2UUCJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uucJ00
4JI3J 4YY3J 4NXMJ 4KY3A 4LFCJ 4X65J 1N34J 4JI5J 2VQEJ 2UXCJ 5IWAJ 3T1HJ 2VQFJ 4DR3J 2HHHJ 4LF5J 1IBMJ 4DV1J 4NXNJ 2UUAJ 1HNZJ 4X62J 4JV5J 3T1YJ 3J81U 3J7AN 4DV0J 2MTLA 4KYZA 2UXDJ 4OX9J 3JAMU 4JI0J 1HNWJ 4LFAJ 4PWWA 3OTOJ 1N33J 5LMNJ 1I94J 4JI4J 4DUYJ 1J5EJ 4YHHJ 4LF6J 4DUZJ 2UXBJ 3R2CJ 1IBKJ 4GKKJ 1HR0J 2MEWA 2MQ8A 4DR7J 4B3TJ 4K0KJ 3IMQJ 4KHPJ 4DR5J 1HNXJ 4LF7J 1FJGJ 4DV3J 4LF4J 4DV7J 4DR6J 4LF8J 2KL8A 2F4VJ 4HHUA 4NEYA 2E5LJ 3R2DJ 1XNRJ 3W1YC 4JI2J 1N32J 3J80U 1XMOJ 4LFBJ 4JI6J 4V1Ak 1XNQJ 3D3BJ 4DR2J 4X64J 5IT9U 5A2QU 4JYAJ 1XMQJ 2KVQE 1IBLJ 4RJVA 1N36J 5LMUJ 4DR1J 4B3SJ 2ZM6J 4DV2J 4JI8J 4LF9J 4JI7J 4JI1J 2UUCJ 4DV5J 3D3CJ 4NEZA 4B3MJ 5LM7E 5AJ3J 4X66J 4DV4J 2UU9J 4GKJJ 5BR8J 5FLXU 4AQYJ 4DV6J 4DR4J 2UUBJ 4B3RJ
chains in the Genus database with same CATH superfamily
2DISA 1ZA2B 4OJ3A 1N0UA 2GO8A 1Q81T 1U6BA 4NLWA 2XSJA 1NSQA 3RTVA 4BHQA 5E41A 1WG1A 5GAGU 2FJEB 5HI7A 4DV1F 2DR5A 1KONA 1JKHA 2DGXA 4GRSA 1TKZB 4AFFA 2XMWA 4QJVA 4X62J 2EI5A 1LXNA 4KIAA 2IYGA 1PJ7A 4HHJA 1TKXA 1M5PC 5CYJA 4FKYA 2H5IB 3WHIA 3GSIA 1PIEA 3RJMB 4NLQA 3WIVA 2VD3A 2K7KA 2DT9A 2W4CA 4RUHA 4QIGA 2D9PA 4E8UA 1WACA 5DRKA 3CB4A 3PW4A 4DL6A 2HVHA 1RA7A 3I82A 4QWBA 3MHYA 1RADB 4MTPA 3DOKB 2FHMA 5IS2A 3QRPA 1I1GA 2A2CA 2OO4A 3ZZOA 2CPXA 3TUPA 4HKQA 2K8GA 2DNMA 3HPOA 3T41A 2DHGA 1JLBB 5KG3A 1J5EF 2BM0A 2C3PA 1UETA 4YHHF 4PG5A 3O44A 1R89A 3GV7B 1HBUB 1VQNS 1HHSA 3QFWA 3LPYA 5IT0A 2BE9B 2X1AA 2HAFA 1CQNA 1UP1A 5U47A 3D66A 2WB1D 4P2SA 4ALZA 4NRTA 2MQ8A 4TNOA 3KG4A 1W2BR 3EVWA 1WNEA 2AJ4A 4C7QA 4OYOA 4OJ1A 2EFQA 1VFJA 1DARA 3RB0A 2RS8A 4XPCA 1T3OA 2Z2LA 2FY1A 4IOAQ 2ZJRQ 5J2PA 4H4OA 5E7OB 4WU3A 1FRMA 2P9CA 1GNKA 3MPYA 3IG1B 3R27A 4I2PA 4I56A 5A76A 2DXFA 5BXIA 2ZKUA 3HK2A 1R43A 4LIRA 4Y65A 4F7VA 5BYSA 1FJ7A 2D1CA 4KKOA 1JQGA 1M1GA 1YZ7A 1U1PA 2JLFA 2LA6A 3GFZA 3I32A 3DOLA 5CCLA 5D8HB 2YKAA 3BN4A 3FKBA 1KR4A 1YZ6A 2ATCB 1MMDA 2PD1A 3QIDA 3RW7A 3KLHA 1T3NA 2HS0A 4DSEA 2YTCA 2GVDB 4OHVA 2ZITA 1VBXA 3DRRB 1NZAA 4DPTA 3UFCX 2WB4A 3MTJA 5I3QA 1JIHA 4RUBA 3B78A 2HFOA 3RBZA 1X4EA 3ZZUA 1WHVA 2ZE2A 4Q8EA 4B3OA 3MEDB 1L3KA 4L75A 4ILLA 3CCTA 2RDIA 3QJLA 2WSEC 4DX6A 2ZM6J 1REVA 3CW2C 2NXNA 5ETLA 5KG0A 2DNRA 1UW4A 1QY7A 1VISA 2CNOB 2G2OA 2O67A 4MH8A 3UQSA 4LF9F 2GA7A 3MR2A 1NU4A 4RW7A 3R1LA 2Z0GA 3ICLA 3UNGC 4NEZA 3CO9A 3U02A 4YUDA 1OSCA 3KK2B 4ERDA 1LKZA 2NUUG 3C8YA 1AT1B 3M8WA 3Q2SC 1SKWA 2FHJD 1KQFB 3QO9B 4B17A 1S59A 1ZH5A 4Z37A 1HI8A 1YIJS 4L76A 4LRCA 4FVMA 1D8ZA 2BABA 1PYSB 2XY7A 2BQUA 2VPWB 3ADAC 4MK8A 5HMWA 5AXNA 2CYYA 3KUGA 4QPXA 1EHWA 1HLWA 2IM2A 4WE1A 3MAHA 3HT3A 3GILA 1YJNS 1VQLS 2DITA 1X4BA 1DTQA 3D1QA 4PQUB 5AE3A 3PW0A 1NK7A 1QSYA 1F2HA 3AB2B 4UT4A 3W5YA 2OFHX 1WTBA 2DRDA 2W1BA 4ZP6A 3BDPA 1LFWA 2DK2A 1CC7A 1RTDB 1RTDA 3S6EA 4LQ3A 3B4MA 2BJ7A 4J9LA 3I87A 1QVFR 1T02A 3ZZYA 2HRUA 5H9EJ 5KFMA 3G6XA 5EDWA 4DSKA 3NNHA 2I5JB 4MKAA 3CT9A 3EGNA 3DC2A 3QWPA 4H4KC 4CLTA 1CJTA 2XY6A 3GJSB 3QRRA 2YKNA 3CDAA 4KPCA 3SXLA 3TOQA 5D4LA 5KFXA 1NUEA 4YB1P 2XB2D 4FNHA 3MR3A 2JEGA 4A46A 3UCZP 1APSA 4KC5A 2IY5B 2F8MA 3NGDA 3MECB 1S9GB 1HNWJ 2UP1A 1U4BA 2VG6B 2XMMA 2ZD1B 2AKWB 3KJVA 5D3GB 5GAGI 2HVZA 2QN6B 4NL5A 4UZCA 4CI0B 2U2FA 5A2QY 1SJFA 5D15A 3LP1A 4U7CA 3QNWB 1GEHA 3FBBA 5J2NA 2UXBJ 4GC6A 1IBKF 4F3OA 1UVJA 2Q66A 5DM7Q 3NWRA 4BWJA 1S0VA 3M8RA 3E3XA 4PCQA 2VPXB 4N7TA 4P52A 5GAEI 2F63A 5FLXY 2DNLA 5DDOC 1FKPA 4OLPA 1IKWA 1PBAA 3HZEA 4J9SA 3NNAA 2VU5A 4LUBA 3TUZC 1VRTB 1YJVA 4ICLA 3MURP 5F0WA 2RKIA 1OY8A 3OTEA 3PYDA 4FP9A 5KG6A 4NLSA 5CQGA 2ZZNA 1UFLA 1IKXA 4IFYA 3ZNUA 1HNXJ 4ZJLA 3Q22A 3DXBA 2V63A 5I3UB 1M0SA 4CCHA 2VFVA 3O3LA 1NDPA 4LF4J 2YX4A 3DU5A 5GAEU 2FZGB 3JS9A 1JXLA 3D2WA 2JFKA 2QYCA 2ZH4A 1RT2B 1KD1T 2HHWA 3DHWC 4HHUA 3R2DJ 1XNRJ 3HX9A 2KZMA 1HBNA 4K2XA 2HZCA 1VHFA 2HS3A 2MJNA 3EDQB 4BC7A 3NCQA 4FPIA 1TK0A 5KFDA 2FVQA 2BE2B 3BQ0A 3AJ2A 4OHXA 4OHWA 3KJFB 5E3PA 1IJEB 1RAAB 3QZ7A 3GIJA 5FJ4A 5IT9U 4AT1B 1HWLA 1OO0B 3OL7A 1TL3A 2DNHA 3CTRA 3DM2A 4FF1A 2GIQA 2HWTA 2E5GA 5JVGQ 1KTVA 4RNMA 3G8TA 3WBZA 2A6MA 2XYPB 2O3DA 3I96A 3F73A 5KFZA 4W98A 4Z7CA 3DLBA 2NXEA 2C2KB 3U1NA 1V9OA 3CJSA 4Y28C 4DHVA 1HMVA 2PIIA 4B3SJ 3UD5A 4DV2J 1PILA 3A8EA 3HKWA 1XN9A 2BMBA 1XR7A 3FC9A 1CJVB 2YKOA 2AF6A 4USUA 3S1TA 2BANB 2CNKB 3W2WA 2UV8A 3TAMB 3VAKA 2GGPA 1VCTA 2V9KA 1RT3A 2CQ3A 3OV7A 3T5KA 5AT1B 3F44A 3KNAA 2GCFA 3KYLA 1Q0NA 5AJ3F 2IRXA 5DO2A 2CDRB 1I3OB 1YGYA 1M5OC 3DLLQ 4A47A 5HVGA 2DXDA 2MQLA 3MMCA 4GC7A 3TAPA 4PKDB 1M1KT 4F0KA 1S12A 4J9NA 3LPEA 3HHLC 1H74A 1FVQA 4J9KA 4QYZJ 2WVDA 2ZWOA 3CCSS 3MCOA 2YBVA 2ZH2A 4I6YA 3IGVA 3ZZ0A 2HFZA 4DX5A 3NGSA 3SCKE 3QPIA 5L9NA 3H20A 2RAQA 1AFIA 2H9ZA 3HCXA 2WTFA 4JI5F 2GJIA 4ZVTB 1SKRA 4ECZA 1Q86T 3OXGA 2PO4A 1DQ9A 2H5JB 2E1PA 3B54A 2Z2MA 2HQ3A 4HEA9 3KMSA 4ETZA 1RT5B 5DS7A 3BB5A 3DLEA 5K8OA 3N01A 1X9WA 4M95A 1QM9A 1VK3A 3MCNA 4NZ0A 4OI4A 2L9NA 1N4LA 4RL1A 1VYAA 3TP2A 1S10A 3T9NA 5B0CA 4DBQA 4ZVQB 1B99A 1AUSL 3MEEB 4DL0C 4JB8B 5HO4A 2CQHA 2MTLA 3HHLD 4OLOA 1N8RT 1FCAA 5M2UA 5IZHA 3JAMU 2RJZA 1JLEA 2X1GA 3HSDA 4OZ5A 5LJ5Y 4U67Q 5E3RA 4K8RA 3D1HA 3THPA 2E9RX 3R7NB 3OFHA 2J0XA 2OMLA 5HQ8A 1SV5A 1HNWF 2C2EA 1T94A 5J2NB 4QPTA 4PUOB 4LREA 1FFWB 4PQAA 1MU2A 4RNFA 2RRNA 3HVTB 1RE1B 4ZVUB 5KFWA 4ZKAA 1DTTB 3OSNA 3KLGA 2CPZA 5B08A 4LF6J 3C16A 1CQMA 2IDEA 4MT1A 4DUZJ 3GJRB 2OPSB 3PYEA 3W2VA 2YH0A 1HR0F 1DHMA 1ZM4A 3DLHA 1NB7A 1CSJA 4KQZA 1S48A 3ENAA 3MCSA 4DPYA 4Q43A 4DR5F 1HA1A 4DFMA 2YX7A 5CA5A 1KLNA 1F60B 4ZJQA 1ROFA 2C22A 1K0TA 3OHBA 4ZN3A 3PW2A 3M4XA 4DI6A 2VG7B 3M2RA 3W64A 5LXYA 1VBZA 3GLJA 1DURA 1HNXF 1HQ2A 2QTWA 4RBUA 2HFSA 3CMES 5KFRA 3C15B 3TWZA 3J7YI 2JSXA 4P10A 2KYXA 1TKXB 2EW9A 2E44A 2GIRA 5A0YA 2FJDB 2PMHA 3MUVP 3C14A 2QIFA 4NEYA 2C1EB 2HQGA 1ZM3A 4RW8A 5CYMB 1UWBB 3SQGA 4EZ9A 5T7LB 1SI9A 3UPFA 1RTHB 4PR6A 5D6GA 1SQFA 1XMOF 2FZKB 2D9OA 2V69A 4WFYA 3EJMA 4OFZA 3FEXB 2W8LA 4EBCA 3ENVA 2UVRA 2VG5B 3D3BJ 4ID5B 2E1MC 1NXIA 1VJQA 3A8IA 1IR0A 1GX5A 1S9GA 1W7WA 1EKRA 2E1RA 3D1OA 3RYLA 3ULHA 4X64F 1F1BB 2K3KA 4F8RA 3H7HB 3K0JA 5KFBA 4F02A 1RKJA 2FJWA 4HT7A 2XLIA 4UW2A 2GS8A 3DRXA 2PSZA 1KSPA 3W5XA 1RWOB 5EHHA 3KLFB 3MM5A 1RT4A 4NLGA 4IOCQ 2IM1A 1MN9A 2JZ5A 4DR1J 3T5HA 3CULA 2K1RB 3GIMA 2CPEA 3VTIA 1VRUA 1QJHA 2P6TA 3OL6A 3BSCA 1K8AT 4UQGA 1FK9B 4JOUA 1JLQA 1RWXB 4DQQA 4I2QB 3AT1B 1LK5A 1VQKS 3W63A 2W01A 3HM9A 3GWCA 1OPZA 4KH1B 1SPBP 2FJVA 4B3MF 4C8KA 1EARA 1GT8A 3M05A 3Q8UA 4G1QA 4GVBB 5ETKA 5AJ3J 2W9CA 2CIMA 4K4WA 1U1NA 1R0AB 3JSYA 3MMAA 4IFYB 3K5PA 2I6WA 3FK4A 1DBDA 3SSQA 4DV4J 3LWLA 2UU9J 4N76A 3OR2B 4LQ9A 1HPZA 4UY85 2VA2A 2YWFA 3VAJA 1WF1A 1WC0A 2VDHA 3AA9A 2Q79A 4B9MA 4X4VA 1DFDA 4RW9A 2LVWA 1RDRA 2O66A 1PJ6A 3IR7B 2V9WA 3THVA 4WP9A 4WWSA 5L1IA 3TJAA 1PJ5A 2F65A 3MFHA 4LFCJ 2KXNB 3Q8SB 3IC1A 2MZRA 2AIRB 1KS2A 2DHHA 2M5YA 1VQSA 5FDLA 3CPWR 4DR3J 2PI5A 4K4UA 2DIUA 2RDDA 4QW9A 1NJIT 4CNZA 5M2RA 2UUAF 1EP4A 1XTZA 3M2UB 2XULA 1LEOA 3M9MB 3MWBA 1TTHB 3ZC4A 1WHWA 4J90A 3WDOA 2L9DA 3IBFB 3WZ0A 4DU7A 4TU7A 1UZDA 3SV3A 1Q8LA 3MEDA 3DLKA 1NNDA 1DQ8A 1Q5VA 1REVB 3NMRA 4OX9F 4KPYA 2YWEA 1IBCB 3HI9A 1X5OA 5ETPA 5DG8A 3Q8QB 4I68A 4JI0F 2BXJA 3PJWA 1OYDA 2B8QA 3C6TB 4WK1A 1NHVA 1BQMB 1XQIA 3CWJA 4B9TA 3P6YC 3RGIA 2FGCA 4PAAA 2OJ3A 3QMQA 3MM7A 5E2QA 2N4DA 2HHXA 4Y2IA 2CFXA 1I94J 1YQHA 3M32A 3THTA 4F4YA 1PSDA 5EWFA 2V67A 3E01B 1RYRA 5KOWA 3N28A 4DUZF 2EFGA 2LXUA 3LGNA 4ZCKA 1MN7A 2BJ9A 3MF5A 3UVJA 2B4PA 4QR2A 2BKOA 2HNDA 2C2NA 2IDLA 2FC8A 2E7XA 3ZTRA 4NYZA 1MMLA 4DFKA 4I6WA 4A8FA 2IBOA 3TVKA 2H5EA 2EFNA 4PG6A 1RSCA 3ZNJ1 1K9MT 4O3RA 1LFPA 1NDKA 3MECA 2JEIA 4CIOA 2VHGA 5CD4H 3L3CA 2V0NA 3EYZA 1S9EB 1KNZA 1IR1A 5J1PA 3T5JA 1PAUB 2HS4A 1FDAA 1WC3A 1Y3KA 1JLFA 1EETB 1R31A 3KDOA 3KNGA 4RW6A 3UW1A 4QWEA 3CGIA 3VAFA 3PX4A 1FJCA 3MAAA 4NWBA 4W4MA 3N5BA 3T3FA 3QGIA 2E5LJ 4IH6A 1N32J 4I4BA 1NSAA 2MZ1A 1TVRA 3LF0A 2FC9A 3QAEA 5KG5A 1LXJA 3BYPA 5G0RA 4UQTA 4X64J 3VAMA 4HI2A 2HQDA 4DCPB 1TMJA 3CEDA 4WPAA 3NEKA 1MU2B 5C42A 5A2QU 2E66A 3ZTQA 2V6AA 3V6DA 3JQMA 3JB9k 1U0SA 1LW0A 5HATA 4M5MA 3TA0A 5I3UA 3DI6A 2ACMA 3QZ8A 1UVIA 2M2BA 2NLWA 4NZ6A 2KH9A 4KO0B 4DR1F 1Y7PA 