2UUAT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uuaT00
4B3ST 5IWAT 4JI1T 4OX9T 1FJGT 4JI3T 4DR1T 4DUYT 4DUZT 4DV6T 4JV5T 3T1HT 4DV0T 4DV4T 4KHPT 4YHHT 2E5LT 2UUBT 1N36T 5LMNT 4DR2T 4B3RT 2F4VT 4DV1T 1N32T 4LF5T 4JYAT 1HNZT 1HR0T 4DR5T 4LF9T 4X65T 1I94T 4X66T 4LFAT 2ZM6T 1J5ET 4LFBT 4NXMT 1IBKT 1XNQT 2UXDT 4JI4T 4JI7T 1IBLT 4DR3T 2UXBT 5LMUT 4LF8T 4JI0T 4JI8T 4LF4T 4AQYT 1XMQT 1XNRT 4GKKT 1XMOT 4DV3T 2HHHT 2VQFT 4JI5T 2UU9T 2UUAT 4JI6T 4GKJT 4DV7T 4DR4T 4DV5T 4DR6T 3T1YT 4LF6T 4DV2T 4NXNT 4X62T 5BR8T 2UXCT 2VQET 4JI2T 2UUCT 4YY3T 1HNXT 4LFCT 1N33T 4LF7T 3OTOT 1HNWT 1N34T 4B3MT 1IBMT 4DR7T 4K0KT 4B3TT 4X64T
chains in the Genus database with same CATH superfamily
1MMGA 2ACZA 3JAFA 5IWAT 3TLSA 4JI1T 5HXCA 2IW5B 3O1IA 3F2EA 4HWIB 1FJGT 5LGNB 5AQUB 2N9DA 2X66A 4UELA 2JQQA 2NW7A 3O1JA 5E0OA 4CXWA 3JC6D 4DVDA 2BKOA 5AQRB 2NW9A 4DR1T 4QWNB 3AE9A 2ZM0A 3RIFA 2E8IA 3W15B 4AQFA 5HXHA 2YDRA 2BG9E 4AQFC 4HFCA 4HKAA 4LMKA 2YK0A 2R6GF 4JEUB 2WS3A 2JJ9A 3SRZA 3CKDA 3UUBA 1OEDA 3DP7A 4IIJE 2LSJA 5FYMA 4DV0T 3ETVA 2UXNB 3AA6B 1O3XA 2WU5A 2LSKA 1YKEB 3N9OA 3NBXX 3KFWX 2WAUA 4KHZF 1D0XA 1HX1B 3KVBA 4U33A 5HAXA 3ZCIA 2ZM8A 3R84B 5ABFB 4YHHT 3ZJ1A 5FKYA 1G8XA 4GK5E 2PTFA 4UR9A 3RIAA 4H9QC 3MZKB 2NOXA 4EYUA 2BS3A 4QHOA 3PUQA 3AEFA 4X1YE 4Z8XA 2I59A 4TWFA 4B3RT 4H9RC 3PUWF 3N9NA 3PV0F 3WI3A 4DV1T 3PUXF 2KWIB 2PG8A 5LP6E 4EEBA 2BBHA 4EV6A 5C2TA 2CA5A 3EUHA 1IBMT 4LF5T 1OEDB 4JYAT 3UU8A 2X0LB 3AA0B 3IEEA 2JIWA 3GA8A 3KVAA 3N9PA 4HEAA 1T7SA 4J2CA 4KUMB 4LMLA 4TNWA 4GOUA 5HEGA 2MBGA 4A5XA 1HR0T 1D1BA 1NEKA 2KINB 4TX5A 4U7YA 4X65T 1R8IA 4ZEYA 3HKEE 1M62A 2EHOA 4EYYR 4X66T 4IT4A 1UUSA 1AJ3A 2DL1A 1G73A 3BQLA 3NZQA 5AQNB 5BMVE 4X20E 4U3CA 1XDPA 2WCAA 2K9AA 3RC3A 1XNQT 3FZLB 2CRBA 4GYRA 1IBLT 2NWBA 3K1SA 3UU5A 4H63V 2YN6A 3ZKRA 4WBNE 4JI0T 2NP9A 2V7IA 3K3OA 3CWZB 2WQYA 4QXBB 1KF6A 3UTKA 5J0ZA 4LF4T 2LSYA 4AQYT 2CHOA 1VCSA 3EI0A 3AE2A 1XNRT 2XTLA 2XSBA 4CQIA 4IE0A 2JQKA 4YSZA 1XMOT 4GKKT 5DQWA 2LRLA 2VKDA 4WZXA 2UXXB 3L39A 4HN9A 3L3PA 4ERRA 2A72A 2VQFT 2UU9T 3GMIA 3PE0A 1CHUA 1FMVA 1ZEEA 2Q9QC 2GK9A 4NPPA 5LB7B 1KEYA 1ZP0A 4IDOA 3HA4A 4XZCA 3H3AA 4ZI7E 5FP3A 1Z8UA 2XY8B 5CFBA 2VKOA 4QH4A 4EXTA 3KV5A 2DLRA 4ZS2A 3QNUA 2ZMAA 3O9XA 2WMNA 4Z91A 1WR0A 3AEEA 3T1YT 4JUYA 4B6XA 4COFA 2N1GA 1BR2A 3AXJA 2LKGA 2XQ8A 3PTRB 4YXDA 4X62T 5BR8T 2UXCT 2L8KA 1LVFA 3CK6A 4ZI3D 2J1DG 2LRKA 2BG9A 2W00A 2X9XA 3C4ZA 4ISSA 4L5GA 1KNZA 4H9NC 3ZT6A 5HWXA 1KK7A 4NUUA 3AE5A 1XZYA 3AAAB 3FHNA 5FVLA 2UUCT 3MK7C 4XBFB 1S35A 5AQOB 5L4HA 1N33T 4DNDA 4HFIA 3Q5WA 3OTOT 2BG9C 2XQ6A 1WLXA 2C5JA 1MMAA 3CPZA 1WRDA 2P9BA 3UUNA 4YJ3E 4I55E 5FY1A 2FBWA 3CX7B 1HX8A 3KDSE 3KINB 3JCFA 2XAHB 4QKNA 5FNVE 1JNZA 3KV6A 5FXWA 4B3TT 2IDOB 1HG2A 5EK2A 1UCUA 2IC6A 2W62A 3FZMB 4IDPA 2JMHA 2WWVA 2BZBA 2YEVC 2CBJA 1YXRA 4F8HA 4YTPA 5C3JA 5L2LA 3MACA 1VOMA 3Q9DA 4DIDB 3E0ZA 4PJLA 2X67A 4AKGA 1U5PA 2XQ5A 4DUZT 4HTEA 3H3MA 3QOFA 4WYVA 2FUPA 1W0BA 3KV4A 4L0RA 3ZMVB 5KMGP 2BS2A 5KDMC 