2UUCI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucI00
1EA6A 3V2UC 4GKKI 4USMA 4JI8I 4JI3I 3WU5A 4LF7E 2DEJA 1FJGI 1A6FA 3T1HI 1FWLA 3M6AA 2ZITA 2X36A 3GONA 4DV7E 4ZVIA 4JI5I 2UUCI 4DV1E 5IWAE 1OJ4A 1ZM2A 4DV1I 4LFAE 4HYMA 4R1FA 1MG7A 1XNQI 1MU5A 2NPFA 3QT8A 4JI7E 4JI7I 4OX9E 4DV5E 2HKEA 3V5RA 1ZXNA 4DR6E 4JV5E 4LF8E 2V8PA 4GKJE 2UUBE 1HNXE 4LF4I 4X65E 4LF5I 4FWGA 4DV2I 1N33E 3OTOI 1Z0EA 4DU8A 4DUZI 3ZKDA 2HK2A 2HHHI 4B3RI 4HACA 4KHPI 4X62E 4X62I 1XMOE 3WU4A 4MYTA 1FNMA 1XMQE 2LJPA 1IBMI 1I94I 5BR8I 1Z0CA 4JI4I 2R3VA 2E5LI 1NZ0A 4K0KI 4JYAI 1N34I 4NXME 4DR7I 2ZBKB 1N32E 1N32I 2R42A 3ZZUA 2BM0A 1Z0VA 3F0NA 4DR5E 4FN5A 4LF6E 1NHJA 4XTJA 2F4VI 2HK3A 1HNZI 4MYUA 1H7SA 3J7AG 4LF9E 4LF9I 3WU3A 3QT7A 4LFBI 1HR0I 4UTGA 4X66E 5LL6R 4DV6E 5IT9C 4FWDA 4EMDA 1HNWE 4LF7I 2VQFE 1N0VC 2ZM6E 1FI4A 1H74A 1Z0TA 1N36E 4DV7I 1J5EE 4DV0E 1Z5BA 1QZRA 5IWAI 4DUYE 4LFAI 4X64E 4DR1E 4DV3E 3B78A 4DV4E 4OX9I 4DV5I 5IT9Q 4DR6I 2UU9E 4JV5I 4LF8I 4P52A 4JI1E 2V34A 1ZM9A 1FWKA 4GKJI 2UUBI 4B3TE 1HNXI 1Z0BA 4LFCE 4X65I 4P7AA 5A2QC 3ZZTA 2BV3A 1N33I 1DARA 4DU7A 2V2ZA 4DPTA 4DPYA 2VQEE 3B82A 1XMOI 3ZZ0A 2UXBE 3PYFA 2UXBI 1B62A 2UXCE 2UUAE 1XMQI 3QT5A 4JI2E 1PVGA 2A2DA 4PRXA 1Z5CA 2HKJA 4NXMI 1ZXMA 3JAMC 2UXDE 2A2CA 4USKA 2BM1A 4DR3E 1Z0GA 4M1KA 4JI6E 1IBLE 1B63A 4KQVA 4URLA 4DR5I 4LF6I 1S16A 1D6TA 1H7UA 5GMEA 4FWHA 5LMUE 4YHHE 4YHHI 4B3ME 4B3MI 1H72C 1XNRE 3JAMQ 5L3JA 1Z5AA 1ZM4A 2CZ9A 3T1YE 4Z7CA 3K1JA 4AQYE 4X66I 3D4JA 3J7AM 1IBKE 1Z0WA 4DV6I 2X7IA 4NXNE 4ED4A 1HNWI 4B3SE 2VQFI 4JI0E 3J80C 2ZM6I 2VF3A 3PYDA 4DR4E 1RR9A 3LPSA 5LMNE 1N36I 1J5EI 4GKKE 4DPXA 4DV0I 1NHHA 1UEKA 2AJ4A 3CWVA 4JI8E 4DUYI 4JI3E 1FJGE 4X64I 1EI1A 4DR1I 4DV3I 3T1HE 4DV4I 2Q2EB 2EFGA 4FW9A 1N0UA 1ZM3A 1WUUA 2UU9I 3J80Q 4JI5E 2V2QA 4JI1I 2UUCE 4B3TI 1KTVA 1XNQE 4DPUA 1VISA 4LFCI 5FLXC 2GS8A 3PYGA 2J7KA 3J81C 1MX0A 5GMDA 1PIEA 2VQEI 3PYEA 4DR2E 4DR2I 1KVKA 4PU9A 1XHKA 4LF4E 3Q1QA 2UXCI 2UUAI 4LF5E 4DV2E 1KIJA 3OTOE 1S4EA 4YY3E 4YY3I 2XEXA 4DUZE 4JI2I 4B3RE 2HHHE 5FLXQ 4KHPE 5A2QQ 1H73A 3WU6A 3J81Q 3HULA 1PKPA 3B8HA 3ZM7A 1NHIA 2UXDI 1IBME 4DR3I 4JI6I 4JG4A 4WUBA 1RREA 1IBLI 4DPWA 1I94E 5BR8E 4WUCA 1ELOA 3LNUA 4JI4E 2E5LE 4UT4A 4K0KE 4JYAE 1N34E 5LMUI 1FKAE 4DR7E 2HFUA 3QT6A 2OI2A 1XNRI 4WUDA 2E1RA 4DXLA 4HACB 4HXZA 3H4LA 3T1YI 2F4VE 4AQYI 1HNZE 1Z59A 1IBKI 2V2VA 3ZKBA 4NXNI 4PRVA 4RPFA 4B3SI 4Z7YA 4HY1A 2DEIA 4JI0I 4I3HA 1KKHA 3K17A 4LFBE 1BKNA 1U2RA 3LTOA 2HFSA 1HR0E 4DR4I 2WW4A 1K47A 5LMNI
chains in the Genus database with same CATH superfamily
