2UUAQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uuaQ00
1LM0A 2F52A 3K80C 2F4VL 3GTPH 4YWKA 1NJIC 2Q2HA 2AMCB 4A3KG 4BY7H 1OXSC 2JA8H 4DV6L 4KHPL 2ZM6Q 2Y0SG 5DLQE 5C0XJ 3VDYA 3ULPA 1QZHA 1JJ2A 3J7ZC 4JI5L 2JK8A 3STBD 3KFUA 2VNUD 4GOPC 1ASZA 4PZ7A 1VQOA 3OTOL 4GNXC 2AWOA 4HIOA 3HKSA 3AQQA 1X3GA 1YZ6A 3HOXH 4JV5L 5IY0A 1VQCA 3CPWA 2EIFA 3CCUA 1O7IA 1VQ5A 4YHHQ 4AQYQ 1UE7A 1VQ4A 4DR7Q 3HOXG 4Y52H 4JYAL 1J6QA 4LF7Q 1VQKA 1PH3A 2Q2UA 3RR5A 1EIFA 1Q7YC 2N3SA 2I5LX 1Q82C 1KC8C 2XGTA 5LMUL 5GQOA 3MEFA 4HIKA 2K52A 2MNAA 3I4OA 2IHEA 1TWGH 2L15A 2E5LQ 3PCOB 4JI4Q 2PI2E 3I56A 3PO2H 4DR6L 4A76A 4DK6C 3AFQA 1SE8A 4A3FG 2GVAA 1N34Q 3GTKH 5JJIA 3PUYA 2R6GA 1V9PA 4L5RC 1NTGA 5IT9c 1KRSA 3M4QA 1TXYA 3BU2A 2MFIA 2RHQB 2UU9L 4RG1A 1YJ9A 3K7UC 2LSSA 1HZAA 2KCTA 1HNZL 1FVIA 4DUZL 3I4NG 2K50A 2NVYH 3NELA 2VQEL 1L1OB 1Y1VH 2CFMA 4LF8Q 1S3OA 5IWAL 2B63H 1VQEA 2VW9A 1MJCA 1PV4A 4X65Q 1Y1VG 1HNWL 1KL9A 1PH4A 3D31A 4LF7L 2R7FA 1PH9A 3S2HH 1EOVA 4X6AH 2B63G 3HKZG 2UXBL 4DR3Q 4NXNL 2Y0SE 4LF6L 4JBJA 4OXPA 4L5SA 4EX5A 1IBKQ 1JE5A 3F8TA 1B70B 4LFAQ 2WFWA 4JI2Q 3M4OH 2HHHQ 4NPSA 5JEAG 3S1QH 2QGQA 1PH7A 1X65A 4BA1I 1X9NA 3UDXA 2AWNA 4YCUA 2VS1A 2IY5B 5FJ8G 5AJ3L 2OQ0A 2LXJA 3UDGA 4JI3Q 2CQOA 4HJ5A 2N8NA 3ULLA 4B3SL 2RHSB 3S1RH 4AIMA 4GKJQ 1E1OA 3CQZH 1X3FA 4OWTB 4C3HH 3U4ZA 5GAGC 5M3MG 1EQRA 2D62A 1E24A 4DV2Q 2NVQH 1I6HH 4YWMA 4X64L 3RN2A 3HOWH 1S72A 1N36L 1FJGQ 4K0KL 4JG2A 4JI7L 3L2PA 1UE1A 1PYSB 3ZJYC 1N33L 2R7ZH 2AKWB 4UP7A 3HOWG 3I4MH 3PIOA 4BY1H 1YEZA 1SROA 4GNXA 4JBMA 2ZTEA 4UP9A 3J80i 5IP7H 1HR0Q 1VQBA 2R7ZG 3HOZH 5LMNW 4IO9A 3I4MG 1Q8KA 3BJUA 4BY1G 5LMUQ 2MO1A 3E9HA 2IX1A 4B3RL 3KF6A 3KJOA 5IP7G 4A3MH 4LF5Q 4DV4Q 1WFQA 5LMNL 1UE5A 1HNXL 1XNRL 3HOZG 4GS3A 2PNHA 1AH9A 5ELNA 4GKKL 1CKMA 3TS2A 4A3MG 3A74A 3M85A 3H3VH 2K14A 2JA5H 4R4CA 2ES2A 3Q8DA 1IBLQ 3ULJA 3EN2A 3HKZE 4DPGA 4JI1L 4QJFA 5C4JH 2JQOA 4DV2L 2JA5G 3I7FA 1QUQB 1M1KC 1OXXK 3AYHB 4JI6Q 4JI0Q 3T1YL 4B3ML 3CCSA 4B3TQ 5IE8A 1GM5A 2OQKA 5H1SE 4DV3L 2HQLA 3A0JA 1XMQL 4AYBG 1U0LA 3K8AA 1SFOH 3GTGH 3HOUH 2UUBL 2YTXA 2Z0SA 1P16A 3L0OA 4HJ8A 4DR1L 4GLXA 4DV5Q 4BXXH 4BA2I 1YNXA 4HJAA 4X62Q 3HOUG 4PG3A 3UDIA 4L5TA 3TQYA 4BXXG 4JOIC 1VQ8A 2YYZA 4XIGS 4JBKA 4DV1Q 4BY7G 4OONA 3T1HQ 2JA8G 2DGYA 4X66Q 4DV0Q 4ALPA 1PA6A 5BR8Q 4WJ3M 1E22A 4KI0A 1Y14B 2K5VA 2B3GA 5M5XH 1YITA 1XPUA 2UXCL 1NMGA 4OX9L 2EXDA 2HIVA 2UUAQ 1LTLA 4L5QA 1N32L 4MNOA 1IL2A 1H95A 1X54A 2PQAB 3K0XA 3RZDH 3S2DH 4LUVA 3KDFB 1N8RC 1A8VA 3TREA 3PUXA 3EBEA 4DV7L 4JI8L 1YJNA 1XMOQ 3H0GH 4A75A 1E3PA 1VQGA 3F2DA 3HOYH 4B3TL 4A3CH 1HJPA 3G4SA 4IOCA 4LUZA 4A3BH 4BBSH 1BKBA 4P74A 3PF4A 3J80c 2R7DA 4IJHA 3H0GG 4PZ8A 3HOYG 1L0WA 4A3CG 2Z6KC 4A3BG 3CC2A 1Q46A 1BVSA 2JA7H 3BZCA 3W1GA 4LFBL 1EQQA 4Y7NH 4ME3A 2ZM6L 1VQIA 1PH8A 4DK3C 3TRZA 1CKOA 4P72A 3GTLH 2JA7G 2K4KA 3L7ZC 4QIWE 4FDBA 1VQHA 1FL0A 3PUZA 4R4TA 2NZHA 2KHJA 1K83H 2K5HA 4DAMA 3PGZA 1OTCA 3CCQA 5FLMH 3FP9A 3S24A 1EFWA 1A62A 3H3VI 4AYBE 3DM3A 2CCZA 3E9IA 3CF5A 4GLAC 3A5UA 2ZJPA 4YHHL 5HY6A 4AQYL 5FLMG 1VQ9A 1LYLA 4DR7L 3U50C 4GLVB 5J3BA 4R4QA 3PO3H 4IFDG 3ER0A 4UP8A 4GOPB 1P8LA 4LF4Q 1V43A 2FXQA 3KOJA 3IRBA 1PH6A 4GNXB 4JBWA 3DLLA 3PO3G 2VQFQ 2Q2TA 3S1MH 1I5FA 1NBWA 1B7YB 4QGUA 1JT8A 4KLKA 2CWPA 2E5LL 3S1NH 1D7QA 1C9OA 4JI4L 1TWAH 3KF6B 2E2IH 3J81j 1N34L 4IPGA 1Z9FA 4LFBQ 2A8VA 1K0RA 4DR2Q 5M5YH 1PH5A 5JJLA 2ZTCA 1XJVA 2E2JH 4OWWB 1MKHA 1J5EQ 1SR3A 2GN5A 3F1ZA 4QL5A 3J7A5 1CUKA 2HIXA 4LUOA 3TEHB 3PIPA 1D8LA 1MIUA 5M3FH 1VQLA 4LF8L 2KHIA 3UDFA 2N49A 1HZ9A 5IYCH 1X55A 1OXUA 1JJGA 4JOIA 4DUYQ 5M3FG 1A63A 2UUCQ 1G51A 3KYHC 2NZOA 1B8AA 4X65L 3H15A 1GO3E 1KIXA 3HOVH 3CD6A 1XPRA 2CKZB 1G291 5IYCG 3S14H 4P73A 4LF4L 3S17H 1AE2A 1FGUA 3ERSX 4GN5A 4DR3L 1K9MC 1IBMQ 3FKIH 1M90C 3AFPA 4NXMQ 1NY4A 4DR5Q 1IBKL 4JI2L 4LFAL 4LF9Q 1VQ6A 2R92H 3NENA 2B29A 2I5HA 2HHHL 4OWXB 2OTLA 1Q1EA 1QVCA 1UEBA 2IHFA 4YY3Q 2ZJQA 2R92G 1R9TH 2IX0A 4RMFA 3CCJA 1Q12A 1CSQA 1A0IA 2JA6H 4JI3L 4A93H 2JEBI 4KHZA 3OW2A 1QVGA 4J15A 4EQ5A 1XNQQ 2Q2IA 4YWLA 3GD7A 2JA6G 3CC7A 4GKJL 4A93G 2Z6KA 1YHBA 5GAHC 3CCEA 3GO5A 1PVOA 1K8AC 4P75A 2F4VQ 1I50H 1W3SA 1VQFA 4MZ9A 1T9HA 1RIPA 3I2ZA 5IP9H 1FJGL 2NN6G 4YCWA 4IPDA 4AH6A 4DV6Q 2WAQG 1HR0W 3S16H 4HIMA 5IP9G 1V1QA 1HZBA 1WCMH 1CKNA 1HR0L 5GADC 4JI5Q 2PI2A 1GKHA 4P71A 1KD1C 1KHIA 2WB1G 1I94Q 3OTOQ 1WCMG 1UE6A 2IT1A 4O2DA 3CAMA 4LF5L 1WI5A 4DV4L 4A3DH 3I55A 1S40A 4JV5Q 1VQAA 1HZCA 1SLJA 3PSIA 2NVTH 1UWVA 1EWIA 4NB3A 3UE0A 1VQNA 4QQBX 4LNQA 1VS0A 3PUWA 1PFSA 1GD7A 4A3DG 3F2BA 5JEAJ 4JYAQ 5K36G 1TWFH 2AHOB 4DNIA 1TWCH 1IBLL 3WWVA 1VQDA 2CWAA 4C3IH 3PV0A 3F2CA 3G71A 4JI6L 1PYBA 1W2BA 4A3LH 1L1OC 4XTCS 3JC66 2QA4A 5C44H 2K5NA 4JI0L 4DR6Q 1PHJA 1YJWA 1LUZA 2A1AA 4OO1G 2YTYA 5C3EH 2YU9H 2BH8A 3STBC 4A3GH 4A3LG 2VL6A 4LW1A 4UPAA 2BA1A 5C44G 1QZGA 4H02A 3CCMA 2ZJRA 4DV5L 2UU9Q 3U58A 1YHAA 4BBSG 5C3EG 2MO0A 1SMXA 2PMZE 3JAMi 1Q81C 4X62L 4POFA 1Q86C 1VCIA 1I94L 1HNZQ 4DUZQ 4HJ7A 2VQEQ 1X56A 4HIDA 4DV1L 3T1HL 1QUQA 5IWAQ 1VQMA 4X66L 3LGJA 4DV0L 3AEVA 1SN8A 1WOCA 2YTVA 5BR8L 2JA9A 5FLXc 3PF5A 3CCVA 1HNWQ 3SGIA 1OXVA 3RN5A 2OTJA 1MJEA 2WAQE 4R4OA 3CXCA 1U5KA 2F3IA 3J81i 5EAYA 2UUAL 2UXBQ 4IJLA 1VQ7A 4NXNQ 1YI2A 4LF6Q 1Q1BA 1I3QH 2KBNA 2D0PA 1EIYB 4A3FH 3TS0A 3EIVA 1NMFA 2NN6I 1DGSA 1XMOL 5JJKA 2WB1E 4PZ6A 3K81C 1VQPA 5E7NA 2UXDQ 3KLWA 5AJ3Q 3G6EA 3M9BA 2YV5A 1JJCB 4TVAB 3I4NH 1N9WA 1WJJA 1Y1WH 1IZ6A 3B6YA 4B3SQ 1YIJA 1C7YA 1K3RA 4IPCA 4HJ9A 2BA0A 4A3GG 3UE1A 4A4IA 4DAYB 4R4IA 3A5ZB 1Y1WG 3W1BA 2JE6I 1YHQA 3M7NA 2EQSA 2PQAA 4QY7A 3K7AH 5M5WH 4X64Q 1KRTA 1JB7A 3KF8B 4O0AA 3D0FA 3KDFA 2I5MX 4A3EH 1N36Q 1EYGA 2I0QA 1WYDA 5IYBH 4JI7Q 4K0KQ 4GN3B 1RL2A 2KCMA 1N33Q 3RLOA 1K73C 1IXRA 3PO2G 4A3EG 1KQSA 4JCVE 1AE3A 1NE3A 2H5XA 1Z47A 5IYBG 4JC0A 1IYJB 5C0XG 3PUVA 2NVXH 3NBHB 5FJ8H 2QEXA 4B3RQ 4A3IH 1XPOA 3OYYA 2VY3A 4PMWA 2BH2A 1CSPA 3KJPA 2ID0A 1PH2A 4C3JH 4DR4Q 1KAWA 5ELOA 4OO1I 5LMNQ 1PH1A 1HNXQ 1XNRQ 4UY8C 5C4XH 2UXDL 4A3IG 1HH2P 3S15H 3FHWA 3HOVG 4GKKQ 1CKNB 2HT1A 2VQFL 5M3MH 5GROA 3JAMc 5C4XG 4C2MH 4DKAC 1QVFA 3FKIG 4TQUS 2ALYB 3NEMA 1L1OA 2LXKA 1E1TA 1E7ZA 1JMCA 4LFCQ 2JEAI 4APVA 4JI1Q 5HGQA 3E0EA 4LWCA 4DR2L 1K8GA 2RCNA 2XTIA 4IPHA 4YCVA 3CPFA 3CCLA 2GVBA 2ASBA 3HFZB 2D0OA 1J5EL 1KXLA 1G6PA 1YBYA 2WP8J 4POGA 1C0AA 3T1YQ 4B3MQ 4WJ4A 2N78A 1XTDA 3J81c 2OCEA 2VZAA 4DV3Q 4GOPA 1XMQQ 3GTMH 1SRUA 2C35B 2UUBQ 3U4VA 2JJQA 4DR1Q 4DUYL 5IYDH 2UUCL 4R1JA 4IFDI 4DR4L 4KHPQ 4BBRH 3RNUA 3GTOH 5IYDG 3GDEA 2ATWA 1X3EA 2V1CC 1ASYA 1IBML 3CMEA 4NXML 4DR5L 4A3JH 4LF9L 3MXNB 3GTJH 4BBRG 3CP0A 3CW2C 2DUDA 4MTNA 3GTQH 3W5OA 4IOAA 4IFDJ 2R93H 2RF4A 2UXCQ 4YY3L 3CCRA 1TWHH 2A19A 4A3JG 2OWOA 4OX9Q 1VQJA 2ZTDA 2K75A 4LFCL 1N32Q 2KENA 2R93G 1BBWA 3CMAA 2VUMH 2MQHA 3CC4A 1GVPA 1EUJA 4GN4B 3G48A 3RLNA 1BBUA 4DV7Q 3BZKA 3M4PA 4JI8Q 2E8GA 3M3YH 3RZOH 1XNQL 2VUMG 1YVCA 1OXTA 2E2HH 5GAEC 3RLFA 4A3KH 1X6OA 3ICEA 1L2FA 5C0XI
chains in the Genus database with same CATH superfamily
3K80C 2F4VL 4A3KG 4BY7H 4HCSA 4O42A 3U9SA 4R9WA 1CT1D 2ZM6Q 5DLQE 5IT9E 1VF5C 3J7ZC 3GTKB 1AFPA 2VNUD 4GOPC 2P5ZX 1ASZA 1SNOA 1DM0B 4GNXC 1GJXA 2RSOA 3OWEB 1SEBD 2RSNA 1X3GA 1YZ6A 2Z1CA 5IY0A 2DNCA 4XYOA 5CV7A 1O7IA 1BXTA 1WTWA 4KY5A 1UE7A 2A74C 5FO9B 4Y52H 1A3VA 1H9MA 4JYAL 3OWFA 1VQKA 4DGZA 1PTOF 1PH3A 5IGGA 1EIFA 2K32A 2MNAA 3I4OA 1TWGH 2L15A 1ZKOA 1TS3A 2PI2E 3KLSA 4A76A 3M4OB 3GTKH 2GVAA 3E6ZX 3PUYA 2R6GA 4K8JA 5IT9c 1TXYA 2SNSA 3BU2A 1SMYD 2RHQB 3FMCA 4RG1A 2CH4W 1B2TA 1SE4A 2LSSA 1HZAA 2KCTA 5M3MB 2MPMA 1RCVD 4ZKBB 2K50A 3ND8A 4F8MA 4LF8Q 1AZPA 3CQZB 1S3OA 2VW9A 1MJCA 2EY2A 4ZQ3A 5FK9C 2F0OA 1KL9A 1TY2A 1EYCA 2KQ3A 4QF4A 2R7FA 3S2HH 1EOVA 2BCOA 2B63G 2EYPA 4DR3Q 4IUNA 1SAPA 1C48A 3LWEA 3GTMB 1B70B 2WFWA 3M4OH 4TRDA 2XSCA 5IGEA 2IY5B 2OQ0A 5G3LD 2CQOA 1TY0A 4HJ5A 1U9RA 4ILWA 4B3SL 4A3JB 2Z4HA 3CQZH 2R61A 2DNEA 3FPUB 2SOBA 5ELEA 1EY6A 3URYA 3RN2A 3K58A 4PMCA 1UE1A 1PYSB 4ZYSA 1E2ZA 4IUVA 1JOKA 5CV6A 3J81L 1YEZA 1SROA 4GNXA 2ZTEA 4UP9A 3HRZC 5IP7H 1HR0Q 1H9SB 1Q8KA 1EL0A 3E9HA 4CKCA 3GTPB 2Y0SB 4DV4Q 1MSGA 5LMNL 2ZT9C 3I73A 3OIQA 4GS3A 1CHQD 5CV8A 2B8GA 4FXDA 2CQAA 4A3MG 3H94A 5G3LF 3H3VH 2JA5H 3TZDA 3Q8DA 3K5MA 1B3AA 5HURA 2JQOA 1OXXK 4JI6Q 4G57A 1CQFA 4K8IA 2DY8A 3CCSA 5H1SE 1XMQL 4TKOB 4HEDA 4R8IA 1ET9A 2CW0C 4DV5Q 2KECA 1K8MA 1YNXA 1SJHD 4X62Q 3HOUG 1QWYA 1JWMD 1A3TA 3TDQA 1G91A 4XIGS 4DF7A 4DV1Q 4BY7G 2F03A 4OONA 4UAIA 4Y7NB 3QB3A 4DV0Q 1BQQT 4ALPA 1RTOA 1LTGD 1YITA 2PO4A 4OX9L 2EXDA 2UUAQ 3HGBA 1N32L 4MNOA 2PQAB 1JOQA 3MVVA 1XX8A 3QIAA 3EBEA 1VQGA 3O13A 3I72A 4B3TL 5FO7B 1DZ1A 2K01A 4P74A 2Z9HA 3E3XA 3HOYG 1O7LA 1PTOB 2WKCA 3CC2A 2G9HD 5FO8B 4Y7NH 1BO0A 2ZM6L 1D6EC 1Y8OB 2E2IB 1CKOA 3SXHA 5IT9L 1SBBB 4HN7A 1CA5A 1VQHA 2K5HA 4K5XA 1LT5D 1PZKD 3S1RB 1A62A 2EXZA 3DM3A 5M3FB 4IFDH 4GLAC 2QEJC 5HY6A 1I6HB 4GLVB 5J3BA 1QE6A 3D4RA 4UP8A 2N88A 3KOJA 1PH6A 3S14B 1PTOH 3DLLA 2Q2TA 4J1MA 1NBWA 1I5FA 2WINB 1LT3D 1HA5A 4CKEA 3S1NH 3H91A 4ME5A 3KF6B 2E2IH 3LNNA 2EY1A 1F9PA 3J81j 3K0YA 1K0RA 2ZTCA 4IURA 4C1NK 1U4LA 1XJVA 3UI2A 2E2JH 1J5EQ 1QJOA 3F1ZA 1ZYRD 3JAML 2F1MA 2HIXA 4KK7A 3PIPA 2PZWA 1MIUA 5M3FH 4FF2A 4RCOA 1VQLA 3AU7A 4CJ0B 5J22A 3UDFA 4LF8L 5FKAC 3R2TA 1X55A 1JJGA 2UUCQ 1G51A 3KYHC 2NZOA 2RDHA 5ELDA 3HOVH 3GP7A 2CKZB 5IYCG 3S14H 4LF4L 1FGUA 4DR3L 