3LG7A 3AEBA 4PFPA 4U7IA 2I0MA 3TLVA 1BR4A 2VB6A 3AAEB 2CEAA 2HN1A 3TKLB 3ZT5A 4PW8A 2DI4A 3LBXA 2XQ4A 4HFVA 1H7CA 2CM0A 4KHPT 2WBLA 5AQSB 2CXLA 4IE4A 4MBQA 1JNRA 2D0UA 2WWUA 2WM9A 3C4XA 4IE6A 3TLWA 4KP3C 3ZMUB 3VKGA 1Y64B 3AE3A 4GK0E 4ZHQE 2CMRA 2NR4A 4L9IA 3UT5E 4PJJA 3V5UA 2A3DA 2DNXA 2XQ7A 1FMWA 2FJDA 4ZOLE 3BQKA 5HEHA 3RYCE 2F4VT 3KV9A 3ANWB 4O4HE 1Y01A 5LA6E 3QK6A 3P4QA 1HF8A 4AI6A 1N32T 3OBVE 4PK5A 2E9XC 5AQGB 5IYZE 4ZI2D 1XDOA 5F8PA 3K8PC 5DQVA 3UUMA 2XUEA 2BDEA 3ZYLA 4CXXA 4UVAB 1ZKEA 2CXFA 2ES0A 2N2NA 4YJ2E 1EZ3A 2V26A 4IDZA 5JDQA 2PJQA 2H7OA 3A7MA 4HWCA 1LRZA 4K0UA 5FL0A 4LF9T 3OYZA 3QB5K 5FVKA 5JREA 2RA1A 3P7IA 2V5CA 2JRKA 2SPCA 1I94T 3RC8A 2CLYB 3CQXC 2V5DA 3I9WA 2K48A 3IF8B 4UV9B 4LFAT 1J5ET 3S4UA 1ZV4X 1J5WA 4JI4T 4JI7T 1WFDA 2IHR1 3ZPOA 1OWAA 4EZ4A 3JADA 2WY2A 2LJLA 3LBXB 5FL1A 2VWAA 4YTMA 2XQ9A 2CCQA 3L8RA 4IE5A 5L3FB 5JRCA 5AQQB 4U2ZA 5JH7E 1LVKA 2KWHA 5CJ5A 2XAQB 2L3LA 3J9X1 3A8YC 3U3IA 3ZJ2A 5ABFA 5LHHB 2YDQA 3AE6A 4U74A 2HH7A 5HEUA 3Q5DA 4ANJA 4YSXA 1HTJF 1B7TA 3B57A 3HKBE 2W66A 2HHHT 4QH1A 2VK9A 2HN2A 2W61A 3MJXA 2EHOC 2A2FX 3OPCA 5AQPB 3X1DA 2BKNA 2XZEA 5L3EB 1HCIA 2UUAT 4GKJT 2WZIA 2DWKA 3G06A 2FJBA 4KI0F 4ZXLA 3CQGB 3C4WA 1J1JA 2K24A 1UX4A 3P4WA 1NWMX 4TV8E 2LKHA 2LEHA 1D1CA 4X1KE 4F6RC 3A5XA 3D0TA 3P50A 2Y6XA 2NTXA 4FI5A 2OLTA 3FBZA 3B5MA 4DBRA 1FEWA 5HEJA 5L4EA 1SUMB 2BS4A 3VU7H 3FZHB 3N2KE 4KX6A 3ZMZB 2WDRA 5J1GA 3SS1A 3EVYA 4U31A 5LGUB 2D5UA 1X79A 4DV2T 3CMLA 4DMVA 4NXNT 5JDFA 1ZHCA 3EDVA 4UVCB 1SA0E 2C5KT 4BA9A 1T72A 2IAKA 2XJ7A 3N9LA 4AXPA 4B3MT 2VQET 4EZHA 3OYXA 4YSYA 5J2UE 3OJAA 2IUBA 3EHZA 2HPLA 2HPJA 5GONE 3MXZA 2QGSA 3LK3B 3LSVA 3IBPA 2DCFA 2MYSA 3VHLA 2LLYA 5HXRA 5ADXL 1HNXT 1D0ZA 4LFCT 2JPFA 1FIOA 2YU1A 5FY0A 4ADZA 1S94A 2J62A 4TWDA 5ABGA 3AA7B 3AE1A 4YT0A 1N34T 3NRXA 2YKSA 1U4QA 3ONLC 1IAPA 1VRBA 2CPTA 2G0UA 3ABVA 2E9XA 3P8CD 4HWDA 4TNVA 2LSGA 4JLEA 4NIQA 3RI5A 2W67A 4UV8B 3ONXA 4PJMA 5EZYE 3SWHA 2BVMA 3MA9A 3H37A 3PUAA 2MAWA 3E08A 4IREA 4UVBB 5HEOA 3ZN1B 4OX9T 2Q9QA 2KSRA 5LGTB 2CLYC 2VVNA 2XQYA 1W9RA 4KBMB 4C90A 1UGOA 3AB3B 4CI3B 5AFUL 3UQ7A 4UEMA 4CZZB 4DUYT 5AQTB 2KMFA 5JDNA 2WU2A 3SFEA 3ZSSA 4OHFA 3PU3A 5JRCB 4GYSA 3M3ZB 3Q5XA 3NWIA 5FXZA 5F5WA 5LXTE 4IGUA 3N2GE 3T1HT 3N9QA 1WCRA 3PDYA 2H88A 3ZSTA 2H7VC 2WB5A 4G2AA 4O4IE 1W09A 3RH3A 3LK2B 3RRWA 3VR9A 4DV4T 3IHRA 2RP4A 2VKJA 2W0GA 5KXJA 2E5LT 2UUBT 2FJEA 1SE7A 1HG5A 2Q9QB 4CI2B 3RHWA 1KNRA 2LHRA 4BAYB 4CXYA 2V6YB 2NW8A 3ANWA 5ETWA 4DR2T 2C5IT 3C98B 4WW0A 4I4TE 2W2UA 4JI3T 2IMLA 1IZNB 4XAXB 3UFEA 2E9XB 4AKHA 4A98A 1BR1A 4O8SA 1KNPA 4JBWF 2RPAA 3HKDE 4QXHB 4YHJA 3GN5B 2XM2A 3PUGA 2LOSA 4WNKA 1DU2A 5JDHA 1HNZT 4EOZB 2LM9A 2E9XD 1UURA 5HCMA 3U78A 4DO0A 3EDUA 2K3WA 2WDVA 3I0OA 4IL9A 5EK4A 3RPUA 3E22E 3K3NA 4ILUA 5H6RB 4DR5T 2X51A 4ZZBA 2B1EA 2KT9A 2V7KA 2WSSV 3KBTA 4EAHA 3PJAA 3PUSA 4O2AE 4EIWA 3PURA 1WYBA 3EAMA 4UIGA 5L3CB 1T8BA 2XPKA 3C50A 3N5LA 1YQ3A 2XAJB 1L0VA 3ZC1A 5JR9C 3AXJB 5CA1E 2XHEB 2YINA 3ETUA 4A56A 