2UUCI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucI00
4DR5E 4B3SE 4DUYI 2A2CA 3J81Q 4DV1E 3CWVA 2E5LE 2ZBKB 1XNQI 1XNQE 2HK2A 1B63A 3T1HE 5FLXQ 5L3JA 1N33E 1MG7A 2R3VA 1NHHA 4LF6E 4JI8I 4K0KE 1Z0VA 1XMQE 2NPFA 1Z0BA 2EFGA 4OX9E 1Z0GA 4DUZE 2GS8A 2F4VE 1Z59A 4YHHI 1H72C 2UUCI 4DR6I 1Z0CA 3ZZUA 4P7AA 4PU9A 3K17A 4URLA 3PYDA 3WU3A 4XTJA 1Z0EA 3V2UC 1BKNA 4GKJE 2X36A 4JI3E 1KKHA 2OI2A 1U2RA 1I94I 1ZXMA 3V5RA 5LMUE 1XNRE 4LF5E 4JI4E 1ZM4A 4GKKE 4KHPE 2XEXA 5IT9Q 4USMA 2HFUA 5LMNE 1IBKE 3J80C 1IBKI 2V34A 4KQVA 5BR8I 2UXDI 4Z7CA 4ZVIA 4LF8I 5LL6R 4HXZA 4UTGA 4JI3I 4DR3E 2AJ4A 2HK3A 4LFCI 4FWDA 4FN5A 2UU9I 4X65E 4K0KI 1WUUA 3WU6A 4AQYE 2VQFI 3H4LA 1Z0WA 2UXBI 1HNXE 3OTOI 3F0NA 4JV5I 1N34I 3M6AA 1XHKA 4NXNE 3B8HA 4HY1A 3B82A 3T1HI 1N33I 4HACA 4X64I 1Z5CA 4DPYA 1Z5AA 4DV4E 1K47A 4FW9A 1HNWI 4R1FA 3ZKDA 3LNUA 3PYGA 4X62E 4JI0I 3QT7A 4X62I 4DPUA 1XMOI 4DR4E 2J7KA 5BR8E 2DEIA 4USKA 1UEKA 1S4EA 5IWAI 3J7AM 4HYMA 4DPXA 3T1YE 4P52A 4MYUA 3T1YI 4LF9E 4DV2E 2WW4A 1J5EE 2UXCI 1FJGI 3QT8A 4DUZI 4DV3E 2UUAI 1H74A 2UUBI 2F4VI 2UXBE 4DUYE 4DV6I 2HHHE 4OX9I 1RREA 3OTOE 1OJ4A 4JV5E 2A2DA 1IBME 1MX0A 4JI2I 4DR3I 1FWKA 1H7UA 5LMUI 4DR2I 1A6FA 4JI7I 1KIJA 1DARA 1XNRI 4LFBE 2V2VA 4DPWA 3D4JA 3PYEA 1NHIA 4DR5I 4B3SI 3GONA 1XMOE 1S16A 3J80Q 3LTOA 4DR6E 3WU4A 3ZZ0A 5A2QC 4DR4I 5GMEA 4DV7E 4ED4A 1H7SA 1IBLE 4JG4A 4X64E 4LF9I 4X66I 4JI6I 4JI6E 1B62A 2UXCE 4JI1I 4JI1E 3K1JA 4DV2I 1EI1A 1Z5BA 3HULA 1N36E 4UT4A 1VISA 2V2ZA 1ZM2A 4DR7E 5FLXC 4B3ME 4M1KA 3LPSA 1N34E 1D6TA 1N0VC 2E5LI 4YY3E 4WUBA 1PVGA 4DV1I 1N32E 1N32I 4B3RE 2VQEE 2BV3A 4JI7E 1QZRA 1HR0E 1I94E 4DR1I 4B3TE 5A2QQ 2ZM6I 1ELOA 1HNZI 2HKJA 1FKAE 4B3TI 1PIEA 4JI5E 1FI4A 5IWAE 3ZKBA 4NXNI 4LF7E 4LF4E 1ZM9A 4I3HA 4GKJI 4FWGA 4JI8E 1PKPA 4Z7YA 1N0UA 4JYAE 4DR1E 2UU9E 1J5EI 4DV5E 4DV5I 1ZXNA 5GMDA 2UUBE 2UXDE 4JI5I 1EA6A 4YY3I 4B3RI 4WUCA 3JAMQ 2VQEI 4WUDA 3QT5A 4DV0I 3B78A 4DV0E 2CZ9A 1FWLA 2X7IA 4HACB 4RPFA 2VF3A 4DXLA 1NZ0A 4LF6I 4JI4I 4PRVA 2VQFE 1HNZE 3J81C 1N36I 4FWHA 4YHHE 2UUCE 4B3MI 4DPTA 1HNXI 1RR9A 2R42A 2DEJA 4DV7I 1NHJA 3JAMC 1IBLI 2V2QA 1Z0TA 4LFAE 2ZITA 4LFAI 4LFCE 3ZZTA 4LF5I 4DV4I 4LFBI 1FJGE 2E1RA 4KHPI 4DR7I 4DV6E 3PYFA 4NXME 2BM1A 4NXMI 4LF8E 2Q2EB 3QT6A 4JI2E 4PRXA 4LF7I 1MU5A 5IT9C 3ZM7A 4X66E 1FNMA 2V8PA 3WU5A 1HR0I 4X65I 4GKKI 4AQYI 4DV3I 2HHHI 2UUAE 2LJPA 2ZM6E 4DU8A 3J7AG 4MYTA 1KVKA 4JI0E 2HFSA 4EMDA 2HKEA 1H73A 4LF4I 4DR2E 1ZM3A 4JYAI 1IBMI 1HNWE 2BM0A 1XMQI 3Q1QA 5LMNI 1KTVA 4DU7A
chains in the Genus database with same CATH superfamily