1K9MC 2KCCA 3AFPA 2B29A 4OWXB 1PRTF 4WFN3 2R92G 1AEXA 3BVGA 3NUCA 4PNYA 1CSQA 4JPBW 3S9WA 1ML0D 1A0IA 1EIGA 3MXUA 3D4WA 3OW2A 3SE0A 5BN5A 2EYOA 4K14A 1VDZA 3GD7A 4HAEA 2JA6G 1YHBA 5GAHC 2NN6H 1TWCB 4KKSA 1HPCA 1L0XB 4RGTA 1W3SA 3NBHA 1RIPA 4JVZA 1AW7A 4IPDA 1JB3A 3QR8A 1MBYA 4G7ZC 3I70A 1CKNA 3MA2B 1HR0L 3MFYA 1GKHA 1I94Q 2IT1A 1UE6A 4O2DA 4ULLA 4DV4L 1HZCA 5ISRA 5K36H 1EWIA 1VQNA 1T5XD 3PUWA 2MGSA 1K3BC 4A3DG 1PFMA 3GTLB 5JEAJ 3G6JB 2AHOB 1TWCH 1AN8A 3WWVA 1VQDA 3IKJA 2CWAA 3MAQA 3F2CA 3G71A 4JI6L 4NMZA 4A3LH 2QA4A 4E6IA 4DR6Q 2YTYA 3H6MA 4J8QA 2VL6A 1QZGA 4DV5L 3U58A 2MO0A 1Y69U 3QO2A 4X62L 2VQEQ 4M8AA 4OIKA 4HIDA 1STYA 5D3IB 2RA4A 2F3VA 1A15A 4DV1L 5IWAQ 4DV0L 1ZEQX 1HNWQ 3K7AB 3SGIA 4Q0FA 4R4OA 4HSVA 2UUAL 2ZXOA 1EY9A 4LF6Q 3HP3A 2D0PA 4A3FH 3TS0A 1NMFA 5JJKA 1K0SA 1QB5D 2FHTA 2F0KA 5E7NA 1SMYC 3C1FA 5AJ3Q 4KHVA 1V1PA 2YV5A 2XVSA 4TVAB 3I4NH 2EJFC 4CHTB 2F0IA 1IZ6A 1SNCA 3B6YA 2FINB 3FKIB 1K3RA 2A5HA 2PYKA 2BA0A 1YNND 2NZ1D 1SNPA 2EQSA 2PQAA 1CK1A 3K7AH 5IGDA 1I4PA 4F7XA 4K0KQ 3MHBA 4JI7Q 2I07B 1BBXC 4GN3B 5EQ0A 4I65A 3RLOA 2AQ3B 1KQSA 3DM1A 4JCVE 1NE3A 2ZXPA 1Z47A 4JC0A 4RAUC 2I46A 3VR2A 5CBEE 5C0XG 2EY6A 2ENBA 1DJRD 1SNMA 5C5MA 5FJ8H 2QEXA 1XPOA 4PMWA 1I50B 3KJPA 1J8IA 3P1HA 1LT4D 5ELOA 5E3FA 3HOVG 4C3JG 3J7AV 3W3AA 2XNAC 2E2DC 4TQUS 4DK1A 4JI1Q 1DOLA 3E0EA 1K8GA 3CCLA 3V05A 2ASBA 1KXLA 2M9VA 1J5EL 2QILA 1PRTB 1EWHA 2OCEA 4DV3Q 3NE5B 2PNRC 2UUBQ 2HUGA 1M8AA 2JJQA 4A3KB 1BUVT 2UUCL 3EFXD 4G7OC 2L55A 5LL6S 4A3GB 3CP0A 4ZKCB 2DUDA 3W5OA 4IOAA 1LO5D 2OWOA 5IGCA 1SNQA 1TS4A 2KENA 2K33A 2QDLA 1BBUA 5CBAE 2D5DA 1GUWA 4A3KH 1S5DD 1LM0A 1LTSD 2DJFC 2F52A 1RKNA 4YWKA 1IYVA 4KTAA 1KDAA 4ZRZA 4MHEA 1G6ZA 3BVZA 1EZ8A 1ILQA 5DM63 1QZHA 5D3DA 4CBVA 3STBD 4EVOA 4PZ7A 2V4DA 1Y1WB 4HIOA 1LT6D 3CPWA 2TSSA 4M1UB 2EIFA 4RCNA 1VQ5A 4ID6A 4YHHQ 1WVLA 4DR7Q 1A2UA 3HOXG 4FF1A 5DM73 3QOJA 1YNJD 3MWYW 3RR5A 4X3SA 2N3SA 5GQOA 1F9RA 2O2LD 4ZAIA 4HIKA 3P75A 4I7ZC 3GV3A 3I3CA 2E5LQ 1EYAA 1X32A 3PCOB 2NVXB 4JI4Q 2LMCB 3NQTA 4XQNA 4DR6L 1SYCA 3AFQA 4A3FG 4KV6A 1STNA 1ZXTA 1NTGA 1DD2A 3KBGA 2MFIA 2SDFA 1YJ9A 1X3QA 3S15B 2PZTA 1FVIA 3I4NG 5EJWA 2VQEL 5EBDA 5I2YA 5IWAL 2B63H 1Y1VG 1HNWL 4NDXA 1PH4A 4LF7L 2F0QA 2L4NA 3HKZG 4ZLTF 4LF6L 3SK6A 4L5SA 4CGYB 1IBKQ 4JI2Q 4LFAQ 4PMBA 4NPSA 5JEAG 3S1QH 2QGQA 2AWNA 5FJ8G 5AJ3L 4A3MB 3UDGA 1ZYRC 4JI3Q 3GQBA 3SK5A 2Q8TA 1II3A 1R4PB 4GKJQ 2K28A 3I90A 3DXJC 1X3FA 4OWTB 5FOBB 3U4ZA 5GAGC 4IUTA 1TWHB 4K2KA 2WV6D 4C3HG 1S72A 5C4JB 4DNTB 4K0KL 4JG2A 4JI7L 3L2PA 1VMPA 3MXGA 2WACA 3PQIA 4UP7A 3EA6A 3PIOA 4JBMA 1Q90A 3J80i 2F0NA 3QOLA 1VQBA 2NBFA 2R7ZG 3HOUB 3FDTA 3KJOA 4A3MH 4BY7B 1WFQA 1UE5A 4G4KA 3Q0AA 1AH9A 4FXGC 4KD4A 3L3OC 3NTIA 1STEA 1U4RA 2VB3X 1O7ZA 3ULJA 5M5XB 3EN2A 3CRKC 4JI1L 5C4JH 1NNXA 2KVMA 4R8NA 3I7FA 1QUQB 4IN3A 3AYHB 5CV9A 3U9OA 1PTOD 1C4QA 1WTOA 4JI0Q 4B3TQ 5IE8A 2OQKA 4DV3L 4AYBG 3K8AA 3J80E 3HOUH 5CGKA 2UUBL 2YTXA 1GUTA 2Z0SA 3L0OA 1IKLA 5I6WA 4HJ8A 5JPNC 3D6CA 4TSSA 4BA2I 4RH6A 1PYWD 4JW0A 1F2LA 1TWGB 3BVMA 4L5TA 3TQYA 4BXXG 3T13A 3ITPA 1JORA 3T1HQ 4O1NA 5BN3A 4WJ3M 4IUQA 1E22A 1Y14B 2K5VA 2QDBA 1HA6A 5M5XH 3N52A 1MHWC 1IL2A 3OIPA 3SEBA 2L11A 1H95A 2G9DA 3RZDH 3VR3A 1A8VA 3TREA 3PUXA 5M9OA 3TZUA 3BS1A 1E3PA 4V0BA 3HOYH 2J0TD 3D4DA 4IOCA 4LUZA 4BBSH 2EDGA 1SDFA 3J80c 3S2HB 4IJHA 2K5QA 2BDOA 4A3CG 3OMCA 4A3BG 1Q46A 1BVSA 2AQ1B 3W1GA 4ME3A 5COYA 2K05A 1CHPD 1XWEA 1HXYD 3BZDB 5C4ZA 2JP1A 3PUZA 2NZHA 2KHJA 3TBIB 3OPOA 1K83H 1ONLA 2K1BA 1OTCA 3VYRA 3CCQA 3FP9A 1EFWA 2RCFA 1E2VA 3A5UA 4YHHL 1VQ9A 1IYUA 4DR7L 4R4QA 4K5VA 5J39A 4LF4Q 5CORA 3PO3G 4QUCA 4N8FA 1T5EA 4KLKA 1YNNC 2E5LL 1D7QA 3OW7A 2R92B 4JI4L 1TWAH 3WOFA 4FNFA 4YIJA 5IOCA 1R9TB 1QNUA 4U68A 4QL5A 5LL6X 3J7A5 1CUKA 3TSSA 3SVMA 1S5CD 5C6AA 2JA5B 4IQZA 2KHIA 2F0WA 1HZ9A 5IYCH 1FR3A 3SK4A 1A63A 1B8AA 1KIXA 4IALA 3A55A 2C5CA 3EVQA 1G291 1TR5A 1IKMA 3RUZA 5CV5A 4GN5A 1LLRD 3NP8A 4B08A 3S16B 4DR5Q 3E0JA 1IBKL 4KKUA 4JI2L 4LFAL 1SYGA 1VQ6A 2R92H 2FFKB 4ABNA 3NENA 2F0MA 2I5HA 1BCPF 3T56B 3VR5A 4NW2A 1QVCA 1UEBA 4YY3Q 2ZJQA 4DAYA 1R9TH 3CCJA 2ICIA 3G7LA 4JI3L 4H44C 2JA6H 4A3DB 2HD3A 2L12A 2Z8LA 3EROA 4EQ5A 1XNQQ 4YWLA 4GKJL 3CC7A 1GXDC 1PVOA 2R3ZA 1B9MA 2MP1A 4OHJA 4DA2A 1HTLD 2X69A 4AH6A 5T1GA 1Q8IA 2EOTA 2EPBA 2WAQG 3S16H 2EYJA 1DOKA 5IP9G 1V1QA 2PI2A 4L63B 4P71A 2WB1G 1KD1C 1TKWB 5CR3A 1HFGA 1WCMG 1WI5A 4A3DH 1S40A 1I4HA 4JV5Q 1VQAA 1SLJA 1UWVA 4QQBX 4LNQA 2ICEC 3KBXA 1PDQA 1PFSA 2TMPA 5ELFA 2A69D 3PV0A 4CDFC 2HCCA 5JPMC 4X3TA 5EKIA 5A2QE 4JI0L 4C3IG 1PHJA 1YJWA 2A1AA 2PQEA 4KY7A 4EQOA 3STBC 4L8JA 4UPAA 2BA1A 3J80L 2GA4B 3MXNA 2UU9Q 1HHVA 4BBSG 5C3EG 1SMXA 2PMZE 1Q81C 1HNZQ 2RBMA 4POFA 1VCIA 4DUZQ 1LTBD 4HJ7A 3S1NB 2RDFA 4RGMA 5NUCA 3LX0A 3T1HL 4QUFA 1QUQA 1LTAD 1YNJC 1OXVA 2EYHA 3RN5A 1WTRA 2OTJA 1J9OA 2E2JB 2Z6BA 4H0LC 2UXBQ 1VQ7A 2KBNA 1EIYB 3H3VC 2QW7A 3EIVA 4PZ6A 1VQPA 3HOVB 2F0EA 3DUZA 3G6EA 3M9BA 1UEAB 3I8ZA 1JJCB 2D9UA 1N9WA 1VF7A 1F9SA 1PRTD 4IPCA 4HJ9A 3UE1A 4A4IA 4R4IA 2K03A 1TS5A 3W1BA 3M7NA 3VR4A 1CA6A 1JB7A 3MEHA 3KF8B 1EYGA 4CDEC 1KNEA 2I0QA 2XRQD 1ESRA 5C0XH 3VYSA 2KCMA 1RDPD 1AE3A 2H5XA 1SSOA 4HMIA 3PUVA 3TN2A 1NCVA 2F0FA 4C3JH 1KAWA 1PH1A 1HNXQ 4UY8C 4A3IG 1E2WA 4FF4A 3N6RA 3GTOB 4GKKQ 1ICWA 5GROA 4NKLA 5JJZA 3GV6A 4DKAC 2ALYB 2MUYA 3NEMA 1BF4A 1DYQA 2LXKA 1E7ZA 2IWHA 2JEAI 4APVA 5KRUA 4BS9A 1EZ6A 4IPHA 1U4MA 1BCPB 2GVBA 2D0OA 1B4OA 2HCIA 1SYDA 4DAPA 2N78A 4DAVA 1SRUA 2F0HA 2C35B 5D14A 1STHA 4DR1Q 5KNBA 1CQVA 3NTKA 4DU9A 3GTOH 1SE2A 5IYDG 4ZCKA 1X3EA 2ATWA 1EY5A 4DR5L 2CH4A 4BBRG 1TVXA 3GTQH 1JR0D 3BYTB 2UXCQ 4YY3L 3CCRA 4A3JG 1B3QA 1STAA 3OHXC 1PTOC 5E4XA 4OL7A 3CC4A 2KHSA 1EUJA 4GN4B 3G48A 3M3YH 4DV7Q 3M4PA 4K6DA 2E8GA 4JI8Q 1XNQL 3KLSX 2VUMG 1YVCA 1OXTA 5GAEC 3RLFA 1TT2A 1X6OA 3BDCA 1H9SA 1HUNA 2AMCB 4A3FB 2JA8H 2M00A 2EYFA 2Y0SG 5EGTA 3VDYA 3V2TA 3ULPA 1JJ2A 5I9OA 5EBCA 2ZXRA 3R2IA 3I4NB 1B44D 2AWOA 3HKSA 3X3MA 5LHY1 2A6HD 4JV5L 3HOXH 3CCUA 1Y1VB 3TP8A 1LTID 2M2LA 4AQYQ 2O5JC 1VQ4A 5CMDA 3TP6A 1KDCA 3T53B 4LF7Q 1HQMC 2XIWA 3I91A 5EPLA 1Q82C 2XGTA 2F4IA 3MEFA 2H1EA 3D6WA 2IHEA 2IJ0A 3A8IE 3I56A 1H9RA 2F0LA 5A2QL 5JJIA 1W6KA 1DXMA 1EY0A 2OF1A 2L9HA 1B50A 3ND9A 4L5RC 1KRSA 3K5OA 1GUNA 2K6AA 2UU9L 1LV9A 4KMUC 2G5DA 5EKKA 4NP5A 1HNZL 2CHBD 4F87A 4DUZL 2NVYH 3NELA 4DXGA 1L1OB 1Y1VH 4LJZC 5EPJA 5KIXA 4C56C 4V190 4C3HB 5KNDA 1VQEA 4X65Q 5DAUA 1KTKA 5E1FA 2B2VC 3P7JA 2UXBL 5JEAH 2R7ZB 2L1BA 5D65A 4OXPA 4EX5A 1JE5A 3F8TA 1TS2A 2X6GA 5I9PA 1F2YA 2B2WC 3LWUA 1X65A 1B1ZA 4YCUA 2VS1A 2XN9C 2LXJA 4IUPA 1I6VC 3ULLA 1X3PA 1ENFA 2B2UC 2RHSB 4AIMA 1KAAA 1E1OA 3NWTA 4C3HH 1EQRA 1SYBA 2D62A 4QIWB 4Q5VA 2DN8A 4YWMA 5IIFA 1Y8NB 2E75C 4ZUJA 3ZYYX 4FYDA 1JE4A 2PZUA 3ZJYC 4AYBB 2R7ZH 2AKWB 3HOWG 2B39A 2KEEA 5LMNW 4IO9A 3I4MG 5LMUQ 4BY1G 2MO1A 3KF6A 1HNXL 1JQYD 3HOZG 1BNZA 4GKKL 1Q3LA 1CKMA 1NR4A 2BDNA 3KF8A 1O7YA 3M85A 2PCFB 1IBLQ 2JSOA 1WTVA 1EU3A 3HKZE 4XXEA 4DV2L 3A56A 1LTRD 1GHJA 1M1KC 5J1ZA 2EYLA 4G7HC 3S2DB 1GM5A 2HQLA 1F77A 1HRJA 4A3BB 1P16A 4DR1L 1VMCA 4BXXH 1D2BA 1XTCD 4HJAA 3BYYB 3W2DA 4PG3A 3DWQA 2IPKD 4JOIC 3I4LA 2JA8G 2DGYA 3AMUA 4X66Q 1PA6A 2B2VA 2F0GA 3C2PA 2KJXA 1PXUA 1XPUA 5EPKA 2UXCL 3QWNA 4IZ8A 2HIVA 1GUOA 4WRDA 2B2WA 1QILA 3S2DH 3K0XA 1EYDA 4KN4C 5CC4A 4DV7L 4JI8L 3DEOA 2B63B 1Z6HA 1EEFD 1HJPA 4A3BH 2B2UA 2MJ8A 3PO3B 4A3CH 1BKBA 3PF4A 1Y8PB 3H0GG 4KJNA 4PZ8A 1L0WA 2Z6KC 1JICA 2SNMA 4N9TA 1IW7D 1VQIA 1PH8A 5JAVA 3TRZA 3S1QB 3J7AF 4P72A 2JA7G 3L7ZC 4QIWE 4FDBA 2EY5A 3MTSA 5M5YB 4DAMA 3WDNA 3PGZA 3S24A 3H3VI 4AYBE 3ONAB 3HZXA 2CCZA 3E9IA 3CF5A 2ZJPA 2AUKA 1EFID 5FLMG 4AQYL 5F2DA 3U50C 3CRLC 3PO3H 2KCNA 3ER0A 4QCLA 4GOPB 1P8LA 3K6OA 2FXQA 3IRBA 4GNXB 1PRTC 2K7VA 1RHPA 1QG7A 4HMJA 3S1MH 4UHVA 4QGUA 1JT8A 3SHLA 1GHKA 1ICFB 4KKTA 2EJMA 3C1EA 1Z9FA 4LFBQ 5M5YH 1KLGD 2NTTA 1RD9D 4OWWB 1KABA 1MKHA 4OEMB 5C4HA 1UUPA 2GN5A 4LUOA 5I2XA 1D8LA 4JOIA 4DUYQ 2JYOA 3BDLA 1EOTA 1ET6A 4X65L 3H15A 4P2CB 4RWSC 1XPRA 4CJ2C 3MFGA 4P73A 2NTSA 3S17H 3DWAA 4KY6A 1NY4A 5JOBA 1Q1EA 2IHFA 4KJOA 2IX0A 4RMFA 1K8OA 3FPPA 1QVGA 2Q2IA 1S5BD 4A93G 2Z6KA 3GO5A 2F0TA 1TWFB 3A54A 4FP5D 4P75A 1WTPA 1STBA 1IL8A 4MZ9A 1T9HA 5IP9H 4C3IB 4YCWA 3RZDB 4DV6Q 4RFBA 1HR0W 3KLRA 4HIMA 4OIJA 1RF2D 1ILPA 3HOYB 1WCMH 4BBSB 5GADC 4JI5Q 1ENAA 1GUSA 1PZJD 3DWPA 1KHIA 4X3UA 3OTOQ 3Q23A 3UE0A 5HGTA 1DOMA 5FLXE 1QCBD 5I4DA 1HFNA 2F0UA 1TWFH 4DNIA 3D8GA 1IBLL 3F2UA 3K57A 1K83B 1D5MC 1EQTA 4C3IH 3MC0B 1W2BA 1I3QB 2C9OA 4XTCS 3JC66 1KNAA 4MIUA 3K59A 1LUZA 2Z4IA 4XT1B 5C3EH 3T16A 2A6ED 5ELCA 4LW1A 4N8X1 5C44G 3CCMA 1D5ZC 1EY8A 2ZJRA 5JVG3 1YHAA 4J6HA 4A3GG 1CI3M 2A6HC 3JAMi 1Q86C 1UNSA 1KLUD 4QMGA 3T4AC 1X56A 2VXWA 1A3UA 1TWAB 2FMCA 2PW7A 1VQMA 4X66L 3LGJA 3AEVA 1G6PA 1CM9A 1WOCA 4RGOS 2JA9A 5FLXc 3CCVA 4MTKA 2WKDA 5M5WB 1MJEA 2WAQE 3FVQA 4FO2A 4IJLA 4NXNQ 1I3QH 1LTTD 2NN6I 1DGSA 2WB1E 3K81C 4A3IB 3D3RA 1BCPD 3JAME 1YIJA 1D5XC 2A68D 3PIP3 3FEWX 3A8KE 1Y1WG 4ZUIA 4X64Q 2KEDA 2PMZB 5M5WH 2NWGA 3D0FA 1N36Q 2JA6B 1RL2A 1N33Q 1K73C 1IXRA 4KN7C 5EKLA 4A3EG 3PO2G 5BN4A 5IYBG 1IYJB 1UAPA 3RD4A 2IX3A 3NBHB 4B3RQ 2KOLA 4RA8A 4A3IH 2VY3A 2BH2A 1CSPA 4CDCC 2ID0A 1PH2A 1ESFA 4OO1I 1XNRQ 2UXDL 2E74C 1HH2P 4BWGB 4BBRB 1CKNB 5M3MH 1D1KA 4I7AA 5C3WA 3JAMc 5C4XG 1IHZA 3A7AB 1QVFA 3GTJB 3KK7A 5A35A 1E1TA 3QJYA 