5L3GB 2H89A 1OXZA 1IBKT 2J47A 2J4GA 4NUVA 4PK4A 4AQGA 5JQGE 3R6NA 4DR3T 2BG9B 2UXBT 2D9DA 5CGMA 4LF8T 5LMUT 5LHIB 4JI8T 2W4XA 2LSIA 2M67A 3PU8A 4CN4A 4E7SA 1XMQT 2V7JA 1US7B 2V6XA 2XAFB 4PAGA 3AEDA 2QVAA 2WZHA 3PUYF 4UF0B 4HE8A 4DMWA 4DV3T 3CVRA 4P1NA 5C8YE 5LCYA 3RIUA 3VR8A 4ILCA 2IIUA 2OV9A 5EK3A 3RRCA 3K3QC 3NKZA 2LT3A 2XSAA 4I0UA 4HFEA 4IL4A 5JDGA 5HCJA 2H3RA 4CI1B 3UULA 3I9YA 2IC9A 2X9WA 4WBOA 3BK9A 4A97A 3RLFF 4YTNA 2V8SV 5LJNA 2W63A 4OYKA 5JR9A 4DR4T 4TWHA 4IDNA 3ZYMA 4H9SE 2Z6EA 5DJQC 3UU6A 1V9DA 3GN5A 2BVLA 3LJCA 3CQCB 2V7LA 4QXCB 5A1LA 5FMNA 2QRXA 4DR6T 3VKHA 2LM2A 3EABA 4LF6T 2QA7A 4V1Av 1VCTA 3CX6B 5HWYA 2X0HA 3QC9A 4O4LE 2EHOB 3FZKB 4N78D 2ZM2A 2OA5A 4Z90A 2E5VA 4I50E 4ILBA 2LHNA 4LF7T 2LOPA 3ONJA 3AEAA 1HNWT 2ACXA 1HS7A 5LYJE 3M65A 2V7MA 4ILAA 4IDQA 4P09A 1E1HB 3Q2MA 4OK0A 4CN6A 4DR7T 5ABHA 3ZMSB 2Y8DA 2NTYA 4UXNB 4AKRB 5JDMA 3UU4A 4AKLA 3Q5EA 4P0BA 4X64T 4B3ST 3C51A 2CHNA 5L3BB 2VASA 3RKGA 3VRBA 3WAKA 2WP9A 3O1HA 5LG3A 5TAOA 2FJAA 3L09A 2JMKA 2PBIA 2Q9QD 3QB5A 3HKCE 5AQLB 3V5SA 3AE7A 3UUXB 4C91A 5JR9B 5L47A 2KNDA 5CA0E 2I6HA 3NZPA 3C64A 4BJMA 3N9MA 5H6QB 1QLBA 4DV6T 2YOEA 1XWMA 2VL8A 3FXEB 3OVUA 4QX8B 5J2TE 3J7Yq 2VURA 4JV5T 2BBJA 3AVRA 2MOZA 1OEDC 2LE8A 1WR6A 2MPKA 3P4RA 4IE7A 2D2SA 2X9HA 2ODVA 3PUVF 3ZYKA 4LMJA 4OFZA 4HFBA 4E7ZA 3RQWA 5AQMB 1MNEA 3T8OA 1MIVA 2C0SA 3OKQA 4MLKA 4QH5A 4UF0A 3TLTA 3ZMTB 4HWFA 3HR0A 1MNDA 5L3DB 5IHYA 2XQ3A 3F31A 3RYFE 3AE4A 3DJBA 5LJMA 5AQFB 1D0YA 1N36T 5AQHB 5JVDE 3P4PA 5AQJB 5LMNT 3ZEFB 2KXPB 3ZC0A 1X9BA 5M4YA 2AXDS 4PJNA 3ESLA 5FXVA 3RYIE 4EGWA 3NRYA 2QYWA 1MMDA 2AE9A 3PJAJ 2BKPA 2XQAA 4KMCA 2Y48B 3AE8A 5LOVE 3VRAA 4YFSA 1MMNA 1CUNA 5ABEA 5LG4A 1W0AA 3ZCJA 3WAJA 4ZS3A 3HI2A 4H63H 4ISTA 4OYJA 3UU3A 4BJNA 4PNIA 2XM1A 5LHGB 3P4SA 1UX5A 2CWOA 2DWGA 3TLUA 1QUUA 1MIWA 5FY7A 3RIUC 3UFGA 3O4XE 5HYAA 2V6YA 2ZM6T 3UQ4A 1ZOYA 4G63A 3IA3A 2M6IA 4LFBT 3RQUA 4NXMT 2UXDT 3LK42 3KBUA 4DBQA 3PUZF 4O2BE 3SFDA 3CIRA 2MTQA 5JDLA 2X68A 2M6BA 5IUXA 5JTGA 4EEDA 2VL0A 4ZI2C 1BR0A 5AQVB 4EB6E 1HFAA 4M1PA 4HGAA 5AQKB 3ZLIA 3B13A 3LFMA 4TN7B 1D1AA 1YKHB 1YQ4A 1MIYA 2PFVA 4AISA 1WYCA 3AEGA 2E2AA 1KFYA 3JC6C 4JI5T 1IJ5A 3RGLA 4JI6T 2WDQA 4X1IE 3AA1B 3LDQB 5AQIB 3BQIA 3JAEA 2X0YA 4PFOA 5F3JA 4DV7T 4MALA 3I1AA 4H9OC 2V1DB 2KZ7B 4JEHB 2CWYA 2XASB 3F57A 3HL6A 4AIUA 3ZT7A 1T98A 1UK5A 1LKXA 3DTOA 3QUJA 4DV5T 4CN1A 1I6ZA 2XAGB 4U2YA 2D0TA 2ODUA 4PK6A 2YU2A 4O4JE 5HXEA 3I0QA 2X9YA 4AKIA 2JQ9A 2JQHA 3FBLA 1QSDA 4FJOA 4H9PC 4Q25A 4TV9E 5FXXA 5LBMA 2VVSA 4ZZCA 1E2AA 5HXSA 3AVSA 3AAIA 2WMOA 2L9QA 3AECA 1OEDE 3FZFB 4HFHA 4YLHA 1YD8G 2VKHA 1GQEA 1Z0PA 4I43B 4ZI3C 5KX5E 4TUYE 1IJ6A 2K5BB 1M7KA 4P0AA 3NVOA 2EHOD 4IHJE 4JI2T 3RKOA 4ASKA 4MFRA 4U72A 2B76A 5LBQB 2YDSA 2CE7A 2ZLYA 5DABA 4YY3T 3RF1A 1NENA 3N2OA 4TZ4C 2CBIA 3MKDA 1YW0A 2A9UA 1SHZC 4MHCA 3ZN0B 3FB2A 2KLQA 1NAFA 3GWHA 2DHRA 4QX7B 3SOLA 1E7PA 5LNKA 4HWHA 4X5TA 5CB4E 4K0KT 4GIWA 3RYHE 3FXDB 3CX8B 2CXDA 4HFDA 3RX6A