4DR5E 4B3SE 4DUYI 2A2CA 3J81Q 4DV1E 2IOQA 3KRNA 3CWVA 2AE8A 2E5LE 2ZBKB 4U3BA 1XNQI 1XNQE 2HK2A 1B63A 3T1HE 5FLXQ 5L3JA 1N33E 5C0XD 1MG7A 2R3VA 1Y6ZA 1NHHA 3CDIA 2C38B 4LF6E 4JI8I 2O1WA 5DRQA 4K0KE 5DNXA 1Z0VA 2BA1D 2NPFA 1XMQE 1Z0BA 1OYRA 2EFGA 4OX9E 1Z0GA 3M85G 4LCFA 4QNKA 2GS8A 4FW5A 4DUZE 1Z59A 2F4VE 5K36F 4YHHI 1H72C 2UUCI 4DR6I 1Z0CA 3ZZUA 4P7AA 2O1UA 4FW7A 3K17A 4PU9A 4URLA 3PYDA 3WU3A 4XTJA 1Z0EA 3V2UC 1BKNA 4LPFA 4GKJE 2X36A 4JI3E 1UDOA 1KKHA 2OI2A 1U2RA 1I94I 1ZXMA 3V5RA 2JEAB 5LMUE 5JEAB 4LF5E 1XNRE 2JE6A 4JI4E 1ZM4A 4GKKE 4OKGA 4KHPE 2XEXA 1VI7A 5IT9Q 4USMA 5JEAF 1YHCA 2HFUA 2WNRA 5LMNE 1IBKE 3J80C 2NN6D 1IBKI 1E3PA 2V34A 2O3ZA 4KQVA 5BR8I 4BA1A 2UXDI 3M85D 1YH8A 5K36E 4Z7CA 4ZVIA 4LF8I 5LL6R 3CDJA 4HXZA 4UTGA 2PNZB 4JI3I 5K36B 4DR3E 4OO1E 2AJ4A 2HK3A 4LFCI 1R6LA 4FWDA 3HJCA 4FN5A 2UU9I 1USUA 4X65E 1R6MA 4K0KI 1WUUA 3WU6A 1Y4SA 4AQYE 2VQFI 3H4LA 1Z0WA 2UXBI 1HNXE 3OTOI 3F0NA 4JV5I 5ELWA 2CG9A 1N34I 2PO0B 4GQUA 3M6AA 1XHKA 4NXNE 3B8HA 4HY1A 3B82A 3T1HI 4IZKB 4IZJB 1N33I 4HACA 2NN6C 4X64I 2F1DA 1Z5CA 4DPYA 1UDQA 5C0XF 1Z5AA 4DV4E 1K47A 4FW9A 5JEAE 1HNWI 4R1FA 2WP8A 3ZKDA 3L7ZB 3LNUA 3PYGA 4X62E 4JI0I 3QT7A 4X62I 4DPUA 1XMOI 5DRPA 4DR4E 4IFDE 2J7KA 5BR8E 2DEIA 4USKA 1UEKA 1S4EA 2JE6B 5IWAI 3P3EA 3J7AM 4BA2A 4HYMA 2BA0G 2NN6A 4OZEA 2IOPA 4DPXA 2VESA 4BA2B 3T1YE 4P52A 4MYUA 3T1YI 5K36C 4LF9E 4DV2E 2WW4A 4LCHA 1J5EE 2UXCI 1FJGI 2NN6F 3QT8A 4DUZI 3GCMA 4DV3E 1H74A 2UUAI 2UUBI 2F4VI 2UXBE 2GQ0A 4DUYE 3L7ZA 4FW6A 4DV6I 2HHHE 4OX9I 1XXEA 3Q6NA 3PS1A 4U3DA 5DNLA 1RREA 3B4TA 1OJ4A 3OTOE 4JV5E 2A2DA 1OYSA 1IBME 1MX0A 2C37B 4DR3I 4JI2I 1FWKA 4OO1D 1H7UA 5LMUI 4DR2I 5K36A 4FW3A 4MU1A 1A6FA 4JI7I 1KIJA 1DARA 1XNRI 4LFBE 2V2VA 3Q6MA 3PRYA 3D4JA 3PYEA 4DPWA 1NHIA 4DR5I 4B3SI 3GONA 1XMOE 1S16A 2C38A 3J80Q 2CVEA 3LTOA 4DR6E 3WU4A 4MQYA 3ZZ0A 1P42A 5A2QC 2Z5EA 5GMEA 4DR4I 4DV7E 4ED4A 2Z5CB 1H7SA 1IBLE 3H1CA 4JG4A 2Z5BB 2PO2A 4X64E 4LF9I 4X66I 4JI6I 4JI6E 1B62A 2UXCE 2C39B 4JI1I 4JI1E 3K1JA 4DV2I 3U1KA 1EI1A 2BR2B 1Z5BA 3HULA 2CGEA 1N36E 2PO2B 4UT4A 1VISA 2O1VA 2V2ZA 1ZM2A 4DR7E 5FLXC 4IFDB 4B3ME 4M1KA 3LPSA 5JEAA 1N34E 1D6TA 4OO1F 1N0VC 2E5LI 1HK7A 4YY3E 4WUBA 4QNJA 1PVGA 5JEAC 4DV1I 1N32E 1N32I 3P3GA 4B3RE 4FW4A 2VQEE 2BV3A 2J65A 4JI7E 1QZRA 5JEAD 1HR0E 1I94E 2BR2A 3U1YA 1RHYA 1UDNA 4DR1I 4B3TE 4J3DA 5EL9A 5A2QQ 4NBQA 1ELOA 2ZM6I 1HNZI 2HKJA 1FKAE 4B3TI 5C0XC 2IERA 1PIEA 3K85A 4LCGA 4JI5E 1FI4A 5IWAE 3ZKBA 4NXNI 4LF7E 5C0XE 2BA0D 2PNZA 4LF4E 1ZM9A 3UHMA 4I3HA 4GKJI 4FWGA 4JI8E 1PKPA 4Z7YA 1N0UA 1E3HA 4JYAE 3HKMA 4OO1B 4DR1E 4AM3A 4LOMA 2UU9E 1J5EI 4DV5E 4DV5I 1ZXNA 5GMDA 2JEBB 5K36D 2O1TA 2NN6E 2UUBE 4MU4A 2UXDE 4JI5I 5DRRA 2WNRB 1EA6A 4N3OA 1UDSA 1Y60A 4YY3I 4B3RI 4WUCA 3JAMQ 2VQEI 4WUDA 2IESA 3QT5A 3DD6A 4IZKA 4DV0I 3B78A 4DV0E 2CZ9A 1FWLA 2X7IA 4HACB 4MDTA 4RPFA 2VF3A 2WP8B 5FWKA 4DXLA 2GO3A 1NZ0A 4LF6I 4PRVA 4JI4I 3M7NG 2VQFE 2C39A 3M7ND 1HNZE 3J81C 1N36I 4MU0A 4FWHA 5DROA 4YHHE 2UUCE 4B3MI 4DPTA 1HNXI 1RR9A 2GO4A 2R42A 2DEJA 4DV7I 