1RHYA 1EA6A 3V2UC 4GKKI 4USMA 4IFDE 4JI8I 3CDIA 4JI3I 3WU5A 2C39B 4IFDD 4LF7E 2DEJA 1FJGI 3PRYA 1A6FA 4AIMA 3T1HI 1FWLA 3M6AA 2J65A 3H1CA 2ZITA 2X36A 3GONA 4MU1A 2CG9A 4DV7E 2PNMA 4MDTA 5C0XE 4ZVIA 4JI5I 5DNLA 2UUCI 5C0XD 4DV1E 5IWAE 1OJ4A 1ZM2A 4DV1I 4LFAE 4HYMA 4R1FA 1MG7A 4QNJA 1XNQI 1MU5A 2WNRA 2NN6B 2NPFA 3QT8A 4JI7E 1UDSA 2IERA 4JI7I 4OX9E 4DV5E 2HKEA 3V5RA 1ZXNA 4DR6E 5DRPA 4JV5E 4LF8E 4OZEA 2V8PA 4GKJE 2UUBE 1HNXE 4LF4I 4X65E 4LF5I 4FWGA 2C38B 4LCHA 2O1TA 4DV2I 3OTOI 1N33E 1Z0EA 4DU8A 4DUZI 3ZKDA 2HK2A 2HHHI 4B3RI 4IZJB 2Z5CA 4HACA 4KHPI 4X62E 4X62I 1XMOE 1VI7A 2PNZA 3WU4A 5JEAC 2WNRB 4MYTA 1FNMA 1XMQE 3PS3A 2LJPA 1IBMI 3P06A 3M7NG 1I94I 1OYRA 5BR8I 3L7ZB 4BA2A 1Z0CA 3P3EA 3P3CA 2R3VA 2PNLA 2E5LI 4JI4I 1NZ0A 4K0KI 4JYAI 5JEAF 3NZKA 1N34I 4NXME 2O1UA 1R6LA 4DR7I 2ZBKB 1N32E 1YH8A 4OKGA 1N32I 2R42A 3PS2A 1UDNA 3ZZUA 4AIDA 2C39A 2BA0D 4LCFA 2BM0A 3KRNA 1Z0VA 4LOMA 3F0NA 4DR5E 4FN5A 4LF6E 2NN6C 1NHJA 4XTJA 3CDJA 2F4VI 2HK3A 1HNZI 4MYUA 1H7SA 3J7AG 4LF9E 4LF9I 2NN6A 3WU3A 3QT7A 4LFBI 1HR0I 5EKWA 1UDQA 2IOPA 4UTGA 5JEAB 4X66E 5LL6R 4DV6E 2WP8B 5IT9C 4FWDA 4EMDA 1HNWE 2F1DA 2PO0B 5FWKA 4LF7I 2VQFE 2JEAA 1N0VC 2O3ZA 2C38A 2ZM6E 1FI4A 5DRQA 1H74A 1Z0TA 1N36E 4DV7I 4IZJA 1J5EE 3GLLA 4DV0E 1Z5BA 2Z5BB 3UHMA 1QZRA 1Y4SA 5IWAI 4DUYE 4LFAI 1Y5YA 4ISAA 4X64E 4DR1E 4DV3E 3B78A 4DV4E 4OX9I 4DV5I 5IT9Q 5DRRA 4DR6I 3L7ZA 4MU3A 3Q6NA 5JEAE 2UU9E 4JV5I 4LF8I 4P52A 4JI1E 2V34A 1R6MA 1ZM9A 1FWKA 4GKJI 2UUBI 4B3TE 1HNXI 2JEAB 3M7ND 1Z0BA 4LFCE 4X65I 4P7AA 5A2QC 3ZZTA 2BV3A 1N33I 1DARA 4DU7A 2V2ZA 4DPTA 4N3OA 2BR2B 3M85G 4DPYA 4OO1F 2VQEE 3DD6A 3B82A 1XMOI 3ZZ0A 2UXBE 3PYFA 2UXBI 1B62A 2O1VA 3Q6MA 2C37B 2UXCE 2UUAE 1XMQI 2NN6E 3U1YA 4QNKA 5K36C 3QT5A 4JI2E 1PVGA 2O1WA 2NN6D 2JE6B 2A2DA 2AE8A 4PRXA 1Z5CA 1Y6ZA 2HKJA 5C0XF 4NXMI 1ZXMA 3JAMC 5JEAA 2UXDE 4MU4A 1OYSA 5K36F 2A2CA 4USKA 2CGEA 2GQ0A 2BM1A 4DR3E 1E3HA 1Z0GA 4M1KA 2WP8A 4JI6E 5K36A 1IBLE 2PO0A 2BA1D 4IS9A 1B63A 4KQVA 4URLA 1XXEA 4DR5I 4LF6I 1S16A 4OO1B 1D6TA 1H7UA 5GMEA 4FWHA 5LMUE 4AM3A 4IZJD 5DROA 4YHHE 4YHHI 4FW4A 4IZKB 4B3ME 4B3MI 2Z5BA 1USVA 1E3PA 1H72C 1HK7A 1XNRE 5EL9A 3JAMQ 5L3JA 1Z5AA 1ZM4A 2CZ9A 3T1YE 4Z7CA 5C0XB 3K1JA 4AQYE 4X66I 1Y4UA 3D4JA 2Z5EA 3J7AM 1IBKE 2PO2B 4BA1B 1Z0WA 3U1KA 4DV6I 2X7IA 5K36B 4NXNE 2GO3A 2PO1B 4MQYA 4ED4A 1HNWI 4B3SE 2JEBB 2VQFI 4JI0E 4FW5A 3J80C 2GO4A 2ZM6I 2VF3A 2CVEA 3PYDA 4DR4E 2BR2A 1RR9A 3LPSA 5LMNE 1N36I 1J5EI 4GKKE 4DPXA 4DV0I 1NHHA 1UEKA 2AJ4A 3CWVA 4JI8E 4DUYI 4JI3E 2C37A 1FJGE 3M85D 4X64I 1EI1A 4DR1I 4DV3I 3T1HE 1YHCA 4DV4I 2JT2A 2Q2EB 2EFGA 4FW9A 1N0UA 2JE6A 1P42A 1ZM3A 1WUUA 2UU9I 3J80Q 4JI5E 4OO1C 2V2QA 4JI1I 2UUCE 4LPFA 1UDOA 5JEAD 5K36E 4B3TI 1KTVA 1XNQE 4DPUA 1VISA 5ELWA 4MU0A 4LFCI 5FLXC 2GS8A 1OYPA 3PYGA 2J7KA 5K36D 4IFDC 3J81C 1MX0A 5GMDA 1PIEA 2IOQA 3K85A 2VQEI 3P3GA 3PYEA 4OO1A 4NBQA 4DR2E 4DR2I 4IFDF 1KVKA 4PU9A 1XHKA 4LF4E 3Q1QA 5C0XC 4IZKA 2UXCI 2UUAI 4LF5E 4IFDA 4DV2E 1KIJA 3OTOE 1S4EA 4YY3E 4YY3I 2XEXA 4DUZE 4JI2I 4B3RE 2HHHE 5FLXQ 