KD1C 2M2LA 3ONAB 1PH9A 3SK8A 3T1HQ 3HOUH 1EYGA 1KRTA 1CA6A 3GTPB 1JOOA 1T5EA 4BS9A 4FNFA 3RZDB 3DXJC 3K5LA 3J7AV 3BVZA 1X6OA 3EBEA 5M3FH 1SYCA 2R93G 1JWUD 5ISRA 4OO1H 1EL0A 3LWEA 3BDLA 3X3MA 4A3FG 4DR1L 2XRSD 2X69A 2QILA 5K36G 1EEID 4DK1A 2DNCA 5KIXA 1A6XA 4DUZL 3RLFA 1HTLD 1H9KA 1J8IA 4RAUC 2Z4IA 1N36L 1KLGD 4A3CH 2KBNA 2ZTEA 4WJWA 1PHJA 1HA6A 2ZJPA 4K2KA 1V8QA 5HY6A 3FPPA 1LV9A 4UHVA 1LT5D 5CV5A 2QKIC 2K7VA 2ES2A 3FDTA 4X66L 1BUVT 1W6KA 3NWTA 1K8MA 1EQVA 3MXGA 4G7ZC 4F87A 1QOHA 1XYIA 2PMZE 1VF7A 3QJYA 2JQOA 2RCFA 4DR4Q 2F0IA 3TREA 5D14A 1MJCA 3P1HA 3S1RB 5JOBA 1S4ZA 2VL6A 3F2BA 4A3MG 1UEAB 2ICIA 4Y52H 4PMWA 1G91A 1A0IA 4RHRA 5C4JB 3HOXG 3S1NB 3P7JA 3U50C 1FNVA 2SOBA 3EN2A 2H5XA 1SMXA 2UU9L 4BY7H 2CQOA 1Y8PB 1HFNA 2FHTA 2E5LL 2NZHA 3O13A 4R4TA 3C2PA 1SYEA 1Y1VB 3SXHA 4A3MB 4K8JA 3GP7A 1SE2A 1OXXK 3E3XA 4QUFA 3A55A 1GJXA 4KJNA 1Y8NB 1VMCA 2EQSA 4KKTA 4ZKBB 3PIO3 1HJPA 3EJIA 1XNQQ 2AKWB 4DF7A 2KEDA 4C3JB 4K14A 4LF5Q 1K73C 3GQBA 2B63H 4LF5L 2N3SA 3Q8DA 2QCPX 4OEMB 3NK9A 1AEXA 1XPOA 3HOUG 2V4DA 4KKUA 3ULPA 4OIJA 1CKNB 4PZ7A 5E4XA 3U4ZA 5KNDA 1WFQA 3FKIG 1F2ZA 2CH4A 2GVBA 1O80A 3OTOQ 4HTHA 3LNNA 5I2YA 3U58A 3CC7A 1X32A 3CQZH 1UUPA 1YITA 5M5XH 3MVVA 5C5MA 4C3JG 3NPPA 2Z0SA 4G7HC 3H3VH 4HR7B 2MFIA 5I4DA 5IP9H 3J80L 4JI5Q 4V190 1BCPD 4WORA 2CW0D 2K5NA 3FEWX 1PA6A 3G4SA 1TWHH 2AWOA 3JAME 1ILPA 5HURA 2SEBD 3NWSA 2I0QA 1GVPA 2DNEA 5FO8B 3PO3G 4DK3C 2F0GA 2VNUD 3HFZB 4IUQA 1EY8A 3T4AC 2ZTCA 1SXTA 2ICEC 1STNA 3MTSA 4YCUA 3HKZE 1ICFB 1D8LA 3G48A 4JPBW 2BA1A 4KD4A 4QUCA 3BG3A 5IYBG 1EY5A 1QNKA 3G6EA 1G291 2K5VA 3BZDB 4DR2Q 3CCSA 1XNRQ 2OF1A 2NBFA 4LF7L 3QOLA 5ELOA 3HOYG 3CCJA 4YHHL 1YHAA 5T1IA 5GAHC 5C44G 1JJGA 4RKLA 3EQLC 1YVCA 4O1NA 1HZCA 5IIFA 4KJOA 2VUMH 1BVSA 4RG1A 3HOZH 1NNXA 4FXGC 1FR3A 2B2YA 1PXUA 3MWYW 1ENCA 1PYSB 2K03A 1VQKA 2NZ1D 3J81L 4ZYSA 1CT1D 1L0XB 2A19A 3CRLC 4LW1A 4BBSG 5JJLA 4K0KQ 1BCPF 4ILWA 1V1PB 4AIMA 1KQSA 3R93A 5C0XG 4FF2A 5IGDA 1RIPA 1I3QH 3CP0A 2NVTB 4A3IB 3PCOB 3CMAA 3A5UA 5ELNA 3TP8A 5JEAJ 3TEHB 2RA4A 4FXDA 4BY1B 1EWHA 3R2TA 4IFDH 2HDMA 4PG3A 1O7YA 3EA6A 4AYBG 1SR3A 4PV1C 3PF5A 1AH9A 4LF8L 4JV5Q 1BCPB 1TWFH 1RL2A 1YI2A 1IBMQ 1A3UA 1E2WA 1DXMA 2JXMB 2ZM6L 4CDDC 4LWCA 4JVZA 3C46A 4KHPL 5JAVA 1LTBD 1CK1A 2A69C 3K0YA 3F8TA 3HOVG 3I4NG 4DR5Q 3VR2A 1S5DD 5I6YA 2WACA 1A3VA 1JT8A 4BBRG 2B2WC 3ULLA 1Z47A 3MXPA 1Y1WH 1YJ9A 1PH2A 3HG9A 1FNUA 1QILA 5D65A 2JEAI 3E9IA 4K5WA 2R93B 3SGIA 4JI7Q 2KHIA 2WB1E 1UE7A 1M4VA 5CYUA 3RD4A 1NAPA 1G2TA 2GN5A 1HZ9A 1WTRA 2RDHA 3S15B 1N33L 1STBA 4HMIA 4B3RL 2DUDA 2DJGC 2JJQA 4PQXA 2Y0SE 3BVMA 4IURA 3GTMB 1B1ZA 3NE5B 4NXML 5NUCA 5GADC 1VQJA 1K0SA 4XYOA 3CW2C 2XSCA 3I7FA 4U68A 1X3FA 1I4RA 2GVAA 4NDXA 1KNEA 4H02A 4HMJA 4B3TQ 1X3GA 2QW7A 1K83H 1KDCA 2E76C 1SNQA 5FO7B 1W6JA 2B29A 2R7DA 2HUGA 4KY5A 2FINB 4FF4A 3HOVH 3I4NH 2C5CA 3PIP3 3F1ZA 4FO2A 4DV4Q 3ULJA 2F4VQ 4A3BB 4JI1L 2VQFL 3CCLA 3I56A 3HOXB 3J7AF 1XXGA 2OTJA 2F0DA 1Z9FA 1WTXA 3TS2A 1EZ6A 1EIFA 2PYKA 4DUZQ 1TT2A 2WV6D 4G4KA 1EIYB 4POFA 1HXYD 3OYYA 5BN3A 1X3PA 1X3EA 5GAEC 4AQYL 5CV7A 3TZDA 2CWAA 4DV6Q 5IP9G 5JPNC 4DR2L 2LXJA 5I2XA 1N34Q 3T16A 2EXDA 4X65L 3H6MA 5FOBB 4LF4L 4ZRZA 4QJFA 3HGBA 1VQEA 2R6GA 5C0XH 1RODA 1GUTA 3VR3A 2UXDL 3IKJA 5E3FA 3H0GH 3SK5A 1ASZA 5FJ8G 1P16A 4EX5A 2PI2A 4LUOA 4A3LG 2BE5C 2NUCA 1R9TB 1EIGA 1A3TA 4QQBX 4IOAA 2EPBA 1KLUD 3G7LA 2E2HH 2JA8G 1VQ4A 3HOUB 5CGKA 4JC0A 4R4CA 4DXFA 4PZ6A 1EYAA 4JI5L 3L7ZC 3KDFB 4Y7NB 3W1GA 3UE0A 2FFKB 4GKJL 4UP9A 3D0FA 3GTLB 1C8CA 3JAMi 3HOYH 1L1OC 5DEHA 3HOWH 1JJ2A 1YIJA 2KEEA 4HCSA 3V2TA 1Y14B 1O78A 4JYAL 5H1SE 5A2QE 4DV3L 1KDBA 1EWCA 5ELEA 4DUYL 1VMPA 4CJ0B 3OWFA 2UXBQ 4IUVA 3E6ZX 4RGNA 1LYLA 4KI0A 4PMCA 3S14H 3MZ5A 2O2LD 3M3YH 4A3LH 2F52A 2E2DC 4DAPA 1S3OA 5EPKA 4IOCA 3CKIB 1EY7A 1H95A 1HUMA 4XYQA 4CDFC 4X62L 1U9RA 1VQGA 3S1RH 1O7ZA 2HT1A 4HN7A 1S40A 2HIVA 4A3EG 4A3JH 3MAQA 1EOVA 3JAML 2YTYA 2PCFB 2V1CC 2VB3X 1PRTD 1IYVA 2JA9A 4R4OA 3K81C 5C4JH 3WWVA 1WTVA 1F9RA 1PFSA 1MSGA 1AW7A 2F0WA 1DM0B 2K33A 3A56A 4FVMA 4C56C 3M3YB 3K7UC 2M9VA 4DFAA 4DR3Q 4IALA 4EGVA 3SHLA 3D31A 1JWSD 5M9OA 4NMZA 4RA8A 2B63G 4LFBQ 3PGZA 1VDZA 1N9WA 2A6EC 1RD9D 4A3JB 2CWPA 1N34L 3E9HA 1DD2A 4UP7A 1PRTB 4B08A 4GOPB 2Z6KC 1STGA 3MXNA 1VF5C 2OQKA 2E74C 3HOYB 4HAEA 4X66Q 1GO3E 3NQIA 1ESRA 1I4HA 1XTDA 5J22A 1H9MA 2CQAA 3EROA 5C6AA 1GUOA 1E0BA 1ZEQX 4RKBA 2NVQB 1DCZA 1K8OA 1OXVA 4DV6L 4K0KL 2EY6A 1WYDA 3K58A 1PH3A 5LMUL 1YJNA 1NMFA 2Z6KA 4JBMA 2Q8IB 4S3SA 4KHVA 2A5HA 5FLXc 5A2QL 2RCNA 2EYJA 1STYA 2EZVA 4QIWB 3K5NA 3S16B 1WCMB 3H0GG 1GD7A 1BDOA 2JA7H 1IYUA 5COYA 3K59A 1TWHB 1U0LA 1SRUA 1JOQA 2KOLA 2UXDQ 4B3ML 4TVAB 2DJFC 1KDAA 4R4IA 3OHXC 3NTIA 1TVXA 5E4WC 4LF6Q 5EPJA 4JV5L 5C4HA 3S15H 2NTSA 3A7LA 1B2TA 4DV1Q 2SNSA 1KTKA 2MNAA 1D6EC 3VR5A 1O7LA 3NTHA 2Y0SG 2N88A 4JI7L 1QNUA 1KABA 2L12A 1X9NA 3AB9A 1L2FA 1M8AA 2VB2X 1UE1A 2E2JH 1PTOC 2FMCA 3G71A 4A3EB 4DR1Q 1X55A 4N8X1 1SDFA 4XT3B 1Q12A 1JWMD 2BDOA 2MQHA 1K83B 3RN5A 2VY3A 4OL7A 4K5VA 2B2VC 2JA6H 3RLNA 5JJKA 5J3BA 3AYHB 1XNRL 3TBIB 5IYDG 1JB3A 1MKHA 4N8FA 5CV4A 1GUNA 3PO2H 4C3IG 3GD7A 1II3A 2ZTDA 4F7XA 2IT1A 1B3AA 5EKIA 2AWNA 5FLXL 3I8ZA 4YWKA 5IYDH 1B9NA 4OWXB 3L9AX 2CHBD 3PUXA 1GHKA 1BO0A 1YHQA 4JI1Q 2KJXA 4DV5L 3FPUB 2KVMA 1ONLA 4LJZC 2ALYB 4QIWE 1O7IA 1OXSC 3D4DA 1AP0A 1LTLA 2K5QA 2PZTA 2XNAC 5F2DA 1W3SA 4HJAA 1XMQQ 2Q2IA 5DM73 4LFCQ 3PO2B 4WJ4A 3FKIB 1IL8A 2JA8B 2F0EA 2F1MA 1S5BD 2VS1A 2EDGA 4M8AA 5M3MB 3CCEA 1Y1VG 4HJ8A 2XIWA 3D6CA 4K6DA 4AYBB 1CA5A 2NN6H 3NEMA 3A0JA 4KMUC 2PZWA 2E2IB 1PH6A 1LM0A 1NY4A 3Q6SA 3RZDH 1L1OB 1MGSA 1SMYC 2RQXA 4O0AA 2JA7G 4LMQD 2G9DA 3A74A 4IO9A 5BN5A 1RKNA 5KGUA 2A68D 3GTJB 3BVGA 4ZCKA 3MHBA 5FO9B 1FNWA 3U9OA 4X3UA 4JI2L 1CZGA 2VQEL 1SLJA 3TS0A 1TU2B 4L5QA 3GDEA 2IX0A 3LX0A 4LF9Q 3H15A 1MSHA 2R7FA 4LUVA 1QWYA 2L15A 3I2ZA 1PH4A 2E2IH 1RCVD 4J1MA 4JI6L 4UY8C 4ZK9B 4OX9L 5LMUQ 4E6IA 2XWJB 5C5LA 5C44B 2EY2A 3BYTB 3A54A 1OO9B 4IJHA 1SNCA 2GA4B 2I07B 3BU2A 4JOIA 5E1FA 3Q23A 3H3VI 3QG1A 2A73B 1C48A 2G9HD 3IRBA 5IYBH 4BA2I 1SJHD 1B4OA 1E1OA 1C7YA 4DKAC 4IJLA 4XQJA 2LS01 3NBHA 4R9WA 1YNJD 3I4MG 3M7GA 1I4XA 1WTWA 5ELCA 4CHTB 2IJ0A 5ELFA 1E3PA 3UDFA 1TKWB 2F0FA 1PTOD 2L11A 5M5WB 3TSSA 4BA1I 3VA7A 1RTOA 2ZXRA 1H9SB 3KF6A 4P74A 4NXNQ 2F0UA 2JE6I 4C1NK 1D2BA 1VQBA 4OIKA 4I7ZC 5JVH3 3CHBD 5KNBA 2F0OA 4RH6A 4IUUA 1B9MA 4X3TA 2X6LA 5IGEA 4CDCC 2PNHA 4DAMA 3I4MH 5L37A 3R2IA 2EE1A 1XPRA 2QEXA 5LL6S 1JORA 2VXWA 2B2TC 4NXNL 1BQQT 3TRZA 4F88A 4C3IH 3K8AA 3SE0A 4GKKQ 4NW2A 2MGSA 2JYOA 2QA4A 3NHHA 1SYDA 5GAGC 2WINB 4ULLA 2K75A 1JMCA 3G6JB 5LMNW 1S72A 1JICA 3SDZA 1EOTA 4GOPA 4A93G 3URYA 4JI3L 1CQVA 1K9MC 1W2BA 3GTPH 3TP7A 2CFMA 2JN4A 3L3OC 1I94L 5EKKA 2YU9H 4CKCA 4KTAA 5C44H 5IT9c 4N9PA 3QOJA 1HQMC 2K50A 5K36H 2ZJQA 3JAMc 3NENA 4YCWA 2K28A 1RTNA 2EY1A 4IN3A 1NUCA 1SAPA 1KL9A 3Q22A 4OELB 3TMEA 3K5OA 4UPAA 4GKJQ 2AUJD 4OWTB 4DAYB 4OHJA 5JPMC 2Z1CA 5IT9L 3OMGA 3DM1A 4POGA 3HKZG 4O2DA 3S2DB 1KXLA 1XMOL 3TQYA 4JI2Q 2A8VA 1PFMA 2PO4A 5LHY1 2E2HB 3KLWA 1GOZA 3I55A 3F2DA 1CHQD 1DGSA 2MHVA 1K28A 1IKMA 1GUSA 3KFUA 1AZQA 3C1FA 1K8AC 4TSSA 1LACA 1Q8IA 3A8JE 1K8GA 3AQQA 3BDCA 4UP8A 4LNQA 1LLRD 2HD3A 1R9TH 2TSSA 1TWCB 2PI2E 1UAPA 2MUYA 1EQQA 4IQZA 2OT2A 4GNXB 4A3DG 1DZ1A 1ICWA 3IFDA 2EYHA 5LMNL 5KYIA 4L5RC 4RGOS 2Y0SB 3AU7A 1R4QB 4IUPA 1V1QA 3VYUA 4DR7L 1PYWD 3A7AB 4PNYA 2XWBB 3AFPA 2B39A 4A3BG 4KHPQ 1TY0A 1UE6A 4DV7L 2JA5G 3W1BA 4HIOA 2UUAQ 4HIMA 4FYDA 1GKHA 5EKLA 1N32L 4JI0Q 4X62Q 2MO1A 4JI0L 2NVTH 2O5IC 3WOFA 3VYSA 3ITPA 1YNNC 1QUQA 4GN5A 3TN2A 1Q90A 2RDFA 3K57A 4DR7Q 3DHQA 4GN3B 3QR8A 1VQDA 3A5ZB 1EY9A 1IBLL 4GLAC 3K5MA 4GLVB 1L0WA 2B2VA 1EUJA 1Q7YC 3W2DA 4YHHQ 1SE8A 4DV0L 5JJZA 3L0OA 1XMQL 2CH4W 1A2UA 4BBRB 2KENA 3T1YL 5D3IB 4XIGS 3NTKA 5M5XB 4MTKA 3RNUA 3K6OA 4V0BA 5GROA 3DMUA 1A2TA 1TS5A 1PZJD 1EY6A 2G5DA 4A3GG 2F4VL 4IPCA 1I4PA 4YY3Q 4RFBA 2A6HC 4BXXG 1NJIC 2D5DA 5JVG3 2YYZA 4GNXC 1RDPD 1XPUA 4KY7A 3RR5A 3S2HH 1XJVA 3STBD 1Y1WB 1YBYA 1Q1EA 5HGQA 4N9TA 3Q0AA 1HRJA 4OO1I 3VYTA 4P72A 2L4NA 3MA2B 5DM63 1IBKL 1JE4A 2K5WA 2N78A 3ZYYX 1E7ZA 3DLLA 2R92B 1DOMA 3UDIA 2EJFC 5GQOA 2B63B 3QIAA 4YWLA 1TS4A 5ELBA 4HIDA 2K5DA 5J39A 3CD6A 5DLQE 5G3LD 1CSPA 3DWAA 4DNRB 2EVBA 1SFOB 1SYFA 2WAQE 4A3CG 2LSSA 1UE5A 5AJ3L 5CV9A 5IYCG 1JB7A 1IHZA 4H13C 2JP1A 5KYLA 4GZYC 1WVLA 2K04A 2KUMA 2HDLA 1CM9A 1HNZL 3JC66 