2Z5CA 1NHJA 3JAMC 4IFDD 1IBLI 2Z5BA 2V2QA 4MU3A 1Z0TA 3P76A 4LFAE 4ISAA 2ZITA 4LFAI 4LFCE 3ZZTA 1USVA 4LF5I 4DV4I 2PO0A 4LFBI 3P06A 1FJGE 4OO1A 2E1RA 2JEAA 4KHPI 4DR7I 4AIMA 4DV6E 4OO1C 3PYFA 4NXME 2NN6B 1Y5YA 2BM1A 3P3CA 4NXMI 4LF8E 2Q2EB 3QT6A 4JI2E 4PRXA 4LF7I 1MU5A 2JT2A 2PO1B 5IT9C 3ZM7A 4X66E 3PS2A 2PNLA 1FNMA 2V8PA 4AIDA 3WU5A 1HR0I 3NZKA 4X65I 4GKKI 5EKWA 4AQYI 3GLLA 4DV3I 2HHHI 2LJPA 2UUAE 2ZM6E 4DU8A 3J7AG 4MYTA 1KVKA 4JI0E 4IFDF 1OYPA 2C37A 3GMEA 2HFSA 1Y4UA 4EMDA 2HKEA 2PNMA 1H73A 4IZJA 2PO1A 4LF4I 4DR2E 4IFDA 1ZM3A 3PS3A 4JYAI 1IBMI 2JEBA 4IFDC 2BA1G 1HNWE 2BM0A 4IZJD 1XMQI 3Q1QA 5C0XB 5LMNI 1KTVA 4BA1B 4DU7A 4IS9A 5C0XA
chains in the Genus database with same CATH topology
4DR5E 4B3SE 4DUYI 2A2CA 3J81Q 4DV1E 2IOQA 3CWVA 2E5LE 2ZBKB 1XNQI 1XNQE 2HK2A 1B63A 3T1HE 5FLXQ 5L3JA 1N33E 1MG7A 2R3VA 1Y6ZA 1NHHA 4LF6E 4JI8I 2O1WA 4K0KE 1Z0VA 1XMQE 2NPFA 1Z0BA 2EFGA 4OX9E 1Z0GA 4DUZE 2GS8A 2F4VE 1Z59A 4YHHI 1H72C 2UUCI 4DR6I 1Z0CA 3ZZUA 4P7AA 2O1UA 4PU9A 3K17A 4URLA 3PYDA 3WU3A 4XTJA 1Z0EA 3V2UC 1BKNA 4GKJE 2X36A 4JI3E 1KKHA 2OI2A 1U2RA 1I94I 1ZXMA 3V5RA 5LMUE 1XNRE 4LF5E 4JI4E 1ZM4A 4GKKE 4KHPE 2XEXA 5IT9Q 4USMA 2HFUA 5LMNE 1IBKE 3J80C 1IBKI 2V34A 4KQVA 5BR8I 2UXDI 4Z7CA 4ZVIA 4LF8I 5LL6R 4HXZA 4UTGA 4JI3I 4DR3E 2AJ4A 2HK3A 4LFCI 4FWDA 3HJCA 4FN5A 2UU9I 1USUA 4X65E 4K0KI 1WUUA 3WU6A 1Y4SA 4AQYE 2VQFI 3H4LA 1Z0WA 2UXBI 1HNXE 3OTOI 3F0NA 4JV5I 2CG9A 1N34I 3M6AA 1XHKA 4NXNE 3B8HA 4HY1A 3B82A 3T1HI 4IZKB 4IZJB 1N33I 4HACA 4X64I 1Z5CA 4DPYA 1Z5AA 4DV4E 1K47A 4FW9A 1HNWI 4R1FA 3ZKDA 3LNUA 3PYGA 4X62E 4JI0I 3QT7A 4X62I 4DPUA 1XMOI 4DR4E 2J7KA 5BR8E 2DEIA 4USKA 1UEKA 1S4EA 5IWAI 3J7AM 4HYMA 2IOPA 4DPXA 3T1YE 4P52A 4MYUA 3T1YI 4LF9E 4DV2E 2WW4A 1J5EE 2UXCI 1FJGI 3QT8A 4DUZI 4DV3E 2UUAI 1H74A 2UUBI 2F4VI 2UXBE 2GQ0A 4DUYE 4DV6I 2HHHE 4OX9I 3Q6NA 1RREA 3OTOE 1OJ4A 4JV5E 2A2DA 1IBME 1MX0A 4JI2I 4DR3I 1FWKA 1H7UA 5LMUI 4DR2I 1A6FA 4JI7I 1KIJA 1DARA 1XNRI 4LFBE 2V2VA 3Q6MA 3PRYA 3D4JA 3PYEA 4DPWA 1NHIA 4B3SI 4DR5I 3GONA 1XMOE 1S16A 3J80Q 3LTOA 4DR6E 3WU4A 3ZZ0A 5A2QC 2Z5EA 5GMEA 4DR4I 4DV7E 4ED4A 2Z5CB 1H7SA 1IBLE 4JG4A 2Z5BB 4X64E 4LF9I 4X66I 4JI6I 4JI6E 1B62A 2UXCE 4JI1I 4JI1E 3K1JA 4DV2I 1EI1A 1Z5BA 3HULA 2CGEA 1N36E 4UT4A 1VISA 2O1VA 2V2ZA 1ZM2A 4DR7E 5FLXC 4B3ME 4M1KA 3LPSA 1N34E 1D6TA 1N0VC 2E5LI 1HK7A 4YY3E 4WUBA 1PVGA 4DV1I 1N32E 1N32I 4B3RE 2VQEE 2BV3A 4JI7E 1QZRA 1HR0E 1I94E 4DR1I 4B3TE 5A2QQ 2ZM6I 1ELOA 1HNZI 2HKJA 1FKAE 4B3TI 1PIEA 3K85A 4JI5E 1FI4A 5IWAE 3ZKBA 4NXNI 4LF7E 4LF4E 1ZM9A 4I3HA 4GKJI 4FWGA 4JI8E 1PKPA 4Z7YA 1N0UA 4JYAE 4DR1E 2UU9E 1J5EI 4DV5E 4DV5I 1ZXNA 5GMDA 2O1TA 2UUBE 2UXDE 4JI5I 1EA6A 4N3OA 4YY3I 4B3RI 4WUCA 3JAMQ 2VQEI 4WUDA 3QT5A 4IZKA 4DV0I 3B78A 4DV0E 2CZ9A 1FWLA 2X7IA 4HACB 4RPFA 2VF3A 5FWKA 