4KHPE 5A2QQ 4LCGA 2IESA 1H73A 3WU6A 3J81Q 3HULA 1PKPA 3B8HA 3ZM7A 5C0XA 1NHIA 2UXDI 2PO2A 4BA1A 3B4TA 1IBME 4DR3I 2PO1A 4JI6I 4JG4A 4WUBA 1RREA 1IBLI 4DPWA 1I94E 5BR8E 2JEBA 4WUCA 1ELOA 3LNUA 4FW3A 4JI4E 2E5LE 5DNXA 4UT4A 4K0KE 4JYAE 1N34E 1USUA 3HJCA 5LMUI 1FKAE 4DR7E 2HFUA 4IFDB 1Y60A 3P76A 3QT6A 2OI2A 1XNRI 4FW7A 4WUDA 2E1RA 3GMEA 4FW6A 4DXLA 2Z5CB 4HACB 4HXZA 3PS1A 3H4LA 3T1YI 2F4VE 2PNZB 2VESA 4AQYI 1HNZE 3HKMA 4U3BA 1Z59A 1IBKI 2V2VA 3ZKBA 4U3DA 4PRVA 4NXNI 2NN6F 3GCMA 4RPFA 4B3SI 4Z7YA 4HY1A 2DEIA 4JI0I 4I3HA 4BA2B 1KKHA 3K17A 4LFBE 1BKNA 1U2RA 3LTOA 4OO1E 2BA0G 2HFSA 2BA1G 1HR0E 4DR4I 2WW4A 1K47A 4GQUA 5LMNI 4J3DA 4OO1D
chains in the Genus database with same CATH topology
1EA6A 3V2UC 4GKKI 4USMA 4JI8I 4JI3I 3WU5A 4LF7E 2DEJA 1FJGI 3PRYA 1A6FA 3T1HI 1FWLA 3M6AA 2ZITA 2X36A 3GONA 2CG9A 4DV7E 2PNMA 4ZVIA 4JI5I 2UUCI 4DV1E 5IWAE 1OJ4A 1ZM2A 4DV1I 4LFAE 4HYMA 4R1FA 1MG7A 1XNQI 1MU5A 2NPFA 3QT8A 4JI7E 4JI7I 4OX9E 4DV5E 2HKEA 3V5RA 1ZXNA 4DR6E 4JV5E 4LF8E 2V8PA 4GKJE 2UUBE 1HNXE 4LF4I 4X65E 4LF5I 4FWGA 4DV2I 2O1TA 1N33E 3OTOI 1Z0EA 4DU8A 4DUZI 3ZKDA 2HK2A 2HHHI 4B3RI 4IZJB 2Z5CA 4HACA 4KHPI 4X62E 4X62I 1XMOE 3WU4A 4MYTA 1FNMA 1XMQE 2LJPA 1IBMI 3P06A 1I94I 5BR8I 1Z0CA 4JI4I 2R3VA 2PNLA 2E5LI 1NZ0A 4K0KI 4JYAI 1N34I 4NXME 2O1UA 4DR7I 2ZBKB 1N32E 1N32I 2R42A 3ZZUA 2BM0A 1Z0VA 3F0NA 4DR5E 4FN5A 4LF6E 1NHJA 4XTJA 2F4VI 2HK3A 1HNZI 4MYUA 1H7SA 3J7AG 4LF9E 4LF9I 3WU3A 3QT7A 4LFBI 1HR0I 2IOPA 4UTGA 4X66E 5LL6R 4DV6E 5IT9C 4FWDA 4EMDA 1HNWE 5FWKA 4LF7I 2VQFE 1N0VC 2ZM6E 1FI4A 1H74A 1Z0TA 1N36E 4DV7I 4IZJA 1J5EE 4DV0E 1Z5BA 2Z5BB 1QZRA 1Y4SA 5IWAI 4DUYE 4LFAI 4X64E 4DR1E 4DV3E 3B78A 4DV4E 4OX9I 4DV5I 5IT9Q 4DR6I 3Q6NA 2UU9E 4JV5I 4LF8I 4P52A 4JI1E 2V34A 1ZM9A 1FWKA 4GKJI 2UUBI 4B3TE 1HNXI 1Z0BA 4LFCE 4X65I 4P7AA 5A2QC 3ZZTA 2BV3A 1N33I 1DARA 4DU7A 2V2ZA 4DPTA 4N3OA 4DPYA 2VQEE 3B82A 1XMOI 3ZZ0A 2UXBE 3PYFA 2UXBI 1B62A 2O1VA 3Q6MA 2UXCE 2UUAE 1XMQI 3QT5A 4JI2E 1PVGA 2O1WA 2A2DA 4PRXA 1Z5CA 1Y6ZA 2HKJA 4NXMI 1ZXMA 3JAMC 2UXDE 2A2CA 4USKA 2CGEA 2GQ0A 2BM1A 4DR3E 1Z0GA 4M1KA 4JI6E 1IBLE 1B63A 4KQVA 4URLA 4DR5I 4LF6I 1S16A 1D6TA 1H7UA 5GMEA 4FWHA 5LMUE 4IZJD 4YHHE 4YHHI 4IZKB 4B3ME 4B3MI 2Z5BA 1USVA 1H72C 1HK7A 1XNRE 3JAMQ 5L3JA 1Z5AA 1ZM4A 2CZ9A 3T1YE 4Z7CA 4AQYE 3K1JA 4X66I 1Y4UA 3D4JA 2Z5EA 3J7AM 1IBKE 1Z0WA 4DV6I 2X7IA 4NXNE 4ED4A 1HNWI 4B3SE 2VQFI 4JI0E 3J80C 2ZM6I 2VF3A 3PYDA 4DR4E 1RR9A 3LPSA 5LMNE 1N36I 1J5EI 4GKKE 4DPXA 4DV0I 1NHHA 1UEKA 2AJ4A 3CWVA 4JI8E 4DUYI 4JI3E 1FJGE 4X64I 1EI1A 4DR1I 4DV3I 3T1HE 4DV4I 2Q2EB 2EFGA 4FW9A 1N0UA 1ZM3A 1WUUA 2UU9I 3J80Q 4JI5E 2V2QA 4JI1I 2UUCE 4B3TI 1KTVA 1XNQE 4DPUA 1VISA 4LFCI 5FLXC 2GS8A 3PYGA 2J7KA 3J81C 1MX0A 5GMDA 1PIEA 2IOQA 3K85A 2VQEI 3PYEA 4DR2E 4DR2I 1KVKA 4PU9A 1XHKA 4LF4E 