1WD6A 3X1LB 2MQMA 3EZUA 3PRBA 1BWVA 2MKHA 4HH0A 4IFVA 3Q23A 3EPIA 1SKSA 1AW0A 5BYRA 1YBTA 1Y00A 1T03B 1QAYA 3OTBA 3PHTA 3M8YA 4MK9A 2LLZA 2B43A 3GG0A 5B0BA 3RR7A 4JUZA 1AZSA 1HARA 4DSLA 4FYDA 1AROP 2MLYA 3RUBL 4DV4F 1HBOA 5C5JA 2EBEA 3HF5A 3UO0A 5BR8J 3OFEA 4P7VA 3HO1A 4LMZA 3PKYA 2XYGB 5F0UA 4DV6F 4ED7A 1RKIA 3DU6A 4FPRA 4NYPA 3J7A1 1HMVB 4DX7A 2GAHC 2F7VA 4F0HA 1NEEA 2MHNA 4NLXA 5C2CA 2VKZG 2J0QD 1NAQA 4ILMA 4NXMJ 2RSQA 5AE1A 4X65F 1FI4A 2GHVC 2MZTA 4LRDA 2QA4S 2CJYB 2BANA 5ETSA 2V2ZA 1KHWA 2QC3A 2JH3A 2D3OR 1P1TA 1TAQA 2AX0A 3M30B 4O0IA 3DGPA 2UVVA 2DBBA 5HROB 2QL9B 3MM9A 3N4WA 2KTQA 1HWUA 1YJUA 4DPUA 4DDFA 9ATCB 4KFBA 3PO5A 3ETOA 5ETQA 1WWHA 2AU0A 3RU0A 2IM3A 4ZK7M 1WHXA 2G9OA 2KFNA 4A48A 3TNVA 2H48B 3ET6A 1TKDA 4W92B 3EVOA 3KLIA 1KVIA 3ZZZA 4JV1A 2J7UA 1H0HB 1D9FA 1SJQA 4JI0J 3JQKA 3M6UA 2CJXB 2HPUA 2Q6BA 4MMOA 1F6TA 1JNRB 2JC1A 3EZ5A 4EGLA 2UV8G 3MZIA 2W9CB 4JI4J 1I94F 1HBUA 4M5JA 3CJ0A 4YP3A 3PR5B 2ZKTA 4QIVA 1FKOB 1QE1B 3BDEA 1O8BA 1HHTP 3GG1A 1LWCB 1O0PA 1N0VC 2M88A 3OL8A 4RW4A 1UVLA 2CVEA 1QSLA 1ELOA 1RT1B 4J9RA 1B3TA 1RT6B 4USJC 4I7FA 3QGGA 3A12A 2ZBIA 4ZP7A 2FLOA 2QL7B 4OZ1A 5AXKA 1H72C 4K0KJ 3IMQJ 5DG7A 2FVRA 3FFIB 4ZJOA 4MFBA 2GNKA 3QYYA 2OH2A 3H42A 4CP5A 1CEZA 2KG0A 3P96A 4NRUA 3GFHA 4J37A 4XTTA 3MEEA 4DU8A 4KRWA 3CJKA 2AZ1A 2JNJA 5D78A 3ELHA 5KFIA 3F41A 1VC6A 4U9RA 3DLKB 2F4VJ 1MW7A 2MKKA 2NPIA 1NKCA 3GCXP 2KI2A 3LAMA 3V4MA 1C0TA 2OEMA 3HKZD 4UTGA 3M7VA 4RW7B 1L3TA 1JX4A 4PWDA 1RTJA 4JI6J 4C4WA 1XNQJ 3G6YA 4ECXA 5KFCA 3B82A 2IRUA 3LW5C 1E6YB 1QUVA 3PVXA 3G96A 2YNFB 3MM7B 2B4OA 2F1FA 3HVTA 3RBXA 1XMQF 1U47A 2ZE2B 4FKXA 2B7CB 3SSSA 1RQ0A 1PYOB 2CQDA 2XNRA 2XC9A 2MKJA 1RAEB 4N47A 1U0HB 5KG4A 3FSXA 2DGUA 3HFVA 3P45B 4C3KA 4A4JA 4WFZA 4I67A 1WOOA 7FD1A 1SH0A 2YNGB 4UUXA 4JI8F 4X4SA 1XK8A 4MKVA 3FDSA 5LL6d 4DPXA 3R6LB 3IR5B 4PABA 2MKIA 1RWVB 2VIHA 2NQPA 4NLOA 5IM0B 4DL2A 2CNNB 2GV1A 3BKUA 2XBPA 1SC1B 3D3CJ 3PNIA 4N41A 1YBUA 4U7UD 2X51A 2DPIA 4XPEA 1FWLA 4NLPA 2KRRA 4IO1A 2ZVSA 2RUSA 4MIBA 2RRBA 1D1UA 4EO6A 3N9UC 4DMZA 4IQXA 2R7TA 3CJRA 1HQUA 3HVRA 4MIAA 2DH9A 5BR8F 3K57A 1U2CA 1ZAXA 2DB1A 3QSIA 4Y6IA 4AQYJ 2V94A 1P9YA 4S0MA 2R7OA 5HMYA 1U1MA 2UUBF 4WE1B 4NLTA 2WONB 4NPOA 4X4TA 1SH2A 2XMAA 1RT7A 3SZ2A 4NXMF 1B0PA 1WI8A 2LU2A 3W62A 2ZH6A 4GO7X 3POTA 1NK0A 1R8CA 2HHVA 4J9VA 4R5PB 1KQSR 1ITPA 2HHHJ 2BYCA 4HTIA 3LGHA 3VZIA 2VG6A 2ZD1A 1V5IB 5EX0A 4G1QB 3ZTOA 2ZOMA 4M5DB 4CTAB 1SC6A 1C0UB 2YXLA 4O44A 1X0FA 5KAKA 3MMAB 1UVMA 3PRDA 3VHQA 4O3SA 3N5FA 2A6OA 3IWNC 3MM5B 4FBUA 2CPJA 3CCLS 2DR7A 2N7YA 1DJ0A 1S79A 2GO9A 2DHAA 5K8PA 1GMWD 2Y8WA 4IKAA 3AA8A 1GAOA 4IG3A 1VRUB 1U2FA 4RBVA 4OYZA 1H2UX 1TELA 3UI3A 4DL5A 1RTIB 1JJ2R 3FNNA 3P5BP 1OY6A 1U49A 1IKXB 2IMWP 4AL6A 3DCAA 4P2XA 3DXSX 1HYSA 3MPVA 3GSDA 5LMNF 3FEZA 4RPFA 2IBKA 5CH7B 3T1AA 2QLXA 5JXSA 2X1FA 1RWUA 3W61A 4KR0B 3TI0A 4W90B 4YN3B 2YX1A 2IA6A 1S72S 2X3DA 1M90T 3CIZA 8AT1B 4GKKJ 1MROB 2ZZTA 1NSKL 2OP5A 4HACB 3W65A 1S6OA 5F8IA 3HT0A 2WVBA 3NG8A 4RUCA 1W25A 1ZPVA 4OI1A 2KYZA 2Z2YB 3NP5A 4ICLB 3CO0P 3NS6A 2RRAA 2VBYA 5H9FK 1NH8A 4LRBA 2HGNA 4C2MA 2FGOA 2RQKA 4D3HA 4ER8A 4U95A 3K8WA 1IUJA 3AXMA 4M5IA 1R8AA 3OR1B 3GE9A 1K1SA 1YJ7A 2DGOA 3LP2B 4PG7A 1DLOA 2B56A 3U1LA 4LBIA 2H4YB 4CO4A 3HHLB 1S1TA 2X7IA 3NRBA 4ZPVR 2ALZA 1JJHA 3TQEA 3H5SA 4C8LA 5D4OA 2E1CA 4WFBQ 3SFGA 4IOBA 5J1EA 1Q8KA 3BGRB 2OPQB 4A8KA 3AODA 4JI2F 1ZYQA 1CJVA 3FCWA 4G65A 4LVOP 3V81A 4LT6A 4TLQA 3MEKA 2OELA 3L09A 1VJWA 4WU2A 4LSNA 3G6VA 2PN6A 1N5YB 4PPDA 4JI6F 1RT3B 2HK3A 1VQOS 4LFBJ 3EICA 3H8YA 4DJBA 3MPUB 1FX4A 1T11A 3LH2S 1KKHA 3J7Z5 3D5MA 2YNHB 3ZO7A 1EIYB 4DUTA 1K1QA 3V4IB 2WOMB 3KLEA 4WBFA 4YS2A 2J9EA 1JLCB 3FSIA 2BDPA 3RRHA 4H54A 1TP7A 2R2TA 2DY9A 4U8VA 4IR9A 1P9QC 3HDSA 3G82B 2HNDB 2PDAA 5F9LA 4MAKA 3TAMA 4M63A 3GMGA 3GB0A 1T05B 3QLHB 1RT1A 1NK4A 3SEOA 4R8UA 3OVSA 5J1NA 4DV5J 4OV6A 1S49A 3G8SA 1F5AA 4FN5A 3W8PA 2J9CA 1I51B 1VK8A 2A18A 2M70A 2WVEA 3IWXA 5HBMB 3CC7S 5KFKA 2HQFA 3T9ZA 1KVJA 1WOSA 1NKEA 4V19J 4DG1A 3QJJA 3M8QA 5CZXA 5DDRC 4A8XA 3MAQA 1FX2A 2VBWA 2KT5A 4NXNJ 1B7YB 4DR4J 2VICA 1OJ4A 1PBUA 2ZBPA 4B3RF 2HMIB 3DYAA 2JVRA 3R9LA 3OL9A 2DGWA 1HW9A 4F4WA 2LQ9A 1TVRB 2VQEF 2UXCJ 4PWDB 1IKVB 2C3OA 3UD3P 2DH8A 3M2VB 4KGKA 1TL5A 2XSJB 3AOAA 5HQMA 3HMJG 3T1HF 2POKA 1A6LA 2ZFHA 3DLEB 3FZ2A 3VZHA 4C98A 1IBMF 2VODA 5I42A 1DTTA 4E98A 2O1PA 1TZ0A 3NAHA 1GK8A 4YB5A 3L4BC 1IKYB 1H7XA 3QBCA 3TZWA 2RT3A 5LXRA 3CC2S 2DIVA 4ED1A 4ANCA 2PA3A 2ZC4A 5D0GA 3RW6A 2ASJA 4CLPA 1SKUB 1UFKA 1RAFB 3C2PA 1JLEB 5AE2A 4UOFA 2J8AA 5E3AA 4ED8A 4QCLA 1AFJA 1CPZA 1P8GA 2R8HA 4ED0A 5I3PA 4NASA 5LSOA 6FD1A 2GZOA 4X4OA 1G6BA 1WF2A 2HURA 5KFTA 2ZH1A 5IM0A 3CCWA 3EDRB 4LFAJ 1NHUA 1ZZFA 3KHLA 1N33J 2M9KA 3WC2A 4KHRA 5HLFA 3C16B 2O01C 4ZHRA 2W2MP 5HROA 3M8PB 1R7IA 3CD6S 4ZLJA 2HHPA 2DXEA 2GHWA 2N4CA 2C28A 1T7PA 3PY8A 3QGPA 2GFFA 2OUGA 2BRKA 1CBKA 2HWIA 3FCHA 5E33A 3V5RA 1TV6B 1UPPA 4WFNQ 1TFYA 2GAGC 2V34A 3BS9A 1RWNB 5BYQA 2ROEA 4IH7A 2QE5A 4XDCA 5C25B 1UEVA 3OUYA 1B7FA 5A6PA 1BY9A 2B4UA 4C11A 2ZHBA 4DR7J 1YVFA 1KQGB 4B3TJ 2ERRA 4Y3CA 2IPOB 2IAJB 3QATA 4ENOA 3RR8A 4RZRA 4ELUA 3GR1A 3RAQA 4FF3A 5L1JA 3FSYA 1P1LA 4NYOA 4ATNA 2GW8A 3HD2A 2G2YA 4Y2MA 3CD0A 4M5DA 5KFSA 5J2PB 3CCVS 4LF7F 4A8WA 4ITSA 3OSPA 4C0HA 1SH3A 4O3PA 3RZAA 1HKAA 2VJUA 4HR2A 1X31C 3CJ3A 3LQVA 2EFVA 1Y4ZB 2FHOB 1RISA 1SUQA 1BQNB 2R2SA 1OMSA 2DR9A 2C3UA 2IYIA 5IOLA 3J80U 4OZ3A 1X4AA 1JB0C 3VAHA 3VGSA 3DOLB 1ZS6A 3CJ8A 3IA0A 3AAWB 5GMEA 2Y0BB 1ZETA 1S1UA 2GVDA 1NK9A 1YX2A 3SMZA 3TVZA 3A3PB 3QIPA 2DD8S 1RHKB 3NS7B 1FA0A 3G8QA 4HL9A 2RS2A 1URNA 2RVJA 3LUYA 2RF2B 2LYVA 3BGOP 3S01A 1V3SA 4EU0A 5LMUF 3PYFA 3KJQB 3CNQP 3PEJA 4ZN1A 2XO7A 1JLQB 2F9DA 2XMTA 2WK4A 1S9FA 2YKQA 1K73T 2UUCJ 2KRBA 5KG1A 3TZYA 1G3OA 4LRFA 1Q7YT 1FTRA 2QJ3A 1NB2A 3KG1A 3W60A 1R8HA 4HHHA 2Y1IA 5F3ZA 2JLGA 2IA0A 4M8LA 3OHAA 1FE4A 1FTCA 2AHOB 1YRTA 1IR2A 3OR1A 1FXLA 5L46A 2FPHX 3H40A 3PW5A 1VQ9S 2B9XA 3ZTPA 4DCJB 5KFOA 2MGZA 3PIPQ 5SUHA 4DV3F 2HLTA 2C42A 1S1TB 3BPSP 2DNPA 5EX3A 4DPWA 1WEYA 1XERA 2ZH9A 3R1HA 1RHUB 2G0JA 4TXSA 3KXDA 4RX6A 4QIFA 4ZVGA 2GIFA 2BQRA 3DDIA 2XMKA 2LEAA 3PX6A 3C6TA 5KT7A 3HHKA 3R8YA 2QLJB 2VFRA 3DMJA 3QT5A 1SCJB 1FFSB 3D6TB 4NCGB 2H3EB 2FZCB 1JLGA 2AW0A 3OQ2A 3JTNA 4LVNP 4OIXA 3RB6A 1FF2A 2AGPA 2XLKA 3A3NB 4CDIA 1S0NA 3ITHA 2C2DA 3MR6A 2GQCA 4K50A 4Y34A 3AH6A 2XSFA 2MSTA 4ES3A 3BREA 3D0IE 1WUUA 1MWZA 5A8RA 3WX4A 4X62F 1M5KC 1U0HA 2FQQB 4CO0A 3UDEA 4DLEA 3QRQA 2R7WA 2WZ1A 3A8JA 2LMIA 1A9NB 1K44A 1V3ZA 2OIHA 2QG9B 2HBZB 4BBYA 5DQHA 5L1LA 2FJXA 3TX8A 3WIUA 3GV5B 4O4RA 4J9PA 3KJNB 3H4DA 4OI0A 5D0HA 1FRLA 3KFWX 3P49B 4C0OC 2R8JA 1IQTA 3H0PA 3NGUA 4ZVEA 1CG2A 5A6WA 4LFAF 3UCUP 2KN4A 4PWWA 5HQLA 4UUWA 4A8MP 1SQGA 1VOMA 5KG7A 3JYTA 4GO5X 2YNIA 1N33F 1YJRA 3I0RB 3O6QA 4YHHJ 4USKA 1SL1A 3MPWA 2ZHAA 3L7PA 4AYBD 2OPPB 1VR6A 2HHQA 5A8WA 4ZCLA 3HSJA 1WKLA 4NE9C 3KHHA 2R2UA 1R0CB 2RQMA 2XWXA 3R7SB 1I5OB 2WONA 2HMIA 3S8SA 2SXLA 2HNZB 2R7RA 4O3NA 4OMFG 4B08A 3KKFA 2J6UA 4USTA 3SDEA 1UMJA 1P27B 4AXJA 1U2RA 3PTWA 4ZLNA 1MNEA 2OEJA 3GTYX 4NMXA 5KT2A 3TARA 3CIMA 4DV7F 1HW8A 2ZUAA 3I56S 1FJEB 4LF8F 4XAKA 1G1XA 3I0SA 3A3OB 2R7QA 4CM0A 2DCLA 4URGA 4JBCA 2YKMA 1R6VA 1NJZA 2W8KA 3IAM9 1FDDA 1UEKA 1OS5A 3WX8A 3MD3A 4O4GA 4F26A 2XCAA 2OKQA 4DR2J 2N3LA 4EYHB 2L08A 4R25A 4M5GA 3DGVA 4FVCA 4N5SA 3VR1A 1IBLF 4F2RA 2AJ2A 3LP2A 5DQIA 1WEXA 2M0GB 2NREA 5RUBA 1MROA 1U8WA 2MLXA 3IWLA 2Z58B 2YWKA 2ZM6F 4C9DA 4YDXA 1KHVA 3M8SA 4PPZA 3DNCA 1ACMB 5K9FA 2XHCA 2EFOA 4DS4A 2LDIA 2JWNA 4FYXB 3UR3C 4DZDA 4LSNB 2A2DA 3SV4A 1FNMA 1N5YA 1QSSA 1YWXA 4KSEB 1N56A 3J81Y 2C2ZB 1QAJA 3QT6A 1TK8A 2IC3B 3OXFA 3NY0A 3T19A 1C4CA 2Z57B 3BGFA 3CUNA 3KMQA 4B3RJ 4ECSA 1JLBA 2JJ4D 1JJ4A 3DKDA 4HH1A 3IG1A 2DGTA 1T9WA 3PACA 4ILRA 3KOAA 3Q2TC 4GKJJ 2FJBB 1F5BA 3TA1A 5EUHA 2HIQA 5DDPC 4NZ7A 3CD7A 1UWAA 2LQBA 3UCGA 5KFPA 3CXCR 2EPIA 3VWSA 2AGQA 9RUBA 4FXDA 2FY8A 3FRZA 4ZA1A 2HHSA 2ZH5A 4FZVA 4YY3F 2CQ2A 1SL2A 4JI3F 4Q2LA 4OHYA 1XMBA 4CLYA 1N52B 1S57A 1NM2A 3HZGA 3OFGA 5CHCB 5KG2A 3LAKA 1XWLA 1C1CA 1T05A 2HW3A 4WCEQ 4KHMA 2QLWA 4ECTA 4L3NA 2V5HG 2QA1A 2MZSA 3I5AA 3SYZA 1KWMA 1S1VB 2FVSA 1G4CA 