2OXPA 2Q2UA 4A3IG 1STEA 2RSNA 1D5XC 3P75A 3OWEB 2A68C 3W3AA 4CGYB 2F0LA 1QJOA 2NVXH 5BR8L 1G8ZD 3H3VC 4LK1C 3I72A 2JA5B 4DN4M 2R7ZG 3PIOA 1KAWA 1JOKA 3MXNB 2QDBA 4EQOA 2I5MX 3ER0A 3MFGA 3M4QA 3TDQA 4MIUA 3KF8B 1EWIA 1G2SA 4BBRH 3OMCA 3J7YW 4DUYQ 1HNWQ 5AFWA 1V9PA 4KK7A 4QCLA 4U673 2WKDA 4UDUC 2KHSA 1EYDA 1HPCA 3OOCA 4MZ9A 2H1EA 2DY8A 3J81j 4QGUA 1Q82C 4ODGA 4RCNA 4AYBE 4EQ5A 2RF4A 2PZUA 4A3JG 1Q81C 1VQMA 2R7ZB 1NMGA 4FDBA 3QWNA 5C0XJ 2UUAL 3RZOB 4XXEA 2LFNA 4OXPA 4B3RQ 1KRSA 1WD1A 1DJRD 4WRDA 3K80C 3ND9A 1P8LA 3I4OA 1TWAB 4O42A 2FXQA 3H09A 5EJWA 5M3MG 4B3SQ 2HCIA 4B3SL 1XTCD 4RGTA 2ATWA 1ILQA 2SNMA 2F0TA 1B53A 4Y7NH 3S1QB 3I91A 3HRZC 4JCVE 1YEZA 2K14A 2K52A 1Y69U 3GTLH 4X6AH 3S17B 4IFDJ 2R93H 2A74C 5EGTA 1TWCH 1CKMA 3CCQA 3KLSA 3MXUA 5CORA 1K3RA 5CV6A 1J5EL 5C4ZA 1CI3M 1UNSA 1IL2A 1SBBB 2A69D 1FJGL 4CJ1B 2PQAA 1EZ8A 4DXGA 1PH8A 2F0KA 5C4XB 4ZKCB 2UUCL 1KIXA 3C3LA 1LTRD 2Z6BA 4QB4A 1PH1A 4A4IA 5IGBA 2EYMA 1VQFA 4J6HA 3TP6A 5FLMG 3PUVA 1D7QA 5C3EG 1F9SA 3BZCA 1PYBA 2RSOA 4YY3L 4RWSC 1SSOA 3NP8A 4A3DH 5FJ8H 1BBXC 3M4OB 3KF8A 2MP1A 2ZJRA 2J0TD 5KRUA 4RHSA 3J7ZC 1L1OA 4CBVA 1JE5A 4C2MB 1KAAA 1EEFD 4IPHA 3UE1A 4I7AA 3M85A 2B8FA 1GXDC 2D9UA 3H94A 2F0QA 4PMBA 2E5LQ 3CMEA 3E0EA 2L9HA 3PO3H 2EIFA 1VQIA 1RF2D 4OGQC 3ZJYC 3FRPB 2VQEQ 2RBMA 4OONA 3KLSX 5KEEA 3KJPA 4B3MQ 1KHIA 1DYQA 1NE3A 4LF6L 3I70A 3MC0B 5M5YB 3S2HB 1WTQA 1X56A 2E2JB 3I3CA 3I4LA 2YV5A 1Q86C 4IFDG 1BOSA 2DN8A 1V1PA 4Z9CB 1MIUA 1D5ZC 3CCUA 3LWUA 2KQ3A 1I6VC 5ELDA 5J1ZA 3I73A 1L0YB 2VUMB 5FLMH 4C3IB 1DOLA 1SN8A 3T56B 5EBDA 4BY1G 1VQPA 3H91A 3I4NB 3HOVB 3I90A 4JK1C 2OCEA 1HTPA 1BBUA 1C9OA 1A8VA 1JCKB 2WKCA 4IUNA 3SR1A 1NCVA 3PO2G 3E0JA 1F77A 3PV0A 1G6PA 2AQ2B 3HKSA 1KC8C 3X3NA 2JA6G 4HJ5A 4DV0Q 2FMMA 1NR4A 1TS3A 4WJ3M 4AH6A 2WB1B 3PQIA 3ERQA 2UXBL 3HZXA 3PF4A 4JG2A 4TQUS 4A3FB 2MO0A 4H0LC 1I94Q 1HR0W 2K32A 1QG7A 3D4WA 3M4OH 3L2PA 3VR4A 3MEHA 1NSNS 2NVXB 4DGZA 5I6WA 4JW0A 4QY7A 2CVRA 2D0PA 1U4MA 1PH5A 4XQQA 4FXKC 2F0PA 4DK0A 3C1EA 1C0AA 1DONA 2NVYB 1SYGA 2B2WA 1Q8KA 4B9WA 1Y1VH 5CR3A 1XWEA 4M1UB 1SFOH 2L0CA 1IKLA 2BDNA 2F0JA 1A62A 4A3EH 4IPDA 1MJEA 3U9SA 3PUYA 2F03A 2R92H 5C3WA 2PW5A 1RHPA 1T5XD 1M90C 2BCOA 1VQ8A 1HZBA 3SEBA 4P71A 1FGBD 3GTKB 1TIID 1R4PB 3HOWB 1HFGA 3STBC 4MNOA 2YTXA 2RHSB 2BH2A 4BBSH 4Q5VA 1F2MA 4APVA 1HHVA 2YTVA 1FGUA 1ASYA 2ZT9C 2X6GA 4PZ8A 1E2VA 5DAUA 2WAQG 2BE5D 1TWGB 2IPKD 2K01A 3J80i 3SK4A 1E22A 4ZQ3A 3MFYA 2IWHA 1MBYA 5CBAE 3A8KE 1S5FD 4B9XA 2IHEA 3KLRA 4A3FH 5K5PA 3CC4A 3D3RA 2BA0A 2C35B 3IAYA 4OX9Q 2OEOA 4IPGA 5IE8A 1HR0Q 1WTHA 1N32Q 2B2UC 2K4KA 4ME5A 2XGTA 4OWWB 1CHPD 1I6HH 2B2YC 5BR8Q 1VQ9A 4HEDA 4LUZA 1IBML 5E7NA 3HOXH 1IW7D 3S2DH 1X54A 4QMGA 3KYHC 1LUZA 2TMPA 3S24A 5DNFA 1YHBA 5JEAG 1NBWA 4H7BA 3KF6B 4JI8Q 1K3BC 3NBIA 3GTQH 2XN9C 1LT4D 1QVGA 1WI5A 3RN2A 3D8GA 3S17H 3RZOH 4C2MH 1S5CD 1LTID 4DA2A 1FVIA 5C3XA 5JEAH 5EBCA 1N8RC 1ET6A 3K0XA 3BS1A 1IBLQ 1QE6A 1SROA 5EQ0A 1YNND 2DY7A 2OQ0A 1ET9A 4K6LA 5IOCA 4TRDA 4MN3A 4R1JA 1PTOH 1PDQA 5EAYA 2VQFQ 3SVMA 4DV5Q 1SEBD 2PW7A 2JA6B 2NWGA 1PRTC 2J4XA 4EVOA 4KN4C 4BY1H 4H44C 1G6ZA 2KCCA 2WP8J 1MHWC 3WOEA 1PV4A 4LAAA 3S1MH 2F0HA 1MD2D 1F2LA 4CKEA 2NN6G 4ZUJA 4C1NI 1LABA 1LT3D 4KN7C 3A8IE 2K1BA 3M7NA 2F0MA 2AHOB 4BY7G 2PNRC 1I50B 2OWOA 1PTOB 1TWFB 2Q2HA 2F0SA 2YU9B 4RCOA 2HHHQ 1OTCA 1LTTD 2HHHL 4HJ9A 4JBJA 3DEOA 1VCIA 4L5SA 2N49A 3CCVA 1T9HA 3ND8A 1CUKA 4AQYQ 4A3MH 4CKBA 2R92G 1WD0A 4F8MA 1YNXA 2WIIB 3KUPA 4FP5D 2B2UA 2L55A 2NZOA 2D62A 3OPOA 2LKVA 4KKSA 4EQPA 1IXRA 4BY7B 3ICEA 2QF7A 2R7ZH 2R3ZA 1D1KA 5FK9C 1PFNA 1HQRD 2UUBQ 3PUWA 3ERSX 2QEJC 1PMRA 4ABNA 5FKAC 1OXUA 1WOCA 4KV6A 1Q46A 2F3VA 2F0VA 4GN4B 1PH7A 2L1BA 1N33Q 3N6RA 1UEBA 2AUKA 1B3QA 3RMHA 4JI8L 1SNMA 2O5JC 4TKOB 4K5XA 1LTAD 4DAVA 4HCEA 1SNPA 5M3FG 1K0RA 1LO5D 2E8GA 2F3WA 5FLXE 1PVOA 2LXKA 4A93B 1BCPC 1TY2A 2J7ZA 1Z7TA 1VQAA 3DEPA 5G3LF 5IGGA 2I5HA 1EY4A 2A6HD 2JA5H 3UI2A 3EVQA 3VYRA 3HS0C 1IYJB 3T13A 5C4XH 4ALPA 2F0NA 1EYCA 1N36Q 2LY7A 2I5LX 2EY5A 3TP5A 3OTOL 1EU3A 3J7A5 1D5MC 1CTMA 5IT9E 1LT6D 1PLFA 3QB3A 4DPGA 1ZYRD 3CRKC 2M00A 5D3DA 1SE3A 3OW2A 1JC7A 2IX3A 3K7AH 1WCMH 3KK7A 3T51B 1E1TA 2RDGA 2JA7B 1VQHA 4KHZA 4WFN3 4X64L 1FD7D 1BNZA 2QGQA 2Z9HA 1Q3LA 5IGFA 3BYYB 2Q2TA 1QVCA 3EIVA 1X65A 2NVYH 1WTOA 3S9WA 1IZ6A 3PMFA 3V05A 1A15A 5T1GA 1QZGA 1B7YB 1KNAA 3UDGA 3CC2A 1I5FA 2H4OA 1SJED 2F4IA 4DV2L 3K7AB 1AN8A 2RVLA 4GOPC 3S1QH 2RHQB 2N55A 2R61A 4LFAQ 4HIKA 2IY5B 3S1NH 1V43A 1VS0A 3OSOA 4FF1A 1I3QB 4X65Q 2CCZA 2I46A 1PTOF 4DR3L 3HOWG 3RUZA 4JI4L 3M9BA 1NTGA 2K05A 1VQ5A 3OIQA 1EU4A 1SNDA 4R4QA 1STAA 3NQTA 3HOZG 4R8NA 4LFAL 2VUMG 1AFPA 1PRTF 5BN4A 2ZXOA 2WAQB 1F2YA 4DR6L 2EYFA 2A1AA 2JEBI 1SMYD 1Y1WG 2Q8TA 1HNWL 2EJGC 5CMDA 2ID0A 2PQEA 3OIPA 1A63A 3EFXD 1VQOA 4L6TB 3F2CA 1TXYA 2E75C 1SNOA 2HQLA 3BJUA 1B44D 2FJ2A 4YWMA 1EQTA 3S1MB 5IWAQ 3GV3A 2IL8A 1CFMA 1I6HB 1XNQL 3VR6A 1B70B 2XTIA 3FVQA 4A75A 1ENFA 3VDYA 3GTOB 2B2TA 2EYOA 2WB1G 4NKLA 3PIPA 2XRQD 2PPBC 3D6WA 5IODA 1HZAA 4XT1B 3CPWA 4DV1L 1ESFA 2B8GA 2CW0C 2KA7A 3HEJA 1TR5A 5I9OA 1YJWA 3GTQB 3FP9A 4QL5A 3RLOA 2PMZB 1VQLA 3CXCA 1GUGA 4K8IA 3GTJH 1S5ED 3Q24A 2IW3A 3E5SA 3CU7A 1F9QA 1LTGD 3W5OA 1BXTA 2P5ZX 4C3JH 3M4PA 1U4LA 4DR4L 2K5HA 4A3KB 5CV8A 4L5TA 1FJGQ 4YIJA 5C4XG 4CJ2C 5CC4A 2VW9A 1YZ6A 2NVQH 1FYCA 4DU9A 3J81i 2HCCA 3D4RA 1HA5A 4KY6A 4L8JA 4JI3Q 2WFWA 2L5TA 1EQRA 4JOIC 4MHEA 1HUNA 3DWPA 2UXCQ 4IUTA 1SE4A 1BF4A 3AEVA 2K6AA 4QF4A 3KJOA 3UDXA 3J80c 1PFBA 1AE2A 3BZKA 2Z4HA 3FHWA 2KECA 1B50A 2DGYA 3DUZA 1XMOQ 2KCNA 1NR2A 1TS2A 4I65A 3NSWA 2Q8RE 4P2CB 4LFCL 3NELA 2O4XA 1I4GA 3CPFA 4LFBL 3GO5A 2EOTA 2UXCL 2A6ED 3LGJA 5M5WH 1M1KC 4ID6A 3PUZA 1GHJA 1Z6HA 4DNTB 1J6QA 4JBWA 1ENAA 2JSOA 1HR0L 1TWAH 1QVFA 3NXWA 1H9RA 3NBHB 1VQNA 4LF9L 2UUBL 4KD3A 2BH8A 2EJMA 5M3FB 4G7OC 1CKOA 5TSSA 3I4MB 2ENBA 5M5YH 1VQCA 4BWGB 1HNZQ 4J8QA 1H9JA 4YCVA 3R8BA 3GTGH 3BDOA 2AQ3B 3FKIH 3HOZB 3U4VA 1GUWA 1V1OA 3GTKH 5A35A 4JI4Q 2EYLA 4ZAIA 3T53B 3CCMA 4A93H 4DK6C 3T1HL 3KDFA 4UAIA 1JR0D 4JI6Q 2EYPA 1FL0A 4GNXA 2IX1A 3M4YA 1JJCB 1BBWA 1C4QA 4DV3Q 1HH2P 4JBKA 4A3IH 1OXTA 1QUQB 2C9OA 1WJJA 4R8IA 4A3DB 1PZID 2VZAA 1AE3A 4J15A 1CZWA 4EQNA 5HGTA 3J80E 4HSPA 4A3GB 2MPMA 1WTPA 4OO1G 2NN6I 5I9PA 2ZM6Q 3HP3A 4GKKL 5IYCH 3CCRA 5IY0A 3AMUA 1HCZA 4DV7Q 3CF5A 1QB5D 3KOJA 2KCMA 1JQYD 1SYBA 2JA8H 2KCTA 3S14B 4X3SA 1AZPA 5M3MH 3T1YQ 1I50H 2ZXPA 2MJ8A 3PO3B 5KNCA 1HNXQ 3CQZB 4NXMQ 1HNXL 3MEFA 4FF3A 1J5EQ 5JJIA 2AMCB 4GS3A 4LF7Q 4A3GH 3FMCA 2BOSA 1VQ6A 3IFTA 1E2ZA 2B3GA 4IZ8A 3IL8A 3GTGB 5C3EH 5AJ3Q 1EY0A 5LL6X 2EXZA 3F2UA 2SDFA 4NP5A 2IHFA 4RGMA 5CBEE 2KHJA 3NUCA 1ZYRC 4C3HH 4ZLTF 4X64Q 4DV2Q 1STHA 2D2CC 4RMFA 3N52A 4L63B 1EFWA 4NB3A 2F3IA 2LMCB 3R3OA 2CKZB 5C0XI 4A3KG 1YNJC 4P73A 1XX8A 4B3TL 3GTMH 3AFQA 4DAYA 1GM5A 4X3KA 1E24A 1B8AA 4NPSA 2UUCQ 3P20A 4KLKA 1U4RA 1UWVA 2D0OA 3VA5A 1QCBD 1D1IA 1IBKQ 2JK8A 1F9PA 5IGCA 2UU9Q 2XVSA 4A76A 4ZUIA 4DNIA 1TWGH 1ZKOA 2RKSA 3PSIA 4DV4L 3V96A 1VQ7A 2HIXA 4G57A 2PQAB 4XTCS 1U5KA 4C3HB
chains in the Genus database with same CATH topology
4LF4Q 1QUQA 1L1OC 2N8NA 3HOWH 4GN5A 1JJ2A 2WP8J 1YIJA 3S16H 4DR6Q 4DR7Q 1Y14B 1PV4A 3S1MH 4A3KH 4JYAL 5H1SE 4LF8Q 4GN3B 4DV3L 1Q1BA 1VQDA 4A3BH 3A5ZB 5LMNQ 4DUYL 1BKBA 2NN6G 1IBLL 4GLAC 4GLVB 1L0WA 4ME3A 1EUJA 4P75A 3J81c 1Q7YC 4YHHQ 1SE8A 3B6YA 4DV0L 1QZHA 3GTOH 3M7NA 2UXBQ 2AHOB 3L0OA 4BY7G 2OWOA 1XMQL 5IWAL 4JYAQ 2Q2HA 1LYLA 2KENA 4KI0A 3CAMA 3T1YL 4XIGS 3S14H 3M3YH 4DR5L 3RNUA 5GROA 2F52A 2HHHQ 4A3LH 1OTCA 5IP7G 2HHHL 2ASBA 1S3OA 4HJ9A 4IOCA 4A3GG 4JBJA 4IPCA 2F4VL 4YY3Q 1VCIA 4L5SA 2N49A 4BXXG 3CCVA 1T9HA 4BXXH 1H95A 1NJIC 1CUKA 4AQYQ 4A3MH 2R92G 4X62L 2YYZA 4GNXC 1XPUA 1VQGA 1YNXA 3RR5A 5IP7H 3S1RH 1XJVA 3S2HH 3STBD 2HT1A 1S40A 2HIVA 4A3EG 1YBYA 1Q1EA 1CKNA 5HGQA 4A3JH 1EOVA 1G51A 4OO1I 2NZOA 2YTYA 4P72A 2V1CC 2D62A 1IBKL 4GLXA 2JA9A 2N78A 1WCMG 3K81C 4R4OA 1IXRA 5C4JH 3WWVA 1E7ZA 3DLLA 1PFSA 4HJ7A 3ICEA 3UDIA 2OTLA 2R7ZH 4MTNA 3DM3A 5GQOA 1CSQA 4IFDI 2UUBQ 4YWLA 3K7UC 4HIDA 1KD1C 3PUWA 3ERSX 3CD6A 5DLQE 4DR3Q 1PH9A 1CSPA 3T1HQ 3HOUH 1OXUA 1WOCA 1EYGA 3D31A 1Q46A 1KRTA 2WAQE 4A3CG 2LSSA 1UE5A 5AJ3L 4GN4B 1PH7A 2B63G 4LFBQ 3PGZA 1N33Q 1N9WA 1UEBA 1X6OA 3EBEA 5IYCG 5M3FH 1JB7A 1N34L 2CWPA 3E9HA 2R93G 4JI8L 4UP7A 4A3FG 4GOPB 4DR1L 2Z6KC 5K36G 5JJKA 2OQKA 1HNZL 5M3FG 3JC66 4DUZL 3RLFA 2Q2UA 1K0RA 2E8GA 