2UUCI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucI00
4FWGA 4B3RI 1Z59A 4JYAE 3JAMC 4HYMA 3J80C 4DUZI 4KHPI 1HNZE 4DV7E 3J7AM 3LTOA 4DR3I 1FKAE 4DV4E 2F4VE 5FLXC 2GS8A 1RREA 2Q2EB 2E5LE 3WU6A 2UXCI 1N36I 1Z0VA 2UXBE 4JV5I 4B3ME 3JAMQ 1DARA 2HKEA 1ZM3A 1H73A 2J7KA 4DR4E 2UUBI 3ZKBA 4DU8A 5FLXQ 2VQEI 3T1YI 2BM1A 1Z0TA 2DEJA 2HKJA 4DV6E 4GKJE 4X65I 3ZM7A 4DR6I 4LF8E 4DR1E 1HNWI 4JI5I 4JI3I 4P7AA 4AQYE 4LFBI 4JI4E 1HNZI 4HXZA 2HFSA 4WUDA 1XNQE 4KQVA 4NXME 4JI0I 4FWDA 3V2UC 2VF3A 4DV5E 3PYGA 2A2CA 2UXBI 4HACB 4B3RE 2OI2A 1XMOI 1OJ4A 4Z7YA 4DUZE 4KHPE 4DR3E 4DR4I 1QZRA 4B3SI 3LNUA 2UXCE 1N36E 4JV5E 1HNXE 1RR9A 1N33I 4YHHI 1B62A 1IBKI 4DR5I 2V2QA 5IT9C 2LJPA 1H74A 3WU3A 4PRVA 4USMA 2UUBE 1ZXNA 2BV3A 1WUUA 1J5EI 1KKHA 4NXNI 1NHHA 3ZZUA 4JI8I 3T1YE 3QT5A 4DU7A 1Z0GA 4X65E 4DR6E 4DV5I 1Z5CA 3QT7A 1HNWE 5IT9Q 4PU9A 4JI5E 5LMNI 4JI3E 3ZKDA 1H72C 2HFUA 1EA6A 4LFBE 4X66I 2VQFI 4JI0E 4LF5I 3WU5A 4LF4I 1PIEA 2UUCI 1Z0CA 1HNXI 1XMOE 2R3VA 1N0VC 4DV1I 4WUBA 4I3HA 4LF6I 4X62I 4USKA 4UTGA 3J80Q 1ZM4A 4LF9E 4LF7I 5GMEA 4B3SE 2HK3A 1IBLI 1N32I 1D6TA 1H7UA 3F0NA 3OTOI 1N33E 4YHHE 1IBKE 4DR5E 3GONA 1MX0A 4DR7I 3T1HI 1ZM9A 5A2QC 2AJ4A 2XEXA 1J5EE 1KIJA 4NXNE 1U2RA 1PKPA 1NHIA 4JI8E 2ZITA 1A6FA 3H4LA 4JI1I 2V2VA 4EMDA 5LMNE 5A2QQ 4DV2I 2UXDI 4X66E 2VQFE 4OX9I 4MYUA 4FN5A 4M1KA 1ZXMA 4LF9I 4JG4A 4LF5E 4LF4E 2UUCE 4PRXA 2V34A 2X7IA 5L3JA 1XHKA 1IBMI 3M6AA 4DV1E 3QT8A 4LF6E 4X62E 1HR0I 4DUYE 1MG7A 4LF7E 2ZM6I 1IBLE 1N32E 2NPFA 4K0KE 3OTOE 1FJGI 1FI4A 2A2DA 4DV3I 3J7AG 4DR7E 5LL6R 3T1HE 1I94I 3HULA 3D4JA 1XMQE 3LPSA 5IWAI 4JI7I 4X64I 1MU5A 4LFAE 4DR2E 4DXLA 1PVGA 3QT6A 3PYEA 3B78A 1FWKA 4URLA 1N34I 4DV0E 2DEIA 4JI1E 4FW9A 4YY3I 2UUAI 2UU9I 4DV2E 1Z0WA 1KVKA 4DPYA 2UXDE 4B3TE 4OX9E 1XNRI 4JI6I 4DUYI 3B8HA 5BR8I 1ZM2A 4P52A 2HHHI 4GKKI 4K0KI 1IBME 3ZZ0A 1Z5BA 2CZ9A 4DPTA 1HR0E 3PYDA 1XMQI 4JI2I 2V2ZA 4HACA 2ZM6E 3PYFA 4WUCA 4LFAI 4HY1A 1EI1A 2V8PA 1NZ0A 4DR2I 1FJGE 1FWLA 4XTJA 3K1JA 4DV3E 4DPXA 1I94E 3CWVA 4DV0I 1FNMA 2X36A 4LFCI 4Z7CA 5IWAE 4JI7E 3J81C 4X64E 1KTVA 1B63A 2WW4A 4JYAI 4B3TI 4DV7I 3Q1QA 4DV4I 2R42A 1N34E 2F4VI 4YY3E 2UUAE 2EFGA 1VISA 5LMUE 4DPWA 2UU9E 2E5LI 4ED4A 4B3MI 3J81Q 4FWHA 4R1FA 1H7SA 1XNRE 4JI6E 1ELOA 1K47A 5BR8E 2HHHE 4GKKE 4RPFA 3B82A 3WU4A 4MYTA 2ZBKB 4ZVIA 4DV6I 1UEKA 4GKJI 1NHJA 5GMDA 4LF8I 4UT4A 4JI2E 1Z0BA 4DR1I 1S4EA 3ZZTA 4DPUA 4AQYI 3K17A 1Z5AA 2VQEE 1N0UA 4JI4I 2BM0A 1Z0EA 2E1RA 1BKNA 1XNQI 1S16A 4NXMI 3V5RA 4LFCE 5LMUI 2HK2A
chains in the Genus database with same CATH superfamily