4USHA 1CS4B 4C8MA 4CLFA 2XS2A 4NLUA 4JV5J 2OPRA 2ROGA 2XNQA 3BPDA 4DN0A 5DG9A 3KLEB 3T1YF 1YJWS 1X5SA 3RAXA 2PE8A 4TKTA 3G71S 1DRZA 3QJPA 3M9NB 2HAIA 5L38A 3NWGA 2HFVA 5F8LA 1LQ9A 1XR5A 1MMNA 3AXKA 4CYUB 2UXDJ 1D8YA 3W9HA 2KU7A 2NYIA 4F36A 3FVYA 2DHSA 2NS1B 1RTZA 4CLUA 2DGSA 4CRJA 1ZAWA 4WYWA 1RWKB 1Z2LA 3FFIA 3KLVA 2MYFA 2BJEA 3TAQA 4ELTA 2BOPA 4UY8T 1VQMS 1ZA1B 2XI3A 2G1HA 2UXBF 3IRXA 2L48A 2KT3A 2VH7A 1H6KX 4YDDB 4DCOB 2OPSA 2VC0A 3GR0A 4YQWA 1FFGB 3NS5A 3QGHA 1R8BA 3HVWA 3WQPA 2ATLA 2I1RA 2I8EA 1UAWA 1LNQA 1IXKA 1S1XA 3M8ZA 3PIOQ 2R7SA 4PQUA 2D3UA 5L8RC 2W4PA 2VZ9A 3SI8A 4ZIVA 1EQ0A 2K2PA 3W9JA 4K59A 2OD4A 4FYYB 1F3FA 2DHXA 2I9SA 2D69A 3MPDA 3Q86A 4WJBA 3SCIE 3BKFA 5MLCV 2JFDA 3G6ES 1KRPA 4Z7YA 1U8SA 4KHPJ 3MD1A 3EM1A 3HULA 3F56A 1TL7A 5D0EA 3LWMA 1FJGJ 4TQRA 4LF4F 5D3GA 3QAUA 2JC0A 2LXFA 3UN2A 4P75A 3I5BA 5H1SV 1VMBA 4YOEA 2CZ9A 2BJDA 3UDVA 4ZS6A 2YNGA 2V2VA 3AFGA 5AXMA 4Q0BB 1U02A 5CXTA 1VS3A 3MTKA 4CO2A 3HFZB 4KTQA 2V50A 2J7KA 1RAOA 4FNIA 4DQRA 2ILYA 5KT3A 3CDEA 4CO1A 2CJAA 3DOKA 3W8GA 5JJBA 2GQ2A 4DR2F 4TYAA 1GTHA 4OL8A 4OYWA 3UE2A 4NLDA 3MFIA 2V2QA 4EK2A 2ZH8A 1ZM2A 2ZJQQ 3TUJC 1VLOA 2YNIB 2BBEA 2HFNA 4ETXA 1N36J 2MB0B 3N6NA 5CZVA 2JOQA 2DNOA 3CJ4A 3TUIC 3RRGA 3LO3A 4ED6A 1YK9A 2QMWA 2CQBA 2OPPA 2YKNB 1Y5NB 4QYZK 2ZH3A 4DV2F 2VASA 2X3GA 3MGJA 3PHEA 1WJ9A 4OYMA 3V6JA 2DR8A 2M8DB 4RKUC 1X60A 5CD4A 2DNYA 2XMUA 5IT4A 2J7WA 3NL0A 2HKEA 2DEIA 4MKBA 3CD5A 4X84A 3BGLA 3GONA 1U6FA 4BC9A 4ECRA 2R7VA 2FHJA 2V2KA 4N8NA 5DETA 2ZOGA 1C0UA 4O44B 2CA9A 4CWBA 1UW9A 1QVGR 4A8QA 4RU2A 1TAUA 5F8MA 4OJGA 1PCAA 3HFKA 5T14A 1HBMB 3V2UC 4EFAC 2XTJP 5K14A 4X4RA 5J2MA 1SBRA 1IWAA 2W7OA 1T8EA 2JL9A 2DR6A 3CCES 1UJ4A 1RHRB 2VA3A 4X2BA 4DN9A 1GFWB 1RT7B 4IG3B 4ZITA 3AJ1A 1GTEA 2LQJA 2BEFA 1D9AA 2LFVA 3HVAA 3I6PA 3G87A 2B0GA 1KLMB 4MIWA 4YY3J 2XS5A 1NPRA 2CQPA 2R7UA 3D0HE 1VRTA 2CPYA 2ASYA 2G0IA 3CC4S 2KHDA 1LOUA 5J2QA 3M6XA 3A8KA 2VONA 4C8NA 4D3GA 3C46A 3DRRA 3CJ2A 4NXNF 2KM8C 5AXLA 3I4HX 4OYPA 2AGOA 2CPDA 1C4AA 2EWHA 1F3VA 1EP4B 3M2UA 3QIPB 3UWTA 5HVHA 4JV5F 1R8PA 2GMJA 3PJXA 2KZZA 5K8NA 3EUNA 2DEJA 1FRIA 2W7AA 1S6UA 3EZOA 4Y0FA 3J81U 1RP5A 3O2IA 4QIEA 4ZVOB 2Y1JA 2XMVA 2X1BA 3AD7C 4KYZA 3ISNC 2DYAA 2UXDF 2DH7A 1J27A 2OSQA 3FBCA 4WZQA 2M8HA 4YMEA 2FHKA 5DM6Q 2XZDB 3KWMA 4J9MA 1F9EB 2Y1LB 2BRLA 1PGZA 5D0RA 3R97A 2GVZB 1U09A 4P7TA 3CCMS 1H2VZ 3H2LA 3KUEA 1SB6A 4FBTA 4X4UA 3ITHB 4CT8A 1J5EJ 2ZH7A 4NLVA 1WHYA 4PG8A 2VJVA 1U45A 3LALA 3R5DA 5DJBA 5GAHU 3Q24A 3NCPA 4B9NA 3GFYA 4HACA 2VBZA 2ZUGA 4TYBA 3TZXA 5HJXA 5DQGA 2A0FB 2AD9A 1HNVA 1TFWA 3C6UA 3LANA 1U7LA 1S4FA 2HQIA 5KT4A 1OPIA 2XWYA 2P5VA 3MR7A 4USWA 4WFXA 5ETOA 2VKRA 4IDKA 4CNYA 4LR7A 2CKWA 1N5VA 2QT7A 3DMJB 2PT0A 4RO0A 3JTPA 3TA2A 4CLKA 1QTNB 1ZTWA 5ETVA 4YB6A 2YQ1A 4YEAA 5FD1A 2F4FA 1JJCB 2YNHA 4FXWA 3KK2A 4KHPF 1U1QA 1DLOB 2ZZMA 2OI2A 2ZDOA 3Q8PB 1YHQS 1FJGF 1NBEB 3NCRA 5A8RB 2QMUB 3BR8A 1XEZA 2YVSA 3MMBA 4CQ1A 1GQEA 7AT1B 5JUMA 1F9FA 5A8KB 1PAEX 1Y5LB 2HK2A 2RE1A 2FVPA 1JLFB 3MCMA 1HD0A 2OMOA 4QR1A 4NMLA 3W1YC 1D0EA 2DGVA 3TZZA 1SIWB 4C48A 3CCZA 3GIRA 1F0XA 3IP0A 2BE7D 4FF2A 4V1Ak 3T5LA 1O51A 3QT8A 2MKSA 1OQ3A 1NDCA 1TUGB 3H98A 2RQ4A 3IS9A 2XM3A 2LQ5A 5ETTA 3P5TL 2WOMA 1AB8A 1U25A 4DG1B 4F3MA 4ECUA 2YPYA 4YR2A 2W24A 4N8OA 4OJHA 2W9BB 2BOAA 2P9GA 2KXFA 4NI2A 3QQCD 2RQCA 4Q8FA 2YQ0A 1U24A 2RU3A 2FD2A 4TQSA 2BW7A 1AXQA 5HSPA 4N56A 3MUMP 4MKYA 3OD2A 2FLNA 4OX6A 4G1PA 2AYGA 3PJ9A 1YBAA 2DY1A 3MR5A 3DFEA 1TR0A 4IFVB 3IAS9 4HYKA 2WSFC 1VC5A 1S1XB 3M2VA 1TUVA 2IHR1 3BQ1A 3SQOP 1ICEB 1SV5B 5KFVA 4B3MJ 3G86A 4R0EA 5I42B 2BJ1A 2QYGA 2KDOA 3SCJE 5B0DA 1S6PB 2Z8QA 2WVCA 2UU9F 2JLEA 3LP1B 1MWYA 2HGLA 2VC1A 3D68A 5CABA 1KFDA 3ZXWA 1UA0A 3R3TA 4XK8C 1HI1A 2C2OB 3DYAB 3FGVA 5HAOA 5IC6B 5IFMA 5F9NA 5F8HA 2R2RA 1S6QB 3VAIA 4DSJA 4KH0B 5EGYA 1IKWB 1RWPB 1UZHA 2CQGA 2QX0A 1N34J 1N6QA 1UVKA 4B9UA 2CDQA 5IV4A 3LOUA 2XEXA 2IIHA 2VQFF 4O4GB 1JWWA 2B9WA 4ID5A 4KT0C 1N5SA 3K89A 4E0DA 1NPKA 4PZVA 3R6GB 4AXIA 1NK6A 3QSYB 3PCOB 4EYIB 3R5AA 3EGVA 3EWGA 4KGZB 1HQEA 3OJSA 2QV6A 3BSOA 5A0YB 1FWPA 1CJKA 3HXMA 1C2PA 3GCWP 4IRDA 4PWUA 2FLLA 2G13A 4OX9J 3AQOA 1VQ6S 3N0VA 1TQLA 3DOMB 2ZBQA 2NXCA 4YFUA 1NCLA 1Z4UA 4P9SA 4ED4A 1RBLA 1UTAA 1JNZB 2BE2A 2WBMA 1ZOTA 2RD5C 2V4JB 3BBFA 1V6HA 2A10A 3I9ZA 1QAXA 1FRXA 1X4CA 1IM6A 4ID8A 2NSCA 5DZ6A 3TJ9A 4ZHRB 1SJRA 3S7RA 3KK1B 2H51B 4OYXA 3CCJS 2VFTA 1KOOA 1S1VA 4C0BA 2ZEJA 3ENWA 3CCUS 2OPRB 3KHGA 1HWKA 4K4TA 1IBKJ 3R2CJ 2IVFB 2GC8A 5C25A 3CE8A 4DQSA 1X7VA 4WP3A 1FKOA 5F41A 5F8NA 4YB7A 2HHUA 1FO1A 2NSBA 1WTFA 2RHSB 1YKWA 2B7BB 2KJVA 1FK9A 3KK3B 1Q1KA 2A3JA 1AUDA 4LIWA 5DLFA 4RW4B 4BS2A 2CJBA 1YITS 1KTQA 1TL4A 4PYAA 1C1CB 4H4OB 2I0XA 2ZBRA 3AD9C 3P4UB 5KOXA 1E6VA 4CH1A 1RA6A 4FXVA 3BV8A 4I2PB 1RU2A 5IC4B 4RU9A 2OTJS 4RNHA 1RWMB 1S7HA 2WCXA 3DRSA 4K5RA 1SVDA 3OR2A 4M94A 1KBRA 3LP0B 2E7VA 1YSJA 3ZTSA 3ZZTA 2DCUB 3CF5Q 1BQNA 4K4SA 2ILZA 2NXJA 4LF2A 2E5LF 1RAIB 2QRRA 2W2PP 4KGXB 1KP6A 1B4SA 3UN5A 4EMDA 1XNRF 1U48A 1N32F 2M4MA 4WZMA 1OQ6A 5E3QA 5CAAA 3KLHB 5I4MA 2QO3A 4ZPCA 1RGVA 4M5NA 4DR3F 2B3TB 1S1UB 1RK8A 4DSFA 3RBDA 1N5TA 3BO4A 4ZPTR 2HHTA 1E6YA 3BYRA 5K20B 5IQQA 1NK5A 1PC5A 3M6WA 4URQU 4L3KA 4Y2AA 2AEFA 4C8OA 2F8HA 2QGFB 4OI3A 2CJQA 5MAOA 1Q79A 4B3SF 3J81j 1O5JA 1HNVB 1BWEA 1Z2ZA 1RAHB 4ZP8A 2IFXA 2LDYA 4F25A 4JI7F 3E2EA 3T6BA 2CJKA 4Q0BA 2V68A 4CLLA 4WP8A 2DNQA 1FDBA 2VPZB 4DS5A 4K5SA 5K8MA 3L9ZA 4PUOA 3I5CA 2JVOA 1F2GA 2UUWA 1FEEA 4TN2A 4Y2KA 2GHPA 2KHCA 1TL7B 2QLBB 3N6LA 4M5KA 5C2GA 3GV8B 3UD4P 2OHDA 2FJAB 3RBEA 1FKAF 3E01A 2IJNA 4KBIA 2MPUA 5FIIA 1VQYA 4H4MB 2V4RA 1T9UA 1RAGB 2HZAA 4FS1A 1EETA 3K7RA 4RW6B 2COLA 1B70B 5DGBA 2CQ4A 2F8EX 1L3SA 2HHHF 2EFPA 1RCOB 3HJVA 5C7PA 2AV5A 2NR0A 2XHWA 1GMWA 1X9MA 2BA9A 2M7SA 3Q8YA 3F0NA 2GX8A 2BM1A 1N34F 3CJTA 1YTYA 2LP4A 4A8YA 1Q4RA 3HHDA 5LSLA 1Y0HA 3DLJA 5IWAF 2VQFJ 3BO3A 2VFSA 3PV8A 1RUSA 1SL0A 2V8VA 1A7GE 2EVZA 2QMXA 3JYTB 1Q95G 1Y5IB 1ZZNA 2KVIA 2EG1A 1FDNA 1S99A 2FVCA 3M1VA 4USVA 4CTAA 3JSMA 3EXYA 3OVAA 1S7IA 2HRYA 1NLKL 1D3WA 5ITHA 3KLFA 3GZ7A 3CMAS 3PFEA 4OX7A 1IWGA 2RU9A 5L1KA 5CYMA 3FUYA 2HNYB 2B9YA 3DHXA 3VGUA 2FUG9 3NAIA 4OQJA 2HNZA 1FD8A 4KJIA 1N54B 2AJFE 3D7SB 1KLMA 1R27B 2FTRA 3SDEB 3HLUA 1WC4A 2PA8D 2RILA 3DN9A 2QSWA 3MOJB 3O8WA 2XCPA 3GP9A 3DDKA 1RXOB 3AJDA 2E7WA 5C42B 4FDFA 4UZBA 1S6PA 2ZOFA 3VCDA 3V6DB 2YWGA 1QTMA 4LF6F 3PXGa 3MM6A 3CVKA 1FD2A 2XYHB 3VVTA 1N5QA 4ZLPA 4DZ6A 4L74A 4DSIA 3AB4B 4ZDNA 3MDFA 2H54B 2D3O1 1FESA 2G0CA 1VQPS 1HR0J 3DRYA 3KUHA 4DL7A 5IXUA 1MG7A 3GYXB 3L7UA 1Q78A 2KM8B 1S6QA 2IMOA 2AZ3A 4KB7A 4RWXA 5KFJA 3D6HB 1TL1A 3K5NA 2Q43A 2DVIA 1Q53A 3GJTB 4QQBA 2XGPA 3I55S 2RIJA 4J9UE 3Q0AA 3EVMA 3VQTA 1R0AA 3UR0A 4K0KF 1NH7A 2Z2ZA 2GVZA 1WDTA 2WHOA 2AWZA 2ABYA 1BXNA 1U6ZA 1Y3JA 3DGPB 3IXQA 1LW2A 2E5IA 1LWEA 3OFFA 2GMHA 4LSLA 4O0NA 2V8PA 3MM9B 3SCLE 2NZCA 2ZBCA 3I0SB 3VGTA 1UEUA 4C3MA 3PDNA 4KFBB 4CO3A 5EN1A 3Q8VA 4PRFA 4ZPWR 2CWXA 2F4VF 2XG8A 2N3OA 4BLGA 1OWXA 1HBNB 1Q8IA 3WC0A 1SXLA 4IQMA 4TU9A 1YG0A 3BGRA 3IBCB 3UDCA 2KFYA 1XMOJ 1JLAB 4MYTA 5KFUA 2PEHA 1RYSA 3FQLA 1XNQF 1IQZA 1BQMA 2DRBA 2AEJA 4WTOB 4JP8A 4P74A 2HG4A 4EBEA 2UVWA 1VQ7S 3M6VA 4M5LA 2MJUA 1PYTA 1NHKL 3IBWA 4JYAF 1X5PA 1XMQJ 1X4DA 4X4QA 2O5DA 2U1AA 4P73A 2LQ8A 4USMA 2NPFA 1TKTB 3NBPB 3HP6A 1HI0P 3V4IA 2LKZA 2A1BA 4I64A 4ANEA 3C66A 1JLCA 2E1AA 3MM8B 2WVFA 3MEGA 2VB6A 3N79A 4ES2A 3W2WB 4JI8J 1T0TV 3KLIB 4JI7J 4JI1J 1F5CA 1RU1A 2CJ9A 4PXBA 3KK3A 3QFHA 3JTOA 3PG9A 4AD6A 4G1IA 1S0MA 2E29A 3SBMA 4X66F 1Q5YA 3FCVA 4U7UK 1CS4A 2YQ3A 3BBCA 2H65B 4MFBB 5B09A 3IRWP 1BD6A 3OVBA 4QWDA 1X4GA 2AJ0A 4OZLA 2E9ZA 5F8JA 1BHNA 2J5AA 3MMBB 3DRSB 3X3UA 3J7ZT 2R9LA 4DFJA 2YY3A 4WF9Q 1RLCL 1WC1A 2ALYB 3VF0B 2PEBA 1H38A 5KFHA 2HEKA 4CYUA 2MKCA 1WC6A 2J0WA 3MUTP 2J6SA 1LWCA 4UF4A 4UOGA 4Q5VA 3V6HA 4C8YA 2AP6A 4LFCF 3O5TB 4EWTA 1C0TB 4DEZA 2KKHA 3FJ2A 4I7FB 2XY5A 5IWAJ 5G4DA 2MQOA 3D54A 2W4DA 3IS9B 2ACYA 2MDAA 2V8GA 3FQKA 3GYNA 2RMLA 3HHEA 4L6V3 4LRAA 1W2IA 3TR5A 2F3JA 3BR9A 1ZBTA 1M5VC 1S9EA 5KFGA 2UUAJ 1JXEA 1ZTTA 2G4BA 1DY3A 3CSKA 4IYQA 2K3IA 4ED2A 5B0EA 3TYTA 2JEJA 1LW0B 1TKZA 2RB7A 3E8OA 2W9BA 3KTQA 2ZNZA 2YPZA 3BSAA 