4A3IG 2JA7G 1N36L 4A3CH 4X66Q 1GO3E 2KBNA 2ZTEA 1PVOA 2LXKA 1XTDA 1PHJA 3GTPH 2ZJPA 2NVXH 5HY6A 5BR8L 1VQAA 2I5HA 2JA5H 1OXVA 4DV6L 4K0KL 1WYDA 2ES2A 1PH3A 5LMUL 1IYJB 4ALPA 4X66L 5C4XH 1KAWA 3PIOA 1YJNA 1NMFA 3MXNB 2R7ZG 1N36Q 2Z6KA 2I5MX 3ER0A 2I5LX 3M4QA 3OTOL 3KF8B 1EWIA 4BBRH 2PMZE 4JBMA 3J7A5 4DUYQ 1HNWQ 2JQOA 5FLXc 1V9PA 4DR4Q 2RCNA 4DPGA 3TREA 1MJCA 3OW2A 3H0GG 2VL6A 3F2BA 4A3MG 1GD7A 4MZ9A 3K7AH 4Y52H 4PMWA 1WCMH 3J81j 4QGUA 1Q82C 2JA7H 4AYBE 4EQ5A 1A0IA 1E1TA 2RF4A 3HOXG 1VQHA 4KHZA 4X64L 4A3JG 1U0LA 3U50C 1SRUA 1Q81C 1VQMA 2QGQA 3EN2A 2UXDQ 1NMGA 4FDBA 4TVAB 5C0XJ 2H5XA 4B3ML 1SMXA 2UU9L 2UUAL 4R4IA 2Q2TA 4BY7H 1QVCA 4OXPA 4LF6Q 1KRSA 4B3RQ 2CQOA 4JV5L 3EIVA 1X65A 3S15H 2NVYH 4DV1Q 2MNAA 1IZ6A 2E5LL 3K80C 2NZHA 1P8LA 3I4OA 4R4TA 2Y0SG 4JI7L 2FXQA 1QZGA 1X9NA 1B7YB 5M3MG 1L2FA 3UDGA 3CC2A 1I5FA 4B3SQ 1OXXK 1UE1A 2E2JH 4B3SL 4DV2L 4GOPC 2ATWA 3S1QH 2RHQB 3G71A 4DR1Q 4Y7NH 2EQSA 4LFAQ 4JCVE 4HIKA 2IY5B 1X55A 1YEZA 2K14A 3S1NH 1HJPA 1V43A 2K52A 3GTLH 4X6AH 1VS0A 4IFDJ 1Q12A 4X65Q 2CCZA 1XNQQ 2MQHA 2R93H 3RN5A 2VY3A 2AKWB 4DR3L 3HOWG 4JI4L 2JA6H 3RLNA 4LF5Q 1TWCH 3M9BA 1CKMA 1K73C 5J3BA 3AYHB 2B63H 4LF5L 1NTGA 2N3SA 3Q8DA 3CCQA 1XNRL 1K3RA 5IYDG 1MKHA 1XPOA 1J5EL 1IL2A 3HOUG 1VQ5A 1FJGL 3ULPA 1CKNB 2PQAA 4PZ7A 4R4QA 3PO2H 3HOZG 3GD7A 1PH8A 3U4ZA 4LFAL 2VUMG 1WFQA 2ZTDA 2IT1A 3FKIG 2GVBA 2UUCL 2AWNA 1KIXA 4YWKA 3OTOQ 4DR6L 5IYDH 2A1AA 2JEBI 4OWXB 1PH1A 3PUXA 1Y1WG 4A4IA 3U58A 1YHQA 4JI1Q 1HNWL 5FLMG 1VQFA 3CC7A 2ID0A 1D7QA 3CQZH 3PUVA 1A63A 5C3EG 1YITA 5M5XH 3BZCA 1PYBA 4DV5L 4YY3L 1VQOA 2Z0SA 3H3VH 4A3DH 3F2CA 2MFIA 1TXYA 5IP9H 4JI5Q 2ALYB 2HQLA 3BJUA 4QIWE 1O7IA 1OXSC 5FJ8H 1LTLA 4YWMA 5IWAQ 2ZJRA 1W3SA 2K5NA 1PA6A 4HJAA 1XMQQ 2Q2IA 1XNQL 3G4SA 1TWHH 3J7ZC 4LFCQ 1L1OA 4WJ4A 1B70B 1JE5A 2AWOA 2XTIA 4IPHA 3UE1A 4A75A 3M85A 3VDYA 2WB1G 2VS1A 2I0QA 3PIPA 1GVPA 3CCEA 3PO3G 4DK3C 1Y1VG 4HJ8A 2VNUD 3HFZB 2E5LQ 3CMEA 3E0EA 1HZAA 3PO3H 2EIFA 1VQIA 2ZTCA 3CPWA 4DV1L 3NEMA 4YCUA 3HKZE 3ZJYC 1D8LA 3G48A 2VQEQ 2BA1A 3A0JA 4OONA 1PH6A 1LM0A 4B3MQ 3KJPA 1NY4A 1KHIA 5IYBG 1YJWA 3G6EA 3RZDH 1L1OB 1NE3A 1G291 2K5VA 3FP9A 4O0AA 4QL5A 3RLOA 3CCSA 4DR2Q 4LF6L 3A74A 4IO9A 1XNRQ 1VQLA 1X56A 3CXCA 4LF7L 2YV5A 5ELOA 3HOYG 3CCJA 4YHHL 1YHAA 5C44G 5GAHC 1JJGA 3GTJH 1Q86C 4IFDG 1YVCA 1HZCA 4JI2L 3W5OA 1MIUA 1SLJA 4C3JH 1BVSA 2VQEL 3CCUA 3M4PA 2VUMH 3TS0A 4RG1A 3HOZH 4DR4L 4L5QA 3GDEA 5FLMH 2IX0A 1SN8A 2K5HA 4LF9Q 3H15A 4L5TA 1FJGQ 1PYSB 1VQKA 4BY1G 1VQPA 4BY1H 5C4XG 2A19A 2R7FA 4LUVA 2VW9A 1YZ6A 2L15A 4LW1A 3I2ZA 2NVQH 2OCEA 1PH4A 3J81i 1BBUA 1C9OA 1A8VA 2E2IH 4BBSG 4K0KQ 5JJLA 4JI6L 4JI3Q 4UY8C 3PO2G 2WFWA 4OX9L 3PV0A 5LMUQ 1EQRA 1G6PA 4JOIC 4AIMA 3HKSA 1KQSA 1KC8C 2UXCQ 5C0XG 4IJHA 3AEVA 2JA6G 3BU2A 4JOIA 4HJ5A 3H3VI 1RIPA 4DV0Q 3KJOA 1I3QH 3CP0A 3IRBA 3UDXA 1AE2A 5IYBH 3J80c 4BA2I 3PCOB 1E1OA 3BZKA 3CMAA 3FHWA 3A5UA 4AH6A 1C7YA 2DGYA 1XMOQ 5ELNA 4WJ3M 5JEAJ 4DKAC 2UXBL 4IJLA 3PF4A 3TEHB 4JG2A 4TQUS 1I94Q 2MO0A 1HR0W 4PG3A 3M4OH 3I4MG 3L2PA 4LFCL 3NELA 4AYBG 1SR3A 3PF5A 3CPFA 1AH9A 4LFBL 3GO5A 4LF8L 4JV5Q 2UXCL 1TWFH 1RL2A 1YI2A 4QY7A 1IBMQ 3LGJA 1E3PA 2D0PA 3UDFA 5M5WH 1M1KC 3PUZA 1PH5A 4BA1I 2ZM6L 4LWCA 3KF6A 1J6QA 4P74A 4JBWA 4NXNQ 1HR0L 1C0AA 2JE6I 4KHPL 1TWAH 1QVFA 1Q8KA 1VQBA 1Y1VH 3NBHB 3F8TA 1VQNA 3HOVG 4DR5Q 3I4NG 1SFOH 4LF9L 2UUBL 1JT8A 1A62A 2BH8A 4BBRG 4A3EH 4IPDA 1CKOA 3ULLA 1Z47A 1Y1WH 1YJ9A 1MJEA 1PH2A 5M5YH 1VQCA 2PNHA 3PUYA 4DAMA 1HNZQ 2R92H 3I4MH 4YCVA 1XPRA 2JEAI 3E9IA 2QEXA 3GTGH 3SGIA 3FKIH 4JI7Q 2KHIA 2WB1E 4NXNL 1UE7A 3U4VA 1M90C 1HZBA 1VQ8A 3GTKH 3TRZA 4P71A 4C3IH 4JI4Q 3K8AA 2GN5A 4GKKQ 1HZ9A 3STBC 4MNOA 2YTXA 2QA4A 2RHSB 1N33L 2BH2A 5GAGC 3CCMA 4BBSH 2K75A 4B3RL 2DUDA 2JJQA 4DK6C 1JMCA 5LMNW 1S72A 2Y0SE 4A93H 4APVA 2YTVA 3T1HL 4GOPA 1FGUA 4A93G 3KDFA 1ASYA 4JI3L 1K9MC 1W2BA 4JI6Q 4NXML 1FL0A 5GADC 1VQJA 4GNXA 2IX1A 2CFMA 4PZ8A 1I94L 2WAQG 3CW2C 1JJCB 3I7FA 1X3FA 1BBWA 4DV3Q 3J80i 2YU9H 2GVAA 1HH2P 4H02A 4JBKA 1E22A 5C44H 4A3IH 1OXTA 4B3TQ 1QUQB 5IT9c 1WJJA 1X3GA 2K50A 1K83H 2VZAA 2ZJQA 2B29A 1AE3A 2R7DA 4J15A 2IHEA 3JAMc 4A3FH 3NENA 3CC4A 4OO1G 4YCWA 2NN6I 2BA0A 2C35B 2ZM6Q 4OX9Q 4IPGA 4GKKL 5IE8A 5IYCH 3HOVH 3I4NH 3CCRA 1HR0Q 5IY0A 1N32Q 1KL9A 2K4KA 2XGTA 4OWWB 3F1ZA 4UPAA 4DV4Q 3CF5A 3KOJA 3ULJA 4DV7Q 2F4VQ 4JI1L 2KCMA 2VQFL 4GKJQ 1I6HH 3CCLA 3I56A 5BR8Q 2JA8H 4OWTB 1VQ9A 4DAYB 2KCTA 4LUZA 1IBML 5M3MH 5E7NA 3T1YQ 2OTJA 1Z9FA 3HOXH 3S2DH 1I50H 3TS2A 1X54A 3KYHC 4POGA 3HKZG 1EIFA 4O2DA 1KXLA 1LUZA 1XMOL 3TQYA 4JI2Q 2A8VA 1HNXQ 4DUZQ 3S24A 4NXMQ 1HNXL 3MEFA 1EIYB 4POFA 3KLWA 3OYYA 1J5EQ 3I55A 2AMCB 1YHBA 1X3EA 4GS3A 5JEAG 5GAEC 3F2DA 1DGSA 5JJIA 4LF7Q 4AQYL 1NBWA 4A3GH 3KFUA 3KF6B 4JI8Q 2CWAA 4DV6Q 5IP9G 4DR2L 1VQ6A 2LXJA 1N34Q 1K8AC 2B3GA 3GTQH 2EXDA 4X65L 1QVGA 4LF4L 1WI5A 5C3EH 3RN2A 5AJ3Q 3S17H 4QJFA 1VQEA 2R6GA 4C2MH 1K8GA 3RZOH 1FVIA 3AQQA 4UP8A 2UXDL 4LNQA 2IHFA 3H0GH 1N8RC 1ASZA 5FJ8G 2KHJA 1P16A 4EX5A 4C3HH 1R9TH 4X64Q 2PI2E 4DV2Q 1EQQA 3K0XA 2PI2A 4LUOA 4RMFA 4GNXB 4A3LG 4A3DG 1EFWA 1IBLQ 4NB3A 5LMNL 2F3IA 1SROA 2CKZB 5C0XI 4A3KG 4IOAA 4QQBX 4L5RC 4P73A 4B3TL 3GTMH 2E2HH 3AFQA 1GM5A 2JA8G 1E24A 1B8AA 1V1QA 4NPSA 1VQ4A 2UUCQ 4DR7L 4KLKA 1UWVA 2D0OA 3AFPA 1IBKQ 2OQ0A 4A3BG 4KHPQ 2JK8A 1UE6A 4JC0A 4DV7L 2JA5G 3W1BA 4R4CA 4R1JA 4HIMA 4PZ6A 4HIOA 4A76A 2UUAQ 2UU9Q 1GKHA 1N32L 4JI5L 3L7ZC 5EAYA 4JI0Q 4X62Q 3KDFB 4DNIA 2VQFQ 3W1GA 1TWGH 2MO1A 3PSIA 4JI0L 3UE0A 4DV4L 4GKJL 4UP9A 4DV5Q 3D0FA 1VQ7A 2HIXA 2NVTH 3JAMi 3HOYH 2PQAB 4XTCS 1U5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 Q;  1QUQ A;  1L1O C;  2N8N A;  3HOW H;  4GN5 A;  1JJ2 A;  2WP8 J;  1YIJ A;  3S16 H;  4DR6 Q;  4DR7 Q;  1Y14 B;  1PV4 A;  3S1M H;  4A3K H;  4JYA L;  5H1S E;  4LF8 Q;  4GN3 B;  4DV3 L;  1Q1B A;  1VQD A;  4A3B H;  3A5Z B;  5LMN Q;  4DUY L;  1BKB A;  2NN6 G;  1IBL L;  4GLA C;  4GLV B;  1L0W A;  4ME3 A;  1EUJ A;  4P75 A;  3J81 c;  1Q7Y C;  4YHH Q;  1SE8 A;  3B6Y A;  4DV0 L;  1QZH A;  3GTO H;  3M7N A;  2UXB Q;  2AHO B;  3L0O A;  4BY7 G;  2OWO A;  1XMQ L;  5IWA L;  4JYA Q;  2Q2H A;  1LYL A;  2KEN A;  4KI0 A;  3CAM A;  3T1Y L;  4XIG S;  3S14 H;  3M3Y H;  4DR5 L;  3RNU A;  5GRO A;  2F52 A;  2HHH Q;  4A3L H;  1OTC A;  5IP7 G;  2HHH L;  2ASB A;  1S3O A;  4HJ9 A;  4IOC A;  4A3G G;  4JBJ A;  4IPC A;  2F4V L;  4YY3 Q;  1VCI A;  4L5S A;  2N49 A;  4BXX G;  3CCV A;  1T9H A;  4BXX H;  1H95 A;  1NJI C;  1CUK A;  4AQY Q;  4A3M H;  2R92 G;  4X62 L;  2YYZ A;  4GNX C;  1XPU A;  1VQG A;  1YNX A;  3RR5 A;  5IP7 H;  3S1R H;  1XJV A;  3S2H H;  3STB D;  2HT1 A;  1S40 A;  2HIV A;  4A3E G;  1YBY A;  1Q1E A;  1CKN A;  5HGQ A;  4A3J H;  1EOV A;  1G51 A;  4OO1 I;  2NZO A;  2YTY A;  4P72 A;  2V1C C;  2D62 A;  1IBK L;  4GLX A;  2JA9 A;  2N78 A;  1WCM G;  3K81 C;  4R4O A;  1IXR A;  5C4J H;  3WWV A;  1E7Z A;  3DLL A;  1PFS A;  4HJ7 A;  3ICE A;  3UDI A;  2OTL A;  2R7Z H;  4MTN A;  3DM3 A;  5GQO A;  1CSQ A;  4IFD I;  2UUB Q;  4YWL A;  3K7U C;  4HID A;  1KD1 C;  3PUW A;  3ERS X;  3CD6 A;  5DLQ E;  4DR3 Q;  1PH9 A;  1CSP A;  3T1H Q;  3HOU H;  1OXU A;  1WOC A;  1EYG A;  3D31 A;  1Q46 A;  1KRT A;  2WAQ E;  4A3C G;  2LSS A;  1UE5 A;  5AJ3 L;  4GN4 B;  1PH7 A;  2B63 G;  4LFB Q;  3PGZ A;  1N33 Q;  1N9W A;  1UEB A;  1X6O A;  3EBE A;  5IYC G;  5M3F H;  1JB7 A;  1N34 L;  2CWP A;  3E9H A;  2R93 G;  4JI8 L;  4UP7 A;  4A3F G;  4GOP B;  4DR1 L;  2Z6K C;  5K36 G;  5JJK A;  2OQK A;  1HNZ L;  5M3F G;  3JC6 6;  4DUZ L;  3RLF A;  2Q2U A;  1K0R A;  2E8G A;  4A3I G;  2JA7 G;  1N36 L;  4A3C H;  4X66 Q;  1GO3 E;  2KBN A;  2ZTE A;  1PVO A;  2LXK A;  1XTD A;  1PHJ A;  3GTP H;  2ZJP A;  2NVX H;  5HY6 A;  5BR8 L;  1VQA A;  2I5H A;  2JA5 H;  1OXV A;  4DV6 L;  4K0K L;  1WYD A;  2ES2 A;  1PH3 A;  5LMU L;  1IYJ B;  4ALP A;  4X66 L;  5C4X H;  1KAW A;  3PIO A;  1YJN A;  1NMF A;  3MXN B;  2R7Z G;  1N36 Q;  2Z6K A;  2I5M X;  3ER0 A;  2I5L X;  3M4Q A;  3OTO L;  3KF8 B;  1EWI A;  4BBR H;  2PMZ E;  4JBM A;  3J7A 5;  4DUY Q;  1HNW Q;  2JQO A;  5FLX c;  1V9P A;  4DR4 Q;  2RCN A;  4DPG A;  3TRE A;  1MJC A;  3OW2 A;  3H0G G;  2VL6 A;  3F2B A;  4A3M G;  1GD7 A;  4MZ9 A;  3K7A H;  4Y52 H;  4PMW A;  1WCM H;  3J81 j;  4QGU A;  1Q82 C;  2JA7 H;  4AYB E;  4EQ5 A;  1A0I A;  1E1T A;  2RF4 A;  3HOX G;  1VQH A;  4KHZ A;  4X64 L;  4A3J G;  