4LFBL 2RCNA 2XTIA 3HFZB 2VUMB 1YBYA 2KUMA 3IFDA 2RKSA 3T1YQ 4B3MQ 4WJ4A 4GOPA 1XTDA 3RZOB 3GTMH 3U4VA 4OGQC 4DUYL 3HG9A 5IYDH 4R1JA 1NR2A 4DR4L 3SK8A 1RJTA 2F3WA 2NUCA 4BBRH 3RNUA 1AP0A 2V1CC 1ASYA 4WJWA 3CMEA 4A3JH 2QCPX 3GTJH 2PW5A 1WD1A 1NSNS 4IFDJ 2F0JA 4C1NI 2AUJD 2A19A 2ZTDA 2K75A 4WORA 4LFCL 3J7YW 2R93G 1PMRA 2VUMH 2MQHA 4DNRB 2JXMB 1GVPA 1CFMA 1H9KA 3BZKA 4RKBA 3RZOH 1V8QA 3MZ5A 3K5LA 3T51B 3KUPA 3MXPA 1NJIC 1FNUA 3GTPH 2Q2HA 1OXSC 4DV6L 4KHPL 1W6JA 5C3XA 2D2CC 3H09A 1V1PB 5C0XJ 2IL8A 2B2TC 4JI5L 3K5NA 2JK8A 3KFUA 1VQOA 1I4GA 3OTOL 3AQQA 1WTQA 1S5ED 1C8CA 1JOOA 2J4XA 4CDDC 4U673 1VQCA 3NPPA 1ENCA 3QG1A 5FLXL 1J6QA 3AB9A 3VYUA 1SJED 5E4WC 2Q2UA 3NTHA 1L0YB 4EQNA 1Q7YC 1KC8C 2I5LX 5LMUL 2K52A 1DONA 3C3LA 1IW7C 2EVBA 1R4QB 1XYIA 1FNVA 4XQQA 4DK6C 1N34Q 1SE8A 2Q8IB 2A73B 4C3JB 1V9PA 3M4QA 1BOSA 2WIIB 1JWSD 1B9NA 3K7UC 4DXFA 2CFMA 5IODA 2NVQB 1PV4A 1Z7TA 3RMHA 3D31A 1S5FD 3HOWB 1PH9A 4X6AH 4NXNL 2Y0SE 4JBJA 2PPBC 3NHHA 2VB2X 3I4MB 4BY1B 2X6LA 1RODA 2HHHQ 3HOZB 1PH7A 4BA1I 1X9NA 3UDXA 3ERQA 3CU7A 3OSOA 2N8NA 3OMGA 3S1RH 1MSHA 5CYUA 5M3MG 3GTQB 1I4QA 1E24A 4DV2Q 2NVQH 1I6HH 1SNDA 3Q22A 4X64L 1BR9A 1U4PA 3HOWH 1FJGQ 1N36L 2B2TA 1N33L 3M3YB 3Q6SA 3I4MH 2OXPA 4BY1H 1SFOB 1MD2D 3GTGB 3HOZH 2F0SA 3BJUA 4B3RL 5KYLA 2IX1A 2BE5D 4LF5Q 5IP7G 2JA8B 1XNRL 5IGFA 2PNHA 2HQEA 5ELNA 3TS2A 5JVH3 2EE1A 3A74A 3E5SA 1TQOA 2K14A 5IGBA 4R4CA 2ES2A 5ELBA 3V96A 4PV1C 4LK1C 4DPGA 4QJFA 2FMMA 2JA5G 4B9XA 3VYTA 3HOXB 3VR6A 4XQJA 2L5TA 1FNWA 3T1YL 4B3ML 3H0GB 2B2YC 3A0JA 3NBIA 1U0LA 1SFOH 1FGBD 3GTGH 5C5LA 4FXKC 4GLXA 1MI2A 1EY7A 3DEPA 1EQVA 3UDIA 4ZK9B 1VQ8A 2YYZA 3WOEA 2JA7B 1HTPA 1TIID 2FJ2A 5BR8Q 3M7GA 4KI0A 2EYMA 2O4XA 2B3GA 3FRPB 3HEJA 1NMGA 3SDZA 1LTLA 4L5QA 2NVYB 1B53A 1X54A 1DCZA 4LUVA 4OO1H 2EJGC 3KDFB 2J7ZA 1N8RC 1YJNA 1XMOQ 3R8BA 1S4ZA 3H0GH 3HKZB 4A75A 2A6EC 3F2DA 2LKVA 3NSWA 3G4SA 3C46A 1LABA 3EJIA 2R7DA 4EQPA 2E76C 2OT2A 3NXWA 2DY7A 2JA7H 3CHBD 3BZCA 4DN4M 1E0BA 1HQRD 2SEBD 2DJGC 1EQQA 4DK3C 3NQIA 1SYEA 3GTLH 5TSSA 1AZQA 2K4KA 2HDLA 4XT3B 3X3NA 1FL0A 4R4TA 4F88A 1PFNA 5KEEA 1F2ZA 1STGA 5FLMH 2O5IC 3NWSA 4RKLA 1LYLA 3NK9A 1HCZA 1O78A 3TP5A 3VA5A 4IFDG 4H7BA 1G2TA 1BCPC 1V43A 2QKIC 3EQLC 4JBWA 5I6YA 2VQFQ 2A68C 1B7YB 4RGNA 4CKBA 2CWPA 3M4YA 1C9OA 1FD7D 1SXTA 1EU4A 1N34L 4IPGA 3L9AX 2A8VA 4DR2Q 1PH5A 5JJLA 1O80A 3DHQA 3IAYA 2B2YA 4A93B 1SR3A 1GUGA 2QF7A 3TEHB 2XWJB 3PIO3 2N49A 1OXUA 5M3FG 1GO3E 1H9JA 3CD6A 4DK0A 1AE2A 3ERSX 4ODGA 2LFNA 1IBMQ 3FKIH 4RHRA 1M90C 4NXMQ 4LF9Q 1WTXA 1TU2B 1QNKA 1KDBA 2HHHL 4HR7B 2H4OA 2OTLA 1Q12A 4A93H 4FF3A 3BG3A 2NVTB 2JEBI 4KHZA 1LACA 4J15A 1CZWA 4IUUA 4K5WA 3CCEA 1K8AC 4KD3A 3PMFA 2F4VQ 1I50H 1VQFA 2LS01 1FJGL 3I2ZA 2NN6G 5CV4A 1XXGA 4XYQA 5C44B 1HZBA 3TP7A 2YU9B 2K5WA 4N9PA 5KNCA 2CW0D 3Q24A 3CAMA 4LF5L 3I55A 3TMEA 3PSIA 2NVTH 4NB3A 1RTNA 1VS0A 1MGSA 2MHVA 3IL8A 2RQXA 1GD7A 3F2BA 4JYAQ 5K36G 3R3OA 2A69C 1EEID 4QB4A 2K5DA 1PYBA 2NB0A 1L1OC 5C44H 2K5NA 4HSPA 2L0CA 1WD0A 4OO1G 1D1IA 2YU9H 2BH8A 1K28A 2K04A 4A3GH 4A3LG 5AFWA 2KA7A 4H02A 1V1OA 2Q8RE 4UDUC 4JBKA 1JC7A 3S1MB 1I94L 3R93A 4HCEA 1A6XA 1OO9B 3BDOA 1SN8A 2YTVA 1F2MA 2B8FA 3A7LA 2OEOA 5BR8L 3PF5A 3PO2B 4A3EB 3CXCA 1U5KA 2F3IA 4OELB 2AQ2B 3A8JE 5EAYA 3J81i 1YI2A 1Q1BA 1I4RA 4XDXA 1XMOL 2EZVA 5DNFA 1PZID 1FYCA 1PFBA 2F0VA 4PQXA 1EIHA 1BDOA 3KLWA 2UXDQ 3HS0C 3CKIB 1NUCA 3S17B 5C4XB 1A2TA 1WJJA 1Y1WH 4B3SQ 1C7YA 4B9WA 1EWCA 4DAYB 1WTHA 3A5ZB 4C2MB 5T1IA 1GOZA 2JE6I 2N55A 1YHQA 4QY7A 1KRTA 5KYIA 4O0AA 4A3EH 3KDFA 3PO2H 2I5MX 1WYDA 2F0PA 5IYBH 4GZYC 3J81E 4DFAA 4S3SA 2CVRA 1HUMA 5DEHA 3VA7A 2NVXH 4K6LA 4EGVA 2WAQB 3OYYA 2LY7A 2NYZD 4DR4Q 5LMNQ 4Z9CB 4X3KA 5C4XH 2BOSA 3S15H 4H13C 3FHWA 2HT1A 2WB1B 1I4XA 2VQFL 1CZGA 1WCMB 3P20A 4C2MH 1EY4A 2XWBB 3FKIG 4FVMA 2R93B 1L1OA 1JMCA 4LFCQ 4JK1C 5HGQA 4DR2L 4LWCA 4HTHA 4YCVA 3CPFA 1NAPA 4L6TB 2WP8J 4POGA 1QOHA 1F9QA 1C0AA 4K2LA 4MN3A 3J81c 2VZAA 1XMQQ 1JWUD 2E2HB 4LAAA 2BE5C 3OOCA 2HDMA 2JN4A 1CTMA 3SR1A 4LMQD 4IFDI 4KHPQ 5KGUA 3GDEA 3DMUA 5K5PA 2RVLA 1IBML 5C3EB 1JCKB 4LF9L 4NXML 3MXNB 3CW2C 2R93H 4MTNA 4CJ1B 2XRSD 2RF4A 1SYFA 4OX9Q 1TWHH 1G2SA 1VQJA 1N32Q 1BBWA 3CMAA 2RDGA 3IFTA 2IW3A 3RLNA 1M4VA 1SE3A 1G8ZD 2F0DA 1PLFA 2E2HH 4RHSA 3ICEA 1L2FA 5C0XI 5L37A
chains in the Genus database with same CATH topology
1LM0A 2F52A 3K80C 2F4VL 3GTPH 4YWKA 1NJIC 2Q2HA 2AMCB 4A3KG 4BY7H 1OXSC 2JA8H 4DV6L 4KHPL 2ZM6Q 2Y0SG 5DLQE 5C0XJ 3VDYA 3ULPA 1QZHA 1JJ2A 3J7ZC 4JI5L 2JK8A 3STBD 3KFUA 2VNUD 4GOPC 1ASZA 4PZ7A 1VQOA 3OTOL 4GNXC 2AWOA 4HIOA 3HKSA 3AQQA 1X3GA 1YZ6A 3HOXH 4JV5L 5IY0A 1VQCA 3CPWA 2EIFA 3CCUA 1O7IA 1VQ5A 4YHHQ 4AQYQ 1UE7A 1VQ4A 4DR7Q 3HOXG 4Y52H 4JYAL 1J6QA 4LF7Q 1VQKA 1PH3A 2Q2UA 3RR5A 1EIFA 1Q7YC 2N3SA 2I5LX 1Q82C 1KC8C 2XGTA 5LMUL 5GQOA 3MEFA 4HIKA 2K52A 2MNAA 3I4OA 2IHEA 1TWGH 2L15A 2E5LQ 3PCOB 4JI4Q 2PI2E 3I56A 3PO2H 4DR6L 4A76A 4DK6C 3AFQA 1SE8A 4A3FG 2GVAA 1N34Q 3GTKH 5JJIA 3PUYA 2R6GA 1V9PA 4L5RC 1NTGA 5IT9c 1KRSA 3M4QA 1TXYA 3BU2A 2MFIA 2RHQB 2UU9L 4RG1A 1YJ9A 3K7UC 2LSSA 1HZAA 2KCTA 1HNZL 1FVIA 4DUZL 3I4NG 2K50A 2NVYH 3NELA 2VQEL 1L1OB 1Y1VH 2CFMA 4LF8Q 1S3OA 5IWAL 2B63H 1VQEA 2VW9A 1MJCA 1PV4A 4X65Q 1Y1VG 1HNWL 1KL9A 1PH4A 3D31A 4LF7L 2R7FA 1PH9A 3S2HH 1EOVA 4X6AH 2B63G 3HKZG 2UXBL 4DR3Q 4NXNL 2Y0SE 4LF6L 4JBJA 4OXPA 4L5SA 4EX5A 1IBKQ 1JE5A 3F8TA 1B70B 4LFAQ 2WFWA 4JI2Q 3M4OH 2HHHQ 4NPSA 5JEAG 3S1QH 2QGQA 1PH7A 1X65A 4BA1I 1X9NA 3UDXA 2AWNA 4YCUA 2VS1A 2IY5B 5FJ8G 5AJ3L 2OQ0A 2LXJA 3UDGA 4JI3Q 2CQOA 4HJ5A 2N8NA 3ULLA 4B3SL 2RHSB 3S1RH 4AIMA 4GKJQ 1E1OA 3CQZH 1X3FA 4OWTB 4C3HH 3U4ZA 5GAGC 5M3MG 1EQRA 2D62A 1E24A 4DV2Q 2NVQH 1I6HH 4YWMA 4X64L 3RN2A 3HOWH 1S72A 1N36L 1FJGQ 4K0KL 4JG2A 4JI7L 3L2PA 1UE1A 1PYSB 3ZJYC 1N33L 2R7ZH 2AKWB 4UP7A 3HOWG 3I4MH 3PIOA 4BY1H 1YEZA 1SROA 4GNXA 4JBMA 2ZTEA 4UP9A 3J80i 5IP7H 1HR0Q 1VQBA 2R7ZG 3HOZH 5LMNW 4IO9A 3I4MG 1Q8KA 3BJUA 4BY1G 5LMUQ 2MO1A 3E9HA 2IX1A 4B3RL 3KF6A 3KJOA 5IP7G 4A3MH 4LF5Q 4DV4Q 1WFQA 5LMNL 1UE5A 1HNXL 1XNRL 3HOZG 4GS3A 2PNHA 1AH9A 5ELNA 4GKKL 1CKMA 3TS2A 4A3MG 3A74A 3M85A 3H3VH 2K14A 2JA5H 4R4CA 2ES2A 3Q8DA 1IBLQ 3ULJA 3EN2A 3HKZE 4DPGA 4JI1L 4QJFA 5C4JH 2JQOA 4DV2L 2JA5G 3I7FA 1QUQB 1M1KC 1OXXK 3AYHB 4JI6Q 4JI0Q 3T1YL 4B3ML 3CCSA 4B3TQ 5IE8A 1GM5A 2OQKA 5H1SE 4DV3L 2HQLA 3A0JA 1XMQL 4AYBG 1U0LA 3K8AA 1SFOH 3GTGH 3HOUH 2UUBL 2YTXA 2Z0SA 1P16A 3L0OA 4HJ8A 4DR1L 4GLXA 4DV5Q 4BXXH 4BA2I 1YNXA 4HJAA 4X62Q 3HOUG 4PG3A 3UDIA 4L5TA 3TQYA 4BXXG 4JOIC 1VQ8A 2YYZA 4XIGS 4JBKA 4DV1Q 4BY7G 4OONA 3T1HQ 2JA8G 2DGYA 4X66Q 4DV0Q 4ALPA 1PA6A 5BR8Q 4WJ3M 1E22A 4KI0A 1Y14B 2K5VA 2B3GA 5M5XH 1YITA 1XPUA 2UXCL 1NMGA 4OX9L 2EXDA 2HIVA 2UUAQ 1LTLA 4L5QA 1N32L 4MNOA 1IL2A 1H95A 1X54A 2PQAB 3K0XA 3RZDH 3S2DH 4LUVA 3KDFB 1N8RC 1A8VA 3TREA 3PUXA 3EBEA 4DV7L 4JI8L 1YJNA 1XMOQ 3H0GH 4A75A 1E3PA 1VQGA 3F2DA 3HOYH 4B3TL 4A3CH 1HJPA 3G4SA 4IOCA 4LUZA 4A3BH 4BBSH 1BKBA 4P74A 3PF4A 3J80c 2R7DA 4IJHA 3H0GG 4PZ8A 3HOYG 1L0WA 4A3CG 2Z6KC 4A3BG 3CC2A 1Q46A 1BVSA 2JA7H 3BZCA 3W1GA 4LFBL 1EQQA 4Y7NH 4ME3A 2ZM6L 1VQIA 1PH8A 4DK3C 3TRZA 1CKOA 4P72A 3GTLH 2JA7G 2K4KA 3L7ZC 4QIWE 4FDBA 1VQHA 1FL0A 3PUZA 4R4TA 2NZHA 2KHJA 1K83H 2K5HA 4DAMA 3PGZA 1OTCA 3CCQA 5FLMH 3FP9A 3S24A 1EFWA 1A62A 3H3VI 4AYBE 3DM3A 2CCZA 3E9IA 3CF5A 4GLAC 3A5UA 2ZJPA 4YHHL 5HY6A 4AQYL 5FLMG 1VQ9A 1LYLA 4DR7L 3U50C 4GLVB 5J3BA 4R4QA 3PO3H 4IFDG 3ER0A 4UP8A 4GOPB 1P8LA 4LF4Q 1V43A 2FXQA 3KOJA 3IRBA 1PH6A 4GNXB 4JBWA 3DLLA 3PO3G 2VQFQ 2Q2TA 3S1MH 1I5FA 1NBWA 1B7YB 4QGUA 1JT8A 4KLKA 2CWPA 2E5LL 3S1NH 1D7QA 1C9OA 4JI4L 1TWAH 3KF6B 2E2IH 3J81j 1N34L 4IPGA 1Z9FA 4LFBQ 2A8VA 1K0RA 4DR2Q 5M5YH 1PH5A 5JJLA 2ZTCA 1XJVA 2E2JH 4OWWB 1MKHA 1J5EQ 1SR3A 2GN5A 3F1ZA 4QL5A 3J7A5 1CUKA 2HIXA 4LUOA 3TEHB 3PIPA 1D8LA 1MIUA 5M3FH 1VQLA 4LF8L 2KHIA 3UDFA 2N49A 1HZ9A 5IYCH 1X55A 1OXUA 1JJGA 4JOIA 4DUYQ 5M3FG 1A63A 2UUCQ 1G51A 3KYHC 2NZOA 1B8AA 4X65L 3H15A 1GO3E 1KIXA 3HOVH 3CD6A 1XPRA 2CKZB 1G291 5IYCG 3S14H 4P73A 4LF4L 3S17H 1AE2A 1FGUA 3ERSX 4GN5A 4DR3L 1K9MC 1IBMQ 3FKIH 1M90C 3AFPA 4NXMQ 1NY4A 4DR5Q 1IBKL 4JI2L 4LFAL 4LF9Q 1VQ6A 2R92H 3NENA 2B29A 2I5HA 2HHHL 4OWXB 2OTLA 1Q1EA 1QVCA 1UEBA 2IHFA 4YY3Q 2ZJQA 2R92G 1R9TH 2IX0A 4RMFA 3CCJA 1Q12A 1CSQA 1A0IA 2JA6H 4JI3L 4A93H 2JEBI 4KHZA 3OW2A 1QVGA 4J15A 4EQ5A 1XNQQ 2Q2IA 4YWLA 3GD7A 2JA6G 3CC7A 4GKJL 4A93G 2Z6KA 1YHBA 5GAHC 3CCEA 3GO5A 1PVOA 1K8AC 4P75A 2F4VQ 1I50H 1W3SA 1VQFA 4MZ9A 1T9HA 1RIPA 3I2ZA 5IP9H 1FJGL 2NN6G 4YCWA 4IPDA 4AH6A 4DV6Q 2WAQG 1HR0W 3S16H 4HIMA 5IP9G 1V1QA 1HZBA 1WCMH 1CKNA 1HR0L 5GADC 4JI5Q 2PI2A 1GKHA 4P71A 1KD1C 1KHIA 2WB1G 1I94Q 3OTOQ 1WCMG 1UE6A 2IT1A 4O2DA 3CAMA 4LF5L 1WI5A 4DV4L 4A3DH 3I55A 1S40A 4JV5Q 1VQAA 1HZCA 1SLJA 3PSIA 2NVTH 1UWVA 1EWIA 4NB3A 3UE0A 1VQNA 4QQBX 4LNQA 1VS0A 3PUWA 1PFSA 1GD7A 4A3DG 3F2BA 5JEAJ 4JYAQ 5K36G 1TWFH 2AHOB 4DNIA 1TWCH 1IBLL 3WWVA 1VQDA 2CWAA 4C3IH 3PV0A 3F2CA 3G71A 4JI6L 1PYBA 1W2BA 4A3LH 1L1OC 4XTCS 3JC66 2QA4A 5C44H 2K5NA 4JI0L 4DR6Q 1PHJA 1YJWA 1LUZA 2A1AA 4OO1G 2YTYA 5C3EH 2YU9H 2BH8A 3STBC 4A3GH 4A3LG 2VL6A 4LW1A 4UPAA 2BA1A 5C44G 1QZGA 4H02A 3CCMA 2ZJRA 4DV5L 2UU9Q 3U58A 1YHAA 4BBSG 5C3EG 2MO0A 1SMXA 2PMZE 3JAMi 1Q81C 4X62L 4POFA 1Q86C 1VCIA 1I94L 1HNZQ 4DUZQ 4HJ7A 2VQEQ 1X56A 4HIDA 4DV1L 3T1HL 1QUQA 5IWAQ 1VQMA 4X66L 3LGJA 