1P6TA 1KQKA 1BE4A 3B8HA 2Y9HA 4KO0A 1GXLA 2FYXA 2MY7A 3GYGA 3MAAB 4WIIA 2EKNA 5KFYA 4DV0F 4DOZA 1H2TZ 2BZ2A 3KDNA 4HT5A 3NMAA 1RZMA 4KV8A 4OX8A 4Z2XA 1RTJB 3GU0A 1PO6A 5G0RB 1N6QB 1GXTA 4E2FB 2RNEA 2RH3A 1U1LA 1PKUA 3BM7A 3H2UB 4B9LA 3TQ1A 4CH0S 2R7XA 2M52A 2WW4A 1FVSA 3ONQA 1M1HA 5LMNJ 2EG2A 1UA1A 4DUYJ 3TRGA 1Q7LB 4Q2MA 5KFLA 3DRPB 4IRCA 4IRKA 1X4HA 1FWKA 1YJTA 1A0OB 2OTLS 3FRYA 1EX8A 3J7YU 4TY8B 3V6KA 2IRYA 1VBKA 4OZJA 2W7PA 1T03A 4QBUA 4RLEA 1WSRA 4TLRA 4DQPA 3FMWA 4NCBA 3NNCA 1SC3B 2NUHA 3FBFA 4NA3A 4F0MA 4G3IA 1DZ5A 4RUAA 3GIIA 3CMQA 5B0AA 4LR9A 2I38A 3K58A 3HJFA 1OYEA 4F2SA 2IAJA 2QFIA 4X4NA 1U26A 3RB4A 4CH7A 1NJWA 3L95X 4OZ0A 1HBOB 4RWWA 4OZNA 4B02A 3PR4A 2R3VA 4HLBA 2QA4G 4DV3J 1HQUB 2XZTB 4WIQA 5DDQC 4N77A 5DLGA 4DR6J 2CADA 2UZAA 1X0PA 5ETRA 2KL8A 1CJKB 1EB0A 3OXLA 5T7LA 4LF1A 4PXDA 1GMVA 1RABB 4RBTA 1T9VA 3AD8C 5THWA 3W5ZA 2ASLA 1VHIA 3SFUA 2B4VA 1NO8A 1T9TA 1M5SA 2CWKA 2LXIA 2B6AA 3G2XA 3POTB 4HDGA 3JAMY 1JK9B 3TO8A 3VV2B 1URRA 2ASDA 4K4VA 1WI6A 1FNOA 2CPIA 3FMBA 1GX6A 3M30A 4ZOSA 5IV3A 4JYAJ 1E6VB 1FERA 3KK1A 2E5JA 4J5OA 5LT5A 2L9WA 2CG8A 3UN3A 2GJFA 4Y00A 5DGAA 2AQ4A 2R8IA 2RHQB 4ES1A 3NGTA 5KT6A 5CYQA 2IJFA 5JVHQ 1HWJA 2CPHA 3OJUA 3C19A 1QE1A 1WSVA 2J9DA 3D6MB 1IJFB 1GXUA 3HD1A 2XO6A 1VC0A 4DWIA 2KB2A 2QL5B 1XR6A 2ZJPQ 1UKUA 1V3RA 1EQMA 4QZVB 4RR5A 4UOHA 1QD1A 2J8SA 4DL3A 1IM4A 2DNGA 4QYRA 4JI1F 2Y8YA 2UUCF 4F67A 2OAUA 4FYWB 4DV5F 2BW2A 3PRVA 1HNIB 1YRXA 3EXCX 4GVBA 4OYIA 3ZFVA 1RWWB 6AT1B 3EPGA 1XC9A 2KFZA 4F3QA 4K4YA 3W9IA 3CJQA 4X66J 1K0VA 3G9CA 4IG0A 3W66A 1KEKA 1HPZB 3QT7A 2MZQA 3RG6A 2KT2A 3H5YA 2FDNA 1LW2B 2Z4PA 1XBWA 4LJMA 1N88A 4ZP9A 3RAMA 4RNOA 3LP0A 4RW9B 3QO9A 3HHNB 2QZ8A 3EE3A 3NGKA 2W2OP 3CJKB 2N7CA 1OIAA 4KGVB 2MGZB 4DV6J 2BR0A 4B3OB 2QLFB 3D6FB 3TEHB 4F4ZA 1S5ZA 2D41A 1XJWB 2PFDA 2XS7A 3CCQS 4X65J 4ZIWA 1S76D 1RLDA 3GQCA 2F9JA 4LBHA 4F4KA 4ECYA 1S1WA 2CUYA 5D77A 3T1HJ 4LF5F 1QLNA 3RB3A 3BKTA 1LWXA 1X5TA 4O3OA 2XGQA 4WYLA 3MMJA 1X9SA 2YNFA 1IBMJ 2HBRB 3PEHA 4OV1A 4B9SA 1MWQA 5GAHI 4J91A 3U27A 1VQ4S 4NA1A 1H98A 4C6AA 1UPMB 4USIA 2MQNA 3HHLA 1K47A 1TKTA 1TMMA 2MSSA 2VPYB 3NBPA 4J7CA 4QR0A 4TVAB 4MK7A 4X4PA 2GMLA 1HIYA 4DV0J 3NKYA 3PM9A 1OSDA 2D7SA 5F8GA 1Q16B 1CJTB 2Y0SD 3MEGB 4HTJA 1VIOA 3IFEA 1VRQC 2FIUA 1L3UA 1YDLA 2AJ1A 1ZM9A 4M5HA 2APOA 2K06A 4TY9A 1DTQB 2XI2A 3LTOA 4I0WA 3RRKA 4R8UB 1J5OB 1NMEB 1ULRA 4ED5A 1X8DA 1KC8T 5E0OA 3OTOF 3M32B 5GADU 4LR8A 5EWGA 4JI4F 3DLGA 4C3LA 2LCWA 4DUYF 2MLZA 5HBMA 1RACB 2VOPA 3K5LA 5J2QB 2IM0A 1PC4A 5HL7Q 3C6UB 3OLAA 2XQCA 1NJXA 4IH5A 1KDNA 1KN6A 4ZVRB 3KHRA 2AEMA 1FRHA 2MEWA 3R5CA 3UNYA 2J6TA 4ZVHA 1LWFA 1CLFA 2C3MA 3AQPA 2CQ1A 4WFAQ 3CDUA 1IN0A 3QLHA 5KFEA 1FKPB 3JXOA 2KG1A 3K17A 4F04B 1NJYA 3C3LA 1X4FA 3B6BA 1QUPA 2RDJA 2YWHA 2HGMA 4EO8A 4Q45A 1SJ4P 3BBBA 4IR1A 5T41A 4PG4A 1B0TA 3A4TA 4LF7J 1NDLA 3AHPA 4URSA 1VLYA 4Y2CA 3JSMB 2C3YA 2XLJA 4I6AA 3CJ5A 2OD6A 3M8QB 4DR6F 2MXYA 1KVKA 2CZ4A 4YR0A 2JX2A 1WC5A 2R4FA 4A8OA 5IQ6A 4WKYA 3AY0A 4ZVSB 4U96A 2YKMB 2Q6CA 1CJUA 3ETMA 2BUNA 3LGMA 1WG5A 4EBDA 1T9YA 1Q8BA 4PEOA 4R5PA 4FF4A 4CLWA 5L9XA 2L41A 3VAGA 3OLBA 2RKIB 3EGWB 1NZ8A 4WXWA 2Q1LA 1HYSB 2MQPA 3L7OA 4ZCMA 1U1RA 3ILJA 3NOGA 1JMTA 2KJWA 4PYDA 2B8PA 8ATCB 4O23A 3DI6B 4QU7A 1TL3B 3DM2B 3Q89A 3BSNA 8RUCA 2AJQA 1MLAA 3GPAA 3H90A 2DNZA 4O3QA 2BKNA 2H1YA 4ZCIA 2V4QA 3BO2A 5LMUJ 2FLPA 2I2YA 3EGZA 5LJ3Y 4P71A 4Q44A 1WG4A 2Q3PA 1HHQA 1YI2S 1JLAA 4F50A 1PG5B 1SJ1A 1L3VA 3CDBA 4I1TA 2Y3YA 5LSRA 1VQ8S 1AZSB 2W25A 1SC4B 1ZPWX 1JKHB 3MOZA 4U8YA 2EKYA 4OHZA 3IM8A 5C24B 6FDRA 4KE5A 3U7JA 1DQAA 2DNNA 3M8PA 3BZQA 1YRUA 2WBRA 3MMCB 2BJ3A 1VI7A 1JXVA 4AQYF 4DL4A 4MJKA 2LEBA 3MXHP 2UUBJ 3BF4A 4GVLA 3NLCA 4HI1A 3MM8A 3NOCA 1WF0A 5KFAA 5HJYA 4NX9A 1FE0A 4NA2A 1SQEA 4KY3A 2J0SD 4PXEA 3IO1A 3SIPB 1O6XA 4P2FA 2B6AB 2GGPB 3AOBA 1FEHA 2OSRA 1RAJA 4ZPAA 2PMZD 1Y9OA 3BH6B 1OY9A 2HIYA 1FRKA 1HQEB 2VL1A 1HNZF 3D4JA 3D9BA 2W2NP 2B51A 3B4DA 4IUFA 1Y10A 2IVYA 2MKYA 2B5JA 3NXZA 2YH1A 4ZPDA 2YWWA 2RF2A 3K5OA 3ET6B 5HP1A 4U6PA 4AL7A 1SUQB 2NYHA 3DOMA 4JI5J 2P6SA 3GIKA 1G2EA 1G7CB 1HL6A 3H5XA 3R5JB 1RHJB 2JHEA 3KG0A 1FRJA 2V4JA 4BWMA 3VGVA 3PFOA 2AMCB 1TU0B 3E51A 5E3CA 1VIXA 4ZVFA 4BCAA 1D09B 3N6MA 4HDHA 1RBOB 4OZ2A 4UOCA 2UUTA 2VUGA 4WXOA 2D3ZA 2DJWA 4WK3A 1DAXA 2BX6A 5HANA 3T6JA 3OTOJ 3VALA 2ADCA 2UVUA 1RT5A 1NRKA 2VDIA 3IR6B 4LBPA 2CRLA 4QWAA 1AYEA 5L39A 1RJJA 2HVIA 4GMKA 3ILOA 4CO5A 5K5MA 2C2MB 1R6YA 1C1BB 4KKOB 4GKKF 3G82A 2WAQD 4OYBA 4ECVA 2PFFB 4P72A 3TJ8A 2F40A 1UL3A 3J80Y 5LOQA 1RT6A 1WDDA 4ZPBA 2N82B 2VFUA 4KGMA 2MQQA 3W3SA 4CM2A 2F5GA 2HVDA 1GMUA 4LSZB 5HMXA 4DQIA 1GH8A 1IKVA 2CQ0A 4LF5J 4MYUA 1EZZB 1I6JA 2L3MA 3GFXA 4OI2A 3BJYA 2C2RA 5HN0A 3IGNA 2NZ4A 2CZVC 4DR5J 7FDRA 2VG7A 3M2RB 4QW8A 1CULA 3H59A 2MHEA 3D0GE 1IKYA 2QFJA 3EX7B 4DV7J 3HSZA 4NLRA 1KOHA 1NPPA 2JEFA 4QIWD 4LF8J 1FXRA 2VBXA 1U1KA 1D9DA 1YLXA 1W26A 1WKKA 3CDWA 2DPJA 1Z1ZA 4NOHA 4F4XA 3W2VB 2HYIB 1NSPA 1BGXT 4DF4A 4JI2J 4TY8A 3I31A 4R0JA 4RW8B 4XDDA 4CT9A 3H25A 1RTHA 4LFBF 1BC6A 2LECA 3TANA 2E9TA 2EC0A 3FEYB 5D4NA 3R5GA 4NCAA 1BUXA 1JLGB 2KXHA 3NGRA 4NLYA 1J5OA 1TUWA 3JSRA 2HZVA 2VV5A 5IT9Y 4JV2A 2HBYB 3I9V9 2J9DE 2B9EA 1BQXA 3BGUA 3QWUA 2HWHA 2BACA 1UJ5A 2XZWA 2KVQE 1AA1B 3DLGB 3HSGA 3VQSA 3Q8RB 3C15A 4H4MA 1WOPA 2NXUA 1IBLJ 1UVNA 2GQQA 3G4SS 3DRPA 2CQCA 2EEYA 4OYAA 2P2CB 1TV6A 4BDPA 2BV3A 2MY8A 3C14B 5A8WB 5CCMA 3OUYB 1UWBA 3SQGB 4F4AA 3OW2R 1LWFB 2BVZA 4C11B 2BQ3A 2W2QP 1B64A 3FBEA 2ZHOA 5KFNA 4C8ZA 4CZCA 2VG5A 1F9HA 3I4PA 3LA0A 2VF3A 4ED3A 5D4PA 1T95A 3ILIA 3KJVB 5HLFB 2EBGA 1HFEL 5HMZA 3A1YG 3K5MA 1YJ9S 4WTYA 2VOOA 2AX1A 4H4KA 3PO4A 1UFWA 3JQJA 5ETNA 4GKJF 2XMJA 5FLXU 4DF8A 2AYMA 1EKSA 2AYEA 5CYQB 3US5A 1HBMA 1RT4B 4DR4F 5K14B 5J2MB 3EMTA 2V8HA 1Y11A 2K1RA 3TVYA 5KFQA 4PXCA 4YR3A 5ETMA 3PW7A 1S97A 2HRTA 1TK5A 4JI3J 1Q82T 4QU6A 3K8VA 1CJUB 1J2VA 2GJ2A 5KTQA 2VQEJ 2UXCF 1RI7A 4I2QA 1FNXH 1VBYA 2OFGX 3A13A 5GADI 4M1KA 4P6QA 1LK7A 2EXUA 1HNIA 1RB0A 2NCKL 3DDNA 3BN7A 3H2VE 3ISZA 4QWCA 4P2MA 3M1VB 5FDLB 4DV1J 4XIUA 2CG4A 1WORA 3AOCA 3O1LA 3OTCA 2YKPA 1HNZJ 4TU8A 4XO0A 4EZ6A 2DRAA 4IG0B 3GJQB 3M9OB 2AYBA 3ILLA 2AT1B 4EI2A 1XIQA 5B0GA 4DLGA 4JV0A 3T1YJ 5GMDA 2R8GA 3ISND 3J7AN 1RT2A 2CXEA 2HNYA 2EK6A 2HLUA 1BMQB 3TX0A 4CLSA 4I69A 3SSRA 3PX0A 1FHTA 1KFSA 3UDLA 5JMNA 1TL1B 5H9FJ 1RTIA 3IN5A 3PKMA 1RBAA 3OPKA 3H5UA 2ROPA 3VVUA 4AE5A 4DXLA 5GVQA 3D67A 4Q7AA 1RCXB 1M5HA 2CVIA 3MI7X 3JSBA 1VGYA 4C97A 2PGCA 2IC3A 5E5NA 1FXDA 2LEPA 3MM6B 3OT9A 5C24A 4ZMMA 4J9QA 1CC8A 2M3DA 2ZDPA 3IM9A 3OBIA 1RHMB 2HVEA 4ZVPB 1H3DA 5HVFA 4DFPA 2ZWPA 1UJ6A 4ELVA 2JDJA 2QSFA 2BKPA 2DGQA 3FZBA 5B0FA 4QOTA 5BJRA 1NKBA 2CQIA 1R3NA 2G1DA 4OI6A 5F3TA 5SZTA 4DR7F 2CAJA 2KO1A 5KFFA 4DX8H 1S1WB 1EAYC 2DO0A 2J76E 4IDKB 4DPOA 1U1OA 4B3TF 1LV5A 3PYGA 1NK8A 4J9OA 2ZNYA 4ECQA 3R7BB 1FT8A 1EJ7L 1LWEB 2H4WB 2HQCA 1R0BG 2DO4A 2G2ZA 4LSLB 4AUKA 2BJ8A 5H9EK 2R8KA 4K4ZA 3PZPA 2OLWA 1WEZA 3ZZPA 2ZVIA 1WELA 2PMWA 3Q83A 5J1EB 3K59A 2W9AA 2OPQA 2B5JB 1BLUA 3K2YA 3P8BB 2V8DA 3UVJB 3V81B 5A8KA 5HP1B 1V5VA 2WSCC 4RNNA 2Y1RI 1S0OA 1WKJA 1VDHA 4L73A 2CPFA 3U1MA 1ZAVA 1HD1A 2PC6A 4NCGA 5HK4A 2E5HA 1SJ3P 4K7QA 2EC2A 2Z56B 1QAIA 4ECWA 1IVZA 2R42A 5KT5A 1N48A 2ZC3A 1L5UA 2WRMA 3P3DA 2DKOB 1S77D 3I0RA 3R5BA 4L72B 4ANDA 5ADZA 1QDUB 3BEGB 4RJVA 1N36F 1H73A 2I5JA 2WW8A 2ADBA 3ZZRA 1CVJA 1T9XA 3TW0A 2MMYA 2PI4A 4KAIA 5GMKa 3IRXB 4NI2B 4CLZA 4WKRA 1S4EA 1C1BA 2HFUA 4K4XA 4AL5A 4K2JA 2IVMA 4A8SA 1VQ5S 4B9VA 2DNKA 2P8IA 5B7WA 4LF9J 2QEXS 1REGX 1RHQB 2D74B 2RUGA 3BH7B 3OTDA 2OEKA 2QA2A 1HWIA 1UCNA 2HSEB 3CCRS 4HVZA 2K7JA 2DTJA 5LM7E 5DZ7A 2FB0A 4FYVB 2JRSA 3W7BA 4ZLLA 4IO9Q 2P9EA 4EEYA 3KLGB 3BQ2A 1MSWD 2CNLB 4FS2A 1CULB 1H7WA 1SIZA 4EUVA 4G6VB 3D28A 3ENQA 5EWEA 2IJRA 2HBQB 5M2PA 2EK1A 2LU1A 2OGUA 2LA4A 2Z30B 4V19X 3TEGA 1B0VA 2MZJA 3H4BA 4KV8B
chains in the Genus database with same CATH topology