1U0L A;  3U50 C;  1SRU A;  1Q81 C;  1VQM A;  2QGQ A;  3EN2 A;  2UXD Q;  1NMG A;  4FDB A;  4TVA B;  5C0X J;  2H5X A;  4B3M L;  1SMX A;  2UU9 L;  2UUA L;  4R4I A;  2Q2T A;  4BY7 H;  1QVC A;  4OXP A;  4LF6 Q;  1KRS A;  4B3R Q;  2CQO A;  4JV5 L;  3EIV A;  1X65 A;  3S15 H;  2NVY H;  4DV1 Q;  2MNA A;  1IZ6 A;  2E5L L;  3K80 C;  2NZH A;  1P8L A;  3I4O A;  4R4T A;  2Y0S G;  4JI7 L;  2FXQ A;  1QZG A;  1X9N A;  1B7Y B;  5M3M G;  1L2F A;  3UDG A;  3CC2 A;  1I5F A;  4B3S Q;  1OXX K;  1UE1 A;  2E2J H;  4B3S L;  4DV2 L;  4GOP C;  2ATW A;  3S1Q H;  2RHQ B;  3G71 A;  4DR1 Q;  4Y7N H;  2EQS A;  4LFA Q;  4JCV E;  4HIK A;  2IY5 B;  1X55 A;  1YEZ A;  2K14 A;  3S1N H;  1HJP A;  1V43 A;  2K52 A;  3GTL H;  4X6A H;  1VS0 A;  4IFD J;  1Q12 A;  4X65 Q;  2CCZ A;  1XNQ Q;  2MQH A;  2R93 H;  3RN5 A;  2VY3 A;  2AKW B;  4DR3 L;  3HOW G;  4JI4 L;  2JA6 H;  3RLN A;  4LF5 Q;  1TWC H;  3M9B A;  1CKM A;  1K73 C;  5J3B A;  3AYH B;  2B63 H;  4LF5 L;  1NTG A;  2N3S A;  3Q8D A;  3CCQ A;  1XNR L;  1K3R A;  5IYD G;  1MKH A;  1XPO A;  1J5E L;  1IL2 A;  3HOU G;  1VQ5 A;  1FJG L;  3ULP A;  1CKN B;  2PQA A;  4PZ7 A;  4R4Q A;  3PO2 H;  3HOZ G;  3GD7 A;  1PH8 A;  3U4Z A;  4LFA L;  2VUM G;  1WFQ A;  2ZTD A;  2IT1 A;  3FKI G;  2GVB A;  2UUC L;  2AWN A;  1KIX A;  4YWK A;  3OTO Q;  4DR6 L;  5IYD H;  2A1A A;  2JEB I;  4OWX B;  1PH1 A;  3PUX A;  1Y1W G;  4A4I A;  3U58 A;  1YHQ A;  4JI1 Q;  1HNW L;  5FLM G;  1VQF A;  3CC7 A;  2ID0 A;  1D7Q A;  3CQZ H;  3PUV A;  1A63 A;  5C3E G;  1YIT A;  5M5X H;  3BZC A;  1PYB A;  4DV5 L;  4YY3 L;  1VQO A;  2Z0S A;  3H3V H;  4A3D H;  3F2C A;  2MFI A;  1TXY A;  5IP9 H;  4JI5 Q;  2ALY B;  2HQL A;  3BJU A;  4QIW E;  1O7I A;  1OXS C;  5FJ8 H;  1LTL A;  4YWM A;  5IWA Q;  2ZJR A;  1W3S A;  2K5N A;  1PA6 A;  4HJA A;  1XMQ Q;  2Q2I A;  1XNQ L;  3G4S A;  1TWH H;  3J7Z C;  4LFC Q;  1L1O A;  4WJ4 A;  1B70 B;  1JE5 A;  2AWO A;  2XTI A;  4IPH A;  3UE1 A;  4A75 A;  3M85 A;  3VDY A;  2WB1 G;  2VS1 A;  2I0Q A;  3PIP A;  1GVP A;  3CCE A;  3PO3 G;  4DK3 C;  1Y1V G;  4HJ8 A;  2VNU D;  3HFZ B;  2E5L Q;  3CME A;  3E0E A;  1HZA A;  3PO3 H;  2EIF A;  1VQI A;  2ZTC A;  3CPW A;  4DV1 L;  3NEM A;  4YCU A;  3HKZ E;  3ZJY C;  1D8L A;  3G48 A;  2VQE Q;  2BA1 A;  3A0J A;  4OON A;  1PH6 A;  1LM0 A;  4B3M Q;  3KJP A;  1NY4 A;  1KHI A;  5IYB G;  1YJW A;  3G6E A;  3RZD H;  1L1O B;  1NE3 A;  1G29 1;  2K5V A;  3FP9 A;  4O0A A;  4QL5 A;  3RLO A;  3CCS A;  4DR2 Q;  4LF6 L;  3A74 A;  4IO9 A;  1XNR Q;  1VQL A;  1X56 A;  3CXC A;  4LF7 L;  2YV5 A;  5ELO A;  3HOY G;  3CCJ A;  4YHH L;  1YHA A;  5C44 G;  5GAH C;  1JJG A;  3GTJ H;  1Q86 C;  4IFD G;  1YVC A;  1HZC A;  4JI2 L;  3W5O A;  1MIU A;  1SLJ A;  4C3J H;  1BVS A;  2VQE L;  3CCU A;  3M4P A;  2VUM H;  3TS0 A;  4RG1 A;  3HOZ H;  4DR4 L;  4L5Q A;  3GDE A;  5FLM H;  2IX0 A;  1SN8 A;  2K5H A;  4LF9 Q;  3H15 A;  4L5T A;  1FJG Q;  1PYS B;  1VQK A;  4BY1 G;  1VQP A;  4BY1 H;  5C4X G;  2A19 A;  2R7F A;  4LUV A;  2VW9 A;  1YZ6 A;  2L15 A;  4LW1 A;  3I2Z A;  2NVQ H;  2OCE A;  1PH4 A;  3J81 i;  1BBU A;  1C9O A;  1A8V A;  2E2I H;  4BBS G;  4K0K Q;  5JJL A;  4JI6 L;  4JI3 Q;  4UY8 C;  3PO2 G;  2WFW A;  4OX9 L;  3PV0 A;  5LMU Q;  1EQR A;  1G6P A;  4JOI C;  4AIM A;  3HKS A;  1KQS A;  1KC8 C;  2UXC Q;  5C0X G;  4IJH A;  3AEV A;  2JA6 G;  3BU2 A;  4JOI A;  4HJ5 A;  3H3V I;  1RIP A;  4DV0 Q;  3KJO A;  1I3Q H;  3CP0 A;  3IRB A;  3UDX A;  1AE2 A;  5IYB H;  3J80 c;  4BA2 I;  3PCO B;  1E1O A;  3BZK A;  3CMA A;  3FHW A;  3A5U A;  4AH6 A;  1C7Y A;  2DGY A;  1XMO Q;  5ELN A;  4WJ3 M;  5JEA J;  4DKA C;  2UXB L;  4IJL A;  3PF4 A;  3TEH B;  4JG2 A;  4TQU S;  1I94 Q;  2MO0 A;  1HR0 W;  4PG3 A;  3M4O H;  3I4M G;  3L2P A;  4LFC L;  3NEL A;  4AYB G;  1SR3 A;  3PF5 A;  3CPF A;  1AH9 A;  4LFB L;  3GO5 A;  4LF8 L;  4JV5 Q;  2UXC L;  1TWF H;  1RL2 A;  1YI2 A;  4QY7 A;  1IBM Q;  3LGJ A;  1E3P A;  2D0P A;  3UDF A;  5M5W H;  1M1K C;  3PUZ A;  1PH5 A;  4BA1 I;  2ZM6 L;  4LWC A;  3KF6 A;  1J6Q A;  4P74 A;  4JBW A;  4NXN Q;  1HR0 L;  1C0A A;  2JE6 I;  4KHP L;  1TWA H;  1QVF A;  1Q8K A;  1VQB A;  1Y1V H;  3NBH B;  3F8T A;  1VQN A;  3HOV G;  4DR5 Q;  3I4N G;  1SFO H;  4LF9 L;  2UUB L;  1JT8 A;  1A62 A;  2BH8 A;  4BBR G;  4A3E H;  4IPD A;  1CKO A;  3ULL A;  1Z47 A;  1Y1W H;  1YJ9 A;  1MJE A;  1PH2 A;  5M5Y H;  1VQC A;  2PNH A;  3PUY A;  4DAM A;  1HNZ Q;  2R92 H;  3I4M H;  4YCV A;  1XPR A;  2JEA I;  3E9I A;  2QEX A;  3GTG H;  3SGI A;  3FKI H;  4JI7 Q;  2KHI A;  2WB1 E;  4NXN L;  1UE7 A;  3U4V A;  1M90 C;  1HZB A;  1VQ8 A;  3GTK H;  3TRZ A;  4P71 A;  4C3I H;  4JI4 Q;  3K8A A;  2GN5 A;  4GKK Q;  1HZ9 A;  3STB C;  4MNO A;  2YTX A;  2QA4 A;  2RHS B;  1N33 L;  2BH2 A;  5GAG C;  3CCM A;  4BBS H;  2K75 A;  4B3R L;  2DUD A;  2JJQ A;  4DK6 C;  1JMC A;  5LMN W;  1S72 A;  2Y0S E;  4A93 H;  4APV A;  2YTV A;  3T1H L;  4GOP A;  1FGU A;  4A93 G;  3KDF A;  1ASY A;  4JI3 L;  1K9M C;  1W2B A;  4JI6 Q;  4NXM L;  1FL0 A;  5GAD C;  1VQJ A;  4GNX A;  2IX1 A;  2CFM A;  4PZ8 A;  1I94 L;  2WAQ G;  3CW2 C;  1JJC B;  3I7F A;  1X3F A;  1BBW A;  4DV3 Q;  3J80 i;  2YU9 H;  2GVA A;  1HH2 P;  4H02 A;  4JBK A;  1E22 A;  5C44 H;  4A3I H;  1OXT A;  4B3T Q;  1QUQ B;  5IT9 c;  1WJJ A;  1X3G A;  2K50 A;  1K83 H;  2VZA A;  2ZJQ A;  2B29 A;  1AE3 A;  2R7D A;  4J15 A;  2IHE A;  3JAM c;  4A3F H;  3NEN A;  3CC4 A;  4OO1 G;  4YCW A;  2NN6 I;  2BA0 A;  2C35 B;  2ZM6 Q;  4OX9 Q;  4IPG A;  4GKK L;  5IE8 A;  5IYC H;  3HOV H;  3I4N H;  3CCR A;  1HR0 Q;  5IY0 A;  1N32 Q;  1KL9 A;  2K4K A;  2XGT A;  4OWW B;  3F1Z A;  4UPA A;  4DV4 Q;  3CF5 A;  3KOJ A;  3ULJ A;  4DV7 Q;  2F4V Q;  4JI1 L;  2KCM A;  2VQF L;  4GKJ Q;  1I6H H;  3CCL A;  3I56 A;  5BR8 Q;  2JA8 H;  4OWT B;  1VQ9 A;  4DAY B;  2KCT A;  4LUZ A;  1IBM L;  5M3M H;  5E7N A;  3T1Y Q;  2OTJ A;  1Z9F A;  3HOX H;  3S2D H;  1I50 H;  3TS2 A;  1X54 A;  3KYH C;  4POG A;  3HKZ G;  1EIF A;  4O2D A;  1KXL A;  1LUZ A;  1XMO L;  3TQY A;  4JI2 Q;  2A8V A;  1HNX Q;  4DUZ Q;  3S24 A;  4NXM Q;  1HNX L;  3MEF A;  1EIY B;  4POF A;  3KLW A;  3OYY A;  1J5E Q;  3I55 A;  2AMC B;  1YHB A;  1X3E A;  4GS3 A;  5JEA G;  5GAE C;  3F2D A;  1DGS A;  5JJI A;  4LF7 Q;  4AQY L;  1NBW A;  4A3G H;  3KFU A;  3KF6 B;  4JI8 Q;  2CWA A;  4DV6 Q;  5IP9 G;  4DR2 L;  1VQ6 A;  2LXJ A;  1N34 Q;  1K8A C;  2B3G A;  3GTQ H;  2EXD A;  4X65 L;  1QVG A;  4LF4 L;  1WI5 A;  5C3E H;  3RN2 A;  5AJ3 Q;  3S17 H;  4QJF A;  1VQE A;  2R6G A;  4C2M H;  1K8G A;  3RZO H;  1FVI A;  3AQQ A;  4UP8 A;  2UXD L;  4LNQ A;  2IHF A;  3H0G H;  1N8R C;  1ASZ A;  5FJ8 G;  2KHJ A;  1P16 A;  4EX5 A;  4C3H H;  1R9T H;  4X64 Q;  2PI2 E;  4DV2 Q;  1EQQ A;  3K0X A;  2PI2 A;  4LUO A;  4RMF A;  4GNX B;  4A3L G;  4A3D G;  1EFW A;  1IBL Q;  4NB3 A;  5LMN L;  2F3I A;  1SRO A;  2CKZ B;  5C0X I;  4A3K G;  4IOA A;  4QQB X;  4L5R C;  4P73 A;  4B3T L;  3GTM H;  2E2H H;  3AFQ A;  1GM5 A;  2JA8 G;  1E24 A;  1B8A A;  1V1Q A;  4NPS A;  1VQ4 A;  2UUC Q;  4DR7 L;  4KLK A;  1UWV A;  2D0O A;  3AFP A;  1IBK Q;  2OQ0 A;  4A3B G;  4KHP Q;  2JK8 A;  1UE6 A;  4JC0 A;  4DV7 L;  2JA5 G;  3W1B A;  4R4C A;  4R1J A;  4HIM A;  4PZ6 A;  4HIO A;  4A76 A;  2UUA Q;  2UU9 Q;  1GKH A;  1N32 L;  4JI5 L;  3L7Z C;  5EAY A;  4JI0 Q;  4X62 Q;  3KDF B;  4DNI A;  2VQF Q;  3W1G A;  1TWG H;  2MO1 A;  3PSI A;  4JI0 L;  3UE0 A;  4DV4 L;  4GKJ L;  4UP9 A;  4DV5 Q;  3D0F A;  1VQ7 A;  2HIX A;  2NVT H;  3JAM i;  3HOY H;  2PQA B;  4XTC S;  1U5K A; 
#chains in the Genus database with same CATH topology