2JT2A 4FWGA 4B3RI 1Z59A 4JYAE 3JAMC 4HYMA 3J80C 4DUZI 4KHPI 1HNZE 4DV7E 3J7AM 3LTOA 2CG9A 4DR3I 1FKAE 4DV4E 2F4VE 3P3EA 5FLXC 2GS8A 1RREA 5C0XD 2Q2EB 2E5LE 3WU6A 5JEAC 5EKWA 2UXCI 1N36I 1Z0VA 2UXBE 5C0XC 4JV5I 4B3ME 2PNMA 5JEAF 1Y4UA 5C0XF 3JAMQ 1DARA 5DROA 2HKEA 2JEBA 1ZM3A 1H73A 2J7KA 4DR4E 3NZKA 2UUBI 2Z5BA 3ZKBA 4MQYA 4BA1A 2IESA 4DU8A 5FLXQ 4MU1A 2VQEI 3T1YI 2BM1A 1Z0TA 2DEJA 2HKJA 4DV6E 4GKJE 4X65I 5C0XA 3ZM7A 4DR6I 4LF8E 4DR1E 1HNWI 2JE6A 1Y6ZA 4JI5I 1XXEA 4JI3I 4AM3A 4P7AA 5C0XE 3P3GA 2BA1G 5DNLA 4AQYE 1YH8A 4LFBI 4JI4E 1HNZI 4HXZA 2HFSA 4WUDA 1XNQE 3K85A 4MDTA 4KQVA 4NXME 4JI0I 4FWDA 3V2UC 2VF3A 4DV5E 2BR2B 1Y5YA 3PYGA 2A2CA 4IFDD 2UXBI 2VESA 4HACB 5DRPA 4B3RE 2OI2A 5EL9A 1XMOI 4LCFA 1OJ4A 4IFDC 4Z7YA 2IOPA 4DUZE 4KHPE 4DR3E 4IFDF 4DR4I 5JEAB 1QZRA 4B3SI 3LNUA 1E3HA 2BA0D 3PS3A 2JEAA 3UHMA 2UXCE 1N36E 4JV5E 5K36D 1HNXE 1RR9A 1N33I 4YHHI 1B62A 1IBKI 2PO2B 2WNRA 4DR5I 5K36C 2V2QA 5IT9C 2LJPA 2Z5CB 1H74A 3WU3A 4PRVA 4USMA 2UUBE 5K36F 4IFDA 1ZXNA 3P3CA 3CDJA 2C38A 3HJCA 2BV3A 4GQUA 1WUUA 1J5EI 1KKHA 2NN6B 4NXNI 4IFDE 4MU0A 1NHHA 3ZZUA 4JI8I 3T1YE 3QT5A 4DU7A 1Z0GA 3P06A 4X65E 2PO1A 4DR6E 4IZJB 4DV5I 1Y60A 1Z5CA 3QT7A 1HNWE 4PU9A 5IT9Q 4JI5E 5LMNI 4JI3E 5K36A 3ZKDA 3U1KA 4ISAA 1H72C 2C39B 3Q6NA 2HFUA 3L7ZB 2GQ0A 1EA6A 3M85D 5K36E 4LFBE 4X66I 2VQFI 2PNLA 4AIMA 4JI0E 4LF5I 3WU5A 4LF4I 1PIEA 2UUCI 1Z0CA 1HNXI 2GO4A 1XMOE 4IS9A 2R3VA 1N0VC 4DV1I 3GCMA 1E3PA 4OZEA 4WUBA 4I3HA 4LF6I 4X62I 4USKA 4UTGA 3J80Q 1ZM4A 4LF9E 4LF7I 5GMEA 4B3SE 2HK3A 1IBLI 1N32I 1D6TA 1H7UA 2WP8A 3F0NA 3OTOI 1N33E 4YHHE 4AIDA 1IBKE 4U3DA 4DR5E 1YHCA 3GONA 1MX0A 4DR7I 2PNZA 3T1HI 1ZM9A 5A2QC 2AJ4A 3PS1A 2XEXA 1UDSA 1OYSA 1J5EE 2PO0A 1R6MA 4IZKB 1KIJA 3PRYA 4NXNE 1U2RA 1PKPA 4QNJA 1NHIA 4JI8E 2ZITA 1A6FA 1RHYA 3H4LA 4MU3A 4OO1D 4JI1I 2V2VA 4EMDA 5LMNE 2JEBB 4FW3A 2CVEA 5A2QQ 4DV2I 4OO1C 2Z5BB 4BA1B 1USVA 1VI7A 2UXDI 2O1UA 4X66E 3Q6MA 2VQFE 4OX9I 4MYUA 4FN5A 4BA2A 4M1KA 1ZXMA 4LF9I 2O1VA 5C0XB 4JG4A 2BA1D 4LF5E 3HKMA 4LF4E 2UUCE 4PRXA 1UDQA 2V34A 2X7IA 2JE6B 5L3JA 3M7NG 1XHKA 1IBMI 4LCHA 4OO1A 2C37A 3M6AA 4DV1E 3QT8A 5ELWA 2Z5EA 4LF6E 4X62E 1HR0I 4DUYE 4OO1E 1MG7A 4LF7E 2ZM6I 2AE8A 1IBLE 1N32E 1USUA 2NPFA 1UDOA 4K0KE 2O3ZA 3DD6A 3OTOE 4FW7A 1FJGI 1FI4A 2A2DA 2CGEA 4DV3I 3J7AG 1Y4SA 4DR7E 5LL6R 3T1HE 1I94I 3HULA 3PS2A 3D4JA 1XMQE 3LPSA 4J3DA 5IWAI 4U3BA 2O1WA 4JI7I 4X64I 1MU5A 4LFAE 4DR2E 4DXLA 1PVGA 2JEAB 3QT6A 3PYEA 3B78A 5DNXA 1FWKA 2IERA 3B4TA 4URLA 1N34I 2DEIA 4DV0E 4JI1E 4FW9A 4YY3I 2UUAI 2UU9I 4DV2E 1OYPA 1Z0WA 1KVKA 4IFDB 2J65A 2C38B 4DPYA 2UXDE 4QNKA 1P42A 4B3TE 4OX9E 1XNRI 4JI6I 4DUYI 3B8HA 5BR8I 5JEAD 1ZM2A 2PO1B 4P52A 4IZKA 2HHHI 4GKKI 5K36B 4K0KI 4LCGA 1OYRA 1IBME 1HK7A 3ZZ0A 1Z5BA 2CZ9A 4DPTA 2F1DA 2BR2A 1HR0E 3PYDA 1XMQI 4JI2I 2V2ZA 4HACA 2ZM6E 4FW5A 3PYFA 4WUCA 4LFAI 4HY1A 1EI1A 2V8PA 1NZ0A 2NN6D 4DR2I 2GO3A 1FJGE 1FWLA 2NN6C 4FW6A 4XTJA 3K1JA 3P76A 5JEAA 4DV3E 4DPXA 1I94E 2NN6F 3CWVA 3GMEA 4DV0I 4IZJD 1FNMA 2X36A 3CDIA 4LFCI 4Z7CA 5IWAE 5JEAE 5FWKA 