4JI3J 4YY3J 4NXMJ 4KY3A 4LFCJ 4X65J 1N34J 4JI5J 2VQEJ 2UXCJ 5IWAJ 3T1HJ 2VQFJ 4DR3J 2HHHJ 4LF5J 1IBMJ 4DV1J 4NXNJ 2UUAJ 1HNZJ 4X62J 4JV5J 3T1YJ 3J81U 3J7AN 4DV0J 2MTLA 4KYZA 2UXDJ 4OX9J 3JAMU 4JI0J 1HNWJ 4LFAJ 4PWWA 3OTOJ 1N33J 5LMNJ 1I94J 4JI4J 4DUYJ 1J5EJ 4YHHJ 4LF6J 4DUZJ 2UXBJ 3R2CJ 1IBKJ 4GKKJ 1HR0J 2MEWA 2MQ8A 4DR7J 4B3TJ 4K0KJ 3IMQJ 4KHPJ 4DR5J 1HNXJ 4LF7J 1FJGJ 4DV3J 4LF4J 4DV7J 4DR6J 4LF8J 2KL8A 2F4VJ 4HHUA 4NEYA 2E5LJ 3R2DJ 1XNRJ 3W1YC 4JI2J 1N32J 3J80U 1XMOJ 4LFBJ 4JI6J 4V1Ak 1XNQJ 3D3BJ 4DR2J 4X64J 5IT9U 5A2QU 4JYAJ 1XMQJ 2KVQE 1IBLJ 4RJVA 1N36J 5LMUJ 4DR1J 4B3SJ 2ZM6J 4DV2J 4JI8J 4LF9J 4JI7J 4JI1J 2UUCJ 4DV5J 3D3CJ 4NEZA 4B3MJ 5LM7E 5AJ3J 4X66J 4DV4J 2UU9J 4GKJJ 5BR8J 5FLXU 4AQYJ 4DV6J 4DR4J 2UUBJ 4B3RJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 J;  4YY3 J;  4NXM J;  4KY3 A;  4LFC J;  4X65 J;  1N34 J;  4JI5 J;  2VQE J;  2UXC J;  5IWA J;  3T1H J;  2VQF J;  4DR3 J;  2HHH J;  4LF5 J;  1IBM J;  4DV1 J;  4NXN J;  2UUA J;  1HNZ J;  4X62 J;  4JV5 J;  3T1Y J;  3J81 U;  3J7A N;  4DV0 J;  2MTL A;  4KYZ A;  2UXD J;  4OX9 J;  3JAM U;  4JI0 J;  1HNW J;  4LFA J;  4PWW A;  3OTO J;  1N33 J;  5LMN J;  1I94 J;  4JI4 J;  4DUY J;  1J5E J;  4YHH J;  4LF6 J;  4DUZ J;  2UXB J;  3R2C J;  1IBK J;  4GKK J;  1HR0 J;  2MEW A;  2MQ8 A;  4DR7 J;  4B3T J;  4K0K J;  3IMQ J;  4KHP J;  4DR5 J;  1HNX J;  4LF7 J;  1FJG J;  4DV3 J;  4LF4 J;  4DV7 J;  4DR6 J;  4LF8 J;  2KL8 A;  2F4V J;  4HHU A;  4NEY A;  2E5L J;  3R2D J;  1XNR J;  3W1Y C;  4JI2 J;  1N32 J;  3J80 U;  1XMO J;  4LFB J;  4JI6 J;  4V1A k;  1XNQ J;  3D3B J;  4DR2 J;  4X64 J;  5IT9 U;  5A2Q U;  4JYA J;  1XMQ J;  2KVQ E;  1IBL J;  4RJV A;  1N36 J;  5LMU J;  4DR1 J;  4B3S J;  2ZM6 J;  4DV2 J;  4JI8 J;  4LF9 J;  4JI7 J;  4JI1 J;  2UUC J;  4DV5 J;  3D3C J;  4NEZ A;  4B3M J;  5LM7 E;  5AJ3 J;  4X66 J;  4DV4 J;  2UU9 J;  4GKJ J;  5BR8 J;  5FLX U;  4AQY J;  4DV6 J;  4DR4 J;  2UUB J;  4B3R J; 
#chains in the Genus database with same CATH topology
 2DIS A;  1ZA2 B;  4OJ3 A;  1N0U A;  2GO8 A;  1Q81 T;  1U6B A;  4NLW A;  2XSJ A;  1NSQ A;  3RTV A;  4BHQ A;  5E41 A;  1WG1 A;  5GAG U;  2FJE B;  5HI7 A;  4DV1 F;  2DR5 A;  1KON A;  1JKH A;  2DGX A;  4GRS A;  1TKZ B;  4AFF A;  2XMW A;  4QJV A;  4X62 J;  2EI5 A;  1LXN A;  4KIA A;  2IYG A;  1PJ7 A;  4HHJ A;  1TKX A;  1M5P C;  5CYJ A;  4FKY A;  2H5I B;  3WHI A;  3GSI A;  1PIE A;  3RJM B;  4NLQ A;  3WIV A;  2VD3 A;  2K7K A;  2DT9 A;  2W4C A;  4RUH A;  4QIG A;  2D9P A;  4E8U A;  1WAC A;  5DRK A;  3CB4 A;  3PW4 A;  4DL6 A;  2HVH A;  1RA7 A;  3I82 A;  4QWB A;  3MHY A;  1RAD B;  4MTP A;  3DOK B;  2FHM A;  5IS2 A;  3QRP A;  1I1G A;  2A2C A;  2OO4 A;  3ZZO A;  2CPX A;  3TUP A;  4HKQ A;  2K8G A;  2DNM A;  3HPO A;  3T41 A;  2DHG A;  1JLB B;  5KG3 A;  1J5E F;  2BM0 A;  2C3P A;  1UET A;  4YHH F;  4PG5 A;  3O44 A;  1R89 A;  3GV7 B;  1HBU B;  1VQN S;  1HHS A;  3QFW A;  3LPY A;  5IT0 A;  2BE9 B;  2X1A A;  2HAF A;  1CQN A;  1UP1 A;  5U47 A;  3D66 A;  2WB1 D;  4P2S A;  4ALZ A;  4NRT A;  2MQ8 A;  4TNO A;  3KG4 A;  1W2B R;  3EVW A;  1WNE A;  2AJ4 A;  4C7Q A;  4OYO A;  4OJ1 A;  2EFQ A;  1VFJ A;  1DAR A;  3RB0 A;  2RS8 A;  4XPC A;  1T3O A;  2Z2L A;  2FY1 A;  4IOA Q;  2ZJR Q;  5J2P A;  4H4O A;  5E7O B;  4WU3 A;  1FRM A;  2P9C A;  1GNK A;  3MPY A;  3IG1 B;  3R27 A;  4I2P A;  4I56 A;  5A76 A;  2DXF A;  5BXI A;  2ZKU A;  3HK2 A;  1R43 A;  4LIR A;  4Y65 A;  4F7V A;  5BYS A;  1FJ7 A;  2D1C A;  4KKO A;  1JQG A;  1M1G A;  1YZ7 A;  1U1P A;  2JLF A;  2LA6 A;  3GFZ A;  3I32 A;  3DOL A;  5CCL A;  5D8H B;  2YKA A;  3BN4 A;  3FKB A;  1KR4 A;  1YZ6 A;  2ATC B;  1MMD A;  2PD1 A;  3QID A;  3RW7 A;  3KLH A;  1T3N A;  2HS0 A;  4DSE A;  2YTC A;  2GVD B;  4OHV A;  2ZIT A;  1VBX A;  3DRR B;  1NZA A;  4DPT A;  3UFC X;  2WB4 A;  3MTJ A;  5I3Q A;  1JIH A;  4RUB A;  3B78 A;  2HFO A;  3RBZ A;  1X4E A;  3ZZU A;  1WHV A;  2ZE2 A;  4Q8E A;  4B3O A;  3MED B;  1L3K A;  4L75 A;  4ILL A;  3CCT A;  2RDI A;  3QJL A;  2WSE C;  4DX6 A;  2ZM6 J;  1REV A;  3CW2 C;  2NXN A;  5ETL A;  5KG0 A;  2DNR A;  1UW4 A;  1QY7 A;  1VIS A;  2CNO B;  2G2O A;  2O67 A;  4MH8 A;  3UQS A;  4LF9 F;  2GA7 A;  3MR2 A;  1NU4 A;  4RW7 A;  3R1L A;  2Z0G A;  3ICL A;  3UNG C;  4NEZ A;  3CO9 A;  3U02 A;  4YUD A;  1OSC A;  3KK2 B;  4ERD A;  1LKZ A;  2NUU G;  3C8Y A;  1AT1 B;  3M8W A;  3Q2S C;  1SKW A;  2FHJ D;  1KQF B;  3QO9 B;  4B17 A;  1S59 A;  1ZH5 A;  4Z37 A;  1HI8 A;  1YIJ S;  4L76 A;  4LRC A;  4FVM A;  1D8Z A;  2BAB A;  1PYS B;  2XY7 A;  2BQU A;  2VPW B;  3ADA C;  4MK8 A;  5HMW A;  5AXN A;  2CYY A;  3KUG A;  4QPX A;  1EHW A;  1HLW A;  2IM2 A;  4WE1 A;  3MAH A;  3HT3 A;  3GIL A;  1YJN S;  1VQL S;  2DIT A;  1X4B A;  1DTQ A;  3D1Q A;  4PQU B;  5AE3 A;  3PW0 A;  1NK7 A;  1QSY A;  1F2H A;  3AB2 B;  4UT4 A;  3W5Y A;  2OFH X;  1WTB A;  2DRD A;  2W1B A;  4ZP6 A;  3BDP A;  1LFW A;  2DK2 A;  1CC7 A;  1RTD B;  1RTD A;  3S6E A;  4LQ3 A;  3B4M A;  2BJ7 A;  4J9L A;  3I87 A;  1QVF R;  1T02 A;  3ZZY A;  2HRU A;  5H9E J;  5KFM A;  3G6X A;  5EDW A;  4DSK A;  3NNH A;  2I5J B;  4MKA A;  3CT9 A;  3EGN A;  3DC2 A;  3QWP A;  4H4K C;  4CLT A;  1CJT A;  2XY6 A;  3GJS B;  3QRR A;  2YKN A;  3CDA A;  4KPC A;  3SXL A;  3TOQ A;  5D4L A;  5KFX A;  1NUE A;  4YB1 P;  2XB2 D;  4FNH A;  3MR3 A;  2JEG A;  4A46 A;  3UCZ P;  1APS A;  4KC5 A;  2IY5 B;  2F8M A;  3NGD A;  3MEC B;  1S9G B;  1HNW J;  2UP1 A;  1U4B A;  2VG6 B;  2XMM A;  2ZD1 B;  2AKW B;  3KJV A;  5D3G B;  5GAG I;  2HVZ A;  2QN6 B;  4NL5 A;  4UZC A;  4CI0 B;  2U2F A;  5A2Q Y;  1SJF A;  5D15 A;  3LP1 A;  4U7C A;  3QNW B;  1GEH A;  3FBB A;  5J2N A;  2UXB J;  4GC6 A;  1IBK F;  4F3O A;  1UVJ A;  2Q66 A;  5DM7 Q;  3NWR A;  4BWJ A;  1S0V A;  3M8R A;  3E3X A;  4PCQ A;  2VPX B;  4N7T A;  4P52 A;  5GAE I;  2F63 A;  5FLX Y;  2DNL A;  5DDO C;  1FKP A;  4OLP A;  1IKW A;  1PBA A;  3HZE A;  4J9S A;  3NNA A;  2VU5 A;  4LUB A;  3TUZ C;  1VRT B;  1YJV A;  4ICL A;  3MUR P;  5F0W A;  2RKI A;  1OY8 A;  3OTE A;  3PYD A;  4FP9 A;  5KG6 A;  4NLS A;  5CQG A;  2ZZN A;  1UFL A;  1IKX A;  4IFY A;  3ZNU A;  1HNX J;  4ZJL A;  3Q22 A;  3DXB A;  2V63 A;  5I3U B;  1M0S A;  4CCH A;  2VFV A;  3O3L A;  1NDP A;  4LF4 J;  2YX4 A;  3DU5 A;  5GAE U;  2FZG B;  3JS9 A;  1JXL A;  3D2W A;  2JFK A;  2QYC A;  2ZH4 A;  1RT2 B;  1KD1 T;  2HHW A;  3DHW C;  4HHU A;  3R2D J;  1XNR J;  3HX9 A;  2KZM A;  1HBN A;  4K2X A;  2HZC A;  1VHF A;  2HS3 A;  2MJN A;  3EDQ B;  4BC7 A;  3NCQ A;  4FPI A;  1TK0 A;  5KFD A;  2FVQ A;  2BE2 B;  3BQ0 A;  3AJ2 A;  4OHX A;  4OHW A;  3KJF B;  5E3P A;  1IJE B;  1RAA B;  3QZ7 A;  3GIJ A;  5FJ4 A;  5IT9 U;  4AT1 B;  1HWL A;  1OO0 B;  3OL7 A;  1TL3 A;  2DNH A;  3CTR A;  3DM2 A;  4FF1 A;  2GIQ A;  2HWT A;  2E5G A;  5JVG Q;  1KTV A;  4RNM A;  3G8T A;  3WBZ A;  2A6M A;  2XYP B;  2O3D A;  3I96 A;  3F73 A;  5KFZ A;  4W98 A;  4Z7C A;  3DLB A;  2NXE A;  2C2K B;  3U1N A;  1V9O A;  3CJS A;  4Y28 C;  4DHV A;  1HMV A;  2PII A;  4B3S J;  3UD5 A;  4DV2 J;  1PIL A;  3A8E A;  3HKW A;  1XN9 A;  2BMB A;  1XR7 A;  3FC9 A;  1CJV B;  2YKO A;  2AF6 A;  4USU A;  3S1T A;  2BAN B;  2CNK B;  3W2W A;  2UV8 A;  3TAM B;  3VAK A;  2GGP A;  1VCT A;  2V9K A;  1RT3 A;  2CQ3 A;  3OV7 A;  3T5K A;  5AT1 B;  3F44 A;  3KNA A;  2GCF A;  3KYL A;  1Q0N A;  5AJ3 F;  2IRX A;  5DO2 A;  2CDR B;  1I3O B;  1YGY A;  1M5O C;  3DLL Q;  4A47 A;  5HVG A;  2DXD A;  2MQL A;  3MMC A;  4GC7 A;  3TAP A;  4PKD B;  1M1K T;  4F0K A;  1S12 A;  4J9N A;  3LPE A;  3HHL C;  1H74 A;  1FVQ A;  4J9K A;  4QYZ J;  2WVD A;  2ZWO A;  3CCS S;  3MCO A;  2YBV A;  2ZH2 A;  4I6Y A;  3IGV A;  3ZZ0 A;  2HFZ A;  4DX5 A;  3NGS A;  3SCK E;  3QPI A;  5L9N A;  3H20 A;  2RAQ A;  1AFI A;  2H9Z A;  3HCX A;  2WTF A;  4JI5 F;  2GJI A;  4ZVT B;  1SKR A;  4ECZ A;  1Q86 T;  3OXG A;  2PO4 A;  1DQ9 A;  2H5J B;  2E1P A;  3B54 A;  2Z2M A;  2HQ3 A;  4HEA 9;  3KMS A;  4ETZ A;  1RT5 B;  5DS7 A;  3BB5 A;  3DLE A;  5K8O A;  3N01 A;  1X9W A;  4M95 A;  1QM9 A;  1VK3 A;  3MCN A;  4NZ0 A;  4OI4 A;  2L9N A;  1N4L A;  4RL1 A;  1VYA A;  3TP2 A;  1S10 A;  3T9N A;  5B0C A;  4DBQ A;  4ZVQ B;  1B99 A;  1AUS L;  3MEE B;  4DL0 C;  4JB8 B;  5HO4 A;  2CQH A;  2MTL A;  3HHL D;  4OLO A;  1N8R T;  1FCA A;  5M2U A;  5IZH A;  3JAM U;  2RJZ A;  1JLE A;  2X1G A;  3HSD A;  4OZ5 A;  5LJ5 Y;  4U67 Q;  5E3R A;  4K8R A;  3D1H A;  3THP A;  