chains in the Genus database with same CATH topology
4B3ST 5IWAT 4JI1T 4OX9T 1FJGT 4JI3T 4DR1T 4DUYT 4DUZT 4DV6T 4JV5T 3T1HT 4DV0T 4DV4T 4KHPT 4YHHT 2E5LT 2UUBT 1N36T 5LMNT 4DR2T 4B3RT 2F4VT 4DV1T 1N32T 4LF5T 4JYAT 1HNZT 1HR0T 4DR5T 4LF9T 4X65T 1I94T 4X66T 4LFAT 2ZM6T 1J5ET 4LFBT 4NXMT 1IBKT 1XNQT 2UXDT 4JI4T 4JI7T 1IBLT 4DR3T 2UXBT 5LMUT 4LF8T 4JI0T 4JI8T 4LF4T 4AQYT 1XMQT 1XNRT 4GKKT 1XMOT 4DV3T 2HHHT 2VQFT 4JI5T 2UU9T 2UUAT 4JI6T 4GKJT 4DV7T 4DR4T 4DV5T 4DR6T 3T1YT 4LF6T 4DV2T 4NXNT 4X62T 5BR8T 2UXCT 2VQET 4JI2T 2UUCT 4YY3T 1HNXT 4LFCT 1N33T 4LF7T 3OTOT 1HNWT 1N34T 4B3MT 1IBMT 4DR7T 4K0KT 4B3TT 4X64T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S T;  5IWA T;  4JI1 T;  4OX9 T;  1FJG T;  4JI3 T;  4DR1 T;  4DUY T;  4DUZ T;  4DV6 T;  4JV5 T;  3T1H T;  4DV0 T;  4DV4 T;  4KHP T;  4YHH T;  2E5L T;  2UUB T;  1N36 T;  5LMN T;  4DR2 T;  4B3R T;  2F4V T;  4DV1 T;  1N32 T;  4LF5 T;  4JYA T;  1HNZ T;  1HR0 T;  4DR5 T;  4LF9 T;  4X65 T;  1I94 T;  4X66 T;  4LFA T;  2ZM6 T;  1J5E T;  4LFB T;  4NXM T;  1IBK T;  1XNQ T;  2UXD T;  4JI4 T;  4JI7 T;  1IBL T;  4DR3 T;  2UXB T;  5LMU T;  4LF8 T;  4JI0 T;  4JI8 T;  4LF4 T;  4AQY T;  1XMQ T;  1XNR T;  4GKK T;  1XMO T;  4DV3 T;  2HHH T;  2VQF T;  4JI5 T;  2UU9 T;  2UUA T;  4JI6 T;  4GKJ T;  4DV7 T;  4DR4 T;  4DV5 T;  4DR6 T;  3T1Y T;  4LF6 T;  4DV2 T;  4NXN T;  4X62 T;  5BR8 T;  2UXC T;  2VQE T;  4JI2 T;  2UUC T;  4YY3 T;  1HNX T;  4LFC T;  1N33 T;  4LF7 T;  3OTO T;  1HNW T;  1N34 T;  4B3M T;  1IBM T;  4DR7 T;  4K0K T;  4B3T T;  4X64 T; 
#chains in the Genus database with same CATH topology
 1MMG A;  2ACZ A;  3JAF A;  5IWA T;  3TLS A;  4JI1 T;  5HXC A;  2IW5 B;  3O1I A;  3F2E A;  4HWI B;  1FJG T;  5LGN B;  5AQU B;  2N9D A;  2X66 A;  4UEL A;  2JQQ A;  2NW7 A;  3O1J A;  5E0O A;  4CXW A;  3JC6 D;  4DVD A;  2BKO A;  5AQR B;  2NW9 A;  4DR1 T;  4QWN B;  3AE9 A;  2ZM0 A;  3RIF A;  2E8I A;  3W15 B;  4AQF A;  5HXH A;  2YDR A;  2BG9 E;  4AQF C;  4HFC A;  4HKA A;  4LMK A;  2YK0 A;  2R6G F;  4JEU B;  2WS3 A;  2JJ9 A;  3SRZ A;  3CKD A;  3UUB A;  1OED A;  3DP7 A;  4IIJ E;  2LSJ A;  5FYM A;  4DV0 T;  3ETV A;  2UXN B;  3AA6 B;  1O3X A;  2WU5 A;  2LSK A;  1YKE B;  3N9O A;  3NBX X;  3KFW X;  2WAU A;  4KHZ F;  1D0X A;  1HX1 B;  3KVB A;  4U33 A;  5HAX A;  3ZCI A;  2ZM8 A;  3R84 B;  5ABF B;  4YHH T;  3ZJ1 A;  5FKY A;  1G8X A;  4GK5 E;  2PTF A;  4UR9 A;  3RIA A;  4H9Q C;  3MZK B;  2NOX A;  4EYU A;  2BS3 A;  4QHO A;  3PUQ A;  3AEF A;  4X1Y E;  4Z8X A;  2I59 A;  4TWF A;  4B3R T;  4H9R C;  3PUW F;  3N9N A;  3PV0 F;  3WI3 A;  4DV1 T;  3PUX F;  2KWI B;  2PG8 A;  5LP6 E;  4EEB A;  2BBH A;  4EV6 A;  5C2T A;  2CA5 A;  3EUH A;  1IBM T;  4LF5 T;  1OED B;  4JYA T;  3UU8 A;  2X0L B;  3AA0 B;  3IEE A;  2JIW A;  3GA8 A;  3KVA A;  3N9P A;  4HEA A;  1T7S A;  4J2C A;  4KUM B;  4LML A;  4TNW A;  4GOU A;  5HEG A;  2MBG A;  4A5X A;  1HR0 T;  1D1B A;  1NEK A;  2KIN B;  4TX5 A;  4U7Y A;  4X65 T;  1R8I A;  4ZEY A;  3HKE E;  1M62 