4DXLA 1NZ0A 4LF6I 4PRVA 4JI4I 2VQFE 1HNZE 3J81C 1N36I 4FWHA 4YHHE 2UUCE 4B3MI 4DPTA 1HNXI 1RR9A 2R42A 2DEJA 4DV7I 2Z5CA 1NHJA 3JAMC 1IBLI 2Z5BA 2V2QA 1Z0TA 4LFAE 2ZITA 4LFAI 4LFCE 3ZZTA 1USVA 4LF5I 4DV4I 4LFBI 3P06A 1FJGE 2E1RA 4KHPI 4DR7I 4DV6E 3PYFA 4NXME 2BM1A 4NXMI 4LF8E 2Q2EB 3QT6A 4JI2E 4PRXA 4LF7I 1MU5A 5IT9C 3ZM7A 4X66E 2PNLA 1FNMA 2V8PA 3WU5A 1HR0I 4X65I 4GKKI 4AQYI 4DV3I 2HHHI 2UUAE 2LJPA 2ZM6E 4DU8A 3J7AG 4MYTA 1KVKA 4JI0E 2HFSA 1Y4UA 4EMDA 2HKEA 2PNMA 1H73A 4IZJA 4LF4I 4DR2E 1ZM3A 4JYAI 1IBMI 1HNWE 2BM0A 4IZJD 1XMQI 3Q1QA 5LMNI 1KTVA 4DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  4B3S E;  4DUY I;  2A2C A;  3J81 Q;  4DV1 E;  3CWV A;  2E5L E;  2ZBK B;  1XNQ I;  1XNQ E;  2HK2 A;  1B63 A;  3T1H E;  5FLX Q;  5L3J A;  1N33 E;  1MG7 A;  2R3V A;  1NHH A;  4LF6 E;  4JI8 I;  4K0K E;  1Z0V A;  1XMQ E;  2NPF A;  1Z0B A;  2EFG A;  4OX9 E;  1Z0G A;  4DUZ E;  2GS8 A;  2F4V E;  1Z59 A;  4YHH I;  1H72 C;  2UUC I;  4DR6 I;  1Z0C A;  3ZZU A;  4P7A A;  4PU9 A;  3K17 A;  4URL A;  3PYD A;  3WU3 A;  4XTJ A;  1Z0E A;  3V2U C;  1BKN A;  4GKJ E;  2X36 A;  4JI3 E;  1KKH A;  2OI2 A;  1U2R A;  1I94 I;  1ZXM A;  3V5R A;  5LMU E;  1XNR E;  4LF5 E;  4JI4 E;  1ZM4 A;  4GKK E;  4KHP E;  2XEX A;  5IT9 Q;  4USM A;  2HFU A;  5LMN E;  1IBK E;  3J80 C;  1IBK I;  2V34 A;  4KQV A;  5BR8 I;  2UXD I;  4Z7C A;  4ZVI A;  4LF8 I;  5LL6 R;  4HXZ A;  4UTG A;  4JI3 I;  4DR3 E;  2AJ4 A;  2HK3 A;  4LFC I;  4FWD A;  4FN5 A;  2UU9 I;  4X65 E;  4K0K I;  1WUU A;  3WU6 A;  4AQY E;  2VQF I;  3H4L A;  1Z0W A;  2UXB I;  1HNX E;  3OTO I;  3F0N A;  4JV5 I;  1N34 I;  3M6A A;  1XHK A;  4NXN E;  3B8H A;  4HY1 A;  3B82 A;  3T1H I;  1N33 I;  4HAC A;  4X64 I;  1Z5C A;  4DPY A;  1Z5A A;  4DV4 E;  1K47 A;  4FW9 A;  1HNW I;  4R1F A;  3ZKD A;  3LNU A;  3PYG A;  4X62 E;  4JI0 I;  3QT7 A;  4X62 I;  4DPU A;  1XMO I;  4DR4 E;  2J7K A;  5BR8 E;  2DEI A;  4USK A;  1UEK A;  1S4E A;  5IWA I;  3J7A M;  4HYM A;  4DPX A;  3T1Y E;  4P52 A;  4MYU A;  3T1Y I;  4LF9 E;  4DV2 E;  2WW4 A;  1J5E E;  2UXC I;  1FJG I;  3QT8 A;  4DUZ I;  4DV3 E;  2UUA I;  1H74 A;  2UUB I;  2F4V I;  2UXB E;  4DUY E;  4DV6 I;  2HHH E;  4OX9 I;  1RRE A;  3OTO E;  1OJ4 A;  4JV5 E;  2A2D A;  1IBM E;  1MX0 A;  4JI2 I;  4DR3 I;  1FWK A;  1H7U A;  5LMU I;  4DR2 I;  1A6F A;  4JI7 I;  1KIJ A;  1DAR A;  1XNR I;  4LFB E;  2V2V A;  4DPW A;  3D4J A;  3PYE A;  1NHI A;  4DR5 I;  4B3S I;  3GON A;  1XMO E;  1S16 A;  3J80 Q;  3LTO A;  4DR6 E;  3WU4 A;  3ZZ0 A;  5A2Q C;  4DR4 I;  5GME A;  4DV7 E;  4ED4 A;  1H7S A;  1IBL E;  4JG4 A;  4X64 E;  4LF9 I;  4X66 I;  4JI6 I;  4JI6 E;  1B62 A;  2UXC E;  4JI1 I;  4JI1 E;  3K1J A;  4DV2 I;  1EI1 A;  1Z5B A;  3HUL A;  1N36 E;  4UT4 A;  1VIS A;  2V2Z A;  1ZM2 A;  4DR7 E;  5FLX