2E9R X;  3R7N B;  3OFH A;  2J0X A;  2OML A;  5HQ8 A;  1SV5 A;  1HNW F;  2C2E A;  1T94 A;  5J2N B;  4QPT A;  4PUO B;  4LRE A;  1FFW B;  4PQA A;  1MU2 A;  4RNF A;  2RRN A;  3HVT B;  1RE1 B;  4ZVU B;  5KFW A;  4ZKA A;  1DTT B;  3OSN A;  3KLG A;  2CPZ A;  5B08 A;  4LF6 J;  3C16 A;  1CQM A;  2IDE A;  4MT1 A;  4DUZ J;  3GJR B;  2OPS B;  3PYE A;  3W2V A;  2YH0 A;  1HR0 F;  1DHM A;  1ZM4 A;  3DLH A;  1NB7 A;  1CSJ A;  4KQZ A;  1S48 A;  3ENA A;  3MCS A;  4DPY A;  4Q43 A;  4DR5 F;  1HA1 A;  4DFM A;  2YX7 A;  5CA5 A;  1KLN A;  1F60 B;  4ZJQ A;  1ROF A;  2C22 A;  1K0T A;  3OHB A;  4ZN3 A;  3PW2 A;  3M4X A;  4DI6 A;  2VG7 B;  3M2R A;  3W64 A;  5LXY A;  1VBZ A;  3GLJ A;  1DUR A;  1HNX F;  1HQ2 A;  2QTW A;  4RBU A;  2HFS A;  3CME S;  5KFR A;  3C15 B;  3TWZ A;  3J7Y I;  2JSX A;  4P10 A;  2KYX A;  1TKX B;  2EW9 A;  2E44 A;  2GIR A;  5A0Y A;  2FJD B;  2PMH A;  3MUV P;  3C14 A;  2QIF A;  4NEY A;  2C1E B;  2HQG A;  1ZM3 A;  4RW8 A;  5CYM B;  1UWB B;  3SQG A;  4EZ9 A;  5T7L B;  1SI9 A;  3UPF A;  1RTH B;  4PR6 A;  5D6G A;  1SQF A;  1XMO F;  2FZK B;  2D9O A;  2V69 A;  4WFY A;  3EJM A;  4OFZ A;  3FEX B;  2W8L A;  4EBC A;  3ENV A;  2UVR A;  2VG5 B;  3D3B J;  4ID5 B;  2E1M C;  1NXI A;  1VJQ A;  3A8I A;  1IR0 A;  1GX5 A;  1S9G A;  1W7W A;  1EKR A;  2E1R A;  3D1O A;  3RYL A;  3ULH A;  4X64 F;  1F1B B;  2K3K A;  4F8R A;  3H7H B;  3K0J A;  5KFB A;  4F02 A;  1RKJ A;  2FJW A;  4HT7 A;  2XLI A;  4UW2 A;  2GS8 A;  3DRX A;  2PSZ A;  1KSP A;  3W5X A;  1RWO B;  5EHH A;  3KLF B;  3MM5 A;  1RT4 A;  4NLG A;  4IOC Q;  2IM1 A;  1MN9 A;  2JZ5 A;  4DR1 J;  3T5H A;  3CUL A;  2K1R B;  3GIM A;  2CPE A;  3VTI A;  1VRU A;  1QJH A;  2P6T A;  3OL6 A;  3BSC A;  1K8A T;  4UQG A;  1FK9 B;  4JOU A;  1JLQ A;  1RWX B;  4DQQ A;  4I2Q B;  3AT1 B;  1LK5 A;  1VQK S;  3W63 A;  2W01 A;  3HM9 A;  3GWC A;  1OPZ A;  4KH1 B;  1SPB P;  2FJV A;  4B3M F;  4C8K A;  1EAR A;  1GT8 A;  3M05 A;  3Q8U A;  4G1Q A;  4GVB B;  5ETK A;  5AJ3 J;  2W9C A;  2CIM A;  4K4W A;  1U1N A;  1R0A B;  3JSY A;  3MMA A;  4IFY B;  3K5P A;  2I6W A;  3FK4 A;  1DBD A;  3SSQ A;  4DV4 J;  3LWL A;  2UU9 J;  4N76 A;  3OR2 B;  4LQ9 A;  1HPZ A;  4UY8 5;  2VA2 A;  2YWF A;  3VAJ A;  1WF1 A;  1WC0 A;  2VDH A;  3AA9 A;  2Q79 A;  4B9M A;  4X4V A;  1DFD A;  4RW9 A;  2LVW A;  1RDR A;  2O66 A;  1PJ6 A;  3IR7 B;  2V9W A;  3THV A;  4WP9 A;  4WWS A;  5L1I A;  3TJA A;  1PJ5 A;  2F65 A;  3MFH A;  4LFC J;  2KXN B;  3Q8S B;  3IC1 A;  2MZR A;  2AIR B;  1KS2 A;  2DHH A;  2M5Y A;  1VQS A;  5FDL A;  3CPW R;  4DR3 J;  2PI5 A;  4K4U A;  2DIU A;  2RDD A;  4QW9 A;  1NJI T;  4CNZ A;  5M2R A;  2UUA F;  1EP4 A;  1XTZ A;  3M2U B;  2XUL A;  1LEO A;  3M9M B;  3MWB A;  1TTH B;  3ZC4 A;  1WHW A;  4J90 A;  3WDO A;  2L9D A;  3IBF B;  3WZ0 A;  4DU7 A;  4TU7 A;  1UZD A;  3SV3 A;  1Q8L A;  3MED A;  3DLK A;  1NND A;  1DQ8 A;  1Q5V A;  1REV B;  3NMR A;  4OX9 F;  4KPY A;  2YWE A;  1IBC B;  3HI9 A;  1X5O A;  5ETP A;  5DG8 A;  3Q8Q B;  4I68 A;  4JI0 F;  2BXJ A;  3PJW A;  1OYD A;  2B8Q A;  3C6T B;  4WK1 A;  1NHV A;  1BQM B;  1XQI A;  3CWJ A;  4B9T A;  3P6Y C;  3RGI A;  2FGC A;  4PAA A;  2OJ3 A;  3QMQ A;  3MM7 A;  5E2Q A;  2N4D A;  2HHX A;  4Y2I A;  2CFX A;  1I94 J;  1YQH A;  3M32 A;  3THT A;  4F4Y A;  1PSD A;  5EWF A;  2V67 A;  3E01 B;  1RYR A;  5KOW A;  3N28 A;  4DUZ F;  2EFG A;  2LXU A;  3LGN A;  4ZCK A;  1MN7 A;  2BJ9 A;  3MF5 A;  3UVJ A;  2B4P A;  4QR2 A;  2BKO A;  2HND A;  2C2N A;  2IDL A;  2FC8 A;  2E7X A;  3ZTR A;  4NYZ A;  1MML A;  4DFK A;  4I6W A;  4A8F A;  2IBO A;  3TVK A;  2H5E A;  2EFN A;  4PG6 A;  1RSC A;  3ZNJ 1;  1K9M T;  4O3R A;  1LFP A;  1NDK A;  3MEC A;  2JEI A;  4CIO A;  2VHG A;  5CD4 H;  3L3C A;  2V0N A;  3EYZ A;  1S9E B;  1KNZ A;  1IR1 A;  5J1P A;  3T5J A;  1PAU B;  2HS4 A;  1FDA A;  1WC3 A;  1Y3K A;  1JLF A;  1EET B;  1R31 A;  3KDO A;  3KNG A;  4RW6 A;  3UW1 A;  4QWE A;  3CGI A;  3VAF A;  3PX4 A;  1FJC A;  3MAA A;  4NWB A;  4W4M A;  3N5B A;  3T3F A;  3QGI A;  2E5L J;  4IH6 A;  1N32 J;  4I4B A;  1NSA A;  2MZ1 A;  1TVR A;  3LF0 A;  2FC9 A;  3QAE A;  5KG5 A;  1LXJ A;  3BYP A;  5G0R A;  4UQT A;  4X64 J;  3VAM A;  4HI2 A;  2HQD A;  4DCP B;  1TMJ A;  3CED A;  4WPA A;  3NEK A;  1MU2 B;  5C42 A;  5A2Q U;  2E66 A;  3ZTQ A;  2V6A A;  3V6D A;  3JQM A;  3JB9 k;  1U0S A;  1LW0 A;  5HAT A;  4M5M A;  3TA0 A;  5I3U A;  3DI6 A;  2ACM A;  3QZ8 A;  1UVI A;  2M2B A;  2NLW A;  4NZ6 A;  2KH9 A;  4KO0 B;  4DR1 F;  1Y7P A;  1WD6 A;  3X1L B;  2MQM A;  3EZU A;  3PRB A;  1BWV A;  2MKH A;  4HH0 A;  4IFV A;  3Q23 A;  3EPI A;  1SKS A;  1AW0 A;  5BYR A;  1YBT A;  1Y00 A;  1T03 B;  1QAY A;  3OTB A;  3PHT A;  3M8Y A;  4MK9 A;  2LLZ A;  2B43 A;  3GG0 A;  5B0B A;  3RR7 A;  4JUZ A;  1AZS A;  1HAR A;  4DSL A;  4FYD A;  1ARO P;  2MLY A;  3RUB L;  4DV4 F;  1HBO A;  5C5J A;  2EBE A;  3HF5 A;  3UO0 A;  5BR8 J;  3OFE A;  4P7V A;  3HO1 A;  4LMZ A;  3PKY A;  2XYG B;  5F0U A;  4DV6 F;  4ED7 A;  1RKI A;  3DU6 A;  4FPR A;  4NYP A;  3J7A 1;  1HMV B;  4DX7 A;  2GAH C;  2F7V A;  4F0H A;  1NEE A;  2MHN A;  4NLX A;  5C2C A;  2VKZ G;  2J0Q D;  1NAQ A;  4ILM A;  4NXM J;  2RSQ A;  5AE1 A;  4X65 F;  1FI4 A;  2GHV C;  2MZT A;  4LRD A;  2QA4 S;  2CJY B;  2BAN A;  5ETS A;  2V2Z A;  1KHW A;  2QC3 A;  2JH3 A;  2D3O R;  1P1T A;  1TAQ A;  2AX0 A;  3M30 B;  4O0I A;  3DGP A;  2UVV A;  2DBB A;  5HRO B;  2QL9 B;  3MM9 A;  3N4W A;  2KTQ A;  1HWU A;  1YJU A;  4DPU A;  4DDF A;  9ATC B;  4KFB A;  3PO5 A;  3ETO A;  5ETQ A;  1WWH A;  2AU0 A;  3RU0 A;  2IM3 A;  4ZK7 M;  1WHX A;  2G9O A;  2KFN A;  4A48 A;  3TNV A;  2H48 B;  3ET6 A;  1TKD A;  4W92 B;  3EVO A;  3KLI A;  1KVI A;  3ZZZ A;  4JV1 A;  2J7U A;  1H0H B;  1D9F A;  1SJQ A;  4JI0 J;  3JQK A;  3M6U A;  2CJX B;  2HPU A;  2Q6B A;  4MMO A;  1F6T A;  1JNR B;  2JC1 A;  3EZ5 A;  4EGL A;  2UV8 G;  3MZI A;  2W9C B;  4JI4 J;  1I94 F;  1HBU A;  4M5J A;  3CJ0 A;  4YP3 A;  3PR5 B;  2ZKT A;  4QIV A;  1FKO B;  1QE1 B;  3BDE A;  1O8B A;  1HHT P;  3GG1 A;  1LWC B;  1O0P A;  1N0V C;  2M88 A;  3OL8 A;  4RW4 A;  1UVL A;  2CVE A;  1QSL A;  1ELO A;  1RT1 B;  4J9R A;  1B3T A;  1RT6 B;  4USJ C;  4I7F A;  3QGG A;  3A12 A;  2ZBI A;  4ZP7 A;  2FLO A;  2QL7 B;  4OZ1 A;  5AXK A;  1H72 C;  4K0K J;  3IMQ J;  5DG7 A;  2FVR A;  3FFI B;  4ZJO A;  4MFB A;  2GNK A;  3QYY A;  2OH2 A;  3H42 A;  4CP5 A;  1CEZ A;  2KG0 A;  3P96 A;  4NRU A;  3GFH A;  4J37 A;  4XTT A;  3MEE A;  4DU8 A;  4KRW A;  3CJK A;  2AZ1 A;  2JNJ A;  5D78 A;  3ELH A;  5KFI A;  3F41 A;  1VC6 A;  4U9R A;  3DLK B;  2F4V J;  1MW7 A;  2MKK A;  2NPI A;  1NKC A;  3GCX P;  2KI2 A;  3LAM A;  3V4M A;  1C0T A;  2OEM A;  3HKZ D;  4UTG A;  3M7V A;  4RW7 B;  1L3T A;  1JX4 A;  4PWD A;  1RTJ A;  4JI6 J;  4C4W A;  1XNQ J;  3G6Y A;  4ECX A;  5KFC A;  3B82 A;  2IRU A;  3LW5 C;  1E6Y B;  1QUV A;  3PVX A;  3G96 A;  2YNF B;  3MM7 B;  2B4O A;  2F1F A;  3HVT A;  3RBX A;  1XMQ F;  1U47 A;  2ZE2 B;  4FKX A;  2B7C B;  3SSS A;  1RQ0 A;  1PYO B;  2CQD A;  2XNR A;  2XC9 A;  2MKJ A;  1RAE B;  4N47 A;  1U0H B;  5KG4 A;  3FSX A;  2DGU A;  3HFV A;  3P45 B;  4C3K A;  4A4J A;  4WFZ A;  4I67 A;  1WOO A;  7FD1 A;  1SH0 A;  2YNG B;  4UUX A;  4JI8 F;  4X4S A;  1XK8 A;  4MKV A;  3FDS A;  5LL6 d;  4DPX A;  3R6L B;  3IR5 B;  4PAB A;  2MKI A;  1RWV B;  2VIH A;  2NQP A;  4NLO A;  5IM0 B;  4DL2 A;  2CNN B;  2GV1 A;  3BKU A;  2XBP A;  1SC1 B;  3D3C J;  3PNI A;  4N41 A;  1YBU A;  4U7U D;  2X51 A;  2DPI A;  4XPE A;  1FWL A;  4NLP A;  2KRR A;  4IO1 A;  2ZVS A;  2RUS A;  4MIB A;  2RRB A;  1D1U A;  4EO6 A;  3N9U C;  4DMZ A;  4IQX A;  2R7T A;  3CJR A;  1HQU A;  3HVR A;  4MIA A;  2DH9 A;  5BR8 F;  3K57 A;  1U2C A;  1ZAX A;  2DB1 A;  3QSI A;  4Y6I A;  4AQY J;  2V94 A;  1P9Y A;  4S0M A;  2R7O A;  5HMY A;  1U1M A;  2UUB F;  4WE1 B;  4NLT A;  2WON B;  4NPO A;  4X4T A;  1SH2 A;  2XMA A;  1RT7 A;  3SZ2 A;  4NXM F;  1B0P A;  1WI8 A;  2LU2 A;  3W62 A;  2ZH6 A;  4GO7 X;  3POT A;  1NK0 A;  1R8C A;  2HHV A;  4J9V A;  4R5P B;  1KQS R;  1ITP A;  2HHH J;  2BYC A;  4HTI A;  3LGH A;  3VZI A;  2VG6 A;  2ZD1 A;  1V5I B;  5EX0 A;  4G1Q B;  3ZTO A;  