4DV0L 3AEVA 1SN8A 1WOCA 2YTVA 5BR8L 2JA9A 5FLXc 3PF5A 3CCVA 1HNWQ 3SGIA 1OXVA 3RN5A 2OTJA 1MJEA 2WAQE 4R4OA 3CXCA 1U5KA 2F3IA 3J81i 5EAYA 2UUAL 2UXBQ 4IJLA 1VQ7A 4NXNQ 1YI2A 4LF6Q 1Q1BA 1I3QH 2KBNA 2D0PA 1EIYB 4A3FH 3TS0A 3EIVA 1NMFA 2NN6I 1DGSA 1XMOL 5JJKA 2WB1E 4PZ6A 3K81C 1VQPA 5E7NA 2UXDQ 3KLWA 5AJ3Q 3G6EA 3M9BA 2YV5A 1JJCB 4TVAB 3I4NH 1N9WA 1WJJA 1Y1WH 1IZ6A 3B6YA 4B3SQ 1YIJA 1C7YA 1K3RA 4IPCA 4HJ9A 2BA0A 4A3GG 3UE1A 4A4IA 4DAYB 4R4IA 3A5ZB 1Y1WG 3W1BA 2JE6I 1YHQA 3M7NA 2EQSA 2PQAA 4QY7A 3K7AH 5M5WH 4X64Q 1KRTA 1JB7A 3KF8B 4O0AA 3D0FA 3KDFA 2I5MX 4A3EH 1N36Q 1EYGA 2I0QA 1WYDA 5IYBH 4JI7Q 4K0KQ 4GN3B 1RL2A 2KCMA 1N33Q 3RLOA 1K73C 1IXRA 3PO2G 4A3EG 1KQSA 4JCVE 1AE3A 1NE3A 2H5XA 1Z47A 5IYBG 4JC0A 1IYJB 5C0XG 3PUVA 2NVXH 3NBHB 5FJ8H 2QEXA 4B3RQ 4A3IH 1XPOA 3OYYA 2VY3A 4PMWA 2BH2A 1CSPA 3KJPA 2ID0A 1PH2A 4C3JH 4DR4Q 1KAWA 5ELOA 4OO1I 5LMNQ 1PH1A 1HNXQ 1XNRQ 4UY8C 5C4XH 2UXDL 4A3IG 1HH2P 3S15H 3FHWA 3HOVG 4GKKQ 1CKNB 2HT1A 2VQFL 5M3MH 5GROA 3JAMc 5C4XG 4C2MH 4DKAC 1QVFA 3FKIG 4TQUS 2ALYB 3NEMA 1L1OA 2LXKA 1E1TA 1E7ZA 1JMCA 4LFCQ 2JEAI 4APVA 4JI1Q 5HGQA 3E0EA 4LWCA 4DR2L 1K8GA 2RCNA 2XTIA 4IPHA 4YCVA 3CPFA 3CCLA 2GVBA 2ASBA 3HFZB 2D0OA 1J5EL 1KXLA 1G6PA 1YBYA 2WP8J 4POGA 1C0AA 3T1YQ 4B3MQ 4WJ4A 2N78A 1XTDA 3J81c 2OCEA 2VZAA 4DV3Q 4GOPA 1XMQQ 3GTMH 1SRUA 2C35B 2UUBQ 3U4VA 2JJQA 4DR1Q 4DUYL 5IYDH 2UUCL 4R1JA 4IFDI 4DR4L 4KHPQ 4BBRH 3RNUA 3GTOH 5IYDG 3GDEA 2ATWA 1X3EA 2V1CC 1ASYA 1IBML 3CMEA 4NXML 4DR5L 4A3JH 4LF9L 3MXNB 3GTJH 4BBRG 3CP0A 3CW2C 2DUDA 4MTNA 3GTQH 3W5OA 4IOAA 4IFDJ 2R93H 2RF4A 2UXCQ 4YY3L 3CCRA 1TWHH 2A19A 4A3JG 2OWOA 4OX9Q 1VQJA 2ZTDA 2K75A 4LFCL 1N32Q 2KENA 2R93G 1BBWA 3CMAA 2VUMH 2MQHA 3CC4A 1GVPA 1EUJA 4GN4B 3G48A 3RLNA 1BBUA 4DV7Q 3BZKA 3M4PA 4JI8Q 2E8GA 3M3YH 3RZOH 1XNQL 2VUMG 1YVCA 1OXTA 2E2HH 5GAEC 3RLFA 4A3KH 1X6OA 3ICEA 1L2FA 5C0XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  2F52 A;  3K80 C;  2F4V L;  3GTP H;  4YWK A;  1NJI C;  2Q2H A;  2AMC B;  4A3K G;  4BY7 H;  1OXS C;  2JA8 H;  4DV6 L;  4KHP L;  2ZM6 Q;  2Y0S G;  5DLQ E;  5C0X J;  3VDY A;  3ULP A;  1QZH A;  1JJ2 A;  3J7Z C;  4JI5 L;  2JK8 A;  3STB D;  3KFU A;  2VNU D;  4GOP C;  1ASZ A;  4PZ7 A;  1VQO A;  3OTO L;  4GNX C;  2AWO A;  4HIO A;  3HKS A;  3AQQ A;  1X3G A;  1YZ6 A;  3HOX H;  4JV5 L;  5IY0 A;  1VQC A;  3CPW A;  2EIF A;  3CCU A;  1O7I A;  1VQ5 A;  4YHH Q;  4AQY Q;  1UE7 A;  1VQ4 A;  4DR7 Q;  3HOX G;  4Y52 H;  4JYA L;  1J6Q A;  4LF7 Q;  1VQK A;  1PH3 A;  2Q2U A;  3RR5 A;  1EIF A;  1Q7Y C;  2N3S A;  2I5L X;  1Q82 C;  1KC8 C;  2XGT A;  5LMU L;  5GQO A;  3MEF A;  4HIK A;  2K52 A;  2MNA A;  3I4O A;  2IHE A;  1TWG H;  2L15 A;  2E5L Q;  3PCO B;  4JI4 Q;  2PI2 E;  3I56 A;  3PO2 H;  4DR6 L;  4A76 A;  4DK6 C;  3AFQ A;  1SE8 A;  4A3F G;  2GVA A;  1N34 Q;  3GTK H;  5JJI A;  3PUY A;  2R6G A;  1V9P A;  4L5R C;  1NTG A;  5IT9 c;  1KRS A;  3M4Q A;  1TXY A;  3BU2 A;  2MFI A;  2RHQ B;  2UU9 L;  4RG1 A;  1YJ9 A;  3K7U C;  2LSS A;  1HZA A;  2KCT A;  1HNZ L;  1FVI A;  4DUZ L;  3I4N G;  2K50 A;  2NVY H;  3NEL A;  2VQE L;  1L1O B;  1Y1V H;  2CFM A;  4LF8 Q;  1S3O A;  5IWA L;  2B63 H;  1VQE A;  2VW9 A;  1MJC A;  1PV4 A;  4X65 Q;  1Y1V G;  1HNW L;  1KL9 A;  1PH4 A;  3D31 A;  4LF7 L;  2R7F A;  1PH9 A;  3S2H H;  1EOV A;  4X6A H;  2B63 G;  3HKZ G;  2UXB L;  4DR3 Q;  4NXN L;  2Y0S E;  4LF6 L;  4JBJ A;  4OXP A;  4L5S A;  4EX5 A;  1IBK Q;  1JE5 A;  3F8T A;  1B70 B;  4LFA Q;  2WFW A;  4JI2 Q;  3M4O H;  2HHH Q;  4NPS A;  5JEA G;  3S1Q H;  2QGQ A;  1PH7 A;  1X65 A;  4BA1 I;  1X9N A;  3UDX A;  2AWN A;  4YCU A;  2VS1 A;  2IY5 B;  5FJ8 G;  5AJ3 L;  2OQ0 A;  2LXJ A;  3UDG A;  4JI3 Q;  2CQO A;  4HJ5 A;  2N8N A;  3ULL A;  4B3S L;  2RHS B;  3S1R H;  4AIM A;  4GKJ Q;  1E1O A;  3CQZ H;  1X3F A;  4OWT B;  4C3H H;  3U4Z A;  5GAG C;  5M3M G;  1EQR A;  2D62 A;  1E24 A;  4DV2 Q;  2NVQ H;  1I6H H;  4YWM A;  4X64 L;  3RN2 A;  3HOW H;  1S72 A;  1N36 L;  1FJG Q;  4K0K L;  4JG2 A;  4JI7 L;  3L2P A;  1UE1 A;  1PYS B;  3ZJY C;  1N33 L;  2R7Z H;  2AKW B;  4UP7 A;  3HOW G;  3I4M H;  3PIO A;  4BY1 H;  1YEZ A;  1SRO A;  4GNX A;  4JBM A;  2ZTE A;  4UP9 A;  3J80 i;  5IP7 H;  1HR0 Q;  1VQB A;  2R7Z G;  3HOZ H;  5LMN W;  4IO9 A;  3I4M G;  1Q8K A;  3BJU A;  4BY1 G;  5LMU Q;  2MO1 A;  3E9H A;  2IX1 A;  4B3R L;  3KF6 A;  3KJO A;  5IP7 G;  4A3M H;  4LF5 Q;  4DV4 Q;  1WFQ A;  5LMN L;  1UE5 A;  1HNX L;  1XNR L;  3HOZ G;  4GS3 A;  2PNH A;  1AH9 A;  5ELN A;  4GKK L;  1CKM A;  3TS2 A;  4A3M G;  3A74 A;  3M85 A;  3H3V H;  2K14 A;  2JA5 H;  4R4C A;  2ES2 A;  3Q8D A;  1IBL Q;  3ULJ A;  3EN2 A;  3HKZ E;  4DPG A;  4JI1 L;  4QJF A;  5C4J H;  2JQO A;  4DV2 L;  2JA5 G;  3I7F A;  1QUQ B;  1M1K C;  1OXX K;  3AYH B;  4JI6 Q;  4JI0 Q;  3T1Y L;  4B3M L;  3CCS A;  4B3T Q;  5IE8 A;  1GM5 A;  2OQK A;  5H1S E;  4DV3 L;  2HQL A;  3A0J A;  1XMQ L;  4AYB G;  1U0L A;  3K8A A;  1SFO H;  3GTG H;  3HOU H;  2UUB L;  2YTX A;  2Z0S A;  1P16 A;  3L0O A;  4HJ8 A;  4DR1 L;  4GLX A;  4DV5 Q;  4BXX H;  4BA2 I;  1YNX A;  4HJA A;  4X62 Q;  3HOU G;  4PG3 A;  3UDI A;  4L5T A;  3TQY A;  4BXX G;  4JOI C;  1VQ8 A;  2YYZ A;  4XIG S;  4JBK A;  4DV1 Q;  4BY7 G;  4OON A;  3T1H Q;  2JA8 G;  2DGY A;  4X66 Q;  4DV0 Q;  4ALP A;  1PA6 A;  5BR8 Q;  4WJ3 M;  1E22 A;  4KI0 A;  1Y14 B;  2K5V A;  2B3G A;  5M5X H;  1YIT A;  1XPU A;  2UXC L;  1NMG A;  4OX9 L;  2EXD A;  2HIV A;  2UUA Q;  1LTL A;  4L5Q A;  1N32 L;  4MNO A;  1IL2 A;  1H95 A;  1X54 A;  2PQA B;  3K0X A;  3RZD H;  3S2D H;  4LUV A;  3KDF B;  1N8R C;  1A8V A;  3TRE A;  3PUX A;  3EBE A;  4DV7 L;  4JI8 L;  1YJN A;  1XMO Q;  3H0G H;  4A75 A;  1E3P A;  1VQG A;  3F2D A;  3HOY H;  4B3T L;  4A3C H;  1HJP A;  3G4S A;  4IOC A;  4LUZ A;  4A3B H;  4BBS H;  1BKB A;  4P74 A;  3PF4 A;  3J80 c;  2R7D A;  4IJH A;  3H0G G;  4PZ8 A;  3HOY G;  1L0W A;  4A3C G;  2Z6K C;  4A3B G;  3CC2 A;  1Q46 A;  1BVS A;  2JA7 H;  3BZC A;  3W1G A;  4LFB L;  1EQQ A;  4Y7N H;  4ME3 A;  2ZM6 L;  1VQI A;  1PH8 A;  4DK3 C;  3TRZ A;  1CKO A;  4P72 A;  3GTL H;  2JA7 G;  2K4K A;  3L7Z C;  4QIW E;  4FDB A;  1VQH A;  1FL0 A;  3PUZ A;  4R4T A;  2NZH A;  2KHJ A;  1K83 H;  2K5H A;  4DAM A;  3PGZ A;  1OTC A;  3CCQ A;  5FLM H;  3FP9 A;  3S24 A;  1EFW A;  1A62 A;  3H3V I;  4AYB E;  3DM3 A;  2CCZ A;  3E9I A;  3CF5 A;  4GLA C;  3A5U A;  2ZJP A;  4YHH L;  5HY6 A;  4AQY L;  5FLM G;  1VQ9 A;  1LYL A;  4DR7 L;  3U50 C;  4GLV B;  5J3B A;  4R4Q A;  3PO3 H;  4IFD G;  3ER0 A;  4UP8 A;  4GOP B;  1P8L A;  4LF4 Q;  1V43 A;  2FXQ A;  3KOJ A;  3IRB A;  1PH6 A;  4GNX B;  4JBW A;  3DLL A;  3PO3 G;  2VQF Q;  2Q2T A;  3S1M H;  1I5F A;  1NBW A;  1B7Y B;  4QGU A;  1JT8 A;  4KLK A;  2CWP A;  2E5L L;  3S1N H;  1D7Q A;  1C9O A;  4JI4 L;  1TWA H;  3KF6 B;  2E2I H;  3J81 j;  1N34 L;  4IPG A;  1Z9F A;  4LFB Q;  2A8V A;  1K0R A;  4DR2 Q;  5M5Y H;  1PH5 A;  5JJL A;  2ZTC A;  1XJV A;  2E2J H;  4OWW B;  1MKH A;  1J5E Q;  1SR3 A;  2GN5 A;  3F1Z A;  4QL5 A;  3J7A 5;  1CUK A;  2HIX A;  4LUO A;  3TEH B;  3PIP A;  1D8L A;  1MIU A;  5M3F H;  1VQL A;  4LF8 L;  2KHI A;  3UDF A;  2N49 A;  1HZ9 A;  5IYC H;  1X55 A;  1OXU A;  1JJG A;  4JOI A;  4DUY Q;  5M3F G;  1A63 A;  2UUC Q;  1G51 A;  3KYH C;  2NZO A;  1B8A A;  4X65 L;  3H15 A;  1GO3 E;  1KIX A;  3HOV H;  3CD6 A;  1XPR A;  2CKZ B;  1G29 1;  5IYC G;  3S14 H;  4P73 A;  4LF4 L;  3S17 H;  1AE2 A;  1FGU A;  3ERS X;  4GN5 A;  4DR3 L;  1K9M C;  1IBM Q;  3FKI H;  1M90 C;  3AFP A;  4NXM Q;  1NY4 A;  4DR5 Q;  1IBK L;  4JI2 L;  4LFA L;  4LF9 Q;  1VQ6 A;  2R92 H;  3NEN A;  2B29 A;  2I5H A;  2HHH L;  4OWX B;  2OTL A;  1Q1E A;  1QVC A;  1UEB A;  2IHF A;  4YY3 Q;  2ZJQ A;  2R92 G;  1R9T H;  2IX0 A;  4RMF A;  3CCJ A;  1Q12 A;  1CSQ A;  1A0I A;  2JA6 H;  4JI3 L;  4A93 H;  2JEB I;  4KHZ A;  3OW2 A;  1QVG A;  4J15 A;  4EQ5 A;  1XNQ Q;  2Q2I A;  4YWL A;  3GD7 A;  2JA6 G;  3CC7 A;  4GKJ L;  4A93 G;  2Z6K A;  1YHB A;  5GAH C;  3CCE A;  3GO5 A;  1PVO A;  1K8A C;  4P75 A;  2F4V Q;  1I50 H;  1W3S A;  1VQF A;  4MZ9 A;  1T9H A;  1RIP A;  3I2Z A;  5IP9 H;  1FJG L;  2NN6 G;  4YCW A;  4IPD A;  4AH6 A;  4DV6 Q;  2WAQ G;  1HR0 W;  3S16 H;  4HIM A;  5IP9 G;  1V1Q A;  1HZB A;  1WCM H;  1CKN A;  1HR0 L;  5GAD C;  4JI5 Q;  2PI2 A;  1GKH A;  4P71 A;  1KD1 C;  1KHI A;  2WB1 G;  1I94 Q;  3OTO Q;  1WCM G;  1UE6 A;  2IT1 A;  4O2D A;  3CAM A;  4LF5 L;  1WI5 A;  4DV4 L;  4A3D H;  3I55 A;  1S40 A;  4JV5 Q;  1VQA A;  1HZC A;  1SLJ A;  3PSI A;  2NVT H;  1UWV A;  1EWI A;  4NB3 A;  3UE0 A;  1VQN A;  4QQB X;  4LNQ A;  1VS0 A;  3PUW A;  1PFS A;  1GD7 A;  4A3D G;  3F2B A;  5JEA J;  4JYA Q;  5K36 G;  1TWF H;  2AHO B;  4DNI A;  1TWC H;  1IBL L;  3WWV A;  1VQD A;  2CWA A;  4C3I H;  3PV0 A;  3F2C A;  3G71 A;  4JI6 L;  1PYB A;  1W2B A;  4A3L H;  1L1O C;  4XTC S;  3JC6 6;  2QA4 A;  5C44 H;  2K5N A;  4JI0 L;  4DR6 Q;  1PHJ A;  1YJW A;  1LUZ A;  2A1A A;  4OO1 G;  2YTY A;  5C3E H;  2YU9 H;  2BH8 A;  3STB C;  4A3G H;  4A3L G;  2VL6 A;  4LW1 A;  4UPA A;  2BA1 A;  5C44 G;  1QZG A;  4H02 A;  3CCM A;  2ZJR A;  4DV5 L;  2UU9 Q;  3U58 A;  1YHA A;  4BBS G;  5C3E G;  2MO0 A;  1SMX A;  2PMZ E;  3JAM i;  1Q81 C;  4X62 L;  4POF A;  1Q86 C;  1VCI A;  1I94 L;  1HNZ Q;  4DUZ Q;  4HJ7 A;  2VQE Q;  1X56 