C;  4B3M E;  4M1K A;  3LPS A;  1N34 E;  1D6T A;  1N0V C;  2E5L I;  4YY3 E;  4WUB A;  1PVG A;  4DV1 I;  1N32 E;  1N32 I;  4B3R E;  2VQE E;  2BV3 A;  4JI7 E;  1QZR A;  1HR0 E;  1I94 E;  4DR1 I;  4B3T E;  5A2Q Q;  2ZM6 I;  1ELO A;  1HNZ I;  2HKJ A;  1FKA E;  4B3T I;  1PIE A;  4JI5 E;  1FI4 A;  5IWA E;  3ZKB A;  4NXN I;  4LF7 E;  4LF4 E;  1ZM9 A;  4I3H A;  4GKJ I;  4FWG A;  4JI8 E;  1PKP A;  4Z7Y A;  1N0U A;  4JYA E;  4DR1 E;  2UU9 E;  1J5E I;  4DV5 E;  4DV5 I;  1ZXN A;  5GMD A;  2UUB E;  2UXD E;  4JI5 I;  1EA6 A;  4YY3 I;  4B3R I;  4WUC A;  3JAM Q;  2VQE I;  4WUD A;  3QT5 A;  4DV0 I;  3B78 A;  4DV0 E;  2CZ9 A;  1FWL A;  2X7I A;  4HAC B;  4RPF A;  2VF3 A;  4DXL A;  1NZ0 A;  4LF6 I;  4JI4 I;  4PRV A;  2VQF E;  1HNZ E;  3J81 C;  1N36 I;  4FWH A;  4YHH E;  2UUC E;  4B3M I;  4DPT A;  1HNX I;  1RR9 A;  2R42 A;  2DEJ A;  4DV7 I;  1NHJ A;  3JAM C;  1IBL I;  2V2Q A;  1Z0T A;  4LFA E;  2ZIT A;  4LFA I;  4LFC E;  3ZZT A;  4LF5 I;  4DV4 I;  4LFB I;  1FJG E;  2E1R A;  4KHP I;  4DR7 I;  4DV6 E;  3PYF A;  4NXM E;  2BM1 A;  4NXM I;  4LF8 E;  2Q2E B;  3QT6 A;  4JI2 E;  4PRX A;  4LF7 I;  1MU5 A;  5IT9 C;  3ZM7 A;  4X66 E;  1FNM A;  2V8P A;  3WU5 A;  1HR0 I;  4X65 I;  4GKK I;  4AQY I;  4DV3 I;  2HHH I;  2UUA E;  2LJP A;  2ZM6 E;  4DU8 A;  3J7A G;  4MYT A;  1KVK A;  4JI0 E;  2HFS A;  4EMD A;  2HKE A;  1H73 A;  4LF4 I;  4DR2 E;  1ZM3 A;  4JYA I;  1IBM I;  1HNW E;  2BM0 A;  1XMQ I;  3Q1Q A;  5LMN I;  1KTV A;  4DU7 A; 
#chains in the Genus database with same CATH topology
 4DR5 E;  4B3S E;  4DUY I;  2A2C A;  3J81 Q;  4DV1 E;  2IOQ A;  3KRN A;  3CWV A;  2AE8 A;  2E5L E;  2ZBK B;  4U3B A;  1XNQ I;  1XNQ E;  2HK2 A;  1B63 A;  3T1H E;  5FLX Q;  5L3J A;  1N33 E;  5C0X D;  1MG7 A;  2R3V A;  1Y6Z A;  1NHH A;  3CDI A;  2C38 B;  4LF6 E;  4JI8 I;  2O1W A;  5DRQ A;  4K0K E;  5DNX A;  1Z0V A;  2BA1 D;  2NPF A;  1XMQ E;  1Z0B A;  1OYR A;  2EFG A;  4OX9 E;  1Z0G A;  3M85 G;  4LCF A;  4QNK A;  2GS8 A;  4FW5 A;  4DUZ E;  1Z59 A;  2F4V E;  5K36 F;  4YHH I;  1H72 C;  2UUC I;  4DR6 I;  1Z0C A;  3ZZU A;  4P7A A;  2O1U A;  4FW7 A;  3K17 A;  4PU9 A;  4URL A;  3PYD A;  3WU3 A;  4XTJ A;  1Z0E A;  3V2U C;  1BKN A;  4LPF A;  4GKJ E;  2X36 A;  4JI3 E;  1UDO A;  1KKH A;  2OI2 A;  1U2R A;  1I94 I;  1ZXM A;  3V5R A;  2JEA B;  5LMU E;  5JEA B;  4LF5 E;  1XNR E;  2JE6 A;  4JI4 E;  1ZM4 A;  4GKK E;  4OKG A;  4KHP E;  2XEX A;  1VI7 A;  5IT9 Q;  4USM A;  5JEA F;  1YHC A;  2HFU A;  2WNR A;  5LMN E;  1IBK E;  3J80 C;  2NN6 D;  1IBK I;  1E3P A;  2V34 A;  2O3Z A;  4KQV A;  5BR8 I;  4BA1 A;  2UXD I;  3M85 D;  1YH8 A;  5K36 E;  4Z7C A;  4ZVI A;  4LF8 I;  5LL6 R;  3CDJ A;  4HXZ A;  4UTG A;  2PNZ B;  4JI3 I;  5K36 B;  4DR3 E;  4OO1 E;  2AJ4 A;  2HK3 A;  4LFC I;  1R6L A;  4FWD A;  