2ZOM A;  4M5D B;  4CTA B;  1SC6 A;  1C0U B;  2YXL A;  4O44 A;  1X0F A;  5KAK A;  3MMA B;  1UVM A;  3PRD A;  3VHQ A;  4O3S A;  3N5F A;  2A6O A;  3IWN C;  3MM5 B;  4FBU A;  2CPJ A;  3CCL S;  2DR7 A;  2N7Y A;  1DJ0 A;  1S79 A;  2GO9 A;  2DHA A;  5K8P A;  1GMW D;  2Y8W A;  4IKA A;  3AA8 A;  1GAO A;  4IG3 A;  1VRU B;  1U2F A;  4RBV A;  4OYZ A;  1H2U X;  1TEL A;  3UI3 A;  4DL5 A;  1RTI B;  1JJ2 R;  3FNN A;  3P5B P;  1OY6 A;  1U49 A;  1IKX B;  2IMW P;  4AL6 A;  3DCA A;  4P2X A;  3DXS X;  1HYS A;  3MPV A;  3GSD A;  5LMN F;  3FEZ A;  4RPF A;  2IBK A;  5CH7 B;  3T1A A;  2QLX A;  5JXS A;  2X1F A;  1RWU A;  3W61 A;  4KR0 B;  3TI0 A;  4W90 B;  4YN3 B;  2YX1 A;  2IA6 A;  1S72 S;  2X3D A;  1M90 T;  3CIZ A;  8AT1 B;  4GKK J;  1MRO B;  2ZZT A;  1NSK L;  2OP5 A;  4HAC B;  3W65 A;  1S6O A;  5F8I A;  3HT0 A;  2WVB A;  3NG8 A;  4RUC A;  1W25 A;  1ZPV A;  4OI1 A;  2KYZ A;  2Z2Y B;  3NP5 A;  4ICL B;  3CO0 P;  3NS6 A;  2RRA A;  2VBY A;  5H9F K;  1NH8 A;  4LRB A;  2HGN A;  4C2M A;  2FGO A;  2RQK A;  4D3H A;  4ER8 A;  4U95 A;  3K8W A;  1IUJ A;  3AXM A;  4M5I A;  1R8A A;  3OR1 B;  3GE9 A;  1K1S A;  1YJ7 A;  2DGO A;  3LP2 B;  4PG7 A;  1DLO A;  2B56 A;  3U1L A;  4LBI A;  2H4Y B;  4CO4 A;  3HHL B;  1S1T A;  2X7I A;  3NRB A;  4ZPV R;  2ALZ A;  1JJH A;  3TQE A;  3H5S A;  4C8L A;  5D4O A;  2E1C A;  4WFB Q;  3SFG A;  4IOB A;  5J1E A;  1Q8K A;  3BGR B;  2OPQ B;  4A8K A;  3AOD A;  4JI2 F;  1ZYQ A;  1CJV A;  3FCW A;  4G65 A;  4LVO P;  3V81 A;  4LT6 A;  4TLQ A;  3MEK A;  2OEL A;  3L09 A;  1VJW A;  4WU2 A;  4LSN A;  3G6V A;  2PN6 A;  1N5Y B;  4PPD A;  4JI6 F;  1RT3 B;  2HK3 A;  1VQO S;  4LFB J;  3EIC A;  3H8Y A;  4DJB A;  3MPU B;  1FX4 A;  1T11 A;  3LH2 S;  1KKH A;  3J7Z 5;  3D5M A;  2YNH B;  3ZO7 A;  1EIY B;  4DUT A;  1K1Q A;  3V4I B;  2WOM B;  3KLE A;  4WBF A;  4YS2 A;  2J9E A;  1JLC B;  3FSI A;  2BDP A;  3RRH A;  4H54 A;  1TP7 A;  2R2T A;  2DY9 A;  4U8V A;  4IR9 A;  1P9Q C;  3HDS A;  3G82 B;  2HND B;  2PDA A;  5F9L A;  4MAK A;  3TAM A;  4M63 A;  3GMG A;  3GB0 A;  1T05 B;  3QLH B;  1RT1 A;  1NK4 A;  3SEO A;  4R8U A;  3OVS A;  5J1N A;  4DV5 J;  4OV6 A;  1S49 A;  3G8S A;  1F5A A;  4FN5 A;  3W8P A;  2J9C A;  1I51 B;  1VK8 A;  2A18 A;  2M70 A;  2WVE A;  3IWX A;  5HBM B;  3CC7 S;  5KFK A;  2HQF A;  3T9Z A;  1KVJ A;  1WOS A;  1NKE A;  4V19 J;  4DG1 A;  3QJJ A;  3M8Q A;  5CZX A;  5DDR C;  4A8X A;  3MAQ A;  1FX2 A;  2VBW A;  2KT5 A;  4NXN J;  1B7Y B;  4DR4 J;  2VIC A;  1OJ4 A;  1PBU A;  2ZBP A;  4B3R F;  2HMI B;  3DYA A;  2JVR A;  3R9L A;  3OL9 A;  2DGW A;  1HW9 A;  4F4W A;  2LQ9 A;  1TVR B;  2VQE F;  2UXC J;  4PWD B;  1IKV B;  2C3O A;  3UD3 P;  2DH8 A;  3M2V B;  4KGK A;  1TL5 A;  2XSJ B;  3AOA A;  5HQM A;  3HMJ G;  3T1H F;  2POK A;  1A6L A;  2ZFH A;  3DLE B;  3FZ2 A;  3VZH A;  4C98 A;  1IBM F;  2VOD A;  5I42 A;  1DTT A;  4E98 A;  2O1P A;  1TZ0 A;  3NAH A;  1GK8 A;  4YB5 A;  3L4B C;  1IKY B;  1H7X A;  3QBC A;  3TZW A;  2RT3 A;  5LXR A;  3CC2 S;  2DIV A;  4ED1 A;  4ANC A;  2PA3 A;  2ZC4 A;  5D0G A;  3RW6 A;  2ASJ A;  4CLP A;  1SKU B;  1UFK A;  1RAF B;  3C2P A;  1JLE B;  5AE2 A;  4UOF A;  2J8A A;  5E3A A;  4ED8 A;  4QCL A;  1AFJ A;  1CPZ A;  1P8G A;  2R8H A;  4ED0 A;  5I3P A;  4NAS A;  5LSO A;  6FD1 A;  2GZO A;  4X4O A;  1G6B A;  1WF2 A;  2HUR A;  5KFT A;  2ZH1 A;  5IM0 A;  3CCW A;  3EDR B;  4LFA J;  1NHU A;  1ZZF A;  3KHL A;  1N33 J;  2M9K A;  3WC2 A;  4KHR A;  5HLF A;  3C16 B;  2O01 C;  4ZHR A;  2W2M P;  5HRO A;  3M8P B;  1R7I A;  3CD6 S;  4ZLJ A;  2HHP A;  2DXE A;  2GHW A;  2N4C A;  2C28 A;  1T7P A;  3PY8 A;  3QGP A;  2GFF A;  2OUG A;  2BRK A;  1CBK A;  2HWI A;  3FCH A;  5E33 A;  3V5R A;  1TV6 B;  1UPP A;  4WFN Q;  1TFY A;  2GAG C;  2V34 A;  3BS9 A;  1RWN B;  5BYQ A;  2ROE A;  4IH7 A;  2QE5 A;  4XDC A;  5C25 B;  1UEV A;  3OUY A;  1B7F A;  5A6P A;  1BY9 A;  2B4U A;  4C11 A;  2ZHB A;  4DR7 J;  1YVF A;  1KQG B;  4B3T J;  2ERR A;  4Y3C A;  2IPO B;  2IAJ B;  3QAT A;  4ENO A;  3RR8 A;  4RZR A;  4ELU A;  3GR1 A;  3RAQ A;  4FF3 A;  5L1J A;  3FSY A;  1P1L A;  4NYO A;  4ATN A;  2GW8 A;  3HD2 A;  2G2Y A;  4Y2M A;  3CD0 A;  4M5D A;  5KFS A;  5J2P B;  3CCV S;  4LF7 F;  4A8W A;  4ITS A;  3OSP A;  4C0H A;  1SH3 A;  4O3P A;  3RZA A;  1HKA A;  2VJU A;  4HR2 A;  1X31 C;  3CJ3 A;  3LQV A;  2EFV A;  1Y4Z B;  2FHO B;  1RIS A;  1SUQ A;  1BQN B;  2R2S A;  1OMS A;  2DR9 A;  2C3U A;  2IYI A;  5IOL A;  3J80 U;  4OZ3 A;  1X4A A;  1JB0 C;  3VAH A;  3VGS A;  3DOL B;  1ZS6 A;  3CJ8 A;  3IA0 A;  3AAW B;  5GME A;  2Y0B B;  1ZET A;  1S1U A;  2GVD A;  1NK9 A;  1YX2 A;  3SMZ A;  3TVZ A;  3A3P B;  3QIP A;  2DD8 S;  1RHK B;  3NS7 B;  1FA0 A;  3G8Q A;  4HL9 A;  2RS2 A;  1URN A;  2RVJ A;  3LUY A;  2RF2 B;  2LYV A;  3BGO P;  3S01 A;  1V3S A;  4EU0 A;  5LMU F;  3PYF A;  3KJQ B;  3CNQ P;  3PEJ A;  4ZN1 A;  2XO7 A;  1JLQ B;  2F9D A;  2XMT A;  2WK4 A;  1S9F A;  2YKQ A;  1K73 T;  2UUC J;  2KRB A;  5KG1 A;  3TZY A;  1G3O A;  4LRF A;  1Q7Y T;  1FTR A;  2QJ3 A;  1NB2 A;  3KG1 A;  3W60 A;  1R8H A;  4HHH A;  2Y1I A;  5F3Z A;  2JLG A;  2IA0 A;  4M8L A;  3OHA A;  1FE4 A;  1FTC A;  2AHO B;  1YRT A;  1IR2 A;  3OR1 A;  1FXL A;  5L46 A;  2FPH X;  3H40 A;  3PW5 A;  1VQ9 S;  2B9X A;  3ZTP A;  4DCJ B;  5KFO A;  2MGZ A;  3PIP Q;  5SUH A;  4DV3 F;  2HLT A;  2C42 A;  1S1T B;  3BPS P;  2DNP A;  5EX3 A;  4DPW A;  1WEY A;  1XER A;  2ZH9 A;  3R1H A;  1RHU B;  2G0J A;  4TXS A;  3KXD A;  4RX6 A;  4QIF A;  4ZVG A;  2GIF A;  2BQR A;  3DDI A;  2XMK A;  2LEA A;  3PX6 A;  3C6T A;  5KT7 A;  3HHK A;  3R8Y A;  2QLJ B;  2VFR A;  3DMJ A;  3QT5 A;  1SCJ B;  1FFS B;  3D6T B;  4NCG B;  2H3E B;  2FZC B;  1JLG A;  2AW0 A;  3OQ2 A;  3JTN A;  4LVN P;  4OIX A;  3RB6 A;  1FF2 A;  2AGP A;  2XLK A;  3A3N B;  4CDI A;  1S0N A;  3ITH A;  2C2D A;  3MR6 A;  2GQC A;  4K50 A;  4Y34 A;  3AH6 A;  2XSF A;  2MST A;  4ES3 A;  3BRE A;  3D0I E;  1WUU A;  1MWZ A;  5A8R A;  3WX4 A;  4X62 F;  1M5K C;  1U0H A;  2FQQ B;  4CO0 A;  3UDE A;  4DLE A;  3QRQ A;  2R7W A;  2WZ1 A;  3A8J A;  2LMI A;  1A9N B;  1K44 A;  1V3Z A;  2OIH A;  2QG9 B;  2HBZ B;  4BBY A;  5DQH A;  5L1L A;  2FJX A;  3TX8 A;  3WIU A;  3GV5 B;  4O4R A;  4J9P A;  3KJN B;  3H4D A;  4OI0 A;  5D0H A;  1FRL A;  3KFW X;  3P49 B;  4C0O C;  2R8J A;  1IQT A;  3H0P A;  3NGU A;  4ZVE A;  1CG2 A;  5A6W A;  4LFA F;  3UCU P;  2KN4 A;  4PWW A;  5HQL A;  4UUW A;  4A8M P;  1SQG A;  1VOM A;  5KG7 A;  3JYT A;  4GO5 X;  2YNI A;  1N33 F;  1YJR A;  3I0R B;  3O6Q A;  4YHH J;  4USK A;  1SL1 A;  3MPW A;  2ZHA A;  3L7P A;  4AYB D;  2OPP B;  1VR6 A;  2HHQ A;  5A8W A;  4ZCL A;  3HSJ A;  1WKL A;  4NE9 C;  3KHH A;  2R2U A;  1R0C B;  2RQM A;  2XWX A;  3R7S B;  1I5O B;  2WON A;  2HMI A;  3S8S A;  2SXL A;  2HNZ B;  2R7R A;  4O3N A;  4OMF G;  4B08 A;  3KKF A;  2J6U A;  4UST A;  3SDE A;  1UMJ A;  1P27 B;  4AXJ A;  1U2R A;  3PTW A;  4ZLN A;  1MNE A;  2OEJ A;  3GTY X;  4NMX A;  5KT2 A;  3TAR A;  3CIM A;  4DV7 F;  1HW8 A;  2ZUA A;  3I56 S;  1FJE B;  4LF8 F;  4XAK A;  1G1X A;  3I0S A;  3A3O B;  2R7Q A;  4CM0 A;  2DCL A;  4URG A;  4JBC A;  2YKM A;  1R6V A;  1NJZ A;  2W8K A;  3IAM 9;  1FDD A;  1UEK A;  1OS5 A;  3WX8 A;  3MD3 A;  4O4G A;  4F26 A;  2XCA A;  2OKQ A;  4DR2 J;  2N3L A;  4EYH B;  2L08 A;  4R25 A;  4M5G A;  3DGV A;  4FVC A;  4N5S A;  3VR1 A;  1IBL F;  4F2R A;  2AJ2 A;  3LP2 A;  5DQI A;  1WEX A;  2M0G B;  2NRE A;  5RUB A;  1MRO A;  1U8W A;  2MLX A;  3IWL A;  2Z58 B;  2YWK A;  2ZM6 F;  4C9D A;  4YDX A;  1KHV A;  3M8S A;  4PPZ A;  3DNC A;  1ACM B;  5K9F A;  2XHC A;  2EFO A;  4DS4 A;  2LDI A;  2JWN A;  4FYX B;  3UR3 C;  4DZD A;  4LSN B;  2A2D A;  3SV4 A;  1FNM A;  1N5Y A;  1QSS A;  1YWX A;  4KSE B;  1N56 A;  3J81 Y;  2C2Z B;  1QAJ A;  3QT6 A;  1TK8 A;  2IC3 B;  3OXF A;  3NY0 A;  3T19 A;  1C4C A;  2Z57 B;  3BGF A;  3CUN A;  3KMQ A;  4B3R J;  4ECS A;  1JLB A;  2JJ4 D;  1JJ4 A;  3DKD A;  4HH1 A;  3IG1 A;  2DGT A;  1T9W A;  3PAC A;  4ILR A;  3KOA A;  3Q2T C;  4GKJ J;  2FJB B;  1F5B A;  3TA1 A;  5EUH A;  2HIQ A;  5DDP C;  4NZ7 A;  3CD7 A;  1UWA A;  2LQB A;  3UCG A;  5KFP A;  3CXC R;  2EPI A;  