A;  4HID A;  4DV1 L;  3T1H L;  1QUQ A;  5IWA Q;  1VQM A;  4X66 L;  3LGJ A;  4DV0 L;  3AEV A;  1SN8 A;  1WOC A;  2YTV A;  5BR8 L;  2JA9 A;  5FLX c;  3PF5 A;  3CCV A;  1HNW Q;  3SGI A;  1OXV A;  3RN5 A;  2OTJ A;  1MJE A;  2WAQ E;  4R4O A;  3CXC A;  1U5K A;  2F3I A;  3J81 i;  5EAY A;  2UUA L;  2UXB Q;  4IJL A;  1VQ7 A;  4NXN Q;  1YI2 A;  4LF6 Q;  1Q1B A;  1I3Q H;  2KBN A;  2D0P A;  1EIY B;  4A3F H;  3TS0 A;  3EIV A;  1NMF A;  2NN6 I;  1DGS A;  1XMO L;  5JJK A;  2WB1 E;  4PZ6 A;  3K81 C;  1VQP A;  5E7N A;  2UXD Q;  3KLW A;  5AJ3 Q;  3G6E A;  3M9B A;  2YV5 A;  1JJC B;  4TVA B;  3I4N H;  1N9W A;  1WJJ A;  1Y1W H;  1IZ6 A;  3B6Y A;  4B3S Q;  1YIJ A;  1C7Y A;  1K3R A;  4IPC A;  4HJ9 A;  2BA0 A;  4A3G G;  3UE1 A;  4A4I A;  4DAY B;  4R4I A;  3A5Z B;  1Y1W G;  3W1B A;  2JE6 I;  1YHQ A;  3M7N A;  2EQS A;  2PQA A;  4QY7 A;  3K7A H;  5M5W H;  4X64 Q;  1KRT A;  1JB7 A;  3KF8 B;  4O0A A;  3D0F A;  3KDF A;  2I5M X;  4A3E H;  1N36 Q;  1EYG A;  2I0Q A;  1WYD A;  5IYB H;  4JI7 Q;  4K0K Q;  4GN3 B;  1RL2 A;  2KCM A;  1N33 Q;  3RLO A;  1K73 C;  1IXR A;  3PO2 G;  4A3E G;  1KQS A;  4JCV E;  1AE3 A;  1NE3 A;  2H5X A;  1Z47 A;  5IYB G;  4JC0 A;  1IYJ B;  5C0X G;  3PUV A;  2NVX H;  3NBH B;  5FJ8 H;  2QEX A;  4B3R Q;  4A3I H;  1XPO A;  3OYY A;  2VY3 A;  4PMW A;  2BH2 A;  1CSP A;  3KJP A;  2ID0 A;  1PH2 A;  4C3J H;  4DR4 Q;  1KAW A;  5ELO A;  4OO1 I;  5LMN Q;  1PH1 A;  1HNX Q;  1XNR Q;  4UY8 C;  5C4X H;  2UXD L;  4A3I G;  1HH2 P;  3S15 H;  3FHW A;  3HOV G;  4GKK Q;  1CKN B;  2HT1 A;  2VQF L;  5M3M H;  5GRO A;  3JAM c;  5C4X G;  4C2M H;  4DKA C;  1QVF A;  3FKI G;  4TQU S;  2ALY B;  3NEM A;  1L1O A;  2LXK A;  1E1T A;  1E7Z A;  1JMC A;  4LFC Q;  2JEA I;  4APV A;  4JI1 Q;  5HGQ A;  3E0E A;  4LWC A;  4DR2 L;  1K8G A;  2RCN A;  2XTI A;  4IPH A;  4YCV A;  3CPF A;  3CCL A;  2GVB A;  2ASB A;  3HFZ B;  2D0O A;  1J5E L;  1KXL A;  1G6P A;  1YBY A;  2WP8 J;  4POG A;  1C0A A;  3T1Y Q;  4B3M Q;  4WJ4 A;  2N78 A;  1XTD A;  3J81 c;  2OCE A;  2VZA A;  4DV3 Q;  4GOP A;  1XMQ Q;  3GTM H;  1SRU A;  2C35 B;  2UUB Q;  3U4V A;  2JJQ A;  4DR1 Q;  4DUY L;  5IYD H;  2UUC L;  4R1J A;  4IFD I;  4DR4 L;  4KHP Q;  4BBR H;  3RNU A;  3GTO H;  5IYD G;  3GDE A;  2ATW A;  1X3E A;  2V1C C;  1ASY A;  1IBM L;  3CME A;  4NXM L;  4DR5 L;  4A3J H;  4LF9 L;  3MXN B;  3GTJ H;  4BBR G;  3CP0 A;  3CW2 C;  2DUD A;  4MTN A;  3GTQ H;  3W5O A;  4IOA A;  4IFD J;  2R93 H;  2RF4 A;  2UXC Q;  4YY3 L;  3CCR A;  1TWH H;  2A19 A;  4A3J G;  2OWO A;  4OX9 Q;  1VQJ A;  2ZTD A;  2K75 A;  4LFC L;  1N32 Q;  2KEN A;  2R93 G;  1BBW A;  3CMA A;  2VUM H;  2MQH A;  3CC4 A;  1GVP A;  1EUJ A;  4GN4 B;  3G48 A;  3RLN A;  1BBU A;  4DV7 Q;  3BZK A;  3M4P A;  4JI8 Q;  2E8G A;  3M3Y H;  3RZO H;  1XNQ L;  2VUM G;  1YVC A;  1OXT A;  2E2H H;  5GAE C;  3RLF A;  4A3K H;  1X6O A;  3ICE A;  1L2F A;  5C0X I; 
#chains in the Genus database with same CATH topology
 3K80 C;  2F4V L;  4A3K G;  4BY7 H;  4HCS A;  4O42 A;  3U9S A;  4R9W A;  1CT1 D;  2ZM6 Q;  5DLQ E;  5IT9 E;  1VF5 C;  3J7Z C;  3GTK B;  1AFP A;  2VNU D;  4GOP C;  2P5Z X;  1ASZ A;  1SNO A;  1DM0 B;  4GNX C;  1GJX A;  2RSO A;  3OWE B;  1SEB D;  2RSN A;  1X3G A;  1YZ6 A;  2Z1C A;  5IY0 A;  2DNC A;  4XYO A;  5CV7 A;  1O7I A;  1BXT A;  1WTW A;  4KY5 A;  1UE7 A;  2A74 C;  5FO9 B;  4Y52 H;  1A3V A;  1H9M A;  4JYA L;  3OWF A;  1VQK A;  4DGZ A;  1PTO F;  1PH3 A;  5IGG A;  1EIF A;  2K32 A;  2MNA A;  3I4O A;  1TWG H;  2L15 A;  1ZKO A;  1TS3 A;  2PI2 E;  3KLS A;  4A76 A;  3M4O B;  3GTK H;  2GVA A;  3E6Z X;  3PUY A;  2R6G A;  4K8J A;  5IT9 c;  1TXY A;  2SNS A;  3BU2 A;  1SMY D;  2RHQ B;  3FMC A;  4RG1 A;  2CH4 W;  1B2T A;  1SE4 A;  2LSS A;  1HZA A;  2KCT A;  5M3M B;  2MPM A;  1RCV D;  4ZKB B;  2K50 A;  3ND8 A;  4F8M A;  4LF8 Q;  1AZP A;  3CQZ B;  1S3O A;  2VW9 A;  1MJC A;  2EY2 A;  4ZQ3 A;  5FK9 C;  2F0O A;  1KL9 A;  1TY2 A;  1EYC A;  2KQ3 A;  4QF4 A;  2R7F A;  3S2H H;  1EOV A;  2BCO A;  2B63 G;  2EYP A;  4DR3 Q;  4IUN A;  1SAP A;  1C48 A;  3LWE A;  3GTM B;  1B70 B;  2WFW A;  3M4O H;  4TRD A;  2XSC A;  5IGE A;  2IY5 B;  2OQ0 A;  5G3L D;  2CQO A;  1TY0 A;  4HJ5 A;  1U9R A;  4ILW A;  4B3S L;  4A3J B;  2Z4H A;  3CQZ H;  2R61 A;  2DNE A;  3FPU B;  2SOB A;  5ELE A;  1EY6 A;  3URY A;  3RN2 A;  3K58 A;  4PMC A;  1UE1 A;  1PYS B;  4ZYS A;  1E2Z A;  4IUV A;  1JOK A;  5CV6 A;  3J81 L;  1YEZ A;  1SRO A;  4GNX A;  2ZTE A;  4UP9 A;  3HRZ C;  5IP7 H;  1HR0 Q;  1H9S B;  1Q8K A;  1EL0 A;  3E9H A;  4CKC A;  3GTP B;  2Y0S B;  4DV4 Q;  1MSG A;  5LMN L;  2ZT9 C;  3I73 A;  3OIQ A;  4GS3 A;  1CHQ D;  5CV8 A;  2B8G A;  4FXD A;  2CQA A;  4A3M G;  3H94 A;  5G3L F;  3H3V H;  2JA5 H;  3TZD A;  3Q8D A;  3K5M A;  1B3A A;  5HUR A;  2JQO A;  1OXX K;  4JI6 Q;  4G57 A;  1CQF A;  4K8I A;  2DY8 A;  3CCS A;  5H1S E;  1XMQ L;  4TKO B;  4HED A;  4R8I A;  1ET9 A;  2CW0 C;  4DV5 Q;  2KEC A;  1K8M A;  1YNX A;  1SJH D;  4X62 Q;  3HOU G;  1QWY A;  1JWM D;  1A3T A;  3TDQ A;  1G91 A;  4XIG S;  4DF7 A;  4DV1 Q;  4BY7 G;  2F03 A;  4OON A;  4UAI A;  4Y7N B;  3QB3 A;  4DV0 Q;  1BQQ T;  4ALP A;  1RTO A;  1LTG D;  1YIT A;  2PO4 A;  4OX9 L;  2EXD A;  2UUA Q;  3HGB A;  1N32 L;  4MNO A;  2PQA B;  1JOQ A;  3MVV A;  1XX8 A;  3QIA A;  3EBE A;  1VQG A;  3O13 A;  3I72 A;  4B3T L;  5FO7 B;  1DZ1 A;  2K01 A;  4P74 A;  2Z9H A;  3E3X A;  3HOY G;  1O7L A;  1PTO B;  2WKC A;  3CC2 A;  2G9H D;  5FO8 B;  4Y7N H;  1BO0 A;  2ZM6 L;  1D6E C;  1Y8O B;  2E2I B;  1CKO A;  3SXH A;  5IT9 L;  1SBB B;  4HN7 A;  1CA5 A;  1VQH A;  2K5H A;  4K5X A;  1LT5 D;  1PZK D;  3S1R B;  1A62 A;  2EXZ A;  3DM3 A;  5M3F B;  4IFD H;  4GLA C;  2QEJ C;  5HY6 A;  1I6H B;  4GLV B;  5J3B A;  1QE6 A;  3D4R A;  4UP8 A;  2N88 A;  3KOJ A;  1PH6 A;  3S14 B;  1PTO H;  3DLL A;  2Q2T A;  4J1M A;  1NBW A;  1I5F A;  2WIN B;  1LT3 D;  1HA5 A;  4CKE A;  3S1N H;  3H91 A;  4ME5 A;  3KF6 B;  2E2I H;  3LNN A;  2EY1 A;  1F9P A;  3J81 j;  3K0Y A;  1K0R A;  2ZTC A;  4IUR A;  4C1N K;  1U4L A;  1XJV A;  3UI2 A;  2E2J H;  1J5E Q;  1QJO A;  3F1Z A;  1ZYR D;  3JAM L;  2F1M A;  2HIX A;  4KK7 A;  3PIP A;  2PZW A;  1MIU A;  5M3F H;  4FF2 A;  4RCO A;  1VQL A;  3AU7 A;  4CJ0 B;  5J22 A;  3UDF A;  4LF8 L;  5FKA C;  3R2T A;  1X55 A;  1JJG A;  2UUC Q;  1G51 A;  3KYH C;  2NZO A;  2RDH A;  5ELD A;  3HOV H;  3GP7 A;  2CKZ B;  5IYC G;  3S14 H;  4LF4 L;  1FGU A;  4DR3 L;  1K9M C;  2KCC A;  3AFP A;  2B29 A;  4OWX B;  1PRT F;  4WFN 3;  2R92 G;  1AEX A;  3BVG A;  3NUC A;  4PNY A;  1CSQ A;  4JPB W;  3S9W A;  1ML0 D;  1A0I A;  1EIG A;  3MXU A;  3D4W A;  3OW2 A;  3SE0 A;  5BN5 A;  2EYO A;  4K14 A;  1VDZ A;  3GD7 A;  4HAE A;  2JA6 G;  1YHB A;  5GAH C;  2NN6 H;  1TWC B;  4KKS A;  1HPC A;  1L0X B;  4RGT A;  1W3S A;  3NBH A;  1RIP A;  4JVZ A;  1AW7 A;  4IPD A;  1JB3 A;  3QR8 A;  1MBY A;  4G7Z C;  3I70 A;  1CKN A;  3MA2 B;  1HR0 L;  3MFY A;  1GKH A;  1I94 Q;  2IT1 A;  1UE6 A;  4O2D A;  4ULL A;  4DV4 L;  1HZC A;  5ISR A;  5K36 H;  1EWI A;  1VQN A;  1T5X D;  3PUW A;  2MGS A;  1K3B C;  4A3D G;  1PFM A;  3GTL B;  5JEA J;  3G6J B;  2AHO B;  1TWC H;  1AN8 A;  3WWV A;  1VQD A;  3IKJ A;  2CWA A;  3MAQ A;  3F2C A;  3G71 A;  4JI6 L;  4NMZ A;  4A3L H;  2QA4 A;  4E6I A;  4DR6 Q;  2YTY A;  3H6M A;  4J8Q A;  2VL6 A;  1QZG A;  4DV5 L;  3U58 A;  2MO0 A;  1Y69 U;  3QO2 A;  4X62 L;  2VQE Q;  4M8A A;  4OIK A;  4HID A;  1STY A;  5D3I B;  2RA4 A;  2F3V A;  1A15 A;  4DV1 L;  5IWA Q;  4DV0 L;  1ZEQ X;  1HNW Q;  3K7A B;  3SGI A;  4Q0F A;  4R4O A;  4HSV A;  2UUA L;  2ZXO A;  1EY9 A;  4LF6 Q;  3HP3 A;  2D0P A;  4A3F H;  3TS0 A;  1NMF A;  5JJK A;  1K0S A;  1QB5 D;  2FHT A;  2F0K A;  5E7N A;  1SMY C;  3C1F A;  5AJ3 Q;  4KHV A;  1V1P A;  2YV5 A;  2XVS A;  4TVA B;  3I4N H;  2EJF C;  4CHT B;  2F0I A;  1IZ6 A;  1SNC A;  3B6Y A;  2FIN B;  3FKI B;  1K3R A;  2A5H A;  2PYK A;  2BA0 A;  1YNN D;  2NZ1 D;  1SNP A;  2EQS A;  2PQA A;  1CK1 A;  3K7A H;  5IGD A;  1I4P A;  4F7X A;  4K0K Q;  3MHB A;  4JI7 Q;  2I07 B;  1BBX C;  4GN3 B;  5EQ0 A;  4I65 A;  3RLO A;  2AQ3 B;  1KQS A;  3DM1 A;  4JCV E;  1NE3 A;  2ZXP A;  1Z47 A;  4JC0 A;  4RAU C;  2I46 A;  3VR2 A;  5CBE E;  5C0X G;  2EY6 A;  2ENB A;  1DJR D;  1SNM A;  5C5M A;  5FJ8 H;  2QEX A;  1XPO A;  4PMW A;  1I50 B;  3KJP A;  1J8I A;  3P1H A;  1LT4 D;  5ELO A;  5E3F A;  3HOV G;  4C3J G;  3J7A V;  3W3A A;  2XNA C;  2E2D C;  4TQU S;  4DK1 A;  4JI1 Q;  1DOL A;  3E0E A;  1K8G A;  3CCL A;  3V05 A;  2ASB A;  1KXL A;  2M9V A;  1J5E L;  2QIL A;  1PRT B;  1EWH A;  2OCE A;  4DV3 Q;  3NE5 B;  2PNR C;  2UUB Q;  2HUG A;  1M8A A;  2JJQ A;  4A3K B;  1BUV T;  2UUC L;  3EFX D;  4G7O C;  2L55 A;  5LL6 S;  4A3G B;  3CP0 A;  4ZKC B;  2DUD A;  3W5O A;  4IOA A;  1LO5 D;  2OWO A;  5IGC A;  1SNQ A;  1TS4 A;  2KEN A;  2K33 A;  2QDL A;  1BBU A;  5CBA E;  2D5D A;  1GUW A;  4A3K H;  1S5D D;  1LM0 A;  1LTS D;  2DJF C;  2F52 A;  1RKN A;  4YWK A;  1IYV A;  4KTA A;  1KDA A;  4ZRZ A;  4MHE A;  1G6Z A;  3BVZ A;  1EZ8 A;  1ILQ A;  5DM6 3;  1QZH A;  5D3D A;  4CBV A;  3STB D;  4EVO A;  4PZ7 A;  2V4D A;  1Y1W B;  4HIO A;  1LT6 D;  3CPW A;  2TSS A;  4M1U B;  2EIF A;  4RCN A;  1VQ5 A;  4ID6 A;  4YHH Q;  1WVL A;  4DR7 Q;  1A2U A;  3HOX G;  4FF1 A;  5DM7 