 4LF4 Q;  1EFI D;  2NYZ D;  2N8N A;  1BR9 A;  1TQO A;  4DR6 Q;  2NTT A;  3S16 H;  1IW7 C;  2AQ1 B;  1ZXT A;  4A3K H;  2Z8L A;  4LF8 Q;  4BBS B;  3HKZ B;  3QO2 A;  1Q1B A;  4A3B H;  5LMN Q;  1BKB A;  1PZK D;  3TZU A;  4ME3 A;  4P75 A;  3WDN A;  3J81 c;  1LTS D;  2QDL A;  3GTO H;  3B6Y A;  1QZH A;  3J81 E;  1RJT A;  5IWA L;  4JYA Q;  3CAM A;  4Q0F A;  1I4Q A;  4XDX A;  4DR5 L;  5IP7 G;  2ASB A;  4C3H G;  3GV6 A;  2NB0 A;  1DOK A;  4HSV A;  4BXX H;  2HQE A;  5EPL A;  3OW7 A;  5IP7 H;  3KBX A;  1CQF A;  5C3E B;  1CKN A;  1MI2 A;  1G51 A;  1ML0 D;  1U4P A;  3KBG A;  4GLX A;  1WCM G;  1X3Q A;  3H0G B;  4CDE C;  4HJ7 A;  2OTL A;  4K2L A;  1Y8O B;  1EIH A;  1J9O A;  4MTN A;  3DM3 A;  1CSQ A;  4IFD I;  3SK6 A;  3DWQ A;  4XQN A;  1H9S A;  1KD1 C;  2M2L A;  3ONA B;  1PH9 A;  3SK8 A;  3T1H Q;  3HOU H;  1EYG A;  1KRT A;  1CA6 A;  3GTP B;  1JOO A;  1T5E A;  4BS9 A;  4FNF A;  3RZD B;  3DXJ C;  3K5L A;  3J7A V;  3BVZ A;  1X6O A;  3EBE A;  5M3F H;  1SYC A;  2R93 G;  1JWU D;  5ISR A;  4OO1 H;  1EL0 A;  3LWE A;  3BDL A;  3X3M A;  4A3F G;  4DR1 L;  2XRS D;  2X69 A;  2QIL A;  5K36 G;  1EEI D;  4DK1 A;  2DNC A;  5KIX A;  1A6X A;  4DUZ L;  3RLF A;  1HTL D;  1H9K A;  1J8I A;  4RAU C;  2Z4I A;  1N36 L;  1KLG D;  4A3C H;  2KBN A;  2ZTE A;  4WJW A;  1PHJ A;  1HA6 A;  2ZJP A;  4K2K A;  1V8Q A;  5HY6 A;  3FPP A;  1LV9 A;  4UHV A;  1LT5 D;  5CV5 A;  2QKI C;  2K7V A;  2ES2 A;  3FDT A;  4X66 L;  1BUV T;  1W6K A;  3NWT A;  1K8M A;  1EQV A;  3MXG A;  4G7Z C;  4F87 A;  1QOH A;  1XYI A;  2PMZ E;  1VF7 A;  3QJY A;  2JQO A;  2RCF A;  4DR4 Q;  2F0I A;  3TRE A;  5D14 A;  1MJC A;  3P1H A;  3S1R B;  5JOB A;  1S4Z A;  2VL6 A;  3F2B A;  4A3M G;  1UEA B;  2ICI A;  4Y52 H;  4PMW A;  1G91 A;  1A0I A;  4RHR A;  5C4J B;  3HOX G;  3S1N B;  3P7J A;  3U50 C;  1FNV A;  2SOB A;  3EN2 A;  2H5X A;  1SMX A;  2UU9 L;  4BY7 H;  2CQO A;  1Y8P B;  1HFN A;  2FHT A;  2E5L L;  2NZH A;  3O13 A;  4R4T A;  3C2P A;  1SYE A;  1Y1V B;  3SXH A;  4A3M B;  4K8J A;  3GP7 A;  1SE2 A;  1OXX K;  3E3X A;  4QUF A;  3A55 A;  1GJX A;  4KJN A;  1Y8N B;  1VMC A;  2EQS A;  4KKT A;  4ZKB B;  3PIO 3;  1HJP A;  3EJI A;  1XNQ Q;  2AKW B;  4DF7 A;  2KED A;  4C3J B;  4K14 A;  4LF5 Q;  1K73 C;  3GQB A;  2B63 H;  4LF5 L;  2N3S A;  3Q8D A;  2QCP X;  4OEM B;  3NK9 A;  1AEX A;  1XPO A;  3HOU G;  2V4D A;  4KKU A;  3ULP A;  4OIJ A;  1CKN B;  4PZ7 A;  5E4X A;  3U4Z A;  5KND A;  1WFQ A;  3FKI G;  1F2Z A;  2CH4 A;  2GVB A;  1O80 A;  3OTO Q;  4HTH A;  3LNN A;  5I2Y A;  3U58 A;  3CC7 A;  1X32 A;  3CQZ H;  1UUP A;  1YIT A;  5M5X H;  3MVV A;  5C5M A;  4C3J G;  3NPP A;  2Z0S A;  4G7H C;  3H3V H;  4HR7 B;  2MFI A;  5I4D A;  5IP9 H;  3J80 L;  4JI5 Q;  4V19 0;  1BCP D;  4WOR A;  2CW0 D;  2K5N A;  3FEW X;  1PA6 A;  3G4S A;  1TWH H;  2AWO A;  3JAM E;  1ILP A;  5HUR A;  2SEB D;  3NWS A;  2I0Q A;  1GVP A;  2DNE A;  5FO8 B;  3PO3 G;  4DK3 C;  2F0G A;  2VNU D;  3HFZ B;  4IUQ A;  1EY8 A;  3T4A C;  2ZTC A;  1SXT A;  2ICE C;  1STN A;  3MTS A;  4YCU A;  3HKZ E;  1ICF B;  1D8L A;  3G48 A;  4JPB W;  2BA1 A;  4KD4 A;  4QUC A;  3BG3 A;  5IYB G;  1EY5 A;  1QNK A;  3G6E A;  1G29 1;  2K5V A;  3BZD B;  4DR2 Q;  3CCS A;  1XNR Q;  2OF1 A;  2NBF A;  4LF7 L;  3QOL A;  5ELO A;  3HOY G;  3CCJ A;  4YHH L;  1YHA A;  5T1I A;  5GAH C;  5C44 G;  1JJG A;  4RKL A;  3EQL C;  1YVC A;  4O1N A;  1HZC A;  5IIF A;  4KJO A;  2VUM H;  1BVS A;  4RG1 A;  3HOZ H;  1NNX A;  4FXG C;  1FR3 A;  2B2Y A;  1PXU A;  3MWY W;  1ENC A;  1PYS B;  2K03 A;  1VQK A;  2NZ1 D;  3J81 L;  4ZYS A;  1CT1 D;  1L0X B;  2A19 A;  3CRL C;  4LW1 A;  4BBS G;  5JJL A;  4K0K Q;  1BCP F;  4ILW A;  1V1P B;  4AIM A;  1KQS A;  3R93 A;  5C0X G;  4FF2 A;  5IGD A;  1RIP A;  1I3Q H;  3CP0 A;  2NVT B;  4A3I B;  3PCO B;  3CMA A;  3A5U A;  5ELN A;  3TP8 A;  5JEA J;  3TEH B;  2RA4 A;  4FXD A;  4BY1 B;  1EWH A;  3R2T A;  4IFD H;  2HDM A;  4PG3 A;  1O7Y A;  3EA6 A;  4AYB G;  1SR3 A;  4PV1 C;  3PF5 A;  1AH9 A;  4LF8 L;  4JV5 Q;  1BCP B;  1TWF H;  1RL2 A;  1YI2 A;  1IBM Q;  1A3U A;  1E2W A;  1DXM A;  2JXM B;  2ZM6 L;  4CDD C;  4LWC A;  4JVZ A;  3C46 A;  4KHP L;  5JAV A;  1LTB D;  1CK1 A;  2A69 C;  3K0Y A;  3F8T A;  3HOV G;  3I4N G;  4DR5 Q;  3VR2 A;  1S5D D;  5I6Y A;  2WAC A;  1A3V A;  1JT8 A;  4BBR G;  2B2W C;  3ULL A;  1Z47 A;  3MXP A;  1Y1W H;  1YJ9 A;  1PH2 A;  3HG9 A;  1FNU A;  1QIL A;  5D65 A;  2JEA I;  3E9I A;  4K5W A;  2R93 B;  3SGI A;  4JI7 Q;  2KHI A;  2WB1 E;  1UE7 A;  1M4V A;  5CYU A;  3RD4 A;  1NAP A;  1G2T A;  2GN5 A;  1HZ9 A;  1WTR A;  2RDH A;  3S15 B;  1N33 L;  1STB A;  4HMI A;  4B3R L;  2DUD A;  2DJG C;  2JJQ A;  4PQX A;  2Y0S E;  3BVM A;  4IUR A;  3GTM B;  1B1Z A;  3NE5 B;  4NXM L;  5NUC A;  5GAD C;  1VQJ A;  1K0S A;  4XYO A;  3CW2 C;  2XSC A;  3I7F A;  4U68 A;  1X3F A;  1I4R A;  2GVA A;  4NDX A;  1KNE A;  4H02 A;  4HMJ A;  4B3T Q;  1X3G A;  2QW7 A;  1K83 H;  1KDC A;  2E76 C;  1SNQ A;  5FO7 B;  1W6J A;  2B29 A;  2R7D A;  2HUG A;  4KY5 A;  2FIN B;  4FF4 A;  3HOV H;  3I4N H;  2C5C A;  3PIP 3;  3F1Z A;  4FO2 A;  4DV4 Q;  3ULJ A;  2F4V Q;  4A3B B;  4JI1 L;  2VQF L;  3CCL A;  3I56 A;  3HOX B;  3J7A F;  1XXG A;  2OTJ A;  2F0D A;  1Z9F A;  1WTX A;  3TS2 A;  1EZ6 A;  1EIF A;  2PYK A;  4DUZ Q;  1TT2 A;  2WV6 D;  4G4K A;  1EIY B;  4POF A;  1HXY D;  3OYY A;  5BN3 A;  1X3P A;  1X3E A;  5GAE C;  4AQY L;  5CV7 A;  3TZD A;  2CWA A;  4DV6 Q;  5IP9 G;  5JPN C;  4DR2 L;  2LXJ A;  5I2X A;  1N34 Q;  3T16 A;  2EXD A;  4X65 L;  3H6M A;  5FOB B;  4LF4 L;  4ZRZ A;  4QJF A;  3HGB A;  1VQE A;  2R6G A;  5C0X H;  1ROD A;  1GUT A;  3VR3 A;  2UXD L;  3IKJ A;  5E3F A;  3H0G H;  3SK5 A;  1ASZ A;  5FJ8 G;  1P16 A;  4EX5 A;  2PI2 A;  4LUO A;  4A3L G;  2BE5 C;  2NUC A;  1R9T B;  1EIG A;  1A3T A;  4QQB X;  4IOA A;  2EPB A;  1KLU D;  3G7L A;  2E2H H;  2JA8 G;  1VQ4 A;  3HOU B;  5CGK A;  4JC0 A;  4R4C A;  4DXF A;  4PZ6 A;  1EYA A;  4JI5 L;  3L7Z C;  3KDF B;  4Y7N B;  3W1G A;  3UE0 A;  2FFK B;  4GKJ L;  4UP9 A;  3D0F A;  3GTL B;  1C8C A;  3JAM i;  3HOY H;  1L1O C;  5DEH A;  3HOW H;  1JJ2 A;  1YIJ A;  2KEE A;  4HCS A;  3V2T A;  1Y14 B;  1O78 A;  4JYA L;  5H1S E;  5A2Q E;  4DV3 L;  1KDB A;  1EWC A;  5ELE A;  4DUY L;  1VMP A;  4CJ0 B;  3OWF A;  2UXB Q;  4IUV A;  3E6Z X;  4RGN A;  1LYL A;  4KI0 A;  4PMC A;  3S14 H;  3MZ5 A;  2O2L D;  3M3Y H;  4A3L H;  2F52 A;  2E2D C;  4DAP A;  1S3O A;  5EPK A;  4IOC A;  3CKI B;  1EY7 A;  1H95 A;  1HUM A;  4XYQ A;  4CDF C;  4X62 L;  1U9R A;  1VQG A;  3S1R H;  1O7Z A;  2HT1 A;  4HN7 A;  1S40 A;  2HIV A;  4A3E G;  4A3J H;  3MAQ A;  1EOV A;  3JAM L;  2YTY A;  2PCF B;  2V1C C;  2VB3 X;  1PRT D;  1IYV A;  2JA9 A;  4R4O A;  3K81 C;  5C4J H;  3WWV A;  1WTV A;  1F9R A;  1PFS A;  1MSG A;  1AW7 A;  2F0W A;  1DM0 B;  2K33 A;  3A56 A;  4FVM A;  4C56 C;  3M3Y B;  3K7U C;  2M9V A;  4DFA A;  4DR3 Q;  4IAL A;  4EGV A;  3SHL A;  3D31 A;  1JWS D;  5M9O A;  4NMZ A;  4RA8 A;  2B63 G;  4LFB Q;  3PGZ A;  1VDZ A;  1N9W A;  2A6E C;  1RD9 D;  4A3J B;  2CWP A;  1N34 L;  3E9H A;  1DD2 A;  4UP7 A;  1PRT B;  4B08 A;  4GOP B;  2Z6K C;  1STG A;  3MXN A;  1VF5 C;  2OQK A;  2E74 C;  3HOY B;  4HAE A;  4X66 Q;  1GO3 E;  3NQI A;  1ESR A;  1I4H A;  1XTD A;  5J22 A;  1H9M A;  2CQA A;  3ERO A;  5C6A A;  1GUO A;  1E0B A;  1ZEQ X;  4RKB A;  2NVQ B;  1DCZ A;  1K8O A;  1OXV A;  4DV6 L;  4K0K L;  2EY6 A;  1WYD A;  3K58 A;  1PH3 A;  5LMU L;  1YJN A;  1NMF A;  2Z6K A;  4JBM A;  2Q8I B;  4S3S A;  4KHV A;  2A5H A;  5FLX c;  5A2Q L;  2RCN A;  2EYJ A;  1STY A;  2EZV A;  4QIW B;  3K5N A;  3S16 B;  1WCM B;  3H0G G;  1GD7 A;  1BDO A;  2JA7 H;  1IYU A;  5COY A;  3K59 A;  1TWH B;  1U0L A;  1SRU A;  1JOQ A;  2KOL A;  2UXD Q;  4B3M L;  4TVA B;  2DJF C;  1KDA A;  4R4I A;  3OHX C;  3NTI A;  1TVX A;  5E4W C;  4LF6 Q;  5EPJ A;  4JV5 L;  5C4H A;  3S15 H;  2NTS A;  3A7L A;  1B2T A;  4DV1 Q;  2SNS A;  1KTK A;  2MNA A;  1D6E C;  3VR5 A;  1O7L A;  3NTH A;  2Y0S G;  2N88 A;  4JI7 L;  1QNU A;  1KAB A;  2L12 A;  1X9N A;  3AB9 A;  1L2F A;  1M8A A;  2VB2 X;  1UE1 A;  2E2J H;  1PTO C;  2FMC A;  3G71 A;  4A3E B;  4DR1 Q;  1X55 A;  4N8X 1;  1SDF A;  4XT3 B;  1Q12 A;  1JWM D;  2BDO A;  2MQH A;  1K83 B;  3RN5 A;  2VY3 A;  4OL7 A;  4K5V A;  2B2V C;  2JA6 H;  3RLN A;  5JJK A;  5J3B A;  3AYH B;  1XNR L;  3TBI B;  5IYD G;  1JB3 A;  1MKH A;  4N8F A;  5CV4 A;  1GUN A;  3PO2 H;  4C3I G;  3GD7 A;  1II3 A;  2ZTD A;  4F7X A;  2IT1 A;  1B3A A;  5EKI A;  2AWN A;  5FLX L;  3I8Z A;  4YWK A;  5IYD H;  1B9N A;  4OWX B;  3L9A X;  2CHB D;  3PUX A;  1GHK A;  1BO0 A;  1YHQ A;  4JI1 Q;  2KJX A;  4DV5 L;  3FPU B;  2KVM A;  1ONL A;  4LJZ C;  2ALY B;  4QIW E;  1O7I A;  1OXS C;  3D4D A;  1AP0 A;  1LTL A;  2K5Q A;  2PZT A;  2XNA C;  5F2D A;  1W3S A;  4HJA A;  1XMQ Q;  2Q2I A;  5DM7 3;  4LFC Q;  3PO2 B;  4WJ4 A;  3FKI B;  1IL8 A;  2JA8 B;  2F0E A;  2F1M A;  1S5B D;  2VS1 A;  2EDG A;  4M8A A;  5M3M B;  3CCE A;  1Y1V G;  4HJ8 A;  2XIW A;  3D6C A;  4K6D A;  4AYB B;  1CA5 A;  2NN6 H;  3NEM A;  3A0J A;  4KMU C;  2PZW A;  2E2I B;  1PH6 A;  1LM0 A;  1NY4 A;  3Q6S