A;  2EHO A;  4EYY R;  4X66 T;  4IT4 A;  1UUS A;  1AJ3 A;  2DL1 A;  1G73 A;  3BQL A;  3NZQ A;  5AQN B;  5BMV E;  4X20 E;  4U3C A;  1XDP A;  2WCA A;  2K9A A;  3RC3 A;  1XNQ T;  3FZL B;  2CRB A;  4GYR A;  1IBL T;  2NWB A;  3K1S A;  3UU5 A;  4H63 V;  2YN6 A;  3ZKR A;  4WBN E;  4JI0 T;  2NP9 A;  2V7I A;  3K3O A;  3CWZ B;  2WQY A;  4QXB B;  1KF6 A;  3UTK A;  5J0Z A;  4LF4 T;  2LSY A;  4AQY T;  2CHO A;  1VCS A;  3EI0 A;  3AE2 A;  1XNR T;  2XTL A;  2XSB A;  4CQI A;  4IE0 A;  2JQK A;  4YSZ A;  1XMO T;  4GKK T;  5DQW A;  2LRL A;  2VKD A;  4WZX A;  2UXX B;  3L39 A;  4HN9 A;  3L3P A;  4ERR A;  2A72 A;  2VQF T;  2UU9 T;  3GMI A;  3PE0 A;  1CHU A;  1FMV A;  1ZEE A;  2Q9Q C;  2GK9 A;  4NPP A;  5LB7 B;  1KEY A;  1ZP0 A;  4IDO A;  3HA4 A;  4XZC A;  3H3A A;  4ZI7 E;  5FP3 A;  1Z8U A;  2XY8 B;  5CFB A;  2VKO A;  4QH4 A;  4EXT A;  3KV5 A;  2DLR A;  4ZS2 A;  3QNU A;  2ZMA A;  3O9X A;  2WMN A;  4Z91 A;  1WR0 A;  3AEE A;  3T1Y T;  4JUY A;  4B6X A;  4COF A;  2N1G A;  1BR2 A;  3AXJ A;  2LKG A;  2XQ8 A;  3PTR B;  4YXD A;  4X62 T;  5BR8 T;  2UXC T;  2L8K A;  1LVF A;  3CK6 A;  4ZI3 D;  2J1D G;  2LRK A;  2BG9 A;  2W00 A;  2X9X A;  3C4Z A;  4ISS A;  4L5G A;  1KNZ A;  4H9N C;  3ZT6 A;  5HWX A;  1KK7 A;  4NUU A;  3AE5 A;  1XZY A;  3AAA B;  3FHN A;  5FVL A;  2UUC T;  3MK7 C;  4XBF B;  1S35 A;  5AQO B;  5L4H A;  1N33 T;  4DND A;  4HFI A;  3Q5W A;  3OTO T;  2BG9 C;  2XQ6 A;  1WLX A;  2C5J A;  1MMA A;  3CPZ A;  1WRD A;  2P9B A;  3UUN A;  4YJ3 E;  4I55 E;  5FY1 A;  2FBW A;  3CX7 B;  1HX8 A;  3KDS E;  3KIN B;  3JCF A;  2XAH B;  4QKN A;  5FNV E;  1JNZ A;  3KV6 A;  5FXW A;  4B3T T;  2IDO B;  1HG2 A;  5EK2 A;  1UCU A;  2IC6 A;  2W62 A;  3FZM B;  4IDP A;  2JMH A;  2WWV A;  2BZB A;  2YEV C;  2CBJ A;  1YXR A;  4F8H A;  4YTP A;  5C3J A;  5L2L A;  3MAC A;  1VOM A;  3Q9D A;  4DID B;  3E0Z A;  4PJL A;  2X67 A;  4AKG A;  1U5P A;  2XQ5 A;  4DUZ T;  4HTE A;  3H3M A;  3QOF A;  4WYV A;  2FUP A;  1W0B A;  3KV4 A;  4L0R A;  3ZMV B;  5KMG P;  2BS2 A;  5KDM C;  3LG7 A;  3AEB A;  4PFP A;  4U7I A;  2I0M A;  3TLV A;  1BR4 A;  2VB6 A;  3AAE B;  2CEA A;  2HN1 A;  3TKL B;  3ZT5 A;  4PW8 A;  2DI4 A;  3LBX A;  2XQ4 A;  4HFV A;  1H7C A;  2CM0 A;  4KHP T;  2WBL A;  5AQS B;  2CXL A;  4IE4 A;  4MBQ A;  1JNR A;  2D0U A;  2WWU A;  2WM9 A;  3C4X A;  4IE6 A;  3TLW A;  4KP3 C;  3ZMU B;  3VKG A;  1Y64 B;  3AE3 A;  4GK0 E;  4ZHQ E;  2CMR A;  2NR4 A;  4L9I A;  3UT5 E;  4PJJ A;  3V5U A;  2A3D A;  2DNX A;  2XQ7 A;  1FMW A;  2FJD A;  4ZOL E;  3BQK A;  5HEH A;  3RYC E;  2F4V T;  3KV9 A;  3ANW B;  4O4H E;  1Y01 A;  5LA6 E;  3QK6 A;  3P4Q A;  1HF8 A;  4AI6 A;  1N32 T;  3OBV E;  4PK5 A;  2E9X C;  5AQG B;  5IYZ E;  4ZI2 D;  1XDO A;  5F8P A;  3K8P C;  5DQV A;  3UUM A;  2XUE A;  2BDE A;  3ZYL A;  4CXX A;  4UVA B;  1ZKE A;  2CXF A;  2ES0 A;  2N2N A;  4YJ2 E;  1EZ3 A;  2V26 A;  4IDZ A;  5JDQ A;  2PJQ A;  2H7O A;  3A7M A;  4HWC A;  1LRZ A;  4K0U A;  5FL0 A;  4LF9 T;  3OYZ A;  3QB5 K;  