3;  3QOJ A;  1YNJ D;  3MWY W;  3RR5 A;  4X3S A;  2N3S A;  5GQO A;  1F9R A;  2O2L D;  4ZAI A;  4HIK A;  3P75 A;  4I7Z C;  3GV3 A;  3I3C A;  2E5L Q;  1EYA A;  1X32 A;  3PCO B;  2NVX B;  4JI4 Q;  2LMC B;  3NQT A;  4XQN A;  4DR6 L;  1SYC A;  3AFQ A;  4A3F G;  4KV6 A;  1STN A;  1ZXT A;  1NTG A;  1DD2 A;  3KBG A;  2MFI A;  2SDF A;  1YJ9 A;  1X3Q A;  3S15 B;  2PZT A;  1FVI A;  3I4N G;  5EJW A;  2VQE L;  5EBD A;  5I2Y A;  5IWA L;  2B63 H;  1Y1V G;  1HNW L;  4NDX A;  1PH4 A;  4LF7 L;  2F0Q A;  2L4N A;  3HKZ G;  4ZLT F;  4LF6 L;  3SK6 A;  4L5S A;  4CGY B;  1IBK Q;  4JI2 Q;  4LFA Q;  4PMB A;  4NPS A;  5JEA G;  3S1Q H;  2QGQ A;  2AWN A;  5FJ8 G;  5AJ3 L;  4A3M B;  3UDG A;  1ZYR C;  4JI3 Q;  3GQB A;  3SK5 A;  2Q8T A;  1II3 A;  1R4P B;  4GKJ Q;  2K28 A;  3I90 A;  3DXJ C;  1X3F A;  4OWT B;  5FOB B;  3U4Z A;  5GAG C;  4IUT A;  1TWH B;  4K2K A;  2WV6 D;  4C3H G;  1S72 A;  5C4J B;  4DNT B;  4K0K L;  4JG2 A;  4JI7 L;  3L2P A;  1VMP A;  3MXG A;  2WAC A;  3PQI A;  4UP7 A;  3EA6 A;  3PIO A;  4JBM A;  1Q90 A;  3J80 i;  2F0N A;  3QOL A;  1VQB A;  2NBF A;  2R7Z G;  3HOU B;  3FDT A;  3KJO A;  4A3M H;  4BY7 B;  1WFQ A;  1UE5 A;  4G4K A;  3Q0A A;  1AH9 A;  4FXG C;  4KD4 A;  3L3O C;  3NTI A;  1STE A;  1U4R A;  2VB3 X;  1O7Z A;  3ULJ A;  5M5X B;  3EN2 A;  3CRK C;  4JI1 L;  5C4J H;  1NNX A;  2KVM A;  4R8N A;  3I7F A;  1QUQ B;  4IN3 A;  3AYH B;  5CV9 A;  3U9O A;  1PTO D;  1C4Q A;  1WTO A;  4JI0 Q;  4B3T Q;  5IE8 A;  2OQK A;  4DV3 L;  4AYB G;  3K8A A;  3J80 E;  3HOU H;  5CGK A;  2UUB L;  2YTX A;  1GUT A;  2Z0S A;  3L0O A;  1IKL A;  5I6W A;  4HJ8 A;  5JPN C;  3D6C A;  4TSS A;  4BA2 I;  4RH6 A;  1PYW D;  4JW0 A;  1F2L A;  1TWG B;  3BVM A;  4L5T A;  3TQY A;  4BXX G;  3T13 A;  3ITP A;  1JOR A;  3T1H Q;  4O1N A;  5BN3 A;  4WJ3 M;  4IUQ A;  1E22 A;  1Y14 B;  2K5V A;  2QDB A;  1HA6 A;  5M5X H;  3N52 A;  1MHW C;  1IL2 A;  3OIP A;  3SEB A;  2L11 A;  1H95 A;  2G9D A;  3RZD H;  3VR3 A;  1A8V A;  3TRE A;  3PUX A;  5M9O A;  3TZU A;  3BS1 A;  1E3P A;  4V0B A;  3HOY H;  2J0T D;  3D4D A;  4IOC A;  4LUZ A;  4BBS H;  2EDG A;  1SDF A;  3J80 c;  3S2H B;  4IJH A;  2K5Q A;  2BDO A;  4A3C G;  3OMC A;  4A3B G;  1Q46 A;  1BVS A;  2AQ1 B;  3W1G A;  4ME3 A;  5COY A;  2K05 A;  1CHP D;  1XWE A;  1HXY D;  3BZD B;  5C4Z A;  2JP1 A;  3PUZ A;  2NZH A;  2KHJ A;  3TBI B;  3OPO A;  1K83 H;  1ONL A;  2K1B A;  1OTC A;  3VYR A;  3CCQ A;  3FP9 A;  1EFW A;  2RCF A;  1E2V A;  3A5U A;  4YHH L;  1VQ9 A;  1IYU A;  4DR7 L;  4R4Q A;  4K5V A;  5J39 A;  4LF4 Q;  5COR A;  3PO3 G;  4QUC A;  4N8F A;  1T5E A;  4KLK A;  1YNN C;  2E5L L;  1D7Q A;  3OW7 A;  2R92 B;  4JI4 L;  1TWA H;  3WOF A;  4FNF A;  4YIJ A;  5IOC A;  1R9T B;  1QNU A;  4U68 A;  4QL5 A;  5LL6 X;  3J7A 5;  1CUK A;  3TSS A;  3SVM A;  1S5C D;  5C6A A;  2JA5 B;  4IQZ A;  2KHI A;  2F0W A;  1HZ9 A;  5IYC H;  1FR3 A;  3SK4 A;  1A63 A;  1B8A A;  1KIX A;  4IAL A;  3A55 A;  2C5C A;  3EVQ A;  1G29 1;  1TR5 A;  1IKM A;  3RUZ A;  5CV5 A;  4GN5 A;  1LLR D;  3NP8 A;  4B08 A;  3S16 B;  4DR5 Q;  3E0J A;  1IBK L;  4KKU A;  4JI2 L;  4LFA L;  1SYG A;  1VQ6 A;  2R92 H;  2FFK B;  4ABN A;  3NEN A;  2F0M A;  2I5H A;  1BCP F;  3T56 B;  3VR5 A;  4NW2 A;  1QVC A;  1UEB A;  4YY3 Q;  2ZJQ A;  4DAY A;  1R9T H;  3CCJ A;  2ICI A;  3G7L A;  4JI3 L;  4H44 C;  2JA6 H;  4A3D B;  2HD3 A;  2L12 A;  2Z8L A;  3ERO A;  4EQ5 A;  1XNQ Q;  4YWL A;  4GKJ L;  3CC7 A;  1GXD C;  1PVO A;  2R3Z A;  1B9M A;  2MP1 A;  4OHJ A;  4DA2 A;  1HTL D;  2X69 A;  4AH6 A;  5T1G A;  1Q8I A;  2EOT A;  2EPB A;  2WAQ G;  3S16 H;  2EYJ A;  1DOK A;  5IP9 G;  1V1Q A;  2PI2 A;  4L63 B;  4P71 A;  2WB1 G;  1KD1 C;  1TKW B;  5CR3 A;  1HFG A;  1WCM G;  1WI5 A;  4A3D H;  1S40 A;  1I4H A;  4JV5 Q;  1VQA A;  1SLJ A;  1UWV A;  4QQB X;  4LNQ A;  2ICE C;  3KBX A;  1PDQ A;  1PFS A;  2TMP A;  5ELF A;  2A69 D;  3PV0 A;  4CDF C;  2HCC A;  5JPM C;  4X3T A;  5EKI A;  5A2Q E;  4JI0 L;  4C3I G;  1PHJ A;  1YJW A;  2A1A A;  2PQE A;  4KY7 A;  4EQO A;  3STB C;  4L8J A;  4UPA A;  2BA1 A;  3J80 L;  2GA4 B;  3MXN A;  2UU9 Q;  1HHV A;  4BBS G;  5C3E G;  1SMX A;  2PMZ E;  1Q81 C;  1HNZ Q;  2RBM A;  4POF A;  1VCI A;  4DUZ Q;  1LTB D;  4HJ7 A;  3S1N B;  2RDF A;  4RGM A;  5NUC A;  3LX0 A;  3T1H L;  4QUF A;  1QUQ A;  1LTA D;  1YNJ C;  1OXV A;  2EYH A;  3RN5 A;  1WTR A;  2OTJ A;  1J9O A;  2E2J B;  2Z6B A;  4H0L C;  2UXB Q;  1VQ7 A;  2KBN A;  1EIY B;  3H3V C;  2QW7 A;  3EIV A;  4PZ6 A;  1VQP A;  3HOV B;  2F0E A;  3DUZ A;  3G6E A;  3M9B A;  1UEA B;  3I8Z A;  1JJC B;  2D9U A;  1N9W A;  1VF7 A;  1F9S A;  1PRT D;  4IPC A;  4HJ9 A;  3UE1 A;  4A4I A;  4R4I A;  2K03 A;  1TS5 A;  3W1B A;  3M7N A;  3VR4 A;  1CA6 A;  1JB7 A;  3MEH A;  3KF8 B;  1EYG A;  4CDE C;  1KNE A;  2I0Q A;  2XRQ D;  1ESR A;  5C0X H;  3VYS A;  2KCM A;  1RDP D;  1AE3 A;  2H5X A;  1SSO A;  4HMI A;  3PUV A;  3TN2 A;  1NCV A;  2F0F A;  4C3J H;  1KAW A;  1PH1 A;  1HNX Q;  4UY8 C;  4A3I G;  1E2W A;  4FF4 A;  3N6R A;  3GTO B;  4GKK Q;  1ICW A;  5GRO A;  4NKL A;  5JJZ A;  3GV6 A;  4DKA C;  2ALY B;  2MUY A;  3NEM A;  1BF4 A;  1DYQ A;  2LXK A;  1E7Z A;  2IWH A;  2JEA I;  4APV A;  5KRU A;  4BS9 A;  1EZ6 A;  4IPH A;  1U4M A;  1BCP B;  2GVB A;  2D0O A;  1B4O A;  2HCI A;  1SYD A;  4DAP A;  2N78 A;  4DAV A;  1SRU A;  2F0H A;  2C35 B;  5D14 A;  1STH A;  4DR1 Q;  5KNB A;  1CQV A;  3NTK A;  4DU9 A;  3GTO H;  1SE2 A;  5IYD G;  4ZCK A;  1X3E A;  2ATW A;  1EY5 A;  4DR5 L;  2CH4 A;  4BBR G;  1TVX A;  3GTQ H;  1JR0 D;  3BYT B;  2UXC Q;  4YY3 L;  3CCR A;  4A3J G;  1B3Q A;  1STA A;  3OHX C;  1PTO C;  5E4X A;  4OL7 A;  3CC4 A;  2KHS A;  1EUJ A;  4GN4 B;  3G48 A;  3M3Y H;  4DV7 Q;  3M4P A;  4K6D A;  2E8G A;  4JI8 Q;  1XNQ L;  3KLS X;  2VUM G;  1YVC A;  1OXT A;  5GAE C;  3RLF A;  1TT2 A;  1X6O A;  3BDC A;  1H9S A;  1HUN A;  2AMC B;  4A3F B;  2JA8 H;  2M00 A;  2EYF A;  2Y0S G;  5EGT A;  3VDY A;  3V2T A;  3ULP A;  1JJ2 A;  5I9O A;  5EBC A;  2ZXR A;  3R2I A;  3I4N B;  1B44 D;  2AWO A;  3HKS A;  3X3M A;  5LHY 1;  2A6H D;  4JV5 L;  3HOX H;  3CCU A;  1Y1V B;  3TP8 A;  1LTI D;  2M2L A;  4AQY Q;  2O5J C;  1VQ4 A;  5CMD A;  3TP6 A;  1KDC A;  3T53 B;  4LF7 Q;  1HQM C;  2XIW A;  3I91 A;  5EPL A;  1Q82 C;  2XGT A;  2F4I A;  3MEF A;  2H1E A;  3D6W A;  2IHE A;  2IJ0 A;  3A8I E;  3I56 A;  1H9R A;  2F0L A;  5A2Q L;  5JJI A;  1W6K A;  1DXM A;  1EY0 A;  2OF1 A;  2L9H A;  1B50 A;  3ND9 A;  4L5R C;  1KRS A;  3K5O A;  1GUN A;  2K6A A;  2UU9 L;  1LV9 A;  4KMU C;  2G5D A;  5EKK A;  4NP5 A;  1HNZ L;  2CHB D;  4F87 A;  4DUZ L;  2NVY H;  3NEL A;  4DXG A;  1L1O B;  1Y1V H;  4LJZ C;  5EPJ A;  5KIX A;  4C56 C;  4V19 0;  4C3H B;  5KND A;  1VQE A;  4X65 Q;  5DAU A;  1KTK A;  5E1F A;  2B2V C;  3P7J A;  2UXB L;  5JEA H;  2R7Z B;  2L1B A;  5D65 A;  4OXP A;  4EX5 A;  1JE5 A;  3F8T A;  1TS2 A;  2X6G A;  5I9P A;  1F2Y A;  2B2W C;  3LWU A;  1X65 A;  1B1Z A;  4YCU A;  2VS1 A;  2XN9 C;  2LXJ A;  4IUP A;  1I6V C;  3ULL A;  1X3P A;  1ENF A;  2B2U C;  2RHS B;  4AIM A;  1KAA A;  1E1O A;  3NWT A;  4C3H H;  1EQR A;  1SYB A;  2D62 A;  4QIW B;  4Q5V A;  2DN8 A;  4YWM A;  5IIF A;  1Y8N B;  2E75 C;  4ZUJ A;  3ZYY X;  4FYD A;  1JE4 A;  2PZU A;  3ZJY C;  4AYB B;  2R7Z H;  2AKW B;  3HOW G;  2B39 A;  2KEE A;  5LMN W;  4IO9 A;  3I4M G;  5LMU Q;  4BY1 G;  2MO1 A;  3KF6 A;  1HNX L;  1JQY D;  3HOZ G;  1BNZ A;  4GKK L;  1Q3L A;  1CKM A;  1NR4 A;  2BDN A;  3KF8 A;  1O7Y A;  3M85 A;  2PCF B;  1IBL Q;  2JSO A;  1WTV A;  1EU3 A;  3HKZ E;  4XXE A;  4DV2 L;  3A56 A;  1LTR D;  1GHJ A;  1M1K C;  5J1Z A;  2EYL A;  4G7H C;  3S2D B;  1GM5 A;  2HQL A;  1F77 A;  1HRJ A;  4A3B B;  1P16 A;  4DR1 L;  1VMC A;  4BXX H;  1D2B A;  1XTC D;  4HJA A;  3BYY B;  3W2D A;  4PG3 A;  3DWQ A;  2IPK D;  4JOI C;  3I4L A;  2JA8 G;  2DGY A;  3AMU A;  4X66 Q;  1PA6 A;  2B2V A;  2F0G A;  3C2P A;  2KJX A;  1PXU A;  1XPU A;  5EPK A;  2UXC L;  3QWN A;  4IZ8 A;  2HIV A;  1GUO A;  4WRD A;  2B2W A;  1QIL A;  3S2D H;  3K0X A;  1EYD A;  4KN4 C;  5CC4 A;  4DV7 L;  4JI8 L;  3DEO A;  2B63 B;  1Z6H A;  1EEF D;  1HJP A;  4A3B H;  2B2U A;  2MJ8 A;  3PO3 B;  4A3C H;  1BKB A;  3PF4 A;  1Y8P B;  3H0G G;  4KJN A;  4PZ8 A;  1L0W A;  2Z6K C;  1JIC A;  2SNM A;  4N9T A;  1IW7 D;  1VQI A;  1PH8 A;  5JAV A;  3TRZ A;  3S1Q B;  3J7A F;  4P72 A;  2JA7 G;  3L7Z C;  4QIW E;  4FDB A;  2EY5 A;  3MTS A;  5M5Y B;  4DAM A;  3WDN A;  3PGZ A;  3S24 A;  3H3V I;  4AYB E;  3ONA B;  3HZX A;  2CCZ A;  3E9I A;  3CF5 A;  2ZJP A;  2AUK A;  1EFI D;  5FLM G;  4AQY L;  5F2D A;  3U50 C;  3CRL C;  3PO3 H;  2KCN A;  3ER0 A;  4QCL A;  4GOP B;  1P8L A;  3K6O A;  2FXQ A;  3IRB A;  4GNX B;  1PRT C;  2K7V A;  1RHP A;  1QG7 A;  4HMJ A;  3S1M H;  4UHV A;  4QGU A;  1JT8 A;  3SHL A;  1GHK A;  1ICF B;  4KKT A;  2EJM A;  3C1E A;  1Z9F A;  4LFB Q;  5M5Y H;  1KLG D;  2NTT A;  1RD9 D;  4OWW B;  1KAB A;  1MKH A;  4OEM B;  5C4H A;  1UUP A;  2GN5 A;  4LUO A;  5I2X A;  1D8L A;  4JOI A;  4DUY Q;  2JYO A;  3BDL A;  1EOT A;  1ET6 A;  4X65 L;  3H15 A;  4P2C B;  4RWS C;  1XPR A;  4CJ2 C;  3MFG A;  4P73 A;  2NTS A;  3S17 H;  3DWA A;  4KY6 A;  1NY4 A;  5JOB A;  1Q1E A;  2IHF A;  4KJO A;  2IX0 A;  4RMF A;  1K8O A;  3FPP A;  1QVG A;  2Q2I A;  1S5B D;  4A93 G;  2Z6K A;  