3HJC A;  4FN5 A;  2UU9 I;  1USU A;  4X65 E;  1R6M A;  4K0K I;  1WUU A;  3WU6 A;  1Y4S A;  4AQY E;  2VQF I;  3H4L A;  1Z0W A;  2UXB I;  1HNX E;  3OTO I;  3F0N A;  4JV5 I;  5ELW A;  2CG9 A;  1N34 I;  2PO0 B;  4GQU A;  3M6A A;  1XHK A;  4NXN E;  3B8H A;  4HY1 A;  3B82 A;  3T1H I;  4IZK B;  4IZJ B;  1N33 I;  4HAC A;  2NN6 C;  4X64 I;  2F1D A;  1Z5C A;  4DPY A;  1UDQ A;  5C0X F;  1Z5A A;  4DV4 E;  1K47 A;  4FW9 A;  5JEA E;  1HNW I;  4R1F A;  2WP8 A;  3ZKD A;  3L7Z B;  3LNU A;  3PYG A;  4X62 E;  4JI0 I;  3QT7 A;  4X62 I;  4DPU A;  1XMO I;  5DRP A;  4DR4 E;  4IFD E;  2J7K A;  5BR8 E;  2DEI A;  4USK A;  1UEK A;  1S4E A;  2JE6 B;  5IWA I;  3P3E A;  3J7A M;  4BA2 A;  4HYM A;  2BA0 G;  2NN6 A;  4OZE A;  2IOP A;  4DPX A;  2VES A;  4BA2 B;  3T1Y E;  4P52 A;  4MYU A;  3T1Y I;  5K36 C;  4LF9 E;  4DV2 E;  2WW4 A;  4LCH A;  1J5E E;  2UXC I;  1FJG I;  2NN6 F;  3QT8 A;  4DUZ I;  3GCM A;  4DV3 E;  1H74 A;  2UUA I;  2UUB I;  2F4V I;  2UXB E;  2GQ0 A;  4DUY E;  3L7Z A;  4FW6 A;  4DV6 I;  2HHH E;  4OX9 I;  1XXE A;  3Q6N A;  3PS1 A;  4U3D A;  5DNL A;  1RRE A;  3B4T A;  1OJ4 A;  3OTO E;  4JV5 E;  2A2D A;  1OYS A;  1IBM E;  1MX0 A;  2C37 B;  4DR3 I;  4JI2 I;  1FWK A;  4OO1 D;  1H7U A;  5LMU I;  4DR2 I;  5K36 A;  4FW3 A;  4MU1 A;  1A6F A;  4JI7 I;  1KIJ A;  1DAR A;  1XNR I;  4LFB E;  2V2V A;  3Q6M A;  3PRY A;  3D4J A;  3PYE A;  4DPW A;  1NHI A;  4DR5 I;  4B3S I;  3GON A;  1XMO E;  1S16 A;  2C38 A;  3J80 Q;  2CVE A;  3LTO A;  4DR6 E;  3WU4 A;  4MQY A;  3ZZ0 A;  1P42 A;  5A2Q C;  2Z5E A;  5GME A;  4DR4 I;  4DV7 E;  4ED4 A;  2Z5C B;  1H7S A;  1IBL E;  3H1C A;  4JG4 A;  2Z5B B;  2PO2 A;  4X64 E;  4LF9 I;  4X66 I;  4JI6 I;  4JI6 E;  1B62 A;  2UXC E;  2C39 B;  4JI1 I;  4JI1 E;  3K1J A;  4DV2 I;  3U1K A;  1EI1 A;  2BR2 B;  1Z5B A;  3HUL A;  2CGE A;  1N36 E;  2PO2 B;  4UT4 A;  1VIS A;  2O1V A;  2V2Z A;  1ZM2 A;  4DR7 E;  5FLX C;  4IFD B;  4B3M E;  4M1K A;  3LPS A;  5JEA A;  1N34 E;  1D6T A;  4OO1 F;  1N0V C;  2E5L I;  1HK7 A;  4YY3 E;  4WUB A;  4QNJ A;  1PVG A;  5JEA C;  4DV1 I;  1N32 E;  1N32 I;  3P3G A;  4B3R E;  4FW4 A;  2VQE E;  2BV3 A;  2J65 A;  4JI7 E;  1QZR A;  5JEA D;  1HR0 E;  1I94 E;  2BR2 A;  3U1Y A;  1RHY A;  1UDN A;  4DR1 I;  4B3T E;  4J3D A;  5EL9 A;  5A2Q Q;  4NBQ A;  1ELO A;  2ZM6 I;  1HNZ I;  2HKJ A;  1FKA E;  4B3T I;  5C0X C;  2IER A;  1PIE A;  3K85 A;  4LCG A;  4JI5 E;  1FI4 A;  5IWA E;  3ZKB A;  4NXN I;  4LF7 E;  5C0X E;  2BA0 D;  2PNZ A;  4LF4 E;  1ZM9 A;  3UHM A;  4I3H A;  4GKJ I;  4FWG A;  4JI8 E;  1PKP A;  4Z7Y A;  1N0U A;  1E3H A;  4JYA E;  3HKM A;  4OO1 B;  4DR1 E;  4AM3 A;  4LOM A;  2UU9 E;  1J5E I;  4DV5 E;  4DV5 I;  1ZXN A;  5GMD A;  2JEB B;  5K36 D;  2O1T A;  2NN6 E;  2UUB E;  4MU4 A;  2UXD E;  4JI5 I;  5DRR A;  2WNR