3Q1QA 4IZKA 2UXCI 2UUAI 4LF5E 4DV2E 1KIJA 3OTOE 1S4EA 4YY3E 4YY3I 2XEXA 4DUZE 4JI2I 4B3RE 2HHHE 5FLXQ 4KHPE 5A2QQ 1H73A 3WU6A 3J81Q 3HULA 1PKPA 3B8HA 3ZM7A 1NHIA 2UXDI 1IBME 4DR3I 4JI6I 4JG4A 4WUBA 1RREA 1IBLI 4DPWA 1I94E 5BR8E 4WUCA 1ELOA 3LNUA 4JI4E 2E5LE 4UT4A 4K0KE 4JYAE 1N34E 1USUA 3HJCA 5LMUI 1FKAE 4DR7E 2HFUA 3QT6A 2OI2A 1XNRI 4WUDA 2E1RA 4DXLA 2Z5CB 4HACB 4HXZA 3H4LA 3T1YI 2F4VE 4AQYI 1HNZE 1Z59A 1IBKI 2V2VA 3ZKBA 4NXNI 4PRVA 4RPFA 4B3SI 4Z7YA 4HY1A 2DEIA 4JI0I 4I3HA 1KKHA 3K17A 4LFBE 1BKNA 1U2RA 3LTOA 2HFSA 1HR0E 4DR4I 2WW4A 1K47A 5LMNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  3V2U C;  4GKK I;  4USM A;  4JI8 I;  4JI3 I;  3WU5 A;  4LF7 E;  2DEJ A;  1FJG I;  1A6F A;  3T1H I;  1FWL A;  3M6A A;  2ZIT A;  2X36 A;  3GON A;  4DV7 E;  4ZVI A;  4JI5 I;  2UUC I;  4DV1 E;  5IWA E;  1OJ4 A;  1ZM2 A;  4DV1 I;  4LFA E;  4HYM A;  4R1F A;  1MG7 A;  1XNQ I;  1MU5 A;  2NPF A;  3QT8 A;  4JI7 E;  4JI7 I;  4OX9 E;  4DV5 E;  2HKE A;  3V5R A;  1ZXN A;  4DR6 E;  4JV5 E;  4LF8 E;  2V8P A;  4GKJ E;  2UUB E;  1HNX E;  4LF4 I;  4X65 E;  4LF5 I;  4FWG A;  4DV2 I;  1N33 E;  3OTO I;  1Z0E A;  4DU8 A;  4DUZ I;  3ZKD A;  2HK2 A;  2HHH I;  4B3R I;  4HAC A;  4KHP I;  4X62 E;  4X62 I;  1XMO E;  3WU4 A;  4MYT A;  1FNM A;  1XMQ E;  2LJP A;  1IBM I;  1I94 I;  5BR8 I;  1Z0C A;  4JI4 I;  2R3V A;  2E5L I;  1NZ0 A;  4K0K I;  4JYA I;  1N34 I;  4NXM E;  4DR7 I;  2ZBK B;  1N32 E;  1N32 I;  2R42 A;  3ZZU A;  2BM0 A;  1Z0V A;  3F0N A;  4DR5 E;  4FN5 A;  4LF6 E;  1NHJ A;  4XTJ A;  2F4V I;  2HK3 A;  1HNZ I;  4MYU A;  1H7S A;  3J7A G;  4LF9 E;  4LF9 I;  3WU3 A;  3QT7 A;  4LFB I;  1HR0 I;  4UTG A;  4X66 E;  5LL6 R;  4DV6 E;  5IT9 C;  4FWD A;  4EMD A;  1HNW E;  4LF7 I;  2VQF E;  1N0V C;  2ZM6 E;  1FI4 A;  1H74 A;  1Z0T A;  1N36 E;  4DV7 I;  1J5E E;  4DV0 E;  1Z5B A;  1QZR A;  5IWA I;  4DUY E;  4LFA I;  4X64 E;  4DR1 E;  4DV3 E;  3B78 A;  4DV4 E;  4OX9 I;  4DV5 I;  5IT9 Q;  4DR6 I;  2UU9 E;  4JV5 I;  4LF8 I;  4P52 A;  4JI1 E;  2V34 A;  1ZM9 A;  1FWK A;  4GKJ I;  2UUB I;  4B3T E;  1HNX I;  1Z0B A;  4LFC E;  4X65 I;  4P7A A;  5A2Q C;  3ZZT A;  2BV3 A;  1N33 I;  1DAR A;  4DU7 A;  2V2Z A;  4DPT A;  4DPY A;  2VQE E;  3B82 A;  1XMO I;  3ZZ0 A;  2UXB E;  3PYF A;  2UXB I;  1B62 A;  2UXC E;  2UUA E;  1XMQ I;  3QT5 A;  4JI2 E;  1PVG A;  2A2D A;  4PRX A;  1Z5C A;  2HKJ A;  4NXM I;  1ZXM A;  3JAM C;  2UXD E;  2A2C A;  4USK A;  2BM1 A;  4DR3 E;  1Z0G A;  4M1K A;  4JI6 E;  1IBL E;  1B63 A;  4KQV A;  4URL A;  4DR5 I;  4LF6 I;  1S16 A;  1D6T A;  1H7U A;  5GME A;  4FWH A;  5LMU E;  4YHH E;  4YHH I;  4B3M E;  4B3M I;  1H72 C;  1XNR E;  3JAM Q;  5L3J A;  1Z5A A;  1ZM4 A;  2CZ9 A;  3T1Y E;  4Z7C A;  3K1J A;  4AQY E;  4X66 I;  3D4J A;  3J7A M;  1IBK E;  1Z0W A;  4DV6 I;  2X7I A;  4NXN E;  4ED4 A;  1HNW I;  4B3S E;  2VQF I;  4JI0 E;  3J80 C;  2ZM6 I;  2VF3 A;  3PYD A;  4DR4 E;  1RR9 A;  3LPS A;  5LMN E;  1N36 I;  1J5E I;  4GKK E;  4DPX A;  4DV0 I;  1NHH A;  1UEK A;  2AJ4 A;  3CWV A;  4JI8 E;  4DUY I;  4JI3 E;  1FJG E;  4X64 I;  1EI1 A;  4DR1 I;  4DV3 I;  3T1H E;  4DV4 I;  2Q2E B;  2EFG A;  4FW9 A;  1N0U A;  1ZM3 A;  1WUU A;  2UU9 I;  3J80 Q;  4JI5 E;  2V2Q A;  4JI1 I;  2UUC E;  4B3T I;  1KTV A;  1XNQ E;  4DPU A;  1VIS A;  4LFC I;  5FLX C;  2GS8 A;  3PYG A;  2J7K A;  3J81 C;  1MX0 A;  5GMD A;  1PIE A;  2VQE I;  3PYE A;  4DR2 E;  4DR2 I;  1KVK A;  4PU9 A;  1XHK A;  4LF4 E;  3Q1Q A;  2UXC I;  2UUA I;  4LF5 E;  4DV2 E;  1KIJ A;  3OTO E;  1S4E A;  4YY3 E;  4YY3 I;  2XEX A;  4DUZ E;  4JI2 I;  4B3R E;  2HHH E;  5FLX Q;  4KHP E;  5A2Q Q;  1H73 A;  3WU6 A;  3J81 Q;  3HUL A;  1PKP A;  3B8H A;  3ZM7 A;  1NHI A;  2UXD I;  1IBM E;  4DR3 I;  4JI6 I;  4JG4 A;  4WUB A;  1RRE A;  1IBL I;  4DPW A;  1I94 E;  5BR8 E;  4WUC A;  1ELO A;  3LNU A;  4JI4 E;  2E5L E;  4UT4 A;  4K0K E;  4JYA E;  1N34 E;  5LMU I;  1FKA E;  4DR7 E;  2HFU A;  3QT6 A;  2OI2 A;  1XNR I;  4WUD A;  2E1R A;  4DXL A;  4HAC B;  4HXZ A;  3H4L A;  3T1Y I;  2F4V E;  4AQY I;  1HNZ E;  1Z59 A;  1IBK I;  2V2V A;  3ZKB A;  4NXN I;  4PRV A;  4RPF A;  4B3S I;  4Z7Y A;  4HY1 A;  2DEI A;  4JI0 I;  4I3H A;  1KKH A;  3K17 A;  4LFB E;  1BKN A;  1U2R A;  3LTO A;  2HFS A;  1HR0 E;  4DR4 I;  2WW4 A;  1K47 A;  5LMN I; 
#chains in the Genus database with same CATH topology
 1RHY A;  1EA6 A;  3V2U C;  4GKK I;  4USM A;  4IFD E;  4JI8 I;  3CDI A;  4JI3 I;  3WU5 A;  2C39 B;  4IFD D;  4LF7 E;  2DEJ A;  1FJG I;  3PRY A;  1A6F A;  4AIM A;  3T1H I;  1FWL A;  3M6A A;  2J65 A;  3H1C A;  2ZIT A;  2X36 A;  3GON A;  4MU1 A;  2CG9 A;  4DV7 E;  2PNM A;  4MDT A;  5C0X E;  4ZVI A;  4JI5 I;  5DNL A;  2UUC I;  5C0X D;  4DV1 E;  5IWA E;  1OJ4 A;  1ZM2 A;  4DV1 I;  4LFA E;  4HYM A;  4R1F A;  1MG7 A;  4QNJ A;  1XNQ I;  1MU5 A;  2WNR A;  2NN6 B;  2NPF A;  3QT8 A;  4JI7 E;  1UDS A;  2IER A;  4JI7 I;  4OX9 E;  4DV5 E;  2HKE A;  3V5R A;  1ZXN A;  4DR6 E;  5DRP A;  4JV5 E;  4LF8 E;  4OZE A;  2V8P A;  4GKJ E;  2UUB E;  1HNX E;  4LF4 I;  4X65 E;  4LF5 I;  4FWG A;  2C38 B;  4LCH A;  2O1T A;  4DV2 I;  3OTO I;  1N33 E;  1Z0E A;  4DU8 A;  4DUZ I;  3ZKD A;  2HK2 A;  2HHH I;  4B3R I;  4IZJ B;  2Z5C A;  4HAC A;  4KHP I;  4X62 E;  4X62 I;  1XMO E;  1VI7 A;  2PNZ A;  3WU4 A;  5JEA C;  2WNR B;  4MYT A;  1FNM A;  1XMQ E;  3PS3 A;  2LJP A;  1IBM I;  3P06 A;  3M7N G;  1I94 I;  1OYR A;  5BR8 I;  3L7Z B;  4BA2 A;  1Z0C A;  3P3E A;  3P3C A;  2R3V A;  2PNL A;  2E5L I;  4JI4 I;  1NZ0 A;  4K0K I;  4JYA I;  5JEA F;  3NZK A;  1N34 I;  4NXM E;  2O1U A;  1R6L A;  4DR7 I;  2ZBK B;  1N32 E;  1YH8 