A;  3RZD H;  1L1O B;  1MGS A;  1SMY C;  2RQX A;  4O0A A;  2JA7 G;  4LMQ D;  2G9D A;  3A74 A;  4IO9 A;  5BN5 A;  1RKN A;  5KGU A;  2A68 D;  3GTJ B;  3BVG A;  4ZCK A;  3MHB A;  5FO9 B;  1FNW A;  3U9O A;  4X3U A;  4JI2 L;  1CZG A;  2VQE L;  1SLJ A;  3TS0 A;  1TU2 B;  4L5Q A;  3GDE A;  2IX0 A;  3LX0 A;  4LF9 Q;  3H15 A;  1MSH A;  2R7F A;  4LUV A;  1QWY A;  2L15 A;  3I2Z A;  1PH4 A;  2E2I H;  1RCV D;  4J1M A;  4JI6 L;  4UY8 C;  4ZK9 B;  4OX9 L;  5LMU Q;  4E6I A;  2XWJ B;  5C5L A;  5C44 B;  2EY2 A;  3BYT B;  3A54 A;  1OO9 B;  4IJH A;  1SNC A;  2GA4 B;  2I07 B;  3BU2 A;  4JOI A;  5E1F A;  3Q23 A;  3H3V I;  3QG1 A;  2A73 B;  1C48 A;  2G9H D;  3IRB A;  5IYB H;  4BA2 I;  1SJH D;  1B4O A;  1E1O A;  1C7Y A;  4DKA C;  4IJL A;  4XQJ A;  2LS0 1;  3NBH A;  4R9W A;  1YNJ D;  3I4M G;  3M7G A;  1I4X A;  1WTW A;  5ELC A;  4CHT B;  2IJ0 A;  5ELF A;  1E3P A;  3UDF A;  1TKW B;  2F0F A;  1PTO D;  2L11 A;  5M5W B;  3TSS A;  4BA1 I;  3VA7 A;  1RTO A;  2ZXR A;  1H9S B;  3KF6 A;  4P74 A;  4NXN Q;  2F0U A;  2JE6 I;  4C1N K;  1D2B A;  1VQB A;  4OIK A;  4I7Z C;  5JVH 3;  3CHB D;  5KNB A;  2F0O A;  4RH6 A;  4IUU A;  1B9M A;  4X3T A;  2X6L A;  5IGE A;  4CDC C;  2PNH A;  4DAM A;  3I4M H;  5L37 A;  3R2I A;  2EE1 A;  1XPR A;  2QEX A;  5LL6 S;  1JOR A;  2VXW A;  2B2T C;  4NXN L;  1BQQ T;  3TRZ A;  4F88 A;  4C3I H;  3K8A A;  3SE0 A;  4GKK Q;  4NW2 A;  2MGS A;  2JYO A;  2QA4 A;  3NHH A;  1SYD A;  5GAG C;  2WIN B;  4ULL A;  2K75 A;  1JMC A;  3G6J B;  5LMN W;  1S72 A;  1JIC A;  3SDZ A;  1EOT A;  4GOP A;  4A93 G;  3URY A;  4JI3 L;  1CQV A;  1K9M C;  1W2B A;  3GTP H;  3TP7 A;  2CFM A;  2JN4 A;  3L3O C;  1I94 L;  5EKK A;  2YU9 H;  4CKC A;  4KTA A;  5C44 H;  5IT9 c;  4N9P A;  3QOJ A;  1HQM C;  2K50 A;  5K36 H;  2ZJQ A;  3JAM c;  3NEN A;  4YCW A;  2K28 A;  1RTN A;  2EY1 A;  4IN3 A;  1NUC A;  1SAP A;  1KL9 A;  3Q22 A;  4OEL B;  3TME A;  3K5O A;  4UPA A;  4GKJ Q;  2AUJ D;  4OWT B;  4DAY B;  4OHJ A;  5JPM C;  2Z1C A;  5IT9 L;  3OMG A;  3DM1 A;  4POG A;  3HKZ G;  4O2D A;  3S2D B;  1KXL A;  1XMO L;  3TQY A;  4JI2 Q;  2A8V A;  1PFM A;  2PO4 A;  5LHY 1;  2E2H B;  3KLW A;  1GOZ A;  3I55 A;  3F2D A;  1CHQ D;  1DGS A;  2MHV A;  1K28 A;  1IKM A;  1GUS A;  3KFU A;  1AZQ A;  3C1F A;  1K8A C;  4TSS A;  1LAC A;  1Q8I A;  3A8J E;  1K8G A;  3AQQ A;  3BDC A;  4UP8 A;  4LNQ A;  1LLR D;  2HD3 A;  1R9T H;  2TSS A;  1TWC B;  2PI2 E;  1UAP A;  2MUY A;  1EQQ A;  4IQZ A;  2OT2 A;  4GNX B;  4A3D G;  1DZ1 A;  1ICW A;  3IFD A;  2EYH A;  5LMN L;  5KYI A;  4L5R C;  4RGO S;  2Y0S B;  3AU7 A;  1R4Q B;  4IUP A;  1V1Q A;  3VYU A;  4DR7 L;  1PYW D;  3A7A B;  4PNY A;  2XWB B;  3AFP A;  2B39 A;  4A3B G;  4KHP Q;  1TY0 A;  1UE6 A;  4DV7 L;  2JA5 G;  3W1B A;  4HIO A;  2UUA Q;  4HIM A;  4FYD A;  1GKH A;  5EKL A;  1N32 L;  4JI0 Q;  4X62 Q;  2MO1 A;  4JI0 L;  2NVT H;  2O5I C;  3WOF A;  3VYS A;  3ITP A;  1YNN C;  1QUQ A;  4GN5 A;  3TN2 A;  1Q90 A;  2RDF A;  3K57 A;  4DR7 Q;  3DHQ A;  4GN3 B;  3QR8 A;  1VQD A;  3A5Z B;  1EY9 A;  1IBL L;  4GLA C;  3K5M A;  4GLV B;  1L0W A;  2B2V A;  1EUJ A;  1Q7Y C;  3W2D A;  4YHH Q;  1SE8 A;  4DV0 L;  5JJZ A;  3L0O A;  1XMQ L;  2CH4 W;  1A2U A;  4BBR B;  2KEN A;  3T1Y L;  5D3I B;  4XIG S;  3NTK A;  5M5X B;  4MTK A;  3RNU A;  3K6O A;  4V0B A;  5GRO A;  3DMU A;  1A2T A;  1TS5 A;  1PZJ D;  1EY6 A;  2G5D A;  4A3G G;  2F4V L;  4IPC A;  1I4P A;  4YY3 Q;  4RFB A;  2A6H C;  4BXX G;  1NJI C;  2D5D A;  5JVG 3;  2YYZ A;  4GNX C;  1RDP D;  1XPU A;  4KY7 A;  3RR5 A;  3S2H H;  1XJV A;  3STB D;  1Y1W B;  1YBY A;  1Q1E A;  5HGQ A;  4N9T A;  3Q0A A;  1HRJ A;  4OO1 I;  3VYT A;  4P72 A;  2L4N A;  3MA2 B;  5DM6 3;  1IBK L;  1JE4 A;  2K5W A;  2N78 A;  3ZYY X;  1E7Z A;  3DLL A;  2R92 B;  1DOM A;  3UDI A;  2EJF C;  5GQO A;  2B63 B;  3QIA A;  4YWL A;  1TS4 A;  5ELB A;  4HID A;  2K5D A;  5J39 A;  3CD6 A;  5DLQ E;  5G3L D;  1CSP A;  3DWA A;  4DNR B;  2EVB A;  1SFO B;  1SYF A;  2WAQ E;  4A3C G;  2LSS A;  1UE5 A;  5AJ3 L;  5CV9 A;  5IYC G;  1JB7 A;  1IHZ A;  4H13 C;  2JP1 A;  5KYL A;  4GZY C;  1WVL A;  2K04 A;  2KUM A;  2HDL A;  1CM9 A;  1HNZ L;  3JC6 6;  2OXP A;  2Q2U A;  4A3I G;  1STE A;  2RSN A;  1D5X C;  3P75 A;  3OWE B;  2A68 C;  3W3A A;  4CGY B;  2F0L A;  1QJO A;  2NVX H;  5BR8 L;  1G8Z D;  3H3V C;  4LK1 C;  3I72 A;  2JA5 B;  4DN4 M;  2R7Z G;  3PIO A;  1KAW A;  1JOK A;  3MXN B;  2QDB A;  4EQO A;  2I5M X;  3ER0 A;  3MFG A;  3M4Q A;  3TDQ A;  4MIU A;  3KF8 B;  1EWI A;  1G2S A;  4BBR H;  3OMC A;  3J7Y W;  4DUY Q;  1HNW Q;  5AFW A;  1V9P A;  4KK7 A;  4QCL A;  4U67 3;  2WKD A;  4UDU C;  2KHS A;  1EYD A;  1HPC A;  3OOC A;  4MZ9 A;  2H1E A;  2DY8 A;  3J81 j;  4QGU A;  1Q82 C;  4ODG A;  4RCN A;  4AYB E;  4EQ5 A;  2RF4 A;  2PZU A;  4A3J G;  1Q81 C;  1VQM A;  2R7Z B;  1NMG A;  4FDB A;  3QWN A;  5C0X J;  2UUA L;  3RZO B;  4XXE A;  2LFN A;  4OXP A;  4B3R Q;  1KRS A;  1WD1 A;  1DJR D;  4WRD A;  3K80 C;  3ND9 A;  1P8L A;  3I4O A;  1TWA B;  4O42 A;  2FXQ A;  3H09 A;  5EJW A;  5M3M G;  4B3S Q;  2HCI A;  4B3S L;  1XTC D;  4RGT A;  2ATW A;  1ILQ A;  2SNM A;  2F0T A;  1B53 A;  4Y7N H;  3S1Q B;  3I91 A;  3HRZ C;  4JCV E;  1YEZ A;  2K14 A;  2K52 A;  1Y69 U;  3GTL H;  4X6A H;  3S17 B;  4IFD J;  2R93 H;  2A74 C;  5EGT A;  1TWC H;  1CKM A;  3CCQ A;  3KLS A;  3MXU A;  5COR A;  1K3R A;  5CV6 A;  1J5E L;  5C4Z A;  1CI3 M;  1UNS A;  1IL2 A;  1SBB B;  2A69 D;  1FJG L;  4CJ1 B;  2PQA A;  1EZ8 A;  4DXG A;  1PH8 A;  2F0K A;  5C4X B;  4ZKC B;  2UUC L;  1KIX A;  3C3L A;  1LTR D;  2Z6B A;  4QB4 A;  1PH1 A;  4A4I A;  5IGB A;  2EYM A;  1VQF A;  4J6H A;  3TP6 A;  5FLM G;  3PUV A;  1D7Q A;  5C3E G;  1F9S A;  3BZC A;  1PYB A;  2RSO A;  4YY3 L;  4RWS C;  1SSO A;  3NP8 A;  4A3D H;  5FJ8 H;  1BBX C;  3M4O B;  3KF8 A;  2MP1 A;  2ZJR A;  2J0T D;  5KRU A;  4RHS A;  3J7Z C;  1L1O A;  4CBV A;  1JE5 A;  4C2M B;  1KAA A;  1EEF D;  4IPH A;  3UE1 A;  4I7A A;  3M85 A;  2B8F A;  1GXD C;  2D9U A;  3H94 A;  2F0Q A;  4PMB A;  2E5L Q;  3CME A;  3E0E A;  2L9H A;  3PO3 H;  2EIF A;  1VQI A;  1RF2 D;  4OGQ C;  3ZJY C;  3FRP B;  2VQE Q;  2RBM A;  4OON A;  3KLS X;  5KEE A;  3KJP A;  4B3M Q;  1KHI A;  1DYQ A;  1NE3 A;  4LF6 L;  3I70 A;  3MC0 B;  5M5Y B;  3S2H B;  1WTQ A;  1X56 A;  2E2J B;  3I3C A;  3I4L A;  2YV5 A;  1Q86 C;  4IFD G;  1BOS A;  2DN8 A;  1V1P A;  4Z9C B;  1MIU A;  1D5Z C;  3CCU A;  3LWU A;  2KQ3 A;  1I6V C;  5ELD A;  5J1Z A;  3I73 A;  1L0Y B;  2VUM B;  5FLM H;  4C3I B;  1DOL A;  1SN8 A;  3T56 B;  5EBD A;  4BY1 G;  1VQP A;  3H91 A;  3I4N B;  3HOV B;  3I90 A;  4JK1 C;  2OCE A;  1HTP A;  1BBU A;  1C9O A;  1A8V A;  1JCK B;  2WKC A;  4IUN A;  3SR1 A;  1NCV A;  3PO2 G;  3E0J A;  1F77 A;  3PV0 A;  1G6P A;  2AQ2 B;  3HKS A;  1KC8 C;  3X3N A;  2JA6 G;  4HJ5 A;  4DV0 Q;  2FMM A;  1NR4 A;  1TS3 A;  4WJ3 M;  4AH6 A;  2WB1 B;  3PQI A;  3ERQ A;  2UXB L;  3HZX A;  3PF4 A;  4JG2 A;  4TQU S;  4A3F B;  2MO0 A;  4H0L C;  1I94 Q;  1HR0 W;  2K32 A;  1QG7 A;  3D4W A;  3M4O H;  3L2P A;  3VR4 A;  3MEH A;  1NSN S;  2NVX B;  4DGZ A;  5I6W A;  4JW0 A;  4QY7 A;  2CVR A;  2D0P A;  1U4M A;  1PH5 A;  4XQQ A;  4FXK C;  2F0P A;  4DK0 A;  3C1E A;  1C0A A;  1DON A;  2NVY B;  1SYG A;  2B2W A;  1Q8K A;  4B9W A;  1Y1V H;  5CR3 A;  1XWE A;  4M1U B;  1SFO H;  2L0C A;  1IKL A;  2BDN A;  2F0J A;  1A62 A;  4A3E H;  4IPD A;  1MJE A;  3U9S A;  3PUY A;  2F03 A;  2R92 H;  5C3W A;  2PW5 A;  1RHP A;  1T5X D;  1M90 C;  2BCO A;  1VQ8 A;  1HZB A;  3SEB A;  4P71 A;  1FGB D;  3GTK B;  1TII D;  1R4P B;  3HOW B;  1HFG A;  3STB C;  4MNO A;  2YTX A;  2RHS B;  2BH2 A;  4BBS H;  4Q5V A;  1F2M A;  4APV A;  1HHV A;  2YTV A;  1FGU A;  1ASY A;  2ZT9 C;  2X6G A;  4PZ8 A;  1E2V A;  5DAU A;  2WAQ G;  2BE5 D;  1TWG B;  2IPK D;  2K01 A;  3J80 i;  3SK4 A;  1E22 A;  4ZQ3 A;  3MFY A;  2IWH A;  1MBY A;  5CBA E;  3A8K E;  1S5F D;  4B9X A;  2IHE A;  3KLR A;  4A3F H;  5K5P A;  3CC4 A;  3D3R A;  2BA0 A;  2C35 B;  3IAY A;  4OX9 Q;  2OEO A;  4IPG A;  5IE8 A;  1HR0 Q;  1WTH A;  1N32 Q;  2B2U C;  2K4K A;  4ME5 A;  2XGT A;  4OWW B;  1CHP D;  1I6H H;  2B2Y C;  5BR8 Q;  1VQ9 A;  4HED A;  4LUZ A;  1IBM L;  5E7N A;  3HOX H;  1IW7 D;  3S2D H;  1X54 A;  4QMG A;  3KYH C;  1LUZ A;  2TMP A;  3S24 A;  5DNF A;  1YHB A;  5JEA G;  1NBW A;  4H7B A;  3KF6 B;  4JI8 