B;  1EA6 A;  4N3O A;  1UDS A;  1Y60 A;  4YY3 I;  4B3R I;  4WUC A;  3JAM Q;  2VQE I;  4WUD A;  2IES A;  3QT5 A;  3DD6 A;  4IZK A;  4DV0 I;  3B78 A;  4DV0 E;  2CZ9 A;  1FWL A;  2X7I A;  4HAC B;  4MDT A;  4RPF A;  2VF3 A;  2WP8 B;  5FWK A;  4DXL A;  2GO3 A;  1NZ0 A;  4LF6 I;  4PRV A;  4JI4 I;  3M7N G;  2VQF E;  2C39 A;  3M7N D;  1HNZ E;  3J81 C;  1N36 I;  4MU0 A;  4FWH A;  5DRO A;  4YHH E;  2UUC E;  4B3M I;  4DPT A;  1HNX I;  1RR9 A;  2GO4 A;  2R42 A;  2DEJ A;  4DV7 I;  2Z5C A;  1NHJ A;  3JAM C;  4IFD D;  1IBL I;  2Z5B A;  2V2Q A;  4MU3 A;  1Z0T A;  3P76 A;  4LFA E;  4ISA A;  2ZIT A;  4LFA I;  4LFC E;  3ZZT A;  1USV A;  4LF5 I;  4DV4 I;  2PO0 A;  4LFB I;  3P06 A;  1FJG E;  4OO1 A;  2E1R A;  2JEA A;  4KHP I;  4DR7 I;  4AIM A;  4DV6 E;  4OO1 C;  3PYF A;  4NXM E;  2NN6 B;  1Y5Y A;  2BM1 A;  3P3C A;  4NXM I;  4LF8 E;  2Q2E B;  3QT6 A;  4JI2 E;  4PRX A;  4LF7 I;  1MU5 A;  2JT2 A;  2PO1 B;  5IT9 C;  3ZM7 A;  4X66 E;  3PS2 A;  2PNL A;  1FNM A;  2V8P A;  4AID A;  3WU5 A;  1HR0 I;  3NZK A;  4X65 I;  4GKK I;  5EKW A;  4AQY I;  3GLL A;  4DV3 I;  2HHH I;  2LJP A;  2UUA E;  2ZM6 E;  4DU8 A;  3J7A G;  4MYT A;  1KVK A;  4JI0 E;  4IFD F;  1OYP A;  2C37 A;  3GME A;  2HFS A;  1Y4U A;  4EMD A;  2HKE A;  2PNM A;  1H73 A;  4IZJ A;  2PO1 A;  4LF4 I;  4DR2 E;  4IFD A;  1ZM3 A;  3PS3 A;  4JYA I;  1IBM I;  2JEB A;  4IFD C;  2BA1 G;  1HNW E;  2BM0 A;  4IZJ D;  1XMQ I;  3Q1Q A;  5C0X B;  5LMN I;  1KTV A;  4BA1 B;  4DU7 A;  4IS9 A;  5C0X A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  4B3S E;  4DUY I;  2A2C A;  3J81 Q;  4DV1 E;  2IOQ A;  3CWV A;  2E5L E;  2ZBK B;  1XNQ I;  1XNQ E;  2HK2 A;  1B63 A;  3T1H E;  5FLX Q;  5L3J A;  1N33 E;  1MG7 A;  2R3V A;  1Y6Z A;  1NHH A;  4LF6 E;  4JI8 I;  2O1W A;  4K0K E;  1Z0V A;  1XMQ E;  2NPF A;  1Z0B A;  2EFG A;  4OX9 E;  1Z0G A;  4DUZ E;  2GS8 A;  2F4V E;  1Z59 A;  4YHH I;  1H72 C;  2UUC I;  4DR6 I;  1Z0C A;  3ZZU A;  4P7A A;  2O1U A;  4PU9 A;  3K17 A;  4URL A;  3PYD A;  3WU3 A;  4XTJ A;  1Z0E A;  3V2U C;  1BKN A;  4GKJ E;  2X36 A;  4JI3 E;  1KKH A;  2OI2 A;  1U2R A;  1I94 I;  1ZXM A;  3V5R A;  5LMU E;  1XNR E;  4LF5 E;  4JI4 E;  1ZM4 A;  4GKK E;  4KHP E;  2XEX A;  5IT9 Q;  4USM A;  2HFU A;  5LMN E;  1IBK E;  3J80 C;  1IBK I;  2V34 A;  4KQV A;  5BR8 I;  2UXD I;  4Z7C A;  4ZVI A;  4LF8 I;  5LL6 R;  4HXZ A;  4UTG A;  4JI3 I;  4DR3 E;  2AJ4 A;  2HK3 A;  4LFC I;  4FWD A;  3HJC A;  4FN5 A;  2UU9 I;  1USU A;  4X65 E;  4K0K I;  1WUU A;  3WU6 A;  1Y4S A;  4AQY E;  2VQF I;  3H4L A;  1Z0W A;  2UXB I;  1HNX E;  3OTO I;  3F0N A;  4JV5 I;  2CG9 A;  1N34 I;  3M6A A;  1XHK A;  4NXN E;  3B8H A;  4HY1 A;  3B82 A;  3T1H I;  4IZK B;  4IZJ B;  1N33 I;  4HAC A;  4X64 I;  1Z5C A;  4DPY A;  1Z5A A;  4DV4 E;  1K47 A;  