3GO5 A;  2F0T A;  1TWF B;  3A54 A;  4FP5 D;  4P75 A;  1WTP A;  1STB A;  1IL8 A;  4MZ9 A;  1T9H A;  5IP9 H;  4C3I B;  4YCW A;  3RZD B;  4DV6 Q;  4RFB A;  1HR0 W;  3KLR A;  4HIM A;  4OIJ A;  1RF2 D;  1ILP A;  3HOY B;  1WCM H;  4BBS B;  5GAD C;  4JI5 Q;  1ENA A;  1GUS A;  1PZJ D;  3DWP A;  1KHI A;  4X3U A;  3OTO Q;  3Q23 A;  3UE0 A;  5HGT A;  1DOM A;  5FLX E;  1QCB D;  5I4D A;  1HFN A;  2F0U A;  1TWF H;  4DNI A;  3D8G A;  1IBL L;  3F2U A;  3K57 A;  1K83 B;  1D5M C;  1EQT A;  4C3I H;  3MC0 B;  1W2B A;  1I3Q B;  2C9O A;  4XTC S;  3JC6 6;  1KNA A;  4MIU A;  3K59 A;  1LUZ A;  2Z4I A;  4XT1 B;  5C3E H;  3T16 A;  2A6E D;  5ELC A;  4LW1 A;  4N8X 1;  5C44 G;  3CCM A;  1D5Z C;  1EY8 A;  2ZJR A;  5JVG 3;  1YHA A;  4J6H A;  4A3G G;  1CI3 M;  2A6H C;  3JAM i;  1Q86 C;  1UNS A;  1KLU D;  4QMG A;  3T4A C;  1X56 A;  2VXW A;  1A3U A;  1TWA B;  2FMC A;  2PW7 A;  1VQM A;  4X66 L;  3LGJ A;  3AEV A;  1G6P A;  1CM9 A;  1WOC A;  4RGO S;  2JA9 A;  5FLX c;  3CCV A;  4MTK A;  2WKD A;  5M5W B;  1MJE A;  2WAQ E;  3FVQ A;  4FO2 A;  4IJL A;  4NXN Q;  1I3Q H;  1LTT D;  2NN6 I;  1DGS A;  2WB1 E;  3K81 C;  4A3I B;  3D3R A;  1BCP D;  3JAM E;  1YIJ A;  1D5X C;  2A68 D;  3PIP 3;  3FEW X;  3A8K E;  1Y1W G;  4ZUI A;  4X64 Q;  2KED A;  2PMZ B;  5M5W H;  2NWG A;  3D0F A;  1N36 Q;  2JA6 B;  1RL2 A;  1N33 Q;  1K73 C;  1IXR A;  4KN7 C;  5EKL A;  4A3E G;  3PO2 G;  5BN4 A;  5IYB G;  1IYJ B;  1UAP A;  3RD4 A;  2IX3 A;  3NBH B;  4B3R Q;  2KOL A;  4RA8 A;  4A3I H;  2VY3 A;  2BH2 A;  1CSP A;  4CDC C;  2ID0 A;  1PH2 A;  1ESF A;  4OO1 I;  1XNR Q;  2UXD L;  2E74 C;  1HH2 P;  4BWG B;  4BBR B;  1CKN B;  5M3M H;  1D1K A;  4I7A A;  5C3W A;  3JAM c;  5C4X G;  1IHZ A;  3A7A B;  1QVF A;  3GTJ B;  3KK7 A;  5A35 A;  1E1T A;  3QJY A;  4LFB L;  2RCN A;  2XTI A;  3HFZ B;  2VUM B;  1YBY A;  2KUM A;  3IFD A;  2RKS A;  3T1Y Q;  4B3M Q;  4WJ4 A;  4GOP A;  1XTD A;  3RZO B;  3GTM H;  3U4V A;  4OGQ C;  4DUY L;  3HG9 A;  5IYD H;  4R1J A;  1NR2 A;  4DR4 L;  3SK8 A;  1RJT A;  2F3W A;  2NUC A;  4BBR H;  3RNU A;  1AP0 A;  2V1C C;  1ASY A;  4WJW A;  3CME A;  4A3J H;  2QCP X;  3GTJ H;  2PW5 A;  1WD1 A;  1NSN S;  4IFD J;  2F0J A;  4C1N I;  2AUJ D;  2A19 A;  2ZTD A;  2K75 A;  4WOR A;  4LFC L;  3J7Y W;  2R93 G;  1PMR A;  2VUM H;  2MQH A;  4DNR B;  2JXM B;  1GVP A;  1CFM A;  1H9K A;  3BZK A;  4RKB A;  3RZO H;  1V8Q A;  3MZ5 A;  3K5L A;  3T51 B;  3KUP A;  3MXP A;  1NJI C;  1FNU A;  3GTP H;  2Q2H A;  1OXS C;  4DV6 L;  4KHP L;  1W6J A;  5C3X A;  2D2C C;  3H09 A;  1V1P B;  5C0X J;  2IL8 A;  2B2T C;  4JI5 L;  3K5N A;  2JK8 A;  3KFU A;  1VQO A;  1I4G A;  3OTO L;  3AQQ A;  1WTQ A;  1S5E D;  1C8C A;  1JOO A;  2J4X A;  4CDD C;  4U67 3;  1VQC A;  3NPP A;  1ENC A;  3QG1 A;  5FLX L;  1J6Q A;  3AB9 A;  3VYU A;  1SJE D;  5E4W C;  2Q2U A;  3NTH A;  1L0Y B;  4EQN A;  1Q7Y C;  1KC8 C;  2I5L X;  5LMU L;  2K52 A;  1DON A;  3C3L A;  1IW7 C;  2EVB A;  1R4Q B;  1XYI A;  1FNV A;  4XQQ A;  4DK6 C;  1N34 Q;  1SE8 A;  2Q8I B;  2A73 B;  4C3J B;  1V9P A;  3M4Q A;  1BOS A;  2WII B;  1JWS D;  1B9N A;  3K7U C;  4DXF A;  2CFM A;  5IOD A;  2NVQ B;  1PV4 A;  1Z7T A;  3RMH A;  3D31 A;  1S5F D;  3HOW B;  1PH9 A;  4X6A H;  4NXN L;  2Y0S E;  4JBJ A;  2PPB C;  3NHH A;  2VB2 X;  3I4M B;  4BY1 B;  2X6L A;  1ROD A;  2HHH Q;  3HOZ B;  1PH7 A;  4BA1 I;  1X9N A;  3UDX A;  3ERQ A;  3CU7 A;  3OSO A;  2N8N A;  3OMG A;  3S1R H;  1MSH A;  5CYU A;  5M3M G;  3GTQ B;  1I4Q A;  1E24 A;  4DV2 Q;  2NVQ H;  1I6H H;  1SND A;  3Q22 A;  4X64 L;  1BR9 A;  1U4P A;  3HOW H;  1FJG Q;  1N36 L;  2B2T A;  1N33 L;  3M3Y B;  3Q6S A;  3I4M H;  2OXP A;  4BY1 H;  1SFO B;  1MD2 D;  3GTG B;  3HOZ H;  2F0S A;  3BJU A;  4B3R L;  5KYL A;  2IX1 A;  2BE5 D;  4LF5 Q;  5IP7 G;  2JA8 B;  1XNR L;  5IGF A;  2PNH A;  2HQE A;  5ELN A;  3TS2 A;  5JVH 3;  2EE1 A;  3A74 A;  3E5S A;  1TQO A;  2K14 A;  5IGB A;  4R4C A;  2ES2 A;  5ELB A;  3V96 A;  4PV1 C;  4LK1 C;  4DPG A;  4QJF A;  2FMM A;  2JA5 G;  4B9X A;  3VYT A;  3HOX B;  3VR6 A;  4XQJ A;  2L5T A;  1FNW A;  3T1Y L;  4B3M L;  3H0G B;  2B2Y C;  3A0J A;  3NBI A;  1U0L A;  1SFO H;  1FGB D;  3GTG H;  5C5L A;  4FXK C;  4GLX A;  1MI2 A;  1EY7 A;  3DEP A;  1EQV A;  3UDI A;  4ZK9 B;  1VQ8 A;  2YYZ A;  3WOE A;  2JA7 B;  1HTP A;  1TII D;  2FJ2 A;  5BR8 Q;  3M7G A;  4KI0 A;  2EYM A;  2O4X A;  2B3G A;  3FRP B;  3HEJ A;  1NMG A;  3SDZ A;  1LTL A;  4L5Q A;  2NVY B;  1B53 A;  1X54 A;  1DCZ A;  4LUV A;  4OO1 H;  2EJG C;  3KDF B;  2J7Z A;  1N8R C;  1YJN A;  1XMO Q;  3R8B A;  1S4Z A;  3H0G H;  3HKZ B;  4A75 A;  2A6E C;  3F2D A;  2LKV A;  3NSW A;  3G4S A;  3C46 A;  1LAB A;  3EJI A;  2R7D A;  4EQP A;  2E76 C;  2OT2 A;  3NXW A;  2DY7 A;  2JA7 H;  3CHB D;  3BZC A;  4DN4 M;  1E0B A;  1HQR D;  2SEB D;  2DJG C;  1EQQ A;  4DK3 C;  3NQI A;  1SYE A;  3GTL H;  5TSS A;  1AZQ A;  2K4K A;  2HDL A;  4XT3 B;  3X3N A;  1FL0 A;  4R4T A;  4F88 A;  1PFN A;  5KEE A;  1F2Z A;  1STG A;  5FLM H;  2O5I C;  3NWS A;  4RKL A;  1LYL A;  3NK9 A;  1HCZ A;  1O78 A;  3TP5 A;  3VA5 A;  4IFD G;  4H7B A;  1G2T A;  1BCP C;  1V43 A;  2QKI C;  3EQL C;  4JBW A;  5I6Y A;  2VQF Q;  2A68 C;  1B7Y B;  4RGN A;  4CKB A;  2CWP A;  3M4Y A;  1C9O A;  1FD7 D;  1SXT A;  1EU4 A;  1N34 L;  4IPG A;  3L9A X;  2A8V A;  4DR2 Q;  1PH5 A;  5JJL A;  1O80 A;  3DHQ A;  3IAY A;  2B2Y A;  4A93 B;  1SR3 A;  1GUG A;  2QF7 A;  3TEH B;  2XWJ B;  3PIO 3;  2N49 A;  1OXU A;  5M3F G;  1GO3 E;  1H9J A;  3CD6 A;  4DK0 A;  1AE2 A;  3ERS X;  4ODG A;  2LFN A;  1IBM Q;  3FKI H;  4RHR A;  1M90 C;  4NXM Q;  4LF9 Q;  1WTX A;  1TU2 B;  1QNK A;  1KDB A;  2HHH L;  4HR7 B;  2H4O A;  2OTL A;  1Q12 A;  4A93 H;  4FF3 A;  3BG3 A;  2NVT B;  2JEB I;  4KHZ A;  1LAC A;  4J15 A;  1CZW A;  4IUU A;  4K5W A;  3CCE A;  1K8A C;  4KD3 A;  3PMF A;  2F4V Q;  1I50 H;  1VQF A;  2LS0 1;  1FJG L;  3I2Z A;  2NN6 G;  5CV4 A;  1XXG A;  4XYQ A;  5C44 B;  1HZB A;  3TP7 A;  2YU9 B;  2K5W A;  4N9P A;  5KNC A;  2CW0 D;  3Q24 A;  3CAM A;  4LF5 L;  3I55 A;  3TME A;  3PSI A;  2NVT H;  4NB3 A;  1RTN A;  1VS0 A;  1MGS A;  2MHV A;  3IL8 A;  2RQX A;  1GD7 A;  3F2B A;  4JYA Q;  5K36 G;  3R3O A;  2A69 C;  1EEI D;  4QB4 A;  2K5D A;  1PYB A;  2NB0 A;  1L1O C;  5C44 H;  2K5N A;  4HSP A;  2L0C A;  1WD0 A;  4OO1 G;  1D1I A;  2YU9 H;  2BH8 A;  1K28 A;  2K04 A;  4A3G H;  4A3L G;  5AFW A;  2KA7 A;  4H02 A;  1V1O A;  2Q8R E;  4UDU C;  4JBK A;  1JC7 A;  3S1M B;  1I94 L;  3R93 A;  4HCE A;  1A6X A;  1OO9 B;  3BDO A;  1SN8 A;  2YTV A;  1F2M A;  2B8F A;  3A7L A;  2OEO A;  5BR8 L;  3PF5 A;  3PO2 B;  4A3E B;  3CXC A;  1U5K A;  2F3I A;  4OEL B;  2AQ2 B;  3A8J E;  5EAY A;  3J81 i;  1YI2 A;  1Q1B A;  1I4R A;  4XDX A;  1XMO L;  2EZV A;  5DNF A;  1PZI D;  1FYC A;  1PFB A;  2F0V A;  4PQX A;  1EIH A;  1BDO A;  3KLW A;  2UXD Q;  3HS0 C;  3CKI B;  1NUC A;  3S17 B;  5C4X B;  1A2T A;  1WJJ A;  1Y1W H;  4B3S Q;  1C7Y A;  4B9W A;  1EWC A;  4DAY B;  1WTH A;  3A5Z B;  4C2M B;  5T1I A;  1GOZ A;  2JE6 I;  2N55 A;  1YHQ A;  4QY7 A;  1KRT A;  5KYI A;  4O0A A;  4A3E H;  3KDF A;  3PO2 H;  2I5M X;  1WYD A;  2F0P A;  5IYB H;  4GZY C;  3J81 E;  4DFA A;  4S3S A;  2CVR A;  1HUM A;  5DEH A;  3VA7 A;  2NVX H;  4K6L A;  4EGV A;  2WAQ B;  3OYY A;  2LY7 A;  2NYZ D;  4DR4 Q;  5LMN Q;  4Z9C B;  4X3K A;  5C4X H;  2BOS A;  3S15 H;  4H13 C;  3FHW A;  2HT1 A;  2WB1 B;  1I4X A;  2VQF L;  1CZG A;  1WCM B;  3P20 A;  4C2M H;  1EY4 A;  2XWB B;  3FKI G;  4FVM A;  2R93 B;  1L1O A;  1JMC A;  4LFC Q;  4JK1 C;  5HGQ A;  4DR2 L;  4LWC A;  4HTH A;  4YCV A;  3CPF A;  1NAP A;  4L6T B;  2WP8 J;  4POG A;  1QOH A;  1F9Q A;  1C0A A;  4K2L A;  4MN3 A;  3J81 c;  2VZA A;  1XMQ Q;  1JWU D;  2E2H B;  4LAA A;  2BE5 C;  3OOC A;  2HDM A;  2JN4 A;  1CTM A;  3SR1 A;  4LMQ D;  4IFD I;  4KHP Q;  5KGU A;  3GDE A;  3DMU A;  5K5P A;  2RVL A;  1IBM L;  5C3E B;  1JCK B;  4LF9 L;  4NXM L;  3MXN B;  3CW2 C;  2R93 H;  4MTN A;  4CJ1 B;  2XRS D;  2RF4 A;  1SYF A;  4OX9 Q;  1TWH H;  1G2S A;  1VQJ A;  1N32 Q;  1BBW A;  3CMA A;  2RDG A;  3IFT A;  2IW3 A;  3RLN A;  1M4V A;  1SE3 A;  1G8Z D;  2F0D A;  1PLF A;  2E2H H;  4RHS A;  3ICE A;  1L2F A;  5C0X I;  5L37 A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  2F52 A;  3K80 C;  2F4V L;  3GTP H;  4YWK A;  1NJI C;  2Q2H A;  2AMC B;  4A3K G;  4BY7 H;  1OXS C;  2JA8 H;  4DV6 L;  4KHP L;  2ZM6 Q;  2Y0S G;  5DLQ E;  5C0X J;  3VDY A;  3ULP A;  1QZH A;  1JJ2 A;  3J7Z C;  4JI5 L;  2JK8 A;  3STB D;  3KFU A;  2VNU D;  4GOP C;  1ASZ A;  4PZ7 A;  1VQO A;  3OTO L;  4GNX C;  2AWO A;  4HIO A;  3HKS A;  3AQQ A;  1X3G A;  1YZ6 A;  3HOX H;  4JV5 L;  5IY0 A;  1VQC A;  3CPW A;  2EIF A;  3CCU A;  1O7I A;  1VQ5 A;  4YHH Q;  4AQY Q;  1UE7 A;  1VQ4 A;  4DR7 Q;  3HOX G;  4Y52 H;  4JYA L;  1J6Q A;  4LF7 Q;  1VQK A;  1PH3 A;  2Q2U A;  3RR5 A;  1EIF A;  1Q7Y C;  2N3S A;  2I5L X;  1Q82 C;  1KC8 C;  2XGT A;  5LMU L;  5GQO A;  3MEF A;  4HIK A;  2K52 A;  2MNA A;  3I4O A;  2IHE A;  1TWG H;  2L15 A;  2E5L Q;  3PCO B;  4JI4 Q;  2PI2 E;  3I56 A;  3PO2 H;  4DR6 L;  4A76 A;  4DK6 C;  3AFQ A;  1SE8 A;  4A3F G;  2GVA A;  1N34 Q;  3GTK H;  5JJI A;  3PUY A;  2R6G A;  1V9P A;  4L5R C;  1NTG A;  5IT9 c;  1KRS A;  3M4Q A;  1TXY A;  3BU2 A;  2MFI A;  2RHQ B;  2UU9 L;  4RG1 A;  1YJ9 A;  3K7U C;  2LSS A;  1HZA A;  2KCT A;  1HNZ L;  1FVI A;  4DUZ L;  3I4N G;  2K50 A;  2NVY H;  3NEL A;  2VQE L;  1L1O B;  1Y1V H;  2CFM A;  4LF8 Q;  1S3O A;  5IWA L;  2B63 H;  1VQE A;  2VW9 A;  1MJC A;  1PV4 A;  4X65 Q;  1Y1V G;  1HNW L;  1KL9 A;  1PH4 A;  3D31 A;  4LF7 L;  2R7F A;  1PH9 A;  3S2H H;  1EOV A;  4X6A H;  2B63 G;  3HKZ G;  2UXB L;  4DR3 Q;  4NXN L;  2Y0S E;  4LF6 L;  4JBJ A;  4OXP A;  4L5S A;  4EX5 A;  1IBK Q;  1JE5 A;  3F8T A;  1B70 B;  4LFA Q;  2WFW A;  4JI2 Q;  3M4O H;  2HHH Q;  4NPS A;  5JEA G;  3S1Q H;  2QGQ A;  1PH7 A;  1X65 A;  4BA1 I;  1X9N A;  3UDX A;  2AWN A;  4YCU A;  2VS1 A;  2IY5 B;  5FJ8 G;  5AJ3 L;  2OQ0 A;  2LXJ A;  3UDG A;  4JI3 Q;  2CQO A;  4HJ5 A;  2N8N A;  3ULL A;  4B3S L;  2RHS B;  3S1R H;  4AIM A;  4GKJ Q;  1E1O A;  3CQZ H;  1X3F A;  4OWT B;  4C3H H;  3U4Z A;  5GAG C;  5M3M G;  1EQR A;  2D62 A;  1E24 A;  4DV2 Q;  2NVQ H;  1I6H H;  4YWM A;  4X64 L;  3RN2 A;  3HOW H;  1S72 A;  1N36 L;  1FJG Q;  4K0K L;  4JG2 A;  4JI7 L;  3L2P A;  1UE1 A;  1PYS B;  3ZJY C;  1N33 L;  2R7Z H;  2AKW B;  4UP7 A;  3HOW G;  3I4M H;  3PIO A;  4BY1 H;  1YEZ A;  1SRO A;  4GNX A;  4JBM A;  2ZTE A;  4UP9 A;  3J80 i;  5IP7 H;  1HR0 Q;  1VQB A;  2R7Z G;  3HOZ H;  5LMN W;  4IO9 A;  3I4M G;  1Q8K A;  3BJU A;  4BY1 G;  5LMU Q;  2MO1 A;  3E9H A;  2IX1 A;  4B3R L;  3KF6 A;  3KJO A;  5IP7 G;  4A3M H;  4LF5 Q;  4DV4 Q;  1WFQ A;  5LMN L;  1UE5 A;  1HNX L;  1XNR L;  3HOZ G;  4GS3 A;  2PNH A;  1AH9 A;  5ELN A;  4GKK L;  1CKM A;  3TS2 A;  4A3M G;  3A74 A;  3M85 A;  3H3V H;  2K14 A;  2JA5 H;  4R4C A;  2ES2 A;  3Q8D A;  1IBL Q;  3ULJ A;  3EN2 A;  3HKZ E;  4DPG A;  4JI1 L;  4QJF A;  5C4J H;  2JQO A;  4DV2 L;  2JA5 G;  3I7F A;  1QUQ B;  1M1K C;  1OXX K;  3AYH B;  4JI6 Q;  4JI0 Q;  3T1Y L;  4B3M L;  3CCS A;  4B3T Q;  5IE8 A;  1GM5 A;  2OQK A;  5H1S E;  4DV3 L;  2HQL A;  3A0J A;  1XMQ L;  4AYB G;  1U0L A;  3K8A A;  1SFO H;  3GTG H;  3HOU H;  2UUB L;  2YTX A;  2Z0S A;  1P16 A;  3L0O A;  4HJ8 A;  4DR1 L;  4GLX A;  4DV5 Q;  4BXX H;  4BA2 I;  1YNX A;  4HJA A;  4X62 Q;  3HOU G;  4PG3 A;  3UDI A;  4L5T A;  3TQY A;  4BXX G;  4JOI C;  1VQ8 A;  2YYZ A;  4XIG S;  4JBK A;  4DV1 Q;  4BY7 G;  4OON A;  3T1H Q;  2JA8 G;  2DGY A;  4X66 Q;  4DV0 Q;  4ALP A;  1PA6 A;  5BR8 Q;  4WJ3 M;  1E22 A;  4KI0 A;  1Y14 B;  2K5V A;  2B3G A;  5M5X H;  1YIT A;  1XPU A;  2UXC L;  1NMG A;  4OX9 L;  2EXD A;  2HIV A;  2UUA Q;  1LTL A;  4L5Q A;  1N32 L;  4MNO A;  1IL2 A;  1H95 A;  1X54 A;  2PQA B;  3K0X A;  3RZD H;  3S2D H;  4LUV A;  3KDF B;  1N8R C;  1A8V A;  3TRE A;  3PUX A;  3EBE A;  4DV7 L;  4JI8 L;  1YJN A;  1XMO Q;  3H0G H;  4A75 A;  1E3P A;  1VQG A;  3F2D A;  3HOY H;  4B3T L;  4A3C H;  1HJP A;  3G4S A;  4IOC A;  4LUZ A;  4A3B H;  4BBS H;  1BKB A;  4P74 A;  3PF4 A;  3J80 c;  2R7D A;  4IJH A;  3H0G G;  4PZ8 A;  3HOY G;  1L0W A;  4A3C G;  2Z6K C;  4A3B G;  3CC2 A;  1Q46 A;  1BVS A;  2JA7 H;  3BZC A;  3W1G A;  4LFB L;  1EQQ A;  4Y7N H;  4ME3 A;  2ZM6 L;  1VQI A;  1PH8 A;  4DK3 C;  3TRZ A;  1CKO A;  4P72 A;  3GTL H;  2JA7 G;  2K4K A;  3L7Z C;  4QIW E;  4FDB A;  1VQH A;  1FL0 A;  3PUZ A;  4R4T A;  2NZH A;  2KHJ A;  1K83 H;  2K5H A;  4DAM A;  3PGZ A;  1OTC A;  3CCQ A;  5FLM H;  3FP9 A;  3S24 A;  1EFW A;  1A62 A;  3H3V I;  4AYB E;  3DM3 A;  2CCZ A;  3E9I A;  3CF5 A;  4GLA C;  3A5U A;  2ZJP A;  4YHH L;  5HY6 A;  4AQY L;  5FLM G;  1VQ9 A;  1LYL A;  4DR7 L;  3U50 C;  4GLV B;  5J3B A;  4R4Q A;  3PO3 H;  4IFD G;  3ER0 A;  4UP8 A;  4GOP B;  1P8L A;  4LF4 Q;  1V43 A;  2FXQ A;  3KOJ A;  3IRB A;  1PH6 A;  4GNX B;  4JBW A;  3DLL A;  3PO3 G;  2VQF Q;  2Q2T A;  3S1M H;  1I5F A;  1NBW A;  1B7Y B;  4QGU A;  1JT8 A;  4KLK A;  2CWP A;  2E5L L;  3S1N H;  1D7Q A;  1C9O A;  4JI4 L;  1TWA H;  3KF6 B;  2E2I H;  3J81 j;  1N34 L;  4IPG A;  1Z9F A;  4LFB Q;  2A8V A;  1K0R A;  4DR2 Q;  5M5Y H;  1PH5 A;  5JJL A;  2ZTC A;  1XJV A;  2E2J H;  4OWW B;  1MKH A;  1J5E Q;  1SR3 A;  2GN5 A;  3F1Z A;  4QL5 A;  3J7A 5;  1CUK A;  2HIX A;  4LUO A;  3TEH B;  3PIP A;  1D8L A;  1MIU A;  5M3F H;  1VQL A;  4LF8 L;  2KHI A;  3UDF A;  2N49 A;  1HZ9 A;  5IYC H;  1X55 A;  1OXU A;  1JJG A;  4JOI A;  4DUY Q;  5M3F G;  1A63 A;  2UUC Q;  1G51 A;  3KYH C;  2NZO A;  1B8A A;  4X65 L;  3H15 A;  1GO3 E;  1KIX A;  3HOV H;  3CD6 A;  1XPR A;  2CKZ B;  1G29 1;  5IYC G;  3S14 H;  4P73 A;  4LF4 L;  3S17 H;  1AE2 A;  1FGU A;  3ERS X;  4GN5 A;  4DR3 L;  1K9M C;  1IBM Q;  3FKI H;  1M90 C;  3AFP A;  4NXM Q;  1NY4 A;  4DR5 Q;  1IBK L;  4JI2 L;  4LFA L;  4LF9 Q;  1VQ6 A;  2R92 H;  3NEN A;  2B29 A;  2I5H A;  2HHH L;  4OWX B;  2OTL A;  1Q1E A;  1QVC A;  1UEB A;  2IHF A;  4YY3 Q;  2ZJQ A;  2R92 G;  1R9T H;  2IX0 A;  4RMF A;  3CCJ A;  1Q12 A;  1CSQ A;  1A0I A;  2JA6 H;  4JI3 L;  4A93 H;  2JEB I;  4KHZ A;  3OW2 A;  1QVG A;  4J15 A;  4EQ5 A;  1XNQ Q;  2Q2I A;  4YWL A;  3GD7 A;  2JA6 G;  3CC7 A;  4GKJ L;  4A93 G;  2Z6K A;  1YHB A;  5GAH C;  3CCE A;  3GO5 A;  1PVO A;  1K8A C;  4P75 A;  2F4V Q;  1I50 H;  1W3S A;  1VQF A;  4MZ9 A;  1T9H A;  1RIP A;  3I2Z A;  5IP9 H;  1FJG L;  2NN6 G;  4YCW A;  4IPD A;  4AH6 A;  4DV6 Q;  2WAQ G;  1HR0 W;  3S16 H;  4HIM A;  5IP9 G;  1V1Q A;  1HZB A;  1WCM H;  1CKN A;  1HR0 L;  5GAD C;  4JI5 Q;  2PI2 A;  1GKH A;  4P71 A;  1KD1 C;  1KHI A;  2WB1 G;  1I94 Q;  3OTO Q;  1WCM G;  1UE6 A;  2IT1 A;  4O2D A;  3CAM A;  4LF5 L;  1WI5 A;  4DV4 L;  4A3D H;  3I55 A;  1S40 A;  4JV5 Q;  1VQA A;  1HZC A;  1SLJ A;  3PSI A;  2NVT H;  1UWV A;  1EWI A;  4NB3 A;  3UE0 A;  1VQN A;  4QQB X;  4LNQ A;  1VS0 A;  3PUW A;  1PFS A;  1GD7 A;  4A3D G;  3F2B A;  5JEA J;  4JYA Q;  5K36 G;  1TWF H;  2AHO B;  4DNI A;  1TWC H;  1IBL L;  3WWV A;  1VQD A;  2CWA A;  4C3I H;  3PV0 A;  3F2C A;  3G71 A;  4JI6 L;  1PYB A;  1W2B A;  4A3L H;  1L1O C;  4XTC S;  3JC6 6;  2QA4 A;  5C44 H;  2K5N A;  4JI0 L;  4DR6 Q;  1PHJ A;  1YJW A;  1LUZ A;  2A1A A;  4OO1 G;  2YTY A;  5C3E H;  2YU9 H;  2BH8 A;  3STB C;  4A3G H;  4A3L G;  2VL6 A;  4LW1 A;  4UPA A;  2BA1 A;  5C44 G;  1QZG A;  4H02 A;  3CCM A;  2ZJR A;  4DV5 L;  2UU9 Q;  3U58 A;  1YHA A;  4BBS G;  5C3E G;  2MO0 A;  1SMX A;  2PMZ E;  3JAM i;  1Q81 C;  4X62 L;  4POF A;  1Q86 C;  1VCI A;  1I94 L;  1HNZ Q;  4DUZ Q;  4HJ7 A;  2VQE Q;  1X56 A;  4HID A;  4DV1 L;  3T1H L;  1QUQ A;  5IWA Q;  1VQM A;  4X66 L;  3LGJ A;  4DV0 L;  3AEV A;  1SN8 A;  1WOC A;  2YTV A;  5BR8 L;  2JA9 A;  5FLX c;  3PF5 A;  3CCV A;  1HNW Q;  3SGI A;  1OXV A;  3RN5 A;  2OTJ A;  1MJE A;  2WAQ E;  4R4O A;  3CXC A;  1U5K A;  2F3I A;  3J81 i;  5EAY A;  2UUA L;  2UXB Q;  4IJL A;  1VQ7 A;  4NXN Q;  1YI2 A;  4LF6 Q;  1Q1B A;  1I3Q H;  2KBN A;  2D0P A;  1EIY B;  4A3F H;  3TS0 A;  3EIV A;  1NMF A;  2NN6 I;  1DGS A;  1XMO L;  5JJK A;  2WB1 E;  4PZ6 A;  3K81 C;  1VQP A;  5E7N A;  2UXD Q;  3KLW A;  5AJ3 Q;  3G6E A;  3M9B A;  2YV5 A;  1JJC B;  4TVA B;  3I4N H;  1N9W A;  1WJJ A;  1Y1W H;  1IZ6 A;  3B6Y A;  4B3S Q;  1YIJ A;  1C7Y A;  1K3R A;  4IPC A;  4HJ9 A;  2BA0 A;  4A3G G;  3UE1 A;  4A4I A;  4DAY B;  4R4I A;  3A5Z B;  1Y1W G;  3W1B A;  2JE6 I;  1YHQ A;  3M7N A;  2EQS A;  2PQA A;  4QY7 A;  3K7A H;  5M5W H;  4X64 Q;  1KRT A;  1JB7 A;  3KF8 B;  4O0A A;  3D0F A;  3KDF A;  2I5M X;  4A3E H;  1N36 Q;  1EYG A;  2I0Q A;  1WYD A;  5IYB H;  4JI7 Q;  4K0K Q;  4GN3 B;  1RL2 A;  2KCM A;  1N33 Q;  3RLO A;  1K73 C;  1IXR A;  3PO2 G;  4A3E G;  1KQS A;  4JCV E;  1AE3 A;  1NE3 A;  2H5X A;  1Z47 A;  5IYB G;  4JC0 A;  1IYJ B;  5C0X G;  3PUV A;  2NVX H;  3NBH B;  5FJ8 H;  2QEX A;  4B3R Q;  4A3I H;  1XPO A;  3OYY A;  2VY3 A;  4PMW A;  2BH2 A;  1CSP A;  3KJP A;  2ID0 A;  1PH2 A;  4C3J H;  4DR4 Q;  1KAW A;  5ELO A;  4OO1 I;  5LMN Q;  1PH1 A;  1HNX Q;  1XNR Q;  4UY8 C;  5C4X H;  2UXD L;  4A3I G;  1HH2 P;  3S15 H;  3FHW A;  3HOV G;  4GKK Q;  1CKN B;  2HT1 A;  2VQF L;  5M3M H;  5GRO A;  3JAM c;  5C4X G;  4C2M H;  4DKA C;  1QVF A;  3FKI G;  4TQU S;  2ALY B;  3NEM A;  1L1O A;  2LXK A;  1E1T A;  1E7Z A;  1JMC A;  4LFC Q;  2JEA I;  4APV A;  4JI1 Q;  5HGQ A;  3E0E A;  4LWC A;  4DR2 L;  1K8G A;  2RCN A;  2XTI A;  4IPH A;  4YCV A;  3CPF A;  3CCL A;  2GVB A;  2ASB A;  3HFZ B;  2D0O A;  1J5E L;  1KXL A;  1G6P A;  1YBY A;  2WP8 J;  4POG A;  1C0A A;  3T1Y Q;  4B3M Q;  4WJ4 A;  2N78 A;  1XTD A;  3J81 c;  2OCE A;  2VZA A;  4DV3 Q;  4GOP A;  1XMQ Q;  3GTM H;  1SRU A;  2C35 B;  2UUB Q;  3U4V A;  2JJQ A;  4DR1 Q;  4DUY L;  5IYD H;  2UUC L;  4R1J A;  4IFD I;  4DR4 L;  4KHP Q;  4BBR H;  3RNU A;  3GTO H;  5IYD G;  3GDE A;  2ATW A;  1X3E A;  2V1C C;  1ASY A;  1IBM L;  3CME A;  4NXM L;  4DR5 L;  4A3J H;  4LF9 L;  3MXN B;  3GTJ H;  4BBR G;  3CP0 A;  3CW2 C;  2DUD A;  4MTN A;  3GTQ H;  3W5O A;  4IOA A;  4IFD J;  2R93 H;  2RF4 A;  2UXC Q;  4YY3 L;  3CCR A;  1TWH H;  2A19 A;  4A3J G;  2OWO A;  4OX9 Q;  1VQJ A;  2ZTD A;  2K75 A;  4LFC L;  1N32 Q;  2KEN A;  2R93 G;  1BBW A;  3CMA A;  2VUM H;  2MQH A;  3CC4 A;  1GVP A;  1EUJ A;  4GN4 B;  3G48 A;  3RLN A;  1BBU A;  4DV7 Q;  3BZK A;  3M4P A;  4JI8 Q;  2E8G A;  3M3Y H;  3RZO H;  1XNQ L;  2VUM G;  1YVC A;  1OXT A;  2E2H H;  5GAE C;  3RLF A;  4A3K H;  1X6O A;  3ICE A;  1L2F A;  5C0X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...