Q;  1K3B C;  3NBI A;  3GTQ H;  2XN9 C;  1LT4 D;  1QVG A;  1WI5 A;  3RN2 A;  3D8G A;  3S17 H;  3RZO H;  4C2M H;  1S5C D;  1LTI D;  4DA2 A;  1FVI A;  5C3X A;  5JEA H;  5EBC A;  1N8R C;  1ET6 A;  3K0X A;  3BS1 A;  1IBL Q;  1QE6 A;  1SRO A;  5EQ0 A;  1YNN D;  2DY7 A;  2OQ0 A;  1ET9 A;  4K6L A;  5IOC A;  4TRD A;  4MN3 A;  4R1J A;  1PTO H;  1PDQ A;  5EAY A;  2VQF Q;  3SVM A;  4DV5 Q;  1SEB D;  2PW7 A;  2JA6 B;  2NWG A;  1PRT C;  2J4X A;  4EVO A;  4KN4 C;  4BY1 H;  4H44 C;  1G6Z A;  2KCC A;  2WP8 J;  1MHW C;  3WOE A;  1PV4 A;  4LAA A;  3S1M H;  2F0H A;  1MD2 D;  1F2L A;  4CKE A;  2NN6 G;  4ZUJ A;  4C1N I;  1LAB A;  1LT3 D;  4KN7 C;  3A8I E;  2K1B A;  3M7N A;  2F0M A;  2AHO B;  4BY7 G;  2PNR C;  1I50 B;  2OWO A;  1PTO B;  1TWF B;  2Q2H A;  2F0S A;  2YU9 B;  4RCO A;  2HHH Q;  1OTC A;  1LTT D;  2HHH L;  4HJ9 A;  4JBJ A;  3DEO A;  1VCI A;  4L5S A;  2N49 A;  3CCV A;  1T9H A;  3ND8 A;  1CUK A;  4AQY Q;  4A3M H;  4CKB A;  2R92 G;  1WD0 A;  4F8M A;  1YNX A;  2WII B;  3KUP A;  4FP5 D;  2B2U A;  2L55 A;  2NZO A;  2D62 A;  3OPO A;  2LKV A;  4KKS A;  4EQP A;  1IXR A;  4BY7 B;  3ICE A;  2QF7 A;  2R7Z H;  2R3Z A;  1D1K A;  5FK9 C;  1PFN A;  1HQR D;  2UUB Q;  3PUW A;  3ERS X;  2QEJ C;  1PMR A;  4ABN A;  5FKA C;  1OXU A;  1WOC A;  4KV6 A;  1Q46 A;  2F3V A;  2F0V A;  4GN4 B;  1PH7 A;  2L1B A;  1N33 Q;  3N6R A;  1UEB A;  2AUK A;  1B3Q A;  3RMH A;  4JI8 L;  1SNM A;  2O5J C;  4TKO B;  4K5X A;  1LTA D;  4DAV A;  4HCE A;  1SNP A;  5M3F G;  1K0R A;  1LO5 D;  2E8G A;  2F3W A;  5FLX E;  1PVO A;  2LXK A;  4A93 B;  1BCP C;  1TY2 A;  2J7Z A;  1Z7T A;  1VQA A;  3DEP A;  5G3L F;  5IGG A;  2I5H A;  1EY4 A;  2A6H D;  2JA5 H;  3UI2 A;  3EVQ A;  3VYR A;  3HS0 C;  1IYJ B;  3T13 A;  5C4X H;  4ALP A;  2F0N A;  1EYC A;  1N36 Q;  2LY7 A;  2I5L X;  2EY5 A;  3TP5 A;  3OTO L;  1EU3 A;  3J7A 5;  1D5M C;  1CTM A;  5IT9 E;  1LT6 D;  1PLF A;  3QB3 A;  4DPG A;  1ZYR D;  3CRK C;  2M00 A;  5D3D A;  1SE3 A;  3OW2 A;  1JC7 A;  2IX3 A;  3K7A H;  1WCM H;  3KK7 A;  3T51 B;  1E1T A;  2RDG A;  2JA7 B;  1VQH A;  4KHZ A;  4WFN 3;  4X64 L;  1FD7 D;  1BNZ A;  2QGQ A;  2Z9H A;  1Q3L A;  5IGF A;  3BYY B;  2Q2T A;  1QVC A;  3EIV A;  1X65 A;  2NVY H;  1WTO A;  3S9W A;  1IZ6 A;  3PMF A;  3V05 A;  1A15 A;  5T1G A;  1QZG A;  1B7Y B;  1KNA A;  3UDG A;  3CC2 A;  1I5F A;  2H4O A;  1SJE D;  2F4I A;  4DV2 L;  3K7A B;  1AN8 A;  2RVL A;  4GOP C;  3S1Q H;  2RHQ B;  2N55 A;  2R61 A;  4LFA Q;  4HIK A;  2IY5 B;  3S1N H;  1V43 A;  1VS0 A;  3OSO A;  4FF1 A;  1I3Q B;  4X65 Q;  2CCZ A;  2I46 A;  1PTO F;  4DR3 L;  3HOW G;  3RUZ A;  4JI4 L;  3M9B A;  1NTG A;  2K05 A;  1VQ5 A;  3OIQ A;  1EU4 A;  1SND A;  4R4Q A;  1STA A;  3NQT A;  3HOZ G;  4R8N A;  4LFA L;  2VUM G;  1AFP A;  1PRT F;  5BN4 A;  2ZXO A;  2WAQ B;  1F2Y A;  4DR6 L;  2EYF A;  2A1A A;  2JEB I;  1SMY D;  1Y1W G;  2Q8T A;  1HNW L;  2EJG C;  5CMD A;  2ID0 A;  2PQE A;  3OIP A;  1A63 A;  3EFX D;  1VQO A;  4L6T B;  3F2C A;  1TXY A;  2E75 C;  1SNO A;  2HQL A;  3BJU A;  1B44 D;  2FJ2 A;  4YWM A;  1EQT A;  3S1M B;  5IWA Q;  3GV3 A;  2IL8 A;  1CFM A;  1I6H B;  1XNQ L;  3VR6 A;  1B70 B;  2XTI A;  3FVQ A;  4A75 A;  1ENF A;  3VDY A;  3GTO B;  2B2T A;  2EYO A;  2WB1 G;  4NKL A;  3PIP A;  2XRQ D;  2PPB C;  3D6W A;  5IOD A;  1HZA A;  4XT1 B;  3CPW A;  4DV1 L;  1ESF A;  2B8G A;  2CW0 C;  2KA7 A;  3HEJ A;  1TR5 A;  5I9O A;  1YJW A;  3GTQ B;  3FP9 A;  4QL5 A;  3RLO A;  2PMZ B;  1VQL A;  3CXC A;  1GUG A;  4K8I A;  3GTJ H;  1S5E D;  3Q24 A;  2IW3 A;  3E5S A;  3CU7 A;  1F9Q A;  1LTG D;  3W5O A;  1BXT A;  2P5Z X;  4C3J H;  3M4P A;  1U4L A;  4DR4 L;  2K5H A;  4A3K B;  5CV8 A;  4L5T A;  1FJG Q;  4YIJ A;  5C4X G;  4CJ2 C;  5CC4 A;  2VW9 A;  1YZ6 A;  2NVQ H;  1FYC A;  4DU9 A;  3J81 i;  2HCC A;  3D4R A;  1HA5 A;  4KY6 A;  4L8J A;  4JI3 Q;  2WFW A;  2L5T A;  1EQR A;  4JOI C;  4MHE A;  1HUN A;  3DWP A;  2UXC Q;  4IUT A;  1SE4 A;  1BF4 A;  3AEV A;  2K6A A;  4QF4 A;  3KJO A;  3UDX A;  3J80 c;  1PFB A;  1AE2 A;  3BZK A;  2Z4H A;  3FHW A;  2KEC A;  1B50 A;  2DGY A;  3DUZ A;  1XMO Q;  2KCN A;  1NR2 A;  1TS2 A;  4I65 A;  3NSW A;  2Q8R E;  4P2C B;  4LFC L;  3NEL A;  2O4X A;  1I4G A;  3CPF A;  4LFB L;  3GO5 A;  2EOT A;  2UXC L;  2A6E D;  3LGJ A;  5M5W H;  1M1K C;  4ID6 A;  3PUZ A;  1GHJ A;  1Z6H A;  4DNT B;  1J6Q A;  4JBW A;  1ENA A;  2JSO A;  1HR0 L;  1TWA H;  1QVF A;  3NXW A;  1H9R A;  3NBH B;  1VQN A;  4LF9 L;  2UUB L;  4KD3 A;  2BH8 A;  2EJM A;  5M3F B;  4G7O C;  1CKO A;  5TSS A;  3I4M B;  2ENB A;  5M5Y H;  1VQC A;  4BWG B;  1HNZ Q;  4J8Q A;  1H9J A;  4YCV A;  3R8B A;  3GTG H;  3BDO A;  2AQ3 B;  3FKI H;  3HOZ B;  3U4V A;  1GUW A;  1V1O A;  3GTK H;  5A35 A;  4JI4 Q;  2EYL A;  4ZAI A;  3T53 B;  3CCM A;  4A93 H;  4DK6 C;  3T1H L;  3KDF A;  4UAI A;  1JR0 D;  4JI6 Q;  2EYP A;  1FL0 A;  4GNX A;  2IX1 A;  3M4Y A;  1JJC B;  1BBW A;  1C4Q A;  4DV3 Q;  1HH2 P;  4JBK A;  4A3I H;  1OXT A;  1QUQ B;  2C9O A;  1WJJ A;  4R8I A;  4A3D B;  1PZI D;  2VZA A;  1AE3 A;  4J15 A;  1CZW A;  4EQN A;  5HGT A;  3J80 E;  4HSP A;  4A3G B;  2MPM A;  1WTP A;  4OO1 G;  2NN6 I;  5I9P A;  2ZM6 Q;  3HP3 A;  4GKK L;  5IYC H;  3CCR A;  5IY0 A;  3AMU A;  1HCZ A;  4DV7 Q;  3CF5 A;  1QB5 D;  3KOJ A;  2KCM A;  1JQY D;  1SYB A;  2JA8 H;  2KCT A;  3S14 B;  4X3S A;  1AZP A;  5M3M H;  3T1Y Q;  1I50 H;  2ZXP A;  2MJ8 A;  3PO3 B;  5KNC A;  1HNX Q;  3CQZ B;  4NXM Q;  1HNX L;  3MEF A;  4FF3 A;  1J5E Q;  5JJI A;  2AMC B;  4GS3 A;  4LF7 Q;  4A3G H;  3FMC A;  2BOS A;  1VQ6 A;  3IFT A;  1E2Z A;  2B3G A;  4IZ8 A;  3IL8 A;  3GTG B;  5C3E H;  5AJ3 Q;  1EY0 A;  5LL6 X;  2EXZ A;  3F2U A;  2SDF A;  4NP5 A;  2IHF A;  4RGM A;  5CBE E;  2KHJ A;  3NUC A;  1ZYR C;  4C3H H;  4ZLT F;  4X64 Q;  4DV2 Q;  1STH A;  2D2C C;  4RMF A;  3N52 A;  4L63 B;  1EFW A;  4NB3 A;  2F3I A;  2LMC B;  3R3O A;  2CKZ B;  5C0X I;  4A3K G;  1YNJ C;  4P73 A;  1XX8 A;  4B3T L;  3GTM H;  3AFQ A;  4DAY A;  1GM5 A;  4X3K A;  1E24 A;  1B8A A;  4NPS A;  2UUC Q;  3P20 A;  4KLK A;  1U4R A;  1UWV A;  2D0O A;  3VA5 A;  1QCB D;  1D1I A;  1IBK Q;  2JK8 A;  1F9P A;  5IGC A;  2UU9 Q;  2XVS A;  4A76 A;  4ZUI A;  4DNI A;  1TWG H;  1ZKO A;  2RKS A;  3PSI A;  4DV4 L;  3V96 A;  1VQ7 A;  2HIX A;  4G57 A;  2PQA B;  4XTC S;  1U5K A;  4C3H B; 
#chains in the Genus database with same CATH homology
 4LF4 Q;  1QUQ A;  1L1O C;  2N8N A;  3HOW H;  4GN5 A;  1JJ2 A;  2WP8 J;  1YIJ A;  3S16 H;  4DR6 Q;  4DR7 Q;  1Y14 B;  1PV4 A;  3S1M H;  4A3K H;  4JYA L;  5H1S E;  4LF8 Q;  4GN3 B;  4DV3 L;  1Q1B A;  1VQD A;  4A3B H;  3A5Z B;  5LMN Q;  4DUY L;  1BKB A;  2NN6 G;  1IBL L;  4GLA C;  4GLV B;  1L0W A;  4ME3 A;  1EUJ A;  4P75 A;  3J81 c;  1Q7Y C;  4YHH Q;  1SE8 A;  3B6Y A;  4DV0 L;  1QZH A;  3GTO H;  3M7N A;  2UXB Q;  2AHO B;  3L0O A;  4BY7 G;  2OWO A;  1XMQ L;  5IWA L;  4JYA Q;  2Q2H A;  1LYL A;  2KEN A;  4KI0 A;  3CAM A;  3T1Y L;  4XIG S;  3S14 H;  3M3Y H;  4DR5 L;  3RNU A;  5GRO A;  2F52 A;  2HHH Q;  4A3L H;  1OTC A;  5IP7 G;  2HHH L;  2ASB A;  1S3O A;  4HJ9 A;  4IOC A;  4A3G G;  4JBJ A;  4IPC A;  2F4V L;  4YY3 Q;  1VCI A;  4L5S A;  2N49 A;  4BXX G;  3CCV A;  1T9H A;  4BXX H;  1H95 A;  1NJI C;  1CUK A;  4AQY Q;  4A3M H;  2R92 G;  4X62 L;  2YYZ A;  4GNX C;  1XPU A;  1VQG A;  1YNX A;  3RR5 A;  5IP7 H;  3S1R H;  1XJV A;  3S2H H;  3STB D;  2HT1 A;  1S40 A;  2HIV A;  4A3E G;  1YBY A;  1Q1E A;  1CKN A;  5HGQ A;  4A3J H;  1EOV A;  1G51 A;  4OO1 I;  2NZO A;  2YTY A;  4P72 A;  2V1C C;  2D62 A;  1IBK L;  4GLX A;  2JA9 A;  2N78 A;  1WCM G;  3K81 C;  4R4O A;  1IXR A;  5C4J H;  3WWV A;  1E7Z A;  3DLL A;  1PFS A;  4HJ7 A;  3ICE A;  3UDI A;  2OTL A;  2R7Z H;  4MTN A;  3DM3 A;  5GQO A;  1CSQ A;  4IFD I;  2UUB Q;  4YWL A;  3K7U C;  4HID A;  1KD1 C;  3PUW A;  3ERS X;  3CD6 A;  5DLQ E;  4DR3 Q;  1PH9 A;  1CSP A;  3T1H Q;  3HOU H;  1OXU A;  1WOC A;  1EYG A;  3D31 A;  1Q46 A;  1KRT A;  2WAQ E;  4A3C G;  2LSS A;  1UE5 A;  5AJ3 L;  4GN4 B;  1PH7 A;  2B63 G;  4LFB Q;  3PGZ A;  1N33 Q;  1N9W A;  1UEB A;  1X6O A;  3EBE A;  5IYC G;  5M3F H;  1JB7 A;  1N34 L;  2CWP A;  3E9H A;  2R93 G;  4JI8 L;  4UP7 A;  4A3F G;  4GOP B;  4DR1 L;  2Z6K C;  5K36 G;  5JJK A;  2OQK A;  1HNZ L;  5M3F G;  3JC6 6;  4DUZ L;  3RLF A;  2Q2U A;  1K0R A;  2E8G A;  4A3I G;  2JA7 G;  1N36 