4JI7E 3J81C 4X64E 1KTVA 1B63A 2PO2A 4OO1F 2WW4A 4JYAI 2BA0G 4B3TI 2Z5CA 4LOMA 2WP8B 3KRNA 1UDNA 4DV7I 3Q1QA 4DV4I 2R42A 1N34E 2F4VI 4YY3E 2NN6A 2UUAE 2PNZB 2EFGA 1VISA 5LMUE 4DPWA 2UU9E 2E5LI 4ED4A 4FW4A 5DRQA 4N3OA 2NN6E 4B3MI 4NBQA 3J81Q 4FWHA 2PO0B 4R1FA 1H7SA 4IZJA 1XNRE 4JI6E 1ELOA 1K47A 5BR8E 3H1CA 2C39A 3L7ZA 2HHHE 4GKKE 4RPFA 3B82A 5DRRA 3WU4A 4MYTA 2ZBKB 4ZVIA 4DV6I 1UEKA 4GKJI 3M85G 1NHJA 1R6LA 5GMDA 4LF8I 4UT4A 4JI2E 1Z0BA 4DR1I 4BA2B 3M7ND 2IOQA 1S4EA 3ZZTA 4DPUA 4MU4A 4AQYI 3K17A 1Z5AA 2VQEE 1N0UA 3U1YA 2O1TA 4JI4I 2BM0A 1Z0EA 2E1RA 4OKGA 1BKNA 1XNQI 2C37B 2WNRB 3GLLA 4OO1B 1S16A 4NXMI 3V5RA 4LFCE 5LMUI 4LPFA 2HK2A
chains in the Genus database with same CATH topology
4FWGA 4B3RI 1Z59A 4JYAE 3JAMC 4HYMA 3J80C 4DUZI 4KHPI 1HNZE 4DV7E 3J7AM 3LTOA 2CG9A 4DR3I 1FKAE 4DV4E 2F4VE 5FLXC 2GS8A 1RREA 2Q2EB 2E5LE 3WU6A 2UXCI 1N36I 1Z0VA 2UXBE 4JV5I 4B3ME 2PNMA 1Y4UA 3JAMQ 1DARA 2HKEA 1ZM3A 1H73A 2J7KA 4DR4E 2UUBI 2Z5BA 3ZKBA 4DU8A 5FLXQ 2VQEI 3T1YI 2BM1A 1Z0TA 2DEJA 2HKJA 4DV6E 4GKJE 4X65I 3ZM7A 4DR6I 4LF8E 4DR1E 1HNWI 1Y6ZA 4JI5I 4JI3I 4P7AA 4AQYE 4LFBI 4JI4E 1HNZI 4HXZA 2HFSA 4WUDA 1XNQE 3K85A 4KQVA 4NXME 4JI0I 4FWDA 3V2UC 2VF3A 4DV5E 3PYGA 2A2CA 2UXBI 4HACB 4B3RE 2OI2A 1XMOI 1OJ4A 4Z7YA 2IOPA 4DUZE 4KHPE 4DR3E 4DR4I 1QZRA 4B3SI 3LNUA 2UXCE 1N36E 4JV5E 1HNXE 1RR9A 1N33I 4YHHI 1B62A 1IBKI 4DR5I 2V2QA 5IT9C 2LJPA 2Z5CB 1H74A 3WU3A 4PRVA 4USMA 2UUBE 1ZXNA 3HJCA 2BV3A 1WUUA 1J5EI 1KKHA 4NXNI 1NHHA 3ZZUA 4JI8I 3T1YE 3QT5A 4DU7A 1Z0GA 3P06A 4X65E 4DR6E 4IZJB 4DV5I 1Z5CA 3QT7A 1HNWE 5IT9Q 4PU9A 4JI5E 5LMNI 4JI3E 3ZKDA 1H72C 3Q6NA 2HFUA 2GQ0A 1EA6A 4LFBE 4X66I 2VQFI 2PNLA 4JI0E 4LF5I 3WU5A 4LF4I 1PIEA 2UUCI 1Z0CA 1HNXI 1XMOE 2R3VA 1N0VC 4DV1I 4WUBA 4I3HA 4LF6I 4X62I 4USKA 4UTGA 3J80Q 1ZM4A 4LF9E 4LF7I 5GMEA 4B3SE 2HK3A 1IBLI 1N32I 1D6TA 1H7UA 3F0NA 3OTOI 1N33E 4YHHE 1IBKE 4DR5E 3GONA 1MX0A 4DR7I 3T1HI 1ZM9A 5A2QC 2AJ4A 2XEXA 1J5EE 4IZKB 1KIJA 3PRYA 4NXNE 1U2RA 1PKPA 1NHIA 4JI8E 2ZITA 1A6FA 3H4LA 4JI1I 2V2VA 4EMDA 5LMNE 5A2QQ 4DV2I 2Z5BB 1USVA 2UXDI 2O1UA 4X66E 3Q6MA 2VQFE 4OX9I 4MYUA 4FN5A 4M1KA 1ZXMA 4LF9I 2O1VA 4JG4A 4LF5E 4LF4E 2UUCE 4PRXA 2V34A 2X7IA 5L3JA 1XHKA 1IBMI 3M6AA 4DV1E 3QT8A 2Z5EA 4LF6E 4X62E 1HR0I 4DUYE 1MG7A 4LF7E 2ZM6I 1IBLE 1N32E 1USUA 2NPFA 4K0KE 3OTOE 1FJGI 1FI4A 2A2DA 2CGEA 4DV3I 3J7AG 1Y4SA 4DR7E 5LL6R 3T1HE 1I94I 3HULA 3D4JA 1XMQE 3LPSA 5IWAI 2O1WA 4JI7I 4X64I 1MU5A 4LFAE 4DR2E 4DXLA 1PVGA 3QT6A 3PYEA 3B78A 1FWKA 4URLA 1N34I 4DV0E 2DEIA 4JI1E 4FW9A 4YY3I 2UUAI 2UU9I 4DV2E 1Z0WA 1KVKA 4DPYA 2UXDE 4B3TE 4OX9E 1XNRI 4JI6I 4DUYI 3B8HA 5BR8I 1ZM2A 4P52A 4IZKA 2HHHI 4GKKI 4K0KI 1IBME 1HK7A 3ZZ0A 1Z5BA 2CZ9A 4DPTA 1HR0E 3PYDA 1XMQI 4JI2I 2V2ZA 4HACA 2ZM6E 3PYFA 4WUCA 4LFAI 4HY1A 1EI1A 2V8PA 1NZ0A 4DR2I 