5FVK A;  5JRE A;  2RA1 A;  3P7I A;  2V5C A;  2JRK A;  2SPC A;  1I94 T;  3RC8 A;  2CLY B;  3CQX C;  2V5D A;  3I9W A;  2K48 A;  3IF8 B;  4UV9 B;  4LFA T;  1J5E T;  3S4U A;  1ZV4 X;  1J5W A;  4JI4 T;  4JI7 T;  1WFD A;  2IHR 1;  3ZPO A;  1OWA A;  4EZ4 A;  3JAD A;  2WY2 A;  2LJL A;  3LBX B;  5FL1 A;  2VWA A;  4YTM A;  2XQ9 A;  2CCQ A;  3L8R A;  4IE5 A;  5L3F B;  5JRC A;  5AQQ B;  4U2Z A;  5JH7 E;  1LVK A;  2KWH A;  5CJ5 A;  2XAQ B;  2L3L A;  3J9X 1;  3A8Y C;  3U3I A;  3ZJ2 A;  5ABF A;  5LHH B;  2YDQ A;  3AE6 A;  4U74 A;  2HH7 A;  5HEU A;  3Q5D A;  4ANJ A;  4YSX A;  1HTJ F;  1B7T A;  3B57 A;  3HKB E;  2W66 A;  2HHH T;  4QH1 A;  2VK9 A;  2HN2 A;  2W61 A;  3MJX A;  2EHO C;  2A2F X;  3OPC A;  5AQP B;  3X1D A;  2BKN A;  2XZE A;  5L3E B;  1HCI A;  2UUA T;  4GKJ T;  2WZI A;  2DWK A;  3G06 A;  2FJB A;  4KI0 F;  4ZXL A;  3CQG B;  3C4W A;  1J1J A;  2K24 A;  1UX4 A;  3P4W A;  1NWM X;  4TV8 E;  2LKH A;  2LEH A;  1D1C A;  4X1K E;  4F6R C;  3A5X A;  3D0T A;  3P50 A;  2Y6X A;  2NTX A;  4FI5 A;  2OLT A;  3FBZ A;  3B5M A;  4DBR A;  1FEW A;  5HEJ A;  5L4E A;  1SUM B;  2BS4 A;  3VU7 H;  3FZH B;  3N2K E;  4KX6 A;  3ZMZ B;  2WDR A;  5J1G A;  3SS1 A;  3EVY A;  4U31 A;  5LGU B;  2D5U A;  1X79 A;  4DV2 T;  3CML A;  4DMV A;  4NXN T;  5JDF A;  1ZHC A;  3EDV A;  4UVC B;  1SA0 E;  2C5K T;  4BA9 A;  1T72 A;  2IAK A;  2XJ7 A;  3N9L A;  4AXP A;  4B3M T;  2VQE T;  4EZH A;  3OYX A;  4YSY A;  5J2U E;  3OJA A;  2IUB A;  3EHZ A;  2HPL A;  2HPJ A;  5GON E;  3MXZ A;  2QGS A;  3LK3 B;  3LSV A;  3IBP A;  2DCF A;  2MYS A;  3VHL A;  2LLY A;  5HXR A;  5ADX L;  1HNX T;  1D0Z A;  4LFC T;  2JPF A;  1FIO A;  2YU1 A;  5FY0 A;  4ADZ A;  1S94 A;  2J62 A;  4TWD A;  5ABG A;  3AA7 B;  3AE1 A;  4YT0 A;  1N34 T;  3NRX A;  2YKS A;  1U4Q A;  3ONL C;  1IAP A;  1VRB A;  2CPT A;  2G0U A;  3ABV A;  2E9X A;  3P8C D;  4HWD A;  4TNV A;  2LSG A;  4JLE A;  4NIQ A;  3RI5 A;  2W67 A;  4UV8 B;  3ONX A;  4PJM A;  5EZY E;  3SWH A;  2BVM A;  3MA9 A;  3H37 A;  3PUA A;  2MAW A;  3E08 A;  4IRE A;  4UVB B;  5HEO A;  3ZN1 B;  4OX9 T;  2Q9Q A;  2KSR A;  5LGT B;  2CLY C;  2VVN A;  2XQY A;  1W9R A;  4KBM B;  4C90 A;  1UGO A;  3AB3 B;  4CI3 B;  5AFU L;  3UQ7 A;  4UEM A;  4CZZ B;  4DUY T;  5AQT B;  2KMF A;  5JDN A;  2WU2 A;  3SFE A;  3ZSS A;  4OHF A;  3PU3 A;  5JRC B;  4GYS A;  3M3Z B;  3Q5X A;  3NWI A;  5FXZ A;  5F5W A;  5LXT E;  4IGU A;  3N2G E;  3T1H T;  3N9Q A;  1WCR A;  3PDY A;  2H88 A;  3ZST A;  2H7V C;  2WB5 A;  4G2A A;  4O4I E;  1W09 A;  3RH3 A;  3LK2 B;  3RRW A;  3VR9 A;  4DV4 T;  3IHR A;  2RP4 A;  2VKJ A;  2W0G A;  5KXJ A;  2E5L T;  2UUB T;  2FJE A;  1SE7 A;  1HG5 A;  2Q9Q B;  4CI2 B;  3RHW A;  1KNR A;  2LHR A;  4BAY B;  4CXY A;  2V6Y B;  2NW8 A;  3ANW A;  5ETW A;  4DR2 T;  2C5I T;  3C98 B;  4WW0 A;  4I4T E;  2W2U A;  4JI3 T;  2IML A;  1IZN B;  4XAX B;  3UFE A;  2E9X B;  4AKH A;  4A98 A;  1BR1 A;  4O8S A;  1KNP A;  4JBW F;  2RPA A;  3HKD E;  4QXH B;  4YHJ A;  3GN5 B;  2XM2 