4FW9 A;  1HNW I;  4R1F A;  3ZKD A;  3LNU A;  3PYG A;  4X62 E;  4JI0 I;  3QT7 A;  4X62 I;  4DPU A;  1XMO I;  4DR4 E;  2J7K A;  5BR8 E;  2DEI A;  4USK A;  1UEK A;  1S4E A;  5IWA I;  3J7A M;  4HYM A;  2IOP A;  4DPX A;  3T1Y E;  4P52 A;  4MYU A;  3T1Y I;  4LF9 E;  4DV2 E;  2WW4 A;  1J5E E;  2UXC I;  1FJG I;  3QT8 A;  4DUZ I;  4DV3 E;  2UUA I;  1H74 A;  2UUB I;  2F4V I;  2UXB E;  2GQ0 A;  4DUY E;  4DV6 I;  2HHH E;  4OX9 I;  3Q6N A;  1RRE A;  3OTO E;  1OJ4 A;  4JV5 E;  2A2D A;  1IBM E;  1MX0 A;  4JI2 I;  4DR3 I;  1FWK A;  1H7U A;  5LMU I;  4DR2 I;  1A6F A;  4JI7 I;  1KIJ A;  1DAR A;  1XNR I;  4LFB E;  2V2V A;  3Q6M A;  3PRY A;  3D4J A;  3PYE A;  4DPW A;  1NHI A;  4B3S I;  4DR5 I;  3GON A;  1XMO E;  1S16 A;  3J80 Q;  3LTO A;  4DR6 E;  3WU4 A;  3ZZ0 A;  5A2Q C;  2Z5E A;  5GME A;  4DR4 I;  4DV7 E;  4ED4 A;  2Z5C B;  1H7S A;  1IBL E;  4JG4 A;  2Z5B B;  4X64 E;  4LF9 I;  4X66 I;  4JI6 I;  4JI6 E;  1B62 A;  2UXC E;  4JI1 I;  4JI1 E;  3K1J A;  4DV2 I;  1EI1 A;  1Z5B A;  3HUL A;  2CGE A;  1N36 E;  4UT4 A;  1VIS A;  2O1V A;  2V2Z A;  1ZM2 A;  4DR7 E;  5FLX C;  4B3M E;  4M1K A;  3LPS A;  1N34 E;  1D6T A;  1N0V C;  2E5L I;  1HK7 A;  4YY3 E;  4WUB A;  1PVG A;  4DV1 I;  1N32 E;  1N32 I;  4B3R E;  2VQE E;  2BV3 A;  4JI7 E;  1QZR A;  1HR0 E;  1I94 E;  4DR1 I;  4B3T E;  5A2Q Q;  2ZM6 I;  1ELO A;  1HNZ I;  2HKJ A;  1FKA E;  4B3T I;  1PIE A;  3K85 A;  4JI5 E;  1FI4 A;  5IWA E;  3ZKB A;  4NXN I;  4LF7 E;  4LF4 E;  1ZM9 A;  4I3H A;  4GKJ I;  4FWG A;  4JI8 E;  1PKP A;  4Z7Y A;  1N0U A;  4JYA E;  4DR1 E;  2UU9 E;  1J5E I;  4DV5 E;  4DV5 I;  1ZXN A;  5GMD A;  2O1T A;  2UUB E;  2UXD E;  4JI5 I;  1EA6 A;  4N3O A;  4YY3 I;  4B3R I;  4WUC A;  3JAM Q;  2VQE I;  4WUD A;  3QT5 A;  4IZK A;  4DV0 I;  3B78 A;  4DV0 E;  2CZ9 A;  1FWL A;  2X7I A;  4HAC B;  4RPF A;  2VF3 A;  5FWK A;  4DXL A;  1NZ0 A;  4LF6 I;  4PRV A;  4JI4 I;  2VQF E;  1HNZ E;  3J81 C;  1N36 I;  4FWH A;  4YHH E;  2UUC E;  4B3M I;  4DPT A;  1HNX I;  1RR9 A;  2R42 A;  2DEJ A;  4DV7 I;  2Z5C A;  1NHJ A;  3JAM C;  1IBL I;  2Z5B A;  2V2Q A;  1Z0T A;  4LFA E;  2ZIT A;  4LFA I;  4LFC E;  3ZZT A;  1USV A;  4LF5 I;  4DV4 I;  4LFB I;  3P06 A;  1FJG E;  2E1R A;  4KHP I;  4DR7 I;  4DV6 E;  3PYF A;  4NXM E;  2BM1 A;  4NXM I;  4LF8 E;  2Q2E B;  3QT6 A;  4JI2 E;  4PRX A;  4LF7 I;  1MU5 A;  5IT9 C;  3ZM7 A;  4X66 E;  2PNL A;  1FNM A;  2V8P A;  3WU5 A;  1HR0 I;  4X65 I;  4GKK I;  4AQY I;  4DV3 I;  2HHH I;  2UUA E;  2LJP A;  2ZM6 E;  4DU8 A;  3J7A G;  4MYT A;  1KVK A;  4JI0 E;  2HFS A;  1Y4U A;  4EMD A;  2HKE A;  2PNM A;  1H73 A;  4IZJ A;  4LF4 I;  4DR2 E;  1ZM3 A;  4JYA I;  1IBM I;  1HNW E;  2BM0 A;  4IZJ D;  1XMQ I;  3Q1Q A;  5LMN I;  1KTV A;  4DU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...