1FJGE 1FWLA 4XTJA 3K1JA 4DV3E 4DPXA 1I94E 3CWVA 4DV0I 4IZJD 1FNMA 2X36A 4LFCI 4Z7CA 5IWAE 5FWKA 4JI7E 3J81C 4X64E 1KTVA 1B63A 2WW4A 4JYAI 4B3TI 2Z5CA 4DV7I 3Q1QA 4DV4I 2R42A 1N34E 2F4VI 4YY3E 2UUAE 2EFGA 1VISA 5LMUE 4DPWA 2UU9E 2E5LI 4ED4A 4N3OA 4B3MI 3J81Q 4FWHA 4R1FA 1H7SA 4IZJA 1XNRE 4JI6E 1ELOA 1K47A 5BR8E 2HHHE 4GKKE 4RPFA 3B82A 3WU4A 4MYTA 2ZBKB 4ZVIA 4DV6I 1UEKA 4GKJI 1NHJA 5GMDA 4LF8I 4UT4A 4JI2E 1Z0BA 4DR1I 2IOQA 1S4EA 3ZZTA 4DPUA 4AQYI 3K17A 1Z5AA 2VQEE 1N0UA 2O1TA 4JI4I 2BM0A 1Z0EA 2E1RA 1BKNA 1XNQI 1S16A 4NXMI 3V5RA 4LFCE 5LMUI 2HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWG A;  4B3R I;  1Z59 A;  4JYA E;  3JAM C;  4HYM A;  3J80 C;  4DUZ I;  4KHP I;  1HNZ E;  4DV7 E;  3J7A M;  3LTO A;  4DR3 I;  1FKA E;  4DV4 E;  2F4V E;  5FLX C;  2GS8 A;  1RRE A;  2Q2E B;  2E5L E;  3WU6 A;  2UXC I;  1N36 I;  1Z0V A;  2UXB E;  4JV5 I;  4B3M E;  3JAM Q;  1DAR A;  2HKE A;  1ZM3 A;  1H73 A;  2J7K A;  4DR4 E;  2UUB I;  3ZKB A;  4DU8 A;  5FLX Q;  2VQE I;  3T1Y I;  2BM1 A;  1Z0T A;  2DEJ A;  2HKJ A;  4DV6 E;  4GKJ E;  4X65 I;  3ZM7 A;  4DR6 I;  4LF8 E;  4DR1 E;  1HNW I;  4JI5 I;  4JI3 I;  4P7A A;  4AQY E;  4LFB I;  4JI4 E;  1HNZ I;  4HXZ A;  2HFS A;  4WUD A;  1XNQ E;  4KQV A;  4NXM E;  4JI0 I;  4FWD A;  3V2U C;  2VF3 A;  4DV5 E;  3PYG A;  2A2C A;  2UXB I;  4HAC B;  4B3R E;  2OI2 A;  1XMO I;  1OJ4 A;  4Z7Y A;  4DUZ E;  4KHP E;  4DR3 E;  4DR4 I;  1QZR A;  4B3S I;  3LNU A;  2UXC E;  1N36 E;  4JV5 E;  1HNX E;  1RR9 A;  1N33 I;  4YHH I;  1B62 A;  1IBK I;  4DR5 I;  2V2Q A;  5IT9 C;  2LJP A;  1H74 A;  3WU3 A;  4PRV A;  4USM A;  2UUB E;  1ZXN A;  2BV3 A;  1WUU A;  1J5E I;  1KKH A;  4NXN I;  1NHH A;  3ZZU A;  4JI8 I;  3T1Y E;  3QT5 A;  4DU7 A;  1Z0G A;  4X65 E;  4DR6 E;  4DV5 I;  1Z5C A;  3QT7 A;  1HNW E;  5IT9 Q;  4PU9 A;  4JI5 E;  5LMN I;  4JI3 E;  3ZKD A;  1H72 C;  2HFU A;  1EA6 A;  4LFB E;  4X66 I;  2VQF I;  4JI0 E;  4LF5 I;  3WU5 A;  4LF4 I;  1PIE A;  2UUC I;  1Z0C A;  1HNX I;  1XMO E;  2R3V A;  1N0V C;  4DV1 I;  4WUB A;  4I3H A;  4LF6 I;  4X62 I;  4USK A;  4UTG A;  3J80 Q;  1ZM4 A;  4LF9 E;  4LF7 I;  5GME A;  4B3S E;  2HK3 A;  1IBL I;  1N32 I;  1D6T A;  1H7U A;  3F0N A;  3OTO I;  1N33 E;  4YHH E;  1IBK E;  4DR5 E;  3GON A;  1MX0 A;  4DR7 I;  3T1H I;  1ZM9 A;  5A2Q C;  2AJ4 A;  2XEX A;  1J5E E;  1KIJ A;  4NXN E;  1U2R A;  1PKP A;  1NHI A;  4JI8 E;  2ZIT A;  1A6F A;  3H4L A;  4JI1 I;  2V2V A;  4EMD A;  5LMN E;  5A2Q Q;  4DV2 I;  2UXD I;  4X66 E;  2VQF E;  4OX9 I;  4MYU A;  4FN5 A;  4M1K A;  1ZXM A;  4LF9 I;  4JG4 A;  4LF5 E;  4LF4 E;  2UUC E;  4PRX A;  2V34 A;  2X7I A;  5L3J A;  1XHK A;  1IBM I;  3M6A A;  4DV1 E;  3QT8 A;  4LF6 E;  4X62 E;  1HR0 I;  4DUY E;  1MG7 A;  4LF7 E;  2ZM6 I;  1IBL E;  1N32 E;  2NPF A;  4K0K E;  