A;  3PUG A;  2LOS A;  4WNK A;  1DU2 A;  5JDH A;  1HNZ T;  4EOZ B;  2LM9 A;  2E9X D;  1UUR A;  5HCM A;  3U78 A;  4DO0 A;  3EDU A;  2K3W A;  2WDV A;  3I0O A;  4IL9 A;  5EK4 A;  3RPU A;  3E22 E;  3K3N A;  4ILU A;  5H6R B;  4DR5 T;  2X51 A;  4ZZB A;  2B1E A;  2KT9 A;  2V7K A;  2WSS V;  3KBT A;  4EAH A;  3PJA A;  3PUS A;  4O2A E;  4EIW A;  3PUR A;  1WYB A;  3EAM A;  4UIG A;  5L3C B;  1T8B A;  2XPK A;  3C50 A;  3N5L A;  1YQ3 A;  2XAJ B;  1L0V A;  3ZC1 A;  5JR9 C;  3AXJ B;  5CA1 E;  2XHE B;  2YIN A;  3ETU A;  4A56 A;  5L3G B;  2H89 A;  1OXZ A;  1IBK T;  2J47 A;  2J4G A;  4NUV A;  4PK4 A;  4AQG A;  5JQG E;  3R6N A;  4DR3 T;  2BG9 B;  2UXB T;  2D9D A;  5CGM A;  4LF8 T;  5LMU T;  5LHI B;  4JI8 T;  2W4X A;  2LSI A;  2M67 A;  3PU8 A;  4CN4 A;  4E7S A;  1XMQ T;  2V7J A;  1US7 B;  2V6X A;  2XAF B;  4PAG A;  3AED A;  2QVA A;  2WZH A;  3PUY F;  4UF0 B;  4HE8 A;  4DMW A;  4DV3 T;  3CVR A;  4P1N A;  5C8Y E;  5LCY A;  3RIU A;  3VR8 A;  4ILC A;  2IIU A;  2OV9 A;  5EK3 A;  3RRC A;  3K3Q C;  3NKZ A;  2LT3 A;  2XSA A;  4I0U A;  4HFE A;  4IL4 A;  5JDG A;  5HCJ A;  2H3R A;  4CI1 B;  3UUL A;  3I9Y A;  2IC9 A;  2X9W A;  4WBO A;  3BK9 A;  4A97 A;  3RLF F;  4YTN A;  2V8S V;  5LJN A;  2W63 A;  4OYK A;  5JR9 A;  4DR4 T;  4TWH A;  4IDN A;  3ZYM A;  4H9S E;  2Z6E A;  5DJQ C;  3UU6 A;  1V9D A;  3GN5 A;  2BVL A;  3LJC A;  3CQC B;  2V7L A;  4QXC B;  5A1L A;  5FMN A;  2QRX A;  4DR6 T;  3VKH A;  2LM2 A;  3EAB A;  4LF6 T;  2QA7 A;  4V1A v;  1VCT A;  3CX6 B;  5HWY A;  2X0H A;  3QC9 A;  4O4L E;  2EHO B;  3FZK B;  4N78 D;  2ZM2 A;  2OA5 A;  4Z90 A;  2E5V A;  4I50 E;  4ILB A;  2LHN A;  4LF7 T;  2LOP A;  3ONJ A;  3AEA A;  1HNW T;  2ACX A;  1HS7 A;  5LYJ E;  3M65 A;  2V7M A;  4ILA A;  4IDQ A;  4P09 A;  1E1H B;  3Q2M A;  4OK0 A;  4CN6 A;  4DR7 T;  5ABH A;  3ZMS B;  2Y8D A;  2NTY A;  4UXN B;  4AKR B;  5JDM A;  3UU4 A;  4AKL A;  3Q5E A;  4P0B A;  4X64 T;  4B3S T;  3C51 A;  2CHN A;  5L3B B;  2VAS A;  3RKG A;  3VRB A;  3WAK A;  2WP9 A;  3O1H A;  5LG3 A;  5TAO A;  2FJA A;  3L09 A;  2JMK A;  2PBI A;  2Q9Q D;  3QB5 A;  3HKC E;  5AQL B;  3V5S A;  3AE7 A;  3UUX B;  4C91 A;  5JR9 B;  5L47 A;  2KND A;  5CA0 E;  2I6H A;  3NZP A;  3C64 A;  4BJM A;  3N9M A;  5H6Q B;  1QLB A;  4DV6 T;  2YOE A;  1XWM A;  2VL8 A;  3FXE B;  3OVU A;  4QX8 B;  5J2T E;  3J7Y q;  2VUR A;  4JV5 T;  2BBJ A;  3AVR A;  2MOZ A;  1OED C;  2LE8 A;  1WR6 A;  2MPK A;  3P4R A;  4IE7 A;  2D2S A;  2X9H A;  2ODV A;  3PUV F;  3ZYK A;  4LMJ A;  4OFZ A;  4HFB A;  4E7Z A;  3RQW A;  5AQM B;  1MNE A;  3T8O A;  1MIV A;  2C0S A;  3OKQ A;  4MLK A;  4QH5 A;  4UF0 A;  3TLT A;  3ZMT B;  4HWF A;  3HR0 A;  1MND A;  5L3D B;  5IHY A;  2XQ3 A;  3F31 A;  3RYF E;  3AE4 A;  3DJB A;  5LJM A;  5AQF B;  1D0Y A;  1N36 T;  5AQH B;  5JVD E;  3P4P A;  5AQJ B;  5LMN T;  3ZEF B;  2KXP B;  3ZC0 A;  1X9B A;  5M4Y A;  2AXD S;  4PJN A;  3ESL A;  5FXV A;  3RYI E;  4EGW A;  3NRY A;  2QYW A;  1MMD A;  2AE9 A;  3PJA J;  2BKP A;  2XQA