L;  4A3C H;  4X66 Q;  1GO3 E;  2KBN A;  2ZTE A;  1PVO A;  2LXK A;  1XTD A;  1PHJ A;  3GTP H;  2ZJP A;  2NVX H;  5HY6 A;  5BR8 L;  1VQA A;  2I5H A;  2JA5 H;  1OXV A;  4DV6 L;  4K0K L;  1WYD A;  2ES2 A;  1PH3 A;  5LMU L;  1IYJ B;  4ALP A;  4X66 L;  5C4X H;  1KAW A;  3PIO A;  1YJN A;  1NMF A;  3MXN B;  2R7Z G;  1N36 Q;  2Z6K A;  2I5M X;  3ER0 A;  2I5L X;  3M4Q A;  3OTO L;  3KF8 B;  1EWI A;  4BBR H;  2PMZ E;  4JBM A;  3J7A 5;  4DUY Q;  1HNW Q;  2JQO A;  5FLX c;  1V9P A;  4DR4 Q;  2RCN A;  4DPG A;  3TRE A;  1MJC A;  3OW2 A;  3H0G G;  2VL6 A;  3F2B A;  4A3M G;  1GD7 A;  4MZ9 A;  3K7A H;  4Y52 H;  4PMW A;  1WCM H;  3J81 j;  4QGU A;  1Q82 C;  2JA7 H;  4AYB E;  4EQ5 A;  1A0I A;  1E1T A;  2RF4 A;  3HOX G;  1VQH A;  4KHZ A;  4X64 L;  4A3J G;  1U0L A;  3U50 C;  1SRU A;  1Q81 C;  1VQM A;  2QGQ A;  3EN2 A;  2UXD Q;  1NMG A;  4FDB A;  4TVA B;  5C0X J;  2H5X A;  4B3M L;  1SMX A;  2UU9 L;  2UUA L;  4R4I A;  2Q2T A;  4BY7 H;  1QVC A;  4OXP A;  4LF6 Q;  1KRS A;  4B3R Q;  2CQO A;  4JV5 L;  3EIV A;  1X65 A;  3S15 H;  2NVY H;  4DV1 Q;  2MNA A;  1IZ6 A;  2E5L L;  3K80 C;  2NZH A;  1P8L A;  3I4O A;  4R4T A;  2Y0S G;  4JI7 L;  2FXQ A;  1QZG A;  1X9N A;  1B7Y B;  5M3M G;  1L2F A;  3UDG A;  3CC2 A;  1I5F A;  4B3S Q;  1OXX K;  1UE1 A;  2E2J H;  4B3S L;  4DV2 L;  4GOP C;  2ATW A;  3S1Q H;  2RHQ B;  3G71 A;  4DR1 Q;  4Y7N H;  2EQS A;  4LFA Q;  4JCV E;  4HIK A;  2IY5 B;  1X55 A;  1YEZ A;  2K14 A;  3S1N H;  1HJP A;  1V43 A;  2K52 A;  3GTL H;  4X6A H;  1VS0 A;  4IFD J;  1Q12 A;  4X65 Q;  2CCZ A;  1XNQ Q;  2MQH A;  2R93 H;  3RN5 A;  2VY3 A;  2AKW B;  4DR3 L;  3HOW G;  4JI4 L;  2JA6 H;  3RLN A;  4LF5 Q;  1TWC H;  3M9B A;  1CKM A;  1K73 C;  5J3B A;  3AYH B;  2B63 H;  4LF5 L;  1NTG A;  2N3S A;  3Q8D A;  3CCQ A;  1XNR L;  1K3R A;  5IYD G;  1MKH A;  1XPO A;  1J5E L;  1IL2 A;  3HOU G;  1VQ5 A;  1FJG L;  3ULP A;  1CKN B;  2PQA A;  4PZ7 A;  4R4Q A;  3PO2 H;  3HOZ G;  3GD7 A;  1PH8 A;  3U4Z A;  4LFA L;  2VUM G;  1WFQ A;  2ZTD A;  2IT1 A;  3FKI G;  2GVB A;  2UUC L;  2AWN A;  1KIX A;  4YWK A;  3OTO Q;  4DR6 L;  5IYD H;  2A1A A;  2JEB I;  4OWX B;  1PH1 A;  3PUX A;  1Y1W G;  4A4I A;  3U58 A;  1YHQ A;  4JI1 Q;  1HNW L;  5FLM G;  1VQF A;  3CC7 A;  2ID0 A;  1D7Q A;  3CQZ H;  3PUV A;  1A63 A;  5C3E G;  1YIT A;  5M5X H;  3BZC A;  1PYB A;  4DV5 L;  4YY3 L;  1VQO A;  2Z0S A;  3H3V H;  4A3D H;  3F2C A;  2MFI A;  1TXY A;  5IP9 H;  4JI5 Q;  2ALY B;  2HQL A;  3BJU A;  4QIW E;  1O7I A;  1OXS C;  5FJ8 H;  1LTL A;  4YWM A;  5IWA Q;  2ZJR A;  1W3S A;  2K5N A;  1PA6 A;  4HJA A;  1XMQ Q;  2Q2I A;  1XNQ L;  3G4S A;  1TWH H;  3J7Z C;  4LFC Q;  1L1O A;  4WJ4 A;  1B70 B;  1JE5 A;  2AWO A;  2XTI A;  4IPH A;  3UE1 A;  4A75 A;  3M85 A;  3VDY A;  2WB1 G;  2VS1 A;  2I0Q A;  3PIP A;  1GVP A;  3CCE A;  3PO3 G;  4DK3 C;  1Y1V G;  4HJ8 A;  2VNU D;  3HFZ B;  2E5L Q;  3CME A;  3E0E A;  1HZA A;  3PO3 H;  2EIF A;  1VQI A;  2ZTC A;  3CPW A;  4DV1 L;  3NEM A;  4YCU A;  3HKZ E;  3ZJY C;  1D8L A;  3G48 A;  2VQE Q;  2BA1 A;  3A0J A;  4OON A;  1PH6 A;  1LM0 A;  4B3M Q;  3KJP A;  1NY4 A;  1KHI A;  5IYB G;  1YJW A;  3G6E A;  3RZD H;  1L1O B;  1NE3 A;  1G29 1;  2K5V A;  3FP9 A;  4O0A A;  4QL5 A;  3RLO A;  3CCS A;  4DR2 Q;  4LF6 L;  3A74 A;  4IO9 A;  1XNR Q;  1VQL A;  1X56 A;  3CXC A;  4LF7 L;  2YV5 A;  5ELO A;  3HOY G;  3CCJ A;  4YHH L;  1YHA A;  5C44 G;  5GAH C;  1JJG A;  3GTJ H;  1Q86 C;  4IFD G;  1YVC A;  1HZC A;  4JI2 L;  3W5O A;  1MIU A;  1SLJ A;  4C3J H;  1BVS A;  2VQE L;  3CCU A;  3M4P A;  2VUM H;  3TS0 A;  4RG1 A;  3HOZ H;  4DR4 L;  4L5Q A;  3GDE A;  5FLM H;  2IX0 A;  1SN8 A;  2K5H A;  4LF9 Q;  3H15 A;  4L5T A;  1FJG Q;  1PYS B;  1VQK A;  4BY1 G;  1VQP A;  4BY1 H;  5C4X G;  2A19 A;  2R7F A;  4LUV A;  2VW9 A;  1YZ6 A;  2L15 A;  4LW1 A;  3I2Z A;  2NVQ H;  2OCE A;  1PH4 A;  3J81 i;  1BBU A;  1C9O A;  1A8V A;  2E2I H;  4BBS G;  4K0K Q;  5JJL A;  4JI6 L;  4JI3 Q;  4UY8 C;  3PO2 G;  2WFW A;  4OX9 L;  3PV0 A;  5LMU Q;  1EQR A;  1G6P A;  4JOI C;  4AIM A;  3HKS A;  1KQS A;  1KC8 C;  2UXC Q;  5C0X G;  4IJH A;  3AEV A;  2JA6 G;  3BU2 A;  4JOI A;  4HJ5 A;  3H3V I;  1RIP A;  4DV0 Q;  3KJO A;  1I3Q H;  3CP0 A;  3IRB A;  3UDX A;  1AE2 A;  5IYB H;  3J80 c;  4BA2 I;  3PCO B;  1E1O A;  3BZK A;  3CMA A;  3FHW A;  3A5U A;  4AH6 A;  1C7Y A;  2DGY A;  1XMO Q;  5ELN A;  4WJ3 M;  5JEA J;  4DKA C;  2UXB L;  4IJL A;  3PF4 A;  3TEH B;  4JG2 A;  4TQU S;  1I94 Q;  2MO0 A;  1HR0 W;  4PG3 A;  3M4O H;  3I4M G;  3L2P A;  4LFC L;  3NEL A;  4AYB G;  1SR3 A;  3PF5 A;  3CPF A;  1AH9 A;  4LFB L;  3GO5 A;  4LF8 L;  4JV5 Q;  2UXC L;  1TWF H;  1RL2 A;  1YI2 A;  4QY7 A;  1IBM Q;  3LGJ A;  1E3P A;  2D0P A;  3UDF A;  5M5W H;  1M1K C;  3PUZ A;  1PH5 A;  4BA1 I;  2ZM6 L;  4LWC A;  3KF6 A;  1J6Q A;  4P74 A;  4JBW A;  4NXN Q;  1HR0 L;  1C0A A;  2JE6 I;  4KHP L;  1TWA H;  1QVF A;  1Q8K A;  1VQB A;  1Y1V H;  3NBH B;  3F8T A;  1VQN A;  3HOV G;  4DR5 Q;  3I4N G;  1SFO H;  4LF9 L;  2UUB L;  1JT8 A;  1A62 A;  2BH8 A;  4BBR G;  4A3E H;  4IPD A;  1CKO A;  3ULL A;  1Z47 A;  1Y1W H;  1YJ9 A;  1MJE A;  1PH2 A;  5M5Y H;  1VQC A;  2PNH A;  3PUY A;  4DAM A;  1HNZ Q;  2R92 H;  3I4M H;  4YCV A;  1XPR A;  2JEA I;  3E9I A;  2QEX A;  3GTG H;  3SGI A;  3FKI H;  4JI7 Q;  2KHI A;  2WB1 E;  4NXN L;  1UE7 A;  3U4V A;  1M90 C;  1HZB A;  1VQ8 A;  3GTK H;  3TRZ A;  4P71 A;  4C3I H;  4JI4 Q;  3K8A A;  2GN5 A;  4GKK Q;  1HZ9 A;  3STB C;  4MNO A;  2YTX A;  2QA4 A;  2RHS B;  1N33 L;  2BH2 A;  5GAG C;  3CCM A;  4BBS H;  2K75 A;  4B3R L;  2DUD A;  2JJQ A;  4DK6 C;  1JMC A;  5LMN W;  1S72 A;  2Y0S E;  4A93 H;  4APV A;  2YTV A;  3T1H L;  4GOP A;  1FGU A;  4A93 G;  3KDF A;  1ASY A;  4JI3 L;  1K9M C;  1W2B A;  4JI6 Q;  4NXM L;  1FL0 A;  5GAD C;  1VQJ A;  4GNX A;  2IX1 A;  2CFM A;  4PZ8 A;  1I94 L;  2WAQ G;  3CW2 C;  1JJC B;  3I7F A;  1X3F A;  1BBW A;  4DV3 Q;  3J80 i;  2YU9 H;  2GVA A;  1HH2 P;  4H02 A;  4JBK A;  1E22 A;  5C44 H;  4A3I H;  1OXT A;  4B3T Q;  1QUQ B;  5IT9 c;  1WJJ A;  1X3G A;  2K50 A;  1K83 H;  2VZA A;  2ZJQ A;  2B29 A;  1AE3 A;  2R7D A;  4J15 A;  2IHE A;  3JAM c;  4A3F H;  3NEN A;  3CC4 A;  4OO1 G;  4YCW A;  2NN6 I;  2BA0 A;  2C35 B;  2ZM6 Q;  4OX9 Q;  4IPG A;  4GKK L;  5IE8 A;  5IYC H;  3HOV H;  3I4N H;  3CCR A;  1HR0 Q;  5IY0 A;  1N32 Q;  1KL9 A;  2K4K A;  2XGT A;  4OWW B;  3F1Z A;  4UPA A;  4DV4 Q;  3CF5 A;  3KOJ A;  3ULJ A;  4DV7 Q;  2F4V Q;  4JI1 L;  2KCM A;  2VQF L;  4GKJ Q;  1I6H H;  3CCL A;  3I56 A;  5BR8 Q;  2JA8 H;  4OWT B;  1VQ9 A;  4DAY B;  2KCT A;  4LUZ A;  1IBM L;  5M3M H;  5E7N A;  3T1Y Q;  2OTJ A;  1Z9F A;  3HOX H;  3S2D H;  1I50 H;  3TS2 A;  1X54 A;  3KYH C;  4POG A;  3HKZ G;  1EIF A;  4O2D A;  1KXL A;  1LUZ A;  1XMO L;  3TQY A;  4JI2 Q;  2A8V A;  1HNX Q;  4DUZ Q;  3S24 A;  4NXM Q;  1HNX L;  3MEF A;  1EIY B;  4POF A;  3KLW A;  3OYY A;  1J5E Q;  3I55 A;  2AMC B;  1YHB A;  1X3E A;  4GS3 A;  5JEA G;  5GAE C;  3F2D A;  1DGS A;  5JJI A;  4LF7 Q;  4AQY L;  1NBW A;  4A3G H;  3KFU A;  3KF6 B;  4JI8 Q;  2CWA A;  4DV6 Q;  5IP9 G;  4DR2 L;  1VQ6 A;  2LXJ A;  1N34 Q;  1K8A C;  2B3G A;  3GTQ H;  2EXD A;  4X65 L;  1QVG A;  4LF4 L;  1WI5 A;  5C3E H;  3RN2 A;  5AJ3 Q;  3S17 H;  4QJF A;  1VQE A;  2R6G A;  4C2M H;  1K8G A;  3RZO H;  1FVI A;  3AQQ A;  4UP8 A;  2UXD L;  4LNQ A;  2IHF A;  3H0G H;  1N8R C;  1ASZ A;  5FJ8 G;  2KHJ A;  1P16 A;  4EX5 A;  4C3H H;  1R9T H;  4X64 Q;  2PI2 E;  4DV2 Q;  1EQQ A;  3K0X A;  2PI2 A;  4LUO A;  4RMF A;  4GNX B;  4A3L G;  4A3D G;  1EFW A;  1IBL Q;  4NB3 A;  5LMN L;  2F3I A;  1SRO A;  2CKZ B;  5C0X I;  4A3K G;  4IOA A;  4QQB X;  4L5R C;  4P73 A;  4B3T L;  3GTM H;  2E2H H;  3AFQ A;  1GM5 A;  2JA8 G;  1E24 A;  1B8A A;  1V1Q A;  4NPS A;  1VQ4 A;  2UUC Q;  4DR7 L;  4KLK A;  1UWV A;  2D0O A;  3AFP A;  1IBK Q;  2OQ0 A;  4A3B G;  4KHP Q;  2JK8 A;  1UE6 A;  4JC0 A;  4DV7 L;  2JA5 G;  3W1B A;  4R4C A;  4R1J A;  4HIM A;  4PZ6 A;  4HIO A;  4A76 A;  2UUA Q;  2UU9 Q;  1GKH A;  1N32 L;  4JI5 L;  3L7Z C;  5EAY A;  4JI0 Q;  4X62 Q;  3KDF B;  4DNI A;  2VQF Q;  3W1G A;  1TWG H;  2MO1 A;  3PSI A;  4JI0 L;  3UE0 A;  4DV4 L;  4GKJ L;  4UP9 A;  4DV5 Q;  3D0F A;  1VQ7 A;  2HIX A;  2NVT H;  3JAM i;  3HOY H;  2PQA B;  4XTC S;  1U5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...