3OTO E;  1FJG I;  1FI4 A;  2A2D A;  4DV3 I;  3J7A G;  4DR7 E;  5LL6 R;  3T1H E;  1I94 I;  3HUL A;  3D4J A;  1XMQ E;  3LPS A;  5IWA I;  4JI7 I;  4X64 I;  1MU5 A;  4LFA E;  4DR2 E;  4DXL A;  1PVG A;  3QT6 A;  3PYE A;  3B78 A;  1FWK A;  4URL A;  1N34 I;  4DV0 E;  2DEI A;  4JI1 E;  4FW9 A;  4YY3 I;  2UUA I;  2UU9 I;  4DV2 E;  1Z0W A;  1KVK A;  4DPY A;  2UXD E;  4B3T E;  4OX9 E;  1XNR I;  4JI6 I;  4DUY I;  3B8H A;  5BR8 I;  1ZM2 A;  4P52 A;  2HHH I;  4GKK I;  4K0K I;  1IBM E;  3ZZ0 A;  1Z5B A;  2CZ9 A;  4DPT A;  1HR0 E;  3PYD A;  1XMQ I;  4JI2 I;  2V2Z A;  4HAC A;  2ZM6 E;  3PYF A;  4WUC A;  4LFA I;  4HY1 A;  1EI1 A;  2V8P A;  1NZ0 A;  4DR2 I;  1FJG E;  1FWL A;  4XTJ A;  3K1J A;  4DV3 E;  4DPX A;  1I94 E;  3CWV A;  4DV0 I;  1FNM A;  2X36 A;  4LFC I;  4Z7C A;  5IWA E;  4JI7 E;  3J81 C;  4X64 E;  1KTV A;  1B63 A;  2WW4 A;  4JYA I;  4B3T I;  4DV7 I;  3Q1Q A;  4DV4 I;  2R42 A;  1N34 E;  2F4V I;  4YY3 E;  2UUA E;  2EFG A;  1VIS A;  5LMU E;  4DPW A;  2UU9 E;  2E5L I;  4ED4 A;  4B3M I;  3J81 Q;  4FWH A;  4R1F A;  1H7S A;  1XNR E;  4JI6 E;  1ELO A;  1K47 A;  5BR8 E;  2HHH E;  4GKK E;  4RPF A;  3B82 A;  3WU4 A;  4MYT A;  2ZBK B;  4ZVI A;  4DV6 I;  1UEK A;  4GKJ I;  1NHJ A;  5GMD A;  4LF8 I;  4UT4 A;  4JI2 E;  1Z0B A;  4DR1 I;  1S4E A;  3ZZT A;  4DPU A;  4AQY I;  3K17 A;  1Z5A A;  2VQE E;  1N0U A;  4JI4 I;  2BM0 A;  1Z0E A;  2E1R A;  1BKN A;  1XNQ I;  1S16 A;  4NXM I;  3V5R A;  4LFC E;  5LMU I;  2HK2 A; 
#chains in the Genus database with same CATH topology
 2JT2 A;  4FWG A;  4B3R I;  1Z59 A;  4JYA E;  3JAM C;  4HYM A;  3J80 C;  4DUZ I;  4KHP I;  1HNZ E;  4DV7 E;  3J7A M;  3LTO A;  2CG9 A;  4DR3 I;  1FKA E;  4DV4 E;  2F4V E;  3P3E A;  5FLX C;  2GS8 A;  1RRE A;  5C0X D;  2Q2E B;  2E5L E;  3WU6 A;  5JEA C;  5EKW A;  2UXC I;  1N36 I;  1Z0V A;  2UXB E;  5C0X C;  4JV5 I;  4B3M E;  2PNM A;  5JEA F;  1Y4U A;  5C0X F;  3JAM Q;  1DAR A;  5DRO A;  2HKE A;  2JEB A;  1ZM3 A;  1H73 A;  2J7K A;  4DR4 E;  3NZK A;  2UUB I;  2Z5B A;  3ZKB A;  4MQY A;  4BA1 A;  2IES A;  4DU8 A;  5FLX Q;  4MU1 A;  2VQE I;  3T1Y I;  2BM1 A;  1Z0T A;  2DEJ A;  2HKJ A;  4DV6 E;  4GKJ E;  4X65 I;  5C0X A;  3ZM7 A;  4DR6 I;  4LF8 E;  4DR1 E;  1HNW I;  2JE6 A;  1Y6Z A;  4JI5 I;  1XXE A;  4JI3 I;  4AM3 A;  4P7A A;  5C0X E;  3P3G A;  2BA1 G;  5DNL A;  4AQY E;  1YH8 A;  4LFB I;  4JI4 E;  1HNZ I;  4HXZ A;  2HFS A;  4WUD A;  1XNQ E;  3K85 A;  4MDT A;  4KQV A;  4NXM E;  4JI0 I;  4FWD A;  3V2U C;  2VF3 A;  4DV5 E;  2BR2 B;  1Y5Y A;  3PYG A;  2A2C A;  4IFD D;  2UXB I;  2VES A;  4HAC B;  5DRP A;  4B3R E;  2OI2 A;  5EL9 A;  1XMO I;  4LCF A;  1OJ4 A;  4IFD C;  4Z7Y A;  2IOP A;  4DUZ E;  4KHP E;  4DR3 E;  4IFD F;  4DR4 I;  5JEA B;  1QZR A;  4B3S I;  3LNU A;  1E3H A;  2BA0 D;  3PS3 