A;  4OKG A;  1N32 I;  2R42 A;  3PS2 A;  1UDN A;  3ZZU A;  4AID A;  2C39 A;  2BA0 D;  4LCF A;  2BM0 A;  3KRN A;  1Z0V A;  4LOM A;  3F0N A;  4DR5 E;  4FN5 A;  4LF6 E;  2NN6 C;  1NHJ A;  4XTJ A;  3CDJ A;  2F4V I;  2HK3 A;  1HNZ I;  4MYU A;  1H7S A;  3J7A G;  4LF9 E;  4LF9 I;  2NN6 A;  3WU3 A;  3QT7 A;  4LFB I;  1HR0 I;  5EKW A;  1UDQ A;  2IOP A;  4UTG A;  5JEA B;  4X66 E;  5LL6 R;  4DV6 E;  2WP8 B;  5IT9 C;  4FWD A;  4EMD A;  1HNW E;  2F1D A;  2PO0 B;  5FWK A;  4LF7 I;  2VQF E;  2JEA A;  1N0V C;  2O3Z A;  2C38 A;  2ZM6 E;  1FI4 A;  5DRQ A;  1H74 A;  1Z0T A;  1N36 E;  4DV7 I;  4IZJ A;  1J5E E;  3GLL A;  4DV0 E;  1Z5B A;  2Z5B B;  3UHM A;  1QZR A;  1Y4S A;  5IWA I;  4DUY E;  4LFA I;  1Y5Y A;  4ISA A;  4X64 E;  4DR1 E;  4DV3 E;  3B78 A;  4DV4 E;  4OX9 I;  4DV5 I;  5IT9 Q;  5DRR A;  4DR6 I;  3L7Z A;  4MU3 A;  3Q6N A;  5JEA E;  2UU9 E;  4JV5 I;  4LF8 I;  4P52 A;  4JI1 E;  2V34 A;  1R6M A;  1ZM9 A;  1FWK A;  4GKJ I;  2UUB I;  4B3T E;  1HNX I;  2JEA B;  3M7N D;  1Z0B A;  4LFC E;  4X65 I;  4P7A A;  5A2Q C;  3ZZT A;  2BV3 A;  1N33 I;  1DAR A;  4DU7 A;  2V2Z A;  4DPT A;  4N3O A;  2BR2 B;  3M85 G;  4DPY A;  4OO1 F;  2VQE E;  3DD6 A;  3B82 A;  1XMO I;  3ZZ0 A;  2UXB E;  3PYF A;  2UXB I;  1B62 A;  2O1V A;  3Q6M A;  2C37 B;  2UXC E;  2UUA E;  1XMQ I;  2NN6 E;  3U1Y A;  4QNK A;  5K36 C;  3QT5 A;  4JI2 E;  1PVG A;  2O1W A;  2NN6 D;  2JE6 B;  2A2D A;  2AE8 A;  4PRX A;  1Z5C A;  1Y6Z A;  2HKJ A;  5C0X F;  4NXM I;  1ZXM A;  3JAM C;  5JEA A;  2UXD E;  4MU4 A;  1OYS A;  5K36 F;  2A2C A;  4USK A;  2CGE A;  2GQ0 A;  2BM1 A;  4DR3 E;  1E3H A;  1Z0G A;  4M1K A;  2WP8 A;  4JI6 E;  5K36 A;  1IBL E;  2PO0 A;  2BA1 D;  4IS9 A;  1B63 A;  4KQV A;  4URL A;  1XXE A;  4DR5 I;  4LF6 I;  1S16 A;  4OO1 B;  1D6T A;  1H7U A;  5GME A;  4FWH A;  5LMU E;  4AM3 A;  4IZJ D;  5DRO A;  4YHH E;  4YHH I;  4FW4 A;  4IZK B;  4B3M E;  4B3M I;  2Z5B A;  1USV A;  1E3P A;  1H72 C;  1HK7 A;  1XNR E;  5EL9 A;  3JAM Q;  5L3J A;  1Z5A A;  1ZM4 A;  2CZ9 A;  3T1Y E;  4Z7C A;  5C0X B;  3K1J A;  4AQY E;  4X66 I;  1Y4U A;  3D4J A;  2Z5E A;  3J7A M;  1IBK E;  2PO2 B;  4BA1 B;  1Z0W A;  3U1K A;  4DV6 I;  2X7I A;  5K36 B;  4NXN E;  2GO3 A;  2PO1 B;  4MQY A;  4ED4 A;  1HNW I;  4B3S E;  2JEB B;  2VQF I;  4JI0 E;  4FW5 A;  3J80 C;  2GO4 A;  2ZM6 I;  2VF3 A;  2CVE A;  3PYD A;  4DR4 E;  2BR2 A;  1RR9 A;  3LPS A;  5LMN E;  1N36 I;  1J5E I;  4GKK E;  4DPX A;  4DV0 I;  1NHH A;  1UEK A;  2AJ4 A;  3CWV A;  4JI8 E;  4DUY I;  4JI3 E;  2C37 A;  1FJG E;  3M85 D;  4X64 I;  1EI1 A;  4DR1 I;  4DV3 I;  3T1H E;  1YHC A;  4DV4 I;  2JT2 A;  2Q2E B;  2EFG A;  4FW9 A;  1N0U A;  2JE6 A;  1P42 A;  1ZM3 A;  1WUU A;  2UU9 I;  3J80 Q;  4JI5 E;  4OO1 C;  2V2Q A;  4JI1 I;  2UUC E;  4LPF A;  1UDO A;  5JEA D;  5K36 