A;  4KMC A;  2Y48 B;  3AE8 A;  5LOV E;  3VRA A;  4YFS A;  1MMN A;  1CUN A;  5ABE A;  5LG4 A;  1W0A A;  3ZCJ A;  3WAJ A;  4ZS3 A;  3HI2 A;  4H63 H;  4IST A;  4OYJ A;  3UU3 A;  4BJN A;  4PNI A;  2XM1 A;  5LHG B;  3P4S A;  1UX5 A;  2CWO A;  2DWG A;  3TLU A;  1QUU A;  1MIW A;  5FY7 A;  3RIU C;  3UFG A;  3O4X E;  5HYA A;  2V6Y A;  2ZM6 T;  3UQ4 A;  1ZOY A;  4G63 A;  3IA3 A;  2M6I A;  4LFB T;  3RQU A;  4NXM T;  2UXD T;  3LK4 2;  3KBU A;  4DBQ A;  3PUZ F;  4O2B E;  3SFD A;  3CIR A;  2MTQ A;  5JDL A;  2X68 A;  2M6B A;  5IUX A;  5JTG A;  4EED A;  2VL0 A;  4ZI2 C;  1BR0 A;  5AQV B;  4EB6 E;  1HFA A;  4M1P A;  4HGA A;  5AQK B;  3ZLI A;  3B13 A;  3LFM A;  4TN7 B;  1D1A A;  1YKH B;  1YQ4 A;  1MIY A;  2PFV A;  4AIS A;  1WYC A;  3AEG A;  2E2A A;  1KFY A;  3JC6 C;  4JI5 T;  1IJ5 A;  3RGL A;  4JI6 T;  2WDQ A;  4X1I E;  3AA1 B;  3LDQ B;  5AQI B;  3BQI A;  3JAE A;  2X0Y A;  4PFO A;  5F3J A;  4DV7 T;  4MAL A;  3I1A A;  4H9O C;  2V1D B;  2KZ7 B;  4JEH B;  2CWY A;  2XAS B;  3F57 A;  3HL6 A;  4AIU A;  3ZT7 A;  1T98 A;  1UK5 A;  1LKX A;  3DTO A;  3QUJ A;  4DV5 T;  4CN1 A;  1I6Z A;  2XAG B;  4U2Y A;  2D0T A;  2ODU A;  4PK6 A;  2YU2 A;  4O4J E;  5HXE A;  3I0Q A;  2X9Y A;  4AKI A;  2JQ9 A;  2JQH A;  3FBL A;  1QSD A;  4FJO A;  4H9P C;  4Q25 A;  4TV9 E;  5FXX A;  5LBM A;  2VVS A;  4ZZC A;  1E2A A;  5HXS A;  3AVS A;  3AAI A;  2WMO A;  2L9Q A;  3AEC A;  1OED E;  3FZF B;  4HFH A;  4YLH A;  1YD8 G;  2VKH A;  1GQE A;  1Z0P A;  4I43 B;  4ZI3 C;  5KX5 E;  4TUY E;  1IJ6 A;  2K5B B;  1M7K A;  4P0A A;  3NVO A;  2EHO D;  4IHJ E;  4JI2 T;  3RKO A;  4ASK A;  4MFR A;  4U72 A;  2B76 A;  5LBQ B;  2YDS A;  2CE7 A;  2ZLY A;  5DAB A;  4YY3 T;  3RF1 A;  1NEN A;  3N2O A;  4TZ4 C;  2CBI A;  3MKD A;  1YW0 A;  2A9U A;  1SHZ C;  4MHC A;  3ZN0 B;  3FB2 A;  2KLQ A;  1NAF A;  3GWH A;  2DHR A;  4QX7 B;  3SOL A;  1E7P A;  5LNK A;  4HWH A;  4X5T A;  5CB4 E;  4K0K T;  4GIW A;  3RYH E;  3FXD B;  3CX8 B;  2CXD A;  4HFD A;  3RX6 A; 
#chains in the Genus database with same CATH homology
 4B3S T;  5IWA T;  4JI1 T;  4OX9 T;  1FJG T;  4JI3 T;  4DR1 T;  4DUY T;  4DUZ T;  4DV6 T;  4JV5 T;  3T1H T;  4DV0 T;  4DV4 T;  4KHP T;  4YHH T;  2E5L T;  2UUB T;  1N36 T;  5LMN T;  4DR2 T;  4B3R T;  2F4V T;  4DV1 T;  1N32 T;  4LF5 T;  4JYA T;  1HNZ T;  1HR0 T;  4DR5 T;  4LF9 T;  4X65 T;  1I94 T;  4X66 T;  4LFA T;  2ZM6 T;  1J5E T;  4LFB T;  4NXM T;  1IBK T;  1XNQ T;  2UXD T;  4JI4 T;  4JI7 T;  1IBL T;  4DR3 T;  2UXB T;  5LMU T;  4LF8 T;  4JI0 T;  4JI8 T;  4LF4 T;  4AQY T;  1XMQ T;  1XNR T;  4GKK T;  1XMO T;  4DV3 T;  2HHH T;  2VQF T;  4JI5 T;  2UU9 T;  2UUA T;  4JI6 T;  4GKJ T;  4DV7 T;  4DR4 T;  4DV5 T;  4DR6 T;  3T1Y T;  4LF6 T;  4DV2 T;  4NXN T;  4X62 T;  5BR8 T;  2UXC T;  2VQE T;  4JI2 T;  2UUC T;  4YY3 T;  1HNX T;  4LFC T;  1N33 T;  4LF7 T;  3OTO T;  1HNW T;  1N34 T;  4B3M T;  1IBM T;  4DR7 T;  4K0K T;  4B3T T;  4X64 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...