A;  2JEA A;  3UHM A;  2UXC E;  1N36 E;  4JV5 E;  5K36 D;  1HNX E;  1RR9 A;  1N33 I;  4YHH I;  1B62 A;  1IBK I;  2PO2 B;  2WNR A;  4DR5 I;  5K36 C;  2V2Q A;  5IT9 C;  2LJP A;  2Z5C B;  1H74 A;  3WU3 A;  4PRV A;  4USM A;  2UUB E;  5K36 F;  4IFD A;  1ZXN A;  3P3C A;  3CDJ A;  2C38 A;  3HJC A;  2BV3 A;  4GQU A;  1WUU A;  1J5E I;  1KKH A;  2NN6 B;  4NXN I;  4IFD E;  4MU0 A;  1NHH A;  3ZZU A;  4JI8 I;  3T1Y E;  3QT5 A;  4DU7 A;  1Z0G A;  3P06 A;  4X65 E;  2PO1 A;  4DR6 E;  4IZJ B;  4DV5 I;  1Y60 A;  1Z5C A;  3QT7 A;  1HNW E;  4PU9 A;  5IT9 Q;  4JI5 E;  5LMN I;  4JI3 E;  5K36 A;  3ZKD A;  3U1K A;  4ISA A;  1H72 C;  2C39 B;  3Q6N A;  2HFU A;  3L7Z B;  2GQ0 A;  1EA6 A;  3M85 D;  5K36 E;  4LFB E;  4X66 I;  2VQF I;  2PNL A;  4AIM A;  4JI0 E;  4LF5 I;  3WU5 A;  4LF4 I;  1PIE A;  2UUC I;  1Z0C A;  1HNX I;  2GO4 A;  1XMO E;  4IS9 A;  2R3V A;  1N0V C;  4DV1 I;  3GCM A;  1E3P A;  4OZE A;  4WUB A;  4I3H A;  4LF6 I;  4X62 I;  4USK A;  4UTG A;  3J80 Q;  1ZM4 A;  4LF9 E;  4LF7 I;  5GME A;  4B3S E;  2HK3 A;  1IBL I;  1N32 I;  1D6T A;  1H7U A;  2WP8 A;  3F0N A;  3OTO I;  1N33 E;  4YHH E;  4AID A;  1IBK E;  4U3D A;  4DR5 E;  1YHC A;  3GON A;  1MX0 A;  4DR7 I;  2PNZ A;  3T1H I;  1ZM9 A;  5A2Q C;  2AJ4 A;  3PS1 A;  2XEX A;  1UDS A;  1OYS A;  1J5E E;  2PO0 A;  1R6M A;  4IZK B;  1KIJ A;  3PRY A;  4NXN E;  1U2R A;  1PKP A;  4QNJ A;  1NHI A;  4JI8 E;  2ZIT A;  1A6F A;  1RHY A;  3H4L A;  4MU3 A;  4OO1 D;  4JI1 I;  2V2V A;  4EMD A;  5LMN E;  2JEB B;  4FW3 A;  2CVE A;  5A2Q Q;  4DV2 I;  4OO1 C;  2Z5B B;  4BA1 B;  1USV A;  1VI7 A;  2UXD I;  2O1U A;  4X66 E;  3Q6M A;  2VQF E;  4OX9 I;  4MYU A;  4FN5 A;  4BA2 A;  4M1K A;  1ZXM A;  4LF9 I;  2O1V A;  5C0X B;  4JG4 A;  2BA1 D;  4LF5 E;  3HKM A;  4LF4 E;  2UUC E;  4PRX A;  1UDQ A;  2V34 A;  2X7I A;  2JE6 B;  5L3J A;  3M7N G;  1XHK A;  1IBM I;  4LCH A;  4OO1 A;  2C37 A;  3M6A A;  4DV1 E;  3QT8 A;  5ELW A;  2Z5E A;  4LF6 E;  4X62 E;  1HR0 I;  4DUY E;  4OO1 E;  1MG7 A;  4LF7 E;  2ZM6 I;  2AE8 A;  1IBL E;  1N32 E;  1USU A;  2NPF A;  1UDO A;  4K0K E;  2O3Z A;  3DD6 A;  3OTO E;  4FW7 A;  1FJG I;  1FI4 A;  2A2D A;  2CGE A;  4DV3 I;  3J7A G;  1Y4S A;  4DR7 E;  5LL6 R;  3T1H E;  1I94 I;  3HUL A;  3PS2 A;  3D4J A;  1XMQ E;  3LPS A;  4J3D A;  5IWA I;  4U3B A;  2O1W A;  4JI7 I;  4X64 I;  1MU5 A;  4LFA E;  4DR2 E;  4DXL A;  1PVG A;  2JEA B;  3QT6 A;  3PYE A;  3B78 A;  5DNX A;  1FWK A;  2IER A;  3B4T A;  4URL A;  1N34 I;  2DEI A;  4DV0 E;  4JI1 E;  4FW9 A;  4YY3 I;  2UUA I;  2UU9 I;  4DV2 E;  1OYP A;  1Z0W A;  1KVK A;  4IFD B;  2J65 A;  2C38 B;  4DPY A;  2UXD E;  4QNK A;  1P42 A;  4B3T E;  4OX9 E;  1XNR I;  4JI6 I;  4DUY I;  3B8H A;  5BR8 I;  5JEA D;  1ZM2 A;  2PO1 B;  4P52 A;  4IZK A;  2HHH I;  4GKK I;  5K36 B;  