E;  4B3T I;  1KTV A;  1XNQ E;  4DPU A;  1VIS A;  5ELW A;  4MU0 A;  4LFC I;  5FLX C;  2GS8 A;  1OYP A;  3PYG A;  2J7K A;  5K36 D;  4IFD C;  3J81 C;  1MX0 A;  5GMD A;  1PIE A;  2IOQ A;  3K85 A;  2VQE I;  3P3G A;  3PYE A;  4OO1 A;  4NBQ A;  4DR2 E;  4DR2 I;  4IFD F;  1KVK A;  4PU9 A;  1XHK A;  4LF4 E;  3Q1Q A;  5C0X C;  4IZK A;  2UXC I;  2UUA I;  4LF5 E;  4IFD A;  4DV2 E;  1KIJ A;  3OTO E;  1S4E A;  4YY3 E;  4YY3 I;  2XEX A;  4DUZ E;  4JI2 I;  4B3R E;  2HHH E;  5FLX Q;  4KHP E;  5A2Q Q;  4LCG A;  2IES A;  1H73 A;  3WU6 A;  3J81 Q;  3HUL A;  1PKP A;  3B8H A;  3ZM7 A;  5C0X A;  1NHI A;  2UXD I;  2PO2 A;  4BA1 A;  3B4T A;  1IBM E;  4DR3 I;  2PO1 A;  4JI6 I;  4JG4 A;  4WUB A;  1RRE A;  1IBL I;  4DPW A;  1I94 E;  5BR8 E;  2JEB A;  4WUC A;  1ELO A;  3LNU A;  4FW3 A;  4JI4 E;  2E5L E;  5DNX A;  4UT4 A;  4K0K E;  4JYA E;  1N34 E;  1USU A;  3HJC A;  5LMU I;  1FKA E;  4DR7 E;  2HFU A;  4IFD B;  1Y60 A;  3P76 A;  3QT6 A;  2OI2 A;  1XNR I;  4FW7 A;  4WUD A;  2E1R A;  3GME A;  4FW6 A;  4DXL A;  2Z5C B;  4HAC B;  4HXZ A;  3PS1 A;  3H4L A;  3T1Y I;  2F4V E;  2PNZ B;  2VES A;  4AQY I;  1HNZ E;  3HKM A;  4U3B A;  1Z59 A;  1IBK I;  2V2V A;  3ZKB A;  4U3D A;  4PRV A;  4NXN I;  2NN6 F;  3GCM A;  4RPF A;  4B3S I;  4Z7Y A;  4HY1 A;  2DEI A;  4JI0 I;  4I3H A;  4BA2 B;  1KKH A;  3K17 A;  4LFB E;  1BKN A;  1U2R A;  3LTO A;  4OO1 E;  2BA0 G;  2HFS A;  2BA1 G;  1HR0 E;  4DR4 I;  2WW4 A;  1K47 A;  4GQU A;  5LMN I;  4J3D A;  4OO1 D; 
#chains in the Genus database with same CATH homology
 1EA6 A;  3V2U C;  4GKK I;  4USM A;  4JI8 I;  4JI3 I;  3WU5 A;  4LF7 E;  2DEJ A;  1FJG I;  3PRY A;  1A6F A;  3T1H I;  1FWL A;  3M6A A;  2ZIT A;  2X36 A;  3GON A;  2CG9 A;  4DV7 E;  2PNM A;  4ZVI A;  4JI5 I;  2UUC I;  4DV1 E;  5IWA E;  1OJ4 A;  1ZM2 A;  4DV1 I;  4LFA E;  4HYM A;  4R1F A;  1MG7 A;  1XNQ I;  1MU5 A;  2NPF A;  3QT8 A;  4JI7 E;  4JI7 I;  4OX9 E;  4DV5 E;  2HKE A;  3V5R A;  1ZXN A;  4DR6 E;  4JV5 E;  4LF8 E;  2V8P A;  4GKJ E;  2UUB E;  1HNX E;  4LF4 I;  4X65 E;  4LF5 I;  4FWG A;  4DV2 I;  2O1T A;  1N33 E;  3OTO I;  1Z0E A;  4DU8 A;  4DUZ I;  3ZKD A;  2HK2 A;  2HHH I;  4B3R I;  4IZJ B;  2Z5C A;  4HAC A;  4KHP I;  4X62 E;  4X62 I;  1XMO E;  3WU4 A;  4MYT A;  1FNM A;  1XMQ E;  2LJP A;  1IBM I;  3P06 A;  1I94 I;  5BR8 I;  1Z0C A;  4JI4 I;  2R3V A;  2PNL A;  2E5L I;  1NZ0 A;  4K0K I;  4JYA I;  1N34 I;  4NXM E;  2O1U A;  4DR7 I;  2ZBK B;  1N32 E;  1N32 I;  2R42 A;  3ZZU A;  2BM0 A;  1Z0V A;  3F0N A;  4DR5 E;  4FN5 A;  4LF6 E;  1NHJ A;  4XTJ A;  2F4V I;  2HK3 A;  1HNZ I;  4MYU A;  1H7S A;  3J7A G;  4LF9 E;  4LF9 I;  3WU3 A;  3QT7 A;  4LFB I;  1HR0 I;  2IOP A;  4UTG A;  4X66 E;  5LL6 R;  4DV6 E;  5IT9 C;  4FWD A;  4EMD A;  1HNW E;  5FWK A;  4LF7 I;  2VQF E;  