4K0K I;  4LCG A;  1OYR A;  1IBM E;  1HK7 A;  3ZZ0 A;  1Z5B A;  2CZ9 A;  4DPT A;  2F1D A;  2BR2 A;  1HR0 E;  3PYD A;  1XMQ I;  4JI2 I;  2V2Z A;  4HAC A;  2ZM6 E;  4FW5 A;  3PYF A;  4WUC A;  4LFA I;  4HY1 A;  1EI1 A;  2V8P A;  1NZ0 A;  2NN6 D;  4DR2 I;  2GO3 A;  1FJG E;  1FWL A;  2NN6 C;  4FW6 A;  4XTJ A;  3K1J A;  3P76 A;  5JEA A;  4DV3 E;  4DPX A;  1I94 E;  2NN6 F;  3CWV A;  3GME A;  4DV0 I;  4IZJ D;  1FNM A;  2X36 A;  3CDI A;  4LFC I;  4Z7C A;  5IWA E;  5JEA E;  5FWK A;  4JI7 E;  3J81 C;  4X64 E;  1KTV A;  1B63 A;  2PO2 A;  4OO1 F;  2WW4 A;  4JYA I;  2BA0 G;  4B3T I;  2Z5C A;  4LOM A;  2WP8 B;  3KRN A;  1UDN A;  4DV7 I;  3Q1Q A;  4DV4 I;  2R42 A;  1N34 E;  2F4V I;  4YY3 E;  2NN6 A;  2UUA E;  2PNZ B;  2EFG A;  1VIS A;  5LMU E;  4DPW A;  2UU9 E;  2E5L I;  4ED4 A;  4FW4 A;  5DRQ A;  4N3O A;  2NN6 E;  4B3M I;  4NBQ A;  3J81 Q;  4FWH A;  2PO0 B;  4R1F A;  1H7S A;  4IZJ A;  1XNR E;  4JI6 E;  1ELO A;  1K47 A;  5BR8 E;  3H1C A;  2C39 A;  3L7Z A;  2HHH E;  4GKK E;  4RPF A;  3B82 A;  5DRR A;  3WU4 A;  4MYT A;  2ZBK B;  4ZVI A;  4DV6 I;  1UEK A;  4GKJ I;  3M85 G;  1NHJ A;  1R6L A;  5GMD A;  4LF8 I;  4UT4 A;  4JI2 E;  1Z0B A;  4DR1 I;  4BA2 B;  3M7N D;  2IOQ A;  1S4E A;  3ZZT A;  4DPU A;  4MU4 A;  4AQY I;  3K17 A;  1Z5A A;  2VQE E;  1N0U A;  3U1Y A;  2O1T A;  4JI4 I;  2BM0 A;  1Z0E A;  2E1R A;  4OKG A;  1BKN A;  1XNQ I;  2C37 B;  2WNR B;  3GLL A;  4OO1 B;  1S16 A;  4NXM I;  3V5R A;  4LFC E;  5LMU I;  4LPF A;  2HK2 A; 
#chains in the Genus database with same CATH homology
 4FWG A;  4B3R I;  1Z59 A;  4JYA E;  3JAM C;  4HYM A;  3J80 C;  4DUZ I;  4KHP I;  1HNZ E;  4DV7 E;  3J7A M;  3LTO A;  2CG9 A;  4DR3 I;  1FKA E;  4DV4 E;  2F4V E;  5FLX C;  2GS8 A;  1RRE A;  2Q2E B;  2E5L E;  3WU6 A;  2UXC I;  1N36 I;  1Z0V A;  2UXB E;  4JV5 I;  4B3M E;  2PNM A;  1Y4U A;  3JAM Q;  1DAR A;  2HKE A;  1ZM3 A;  1H73 A;  2J7K A;  4DR4 E;  2UUB I;  2Z5B A;  3ZKB A;  4DU8 A;  5FLX Q;  2VQE I;  3T1Y I;  2BM1 A;  1Z0T A;  2DEJ A;  2HKJ A;  4DV6 E;  4GKJ E;  4X65 I;  3ZM7 A;  4DR6 I;  4LF8 E;  4DR1 E;  1HNW I;  1Y6Z A;  4JI5 I;  4JI3 I;  4P7A A;  4AQY E;  4LFB I;  4JI4 E;  1HNZ I;  4HXZ A;  2HFS A;  4WUD A;  1XNQ E;  3K85 A;  4KQV A;  4NXM E;  4JI0 I;  4FWD A;  3V2U C;  2VF3 A;  4DV5 E;  3PYG A;  2A2C A;  2UXB I;  4HAC B;  4B3R E;  2OI2 A;  1XMO I;  1OJ4 A;  4Z7Y A;  2IOP A;  4DUZ E;  4KHP E;  4DR3 E;  4DR4 I;  1QZR A;  4B3S I;  3LNU A;  2UXC E;  1N36 E;  4JV5 E;  1HNX E;  1RR9 A;  1N33 I;  4YHH I;  1B62 A;  1IBK I;  4DR5 I;  2V2Q A;  5IT9 C;  2LJP A;  2Z5C B;  1H74 A;  3WU3 A;  4PRV A;  4USM A;  2UUB E;  1ZXN A;  3HJC A;  2BV3 A;  1WUU A;  1J5E I;  1KKH A;  4NXN I;  1NHH A;  3ZZU A;  4JI8 I;  3T1Y E;  3QT5 A;  4DU7 A;  1Z0G A;  3P06 A;  4X65 E;  4DR6 E;  4IZJ B;  4DV5 I;  1Z5C A;  3QT7 A;  1HNW E;  5IT9 Q;  4PU9 A;  4JI5 E;  5LMN I;  4JI3 E;  3ZKD A;  1H72 C;  3Q6N A;  2HFU A;  2GQ0 A;  1EA6 A;  4LFB E;  4X66 I;  2VQF I;  2PNL A;  4JI0 E;  4LF5 I;  3WU5 A;  4LF4 I;  1PIE A;  2UUC I;  1Z0C A;  1HNX I;  1XMO E;  2R3V A;  1N0V C;  4DV1 I;  4WUB A;  4I3H A;  4LF6 I;  4X62 I;  4USK A;  4UTG A;  3J80 Q;  1ZM4 A;  4LF9 E;  4LF7 I;  5GME A;  4B3S E;  2HK3 A;  1IBL I;  1N32 I;  1D6T A;  1H7U A;  3F0N A;  3OTO I;  1N33 E;  4YHH E;  1IBK E;  4DR5 E;  3GON A;  1MX0 A;  4DR7 I;  3T1H I;  1ZM9 A;  5A2Q C;  2AJ4 A;  2XEX A;  1J5E E;  4IZK B;  1KIJ A;  3PRY A;  4NXN E;  1U2R A;  1PKP A;  1NHI A;  4JI8 E;  2ZIT A;  1A6F A;  3H4L A;  4JI1 I;  2V2V A;  4EMD A;  5LMN E;  5A2Q Q;  4DV2 I;  2Z5B B;  1USV A;  2UXD I;  2O1U A;  4X66 E;  3Q6M A;  2VQF E;  4OX9 I;  4MYU A;  4FN5 A;  4M1K A;  1ZXM A;  4LF9 I;  2O1V A;  4JG4 A;  4LF5 E;  4LF4 E;  2UUC E;  4PRX A;  2V34 A;  2X7I A;  5L3J A;  1XHK A;  1IBM I;  3M6A A;  4DV1 E;  3QT8 A;  2Z5E A;  4LF6 E;  4X62 E;  1HR0 I;  4DUY E;  1MG7 A;  4LF7 E;  2ZM6 I;  1IBL E;  1N32 E;  1USU A;  2NPF A;  4K0K E;  3OTO E;  1FJG I;  1FI4 A;  2A2D A;  2CGE A;  4DV3 I;  3J7A G;  1Y4S A;  4DR7 E;  5LL6 R;  3T1H E;  1I94 I;  3HUL A;  3D4J A;  1XMQ E;  3LPS A;  5IWA I;  2O1W A;  4JI7 I;  4X64 I;  1MU5 A;  4LFA E;  4DR2 E;  4DXL A;  1PVG A;  3QT6 A;  3PYE A;  3B78 A;  1FWK A;  4URL A;  1N34 I;  4DV0 E;  2DEI A;  4JI1 E;  4FW9 A;  4YY3 I;  2UUA I;  2UU9 I;  4DV2 E;  1Z0W A;  1KVK A;  4DPY A;  2UXD E;  4B3T E;  4OX9 E;  1XNR I;  4JI6 I;  4DUY I;  3B8H A;  5BR8 I;  1ZM2 A;  4P52 A;  4IZK A;  2HHH I;  4GKK I;  4K0K I;  1IBM E;  1HK7 A;  3ZZ0 A;  1Z5B A;  2CZ9 A;  4DPT A;  1HR0 E;  3PYD A;  1XMQ I;  4JI2 I;  2V2Z A;  4HAC A;  2ZM6 E;  3PYF A;  4WUC A;  4LFA I;  4HY1 A;  1EI1 A;  2V8P A;  1NZ0 A;  4DR2 I;  1FJG E;  1FWL A;  4XTJ A;  3K1J A;  4DV3 E;  4DPX A;  1I94 E;  3CWV A;  4DV0 I;  4IZJ D;  1FNM A;  2X36 A;  4LFC I;  4Z7C A;  5IWA E;  5FWK A;  4JI7 E;  3J81 C;  4X64 E;  1KTV A;  1B63 A;  2WW4 A;  4JYA I;  4B3T I;  2Z5C A;  4DV7 I;  3Q1Q A;  4DV4 I;  2R42 A;  1N34 E;  2F4V I;  4YY3 E;  2UUA E;  2EFG A;  1VIS A;  5LMU E;  4DPW A;  2UU9 E;  2E5L I;  4ED4 A;  4N3O A;  4B3M I;  3J81 Q;  4FWH A;  4R1F A;  1H7S A;  4IZJ A;  1XNR E;  4JI6 E;  1ELO A;  1K47 A;  5BR8 E;  2HHH E;  4GKK E;  4RPF A;  3B82 A;  3WU4 A;  4MYT A;  2ZBK B;  4ZVI A;  4DV6 I;  1UEK A;  4GKJ I;  1NHJ A;  5GMD A;  4LF8 I;  4UT4 A;  4JI2 E;  1Z0B A;  4DR1 I;  2IOQ A;  1S4E A;  3ZZT A;  4DPU A;  4AQY I;  3K17 A;  1Z5A A;  2VQE E;  1N0U A;  2O1T A;  4JI4 I;  2BM0 A;  1Z0E A;  2E1R A;  1BKN A;  1XNQ I;  1S16 A;  4NXM I;  3V5R A;  4LFC E;  5LMU I;  2HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...