1N0V C;  2ZM6 E;  1FI4 A;  1H74 A;  1Z0T A;  1N36 E;  4DV7 I;  4IZJ A;  1J5E E;  4DV0 E;  1Z5B A;  2Z5B B;  1QZR A;  1Y4S A;  5IWA I;  4DUY E;  4LFA I;  4X64 E;  4DR1 E;  4DV3 E;  3B78 A;  4DV4 E;  4OX9 I;  4DV5 I;  5IT9 Q;  4DR6 I;  3Q6N A;  2UU9 E;  4JV5 I;  4LF8 I;  4P52 A;  4JI1 E;  2V34 A;  1ZM9 A;  1FWK A;  4GKJ I;  2UUB I;  4B3T E;  1HNX I;  1Z0B A;  4LFC E;  4X65 I;  4P7A A;  5A2Q C;  3ZZT A;  2BV3 A;  1N33 I;  1DAR A;  4DU7 A;  2V2Z A;  4DPT A;  4N3O A;  4DPY A;  2VQE E;  3B82 A;  1XMO I;  3ZZ0 A;  2UXB E;  3PYF A;  2UXB I;  1B62 A;  2O1V A;  3Q6M A;  2UXC E;  2UUA E;  1XMQ I;  3QT5 A;  4JI2 E;  1PVG A;  2O1W A;  2A2D A;  4PRX A;  1Z5C A;  1Y6Z A;  2HKJ A;  4NXM I;  1ZXM A;  3JAM C;  2UXD E;  2A2C A;  4USK A;  2CGE A;  2GQ0 A;  2BM1 A;  4DR3 E;  1Z0G A;  4M1K A;  4JI6 E;  1IBL E;  1B63 A;  4KQV A;  4URL A;  4DR5 I;  4LF6 I;  1S16 A;  1D6T A;  1H7U A;  5GME A;  4FWH A;  5LMU E;  4IZJ D;  4YHH E;  4YHH I;  4IZK B;  4B3M E;  4B3M I;  2Z5B A;  1USV A;  1H72 C;  1HK7 A;  1XNR E;  3JAM Q;  5L3J A;  1Z5A A;  1ZM4 A;  2CZ9 A;  3T1Y E;  4Z7C A;  4AQY E;  3K1J A;  4X66 I;  1Y4U A;  3D4J A;  2Z5E A;  3J7A M;  1IBK E;  1Z0W A;  4DV6 I;  2X7I A;  4NXN E;  4ED4 A;  1HNW I;  4B3S E;  2VQF I;  4JI0 E;  3J80 C;  2ZM6 I;  2VF3 A;  3PYD A;  4DR4 E;  1RR9 A;  3LPS A;  5LMN E;  1N36 I;  1J5E I;  4GKK E;  4DPX A;  4DV0 I;  1NHH A;  1UEK A;  2AJ4 A;  3CWV A;  4JI8 E;  4DUY I;  4JI3 E;  1FJG E;  4X64 I;  1EI1 A;  4DR1 I;  4DV3 I;  3T1H E;  4DV4 I;  2Q2E B;  2EFG A;  4FW9 A;  1N0U A;  1ZM3 A;  1WUU A;  2UU9 I;  3J80 Q;  4JI5 E;  2V2Q A;  4JI1 I;  2UUC E;  4B3T I;  1KTV A;  1XNQ E;  4DPU A;  1VIS A;  4LFC I;  5FLX C;  2GS8 A;  3PYG A;  2J7K A;  3J81 C;  1MX0 A;  5GMD A;  1PIE A;  2IOQ A;  3K85 A;  2VQE I;  3PYE A;  4DR2 E;  4DR2 I;  1KVK A;  4PU9 A;  1XHK A;  4LF4 E;  3Q1Q A;  4IZK A;  2UXC I;  2UUA I;  4LF5 E;  4DV2 E;  1KIJ A;  3OTO E;  1S4E A;  4YY3 E;  4YY3 I;  2XEX A;  4DUZ E;  4JI2 I;  4B3R E;  2HHH E;  5FLX Q;  4KHP E;  5A2Q Q;  1H73 A;  3WU6 A;  3J81 Q;  3HUL A;  1PKP A;  3B8H A;  3ZM7 A;  1NHI A;  2UXD I;  1IBM E;  4DR3 I;  4JI6 I;  4JG4 A;  4WUB A;  1RRE A;  1IBL I;  4DPW A;  1I94 E;  5BR8 E;  4WUC A;  1ELO A;  3LNU A;  4JI4 E;  2E5L E;  4UT4 A;  4K0K E;  4JYA E;  1N34 E;  1USU A;  3HJC A;  5LMU I;  1FKA E;  4DR7 E;  2HFU A;  3QT6 A;  2OI2 A;  1XNR I;  4WUD A;  2E1R A;  4DXL A;  2Z5C B;  4HAC B;  4HXZ A;  3H4L A;  3T1Y I;  2F4V E;  4AQY I;  1HNZ E;  1Z59 A;  1IBK I;  2V2V A;  3ZKB A;  4NXN I;  4PRV A;  4RPF A;  4B3S I;  4Z7Y A;  4HY1 A;  2DEI A;  4JI0 I;  4I3H A;  1KKH A;  3K17 A;  4LFB E;  1BKN A;  1U2R A;  3LTO A;  2HFS A;  1HR0 E;  4DR4 I;  2WW4 A;  1K47 A;  5LMN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...