3VWS A;  2AGQ A;  9RUB A;  4FXD A;  2FY8 A;  3FRZ A;  4ZA1 A;  2HHS A;  2ZH5 A;  4FZV A;  4YY3 F;  2CQ2 A;  1SL2 A;  4JI3 F;  4Q2L A;  4OHY A;  1XMB A;  4CLY A;  1N52 B;  1S57 A;  1NM2 A;  3HZG A;  3OFG A;  5CHC B;  5KG2 A;  3LAK A;  1XWL A;  1C1C A;  1T05 A;  2HW3 A;  4WCE Q;  4KHM A;  2QLW A;  4ECT A;  4L3N A;  2V5H G;  2QA1 A;  2MZS A;  3I5A A;  3SYZ A;  1KWM A;  1S1V B;  2FVS A;  1G4C A;  4USH A;  1CS4 B;  4C8M A;  4CLF A;  2XS2 A;  4NLU A;  4JV5 J;  2OPR A;  2ROG A;  2XNQ A;  3BPD A;  4DN0 A;  5DG9 A;  3KLE B;  3T1Y F;  1YJW S;  1X5S A;  3RAX A;  2PE8 A;  4TKT A;  3G71 S;  1DRZ A;  3QJP A;  3M9N B;  2HAI A;  5L38 A;  3NWG A;  2HFV A;  5F8L A;  1LQ9 A;  1XR5 A;  1MMN A;  3AXK A;  4CYU B;  2UXD J;  1D8Y A;  3W9H A;  2KU7 A;  2NYI A;  4F36 A;  3FVY A;  2DHS A;  2NS1 B;  1RTZ A;  4CLU A;  2DGS A;  4CRJ A;  1ZAW A;  4WYW A;  1RWK B;  1Z2L A;  3FFI A;  3KLV A;  2MYF A;  2BJE A;  3TAQ A;  4ELT A;  2BOP A;  4UY8 T;  1VQM S;  1ZA1 B;  2XI3 A;  2G1H A;  2UXB F;  3IRX A;  2L48 A;  2KT3 A;  2VH7 A;  1H6K X;  4YDD B;  4DCO B;  2OPS A;  2VC0 A;  3GR0 A;  4YQW A;  1FFG B;  3NS5 A;  3QGH A;  1R8B A;  3HVW A;  3WQP A;  2ATL A;  2I1R A;  2I8E A;  1UAW A;  1LNQ A;  1IXK A;  1S1X A;  3M8Z A;  3PIO Q;  2R7S A;  4PQU A;  2D3U A;  5L8R C;  2W4P A;  2VZ9 A;  3SI8 A;  4ZIV A;  1EQ0 A;  2K2P A;  3W9J A;  4K59 A;  2OD4 A;  4FYY B;  1F3F A;  2DHX A;  2I9S A;  2D69 A;  3MPD A;  3Q86 A;  4WJB A;  3SCI E;  3BKF A;  5MLC V;  2JFD A;  3G6E S;  1KRP A;  4Z7Y A;  1U8S A;  4KHP J;  3MD1 A;  3EM1 A;  3HUL A;  3F56 A;  1TL7 A;  5D0E A;  3LWM A;  1FJG J;  4TQR A;  4LF4 F;  5D3G A;  3QAU A;  2JC0 A;  2LXF A;  3UN2 A;  4P75 A;  3I5B A;  5H1S V;  1VMB A;  4YOE A;  2CZ9 A;  2BJD A;  3UDV A;  4ZS6 A;  2YNG A;  2V2V A;  3AFG A;  5AXM A;  4Q0B B;  1U02 A;  5CXT A;  1VS3 A;  3MTK A;  4CO2 A;  3HFZ B;  4KTQ A;  2V50 A;  2J7K A;  1RAO A;  4FNI A;  4DQR A;  2ILY A;  5KT3 A;  3CDE A;  4CO1 A;  2CJA A;  3DOK A;  3W8G A;  5JJB A;  2GQ2 A;  4DR2 F;  4TYA A;  1GTH A;  4OL8 A;  4OYW A;  3UE2 A;  4NLD A;  3MFI A;  2V2Q A;  4EK2 A;  2ZH8 A;  1ZM2 A;  2ZJQ Q;  3TUJ C;  1VLO A;  2YNI B;  2BBE A;  2HFN A;  4ETX A;  1N36 J;  2MB0 B;  3N6N A;  5CZV A;  2JOQ A;  2DNO A;  3CJ4 A;  3TUI C;  3RRG A;  3LO3 A;  4ED6 A;  1YK9 A;  2QMW A;  2CQB A;  2OPP A;  2YKN B;  1Y5N B;  4QYZ K;  2ZH3 A;  4DV2 F;  2VAS A;  2X3G A;  3MGJ A;  3PHE A;  1WJ9 A;  4OYM A;  3V6J A;  2DR8 A;  2M8D B;  4RKU C;  1X60 A;  5CD4 A;  2DNY A;  2XMU A;  5IT4 A;  2J7W A;  3NL0 A;  2HKE A;  2DEI A;  4MKB A;  3CD5 A;  4X84 A;  3BGL A;  3GON A;  1U6F A;  4BC9 A;  4ECR A;  2R7V A;  2FHJ A;  2V2K A;  4N8N A;  5DET A;  2ZOG A;  1C0U A;  4O44 B;  2CA9 A;  4CWB A;  1UW9 A;  1QVG R;  4A8Q A;  4RU2 A;  1TAU A;  5F8M A;  4OJG A;  1PCA A;  3HFK A;  5T14 A;  1HBM B;  3V2U C;  4EFA C;  2XTJ P;  5K14 A;  4X4R A;  5J2M A;  1SBR A;  1IWA A;  2W7O A;  1T8E A;  2JL9 A;  2DR6 A;  3CCE S;  1UJ4 A;  1RHR B;  2VA3 A;  4X2B A;  4DN9 A;  1GFW B;  1RT7 B;  4IG3 B;  4ZIT A;  3AJ1 A;  1GTE A;  2LQJ A;  2BEF A;  1D9A A;  2LFV A;  3HVA A;  3I6P A;  3G87 A;  2B0G A;  1KLM B;  4MIW A;  4YY3 J;  2XS5 A;  1NPR A;  2CQP A;  2R7U A;  3D0H E;  1VRT A;  2CPY A;  2ASY A;  2G0I A;  3CC4 S;  2KHD A;  1LOU A;  5J2Q A;  3M6X A;  3A8K A;  2VON A;  4C8N A;  4D3G A;  3C46 A;  3DRR A;  3CJ2 A;  4NXN F;  2KM8 C;  5AXL A;  3I4H X;  4OYP A;  2AGO A;  2CPD A;  1C4A A;  2EWH A;  1F3V A;  1EP4 B;  3M2U A;  3QIP B;  3UWT A;  5HVH A;  4JV5 F;  1R8P A;  2GMJ A;  3PJX A;  2KZZ A;  5K8N A;  3EUN A;  2DEJ A;  1FRI A;  2W7A A;  1S6U A;  3EZO A;  4Y0F A;  3J81 U;  1RP5 A;  3O2I A;  4QIE A;  4ZVO B;  2Y1J A;  2XMV A;  2X1B A;  3AD7 C;  4KYZ A;  3ISN C;  2DYA A;  2UXD F;  2DH7 A;  1J27 A;  2OSQ A;  3FBC A;  4WZQ A;  2M8H A;  4YME A;  2FHK A;  5DM6 Q;  2XZD B;  3KWM A;  4J9M A;  1F9E B;  2Y1L B;  2BRL A;  1PGZ A;  5D0R A;  3R97 A;  2GVZ B;  1U09 A;  4P7T A;  3CCM S;  1H2V Z;  3H2L A;  3KUE A;  1SB6 A;  4FBT A;  4X4U A;  3ITH B;  4CT8 A;  1J5E J;  2ZH7 A;  4NLV A;  1WHY A;  4PG8 A;  2VJV A;  1U45 A;  3LAL A;  3R5D A;  5DJB A;  5GAH U;  3Q24 A;  3NCP A;  4B9N A;  3GFY A;  4HAC A;  2VBZ A;  2ZUG A;  4TYB A;  3TZX A;  5HJX A;  5DQG A;  2A0F B;  2AD9 A;  1HNV A;  1TFW A;  3C6U A;  3LAN A;  1U7L A;  1S4F A;  2HQI A;  5KT4 A;  1OPI A;  2XWY A;  2P5V A;  3MR7 A;  4USW A;  4WFX A;  5ETO A;  2VKR A;  4IDK A;  4CNY A;  4LR7 A;  2CKW A;  1N5V A;  2QT7 A;  3DMJ B;  2PT0 A;  4RO0 A;  3JTP A;  3TA2 A;  4CLK A;  1QTN B;  1ZTW A;  5ETV A;  4YB6 A;  2YQ1 A;  4YEA A;  5FD1 A;  2F4F A;  1JJC B;  2YNH A;  4FXW A;  3KK2 A;  4KHP F;  1U1Q A;  1DLO B;  2ZZM A;  2OI2 A;  2ZDO A;  3Q8P B;  1YHQ S;  1FJG F;  1NBE B;  3NCR A;  5A8R B;  2QMU B;  3BR8 A;  1XEZ A;  2YVS A;  3MMB A;  4CQ1 A;  1GQE A;  7AT1 B;  5JUM A;  1F9F A;  5A8K B;  1PAE X;  1Y5L B;  2HK2 A;  2RE1 A;  2FVP A;  1JLF B;  3MCM A;  1HD0 A;  2OMO A;  4QR1 A;  4NML A;  3W1Y C;  1D0E A;  2DGV A;  3TZZ A;  1SIW B;  4C48 A;  3CCZ A;  3GIR A;  1F0X A;  3IP0 A;  2BE7 D;  4FF2 A;  4V1A k;  3T5L A;  1O51 A;  3QT8 A;  2MKS A;  1OQ3 A;  1NDC A;  1TUG B;  3H98 A;  2RQ4 A;  3IS9 A;  2XM3 A;  2LQ5 A;  5ETT A;  3P5T L;  2WOM A;  1AB8 A;  1U25 A;  4DG1 B;  4F3M A;  4ECU A;  2YPY A;  4YR2 A;  2W24 A;  4N8O A;  4OJH A;  2W9B B;  2BOA A;  2P9G A;  2KXF A;  4NI2 A;  3QQC D;  2RQC A;  4Q8F A;  2YQ0 A;  1U24 A;  2RU3 A;  2FD2 A;  4TQS A;  2BW7 A;  1AXQ A;  5HSP A;  4N56 A;  3MUM P;  4MKY A;  3OD2 A;  2FLN A;  4OX6 A;  4G1P A;  2AYG A;  3PJ9 A;  1YBA A;  2DY1 A;  3MR5 A;  3DFE A;  1TR0 A;  4IFV B;  3IAS 9;  4HYK A;  2WSF C;  1VC5 A;  1S1X B;  3M2V A;  1TUV A;  2IHR 1;  3BQ1 A;  3SQO P;  1ICE B;  1SV5 B;  5KFV A;  4B3M J;  3G86 A;  4R0E A;  5I42 B;  2BJ1 A;  2QYG A;  2KDO A;  3SCJ E;  5B0D A;  1S6P B;  2Z8Q A;  2WVC A;  2UU9 F;  2JLE A;  3LP1 B;  1MWY A;  2HGL A;  2VC1 A;  3D68 A;  5CAB A;  1KFD A;  3ZXW A;  1UA0 A;  3R3T A;  4XK8 C;  1HI1 A;  2C2O B;  3DYA B;  3FGV A;  5HAO A;  5IC6 B;  5IFM A;  5F9N A;  5F8H A;  2R2R A;  1S6Q B;  3VAI A;  4DSJ A;  4KH0 B;  5EGY A;  1IKW B;  1RWP B;  1UZH A;  2CQG A;  2QX0 A;  1N34 J;  1N6Q A;  1UVK A;  4B9U A;  2CDQ A;  5IV4 A;  3LOU A;  2XEX A;  2IIH A;  2VQF F;  4O4G B;  1JWW A;  2B9W A;  4ID5 A;  4KT0 C;  1N5S A;  3K89 A;  4E0D A;  1NPK A;  4PZV A;  3R6G B;  4AXI A;  1NK6 A;  3QSY B;  3PCO B;  4EYI B;  3R5A A;  3EGV A;  3EWG A;  4KGZ B;  1HQE A;  3OJS A;  2QV6 A;  3BSO A;  5A0Y B;  1FWP A;  1CJK A;  3HXM A;  1C2P A;  3GCW P;  4IRD A;  4PWU A;  2FLL A;  2G13 A;  4OX9 J;  3AQO A;  1VQ6 S;  3N0V A;  1TQL A;  3DOM B;  2ZBQ A;  2NXC A;  4YFU A;  1NCL A;  1Z4U A;  4P9S A;  4ED4 A;  1RBL A;  1UTA A;  1JNZ B;  2BE2 A;  2WBM A;  1ZOT A;  2RD5 C;  2V4J B;  3BBF A;  1V6H A;  2A10 A;  3I9Z A;  1QAX A;  1FRX A;  1X4C A;  1IM6 A;  4ID8 A;  2NSC A;  5DZ6 A;  3TJ9 A;  4ZHR B;  1SJR A;  3S7R A;  3KK1 B;  2H51 B;  4OYX A;  3CCJ S;  2VFT A;  1KOO A;  1S1V A;  4C0B A;  2ZEJ A;  3ENW A;  3CCU S;  2OPR B;  3KHG A;  1HWK A;  4K4T A;  1IBK J;  3R2C J;  2IVF B;  2GC8 A;  5C25 A;  3CE8 A;  4DQS A;  1X7V A;  4WP3 A;  1FKO A;  5F41 A;  5F8N A;  4YB7 A;  2HHU A;  1FO1 A;  2NSB A;  1WTF A;  2RHS B;  1YKW A;  2B7B B;  2KJV A;  1FK9 A;  3KK3 B;  1Q1K A;  2A3J A;  1AUD A;  4LIW A;  5DLF A;  4RW4 B;  4BS2 A;  2CJB A;  1YIT S;  1KTQ A;  1TL4 A;  4PYA A;  1C1C B;  4H4O B;  2I0X A;  2ZBR A;  3AD9 C;  3P4U B;  5KOX A;  1E6V A;  4CH1 A;  1RA6 A;  4FXV A;  3BV8 A;  4I2P B;  1RU2 A;  5IC4 B;  4RU9 A;  2OTJ S;  4RNH A;  1RWM B;  1S7H A;  2WCX A;  3DRS A;  4K5R A;  1SVD A;  3OR2 A;  4M94 A;  1KBR A;  3LP0 B;  2E7V A;  1YSJ A;  3ZTS A;  3ZZT A;  2DCU B;  3CF5 Q;  1BQN A;  4K4S A;  2ILZ A;  2NXJ A;  4LF2 A;  2E5L F;  1RAI B;  2QRR A;  2W2P P;  4KGX B;  1KP6 A;  1B4S A;  3UN5 A;  4EMD A;  1XNR F;  1U48 A;  1N32 F;  2M4M A;  4WZM A;  1OQ6 A;  5E3Q A;  5CAA A;  3KLH B;  5I4M A;  2QO3 A;  4ZPC A;  1RGV A;  4M5N A;  4DR3 F;  2B3T B;  1S1U B;  1RK8 A;  4DSF A;  3RBD A;  1N5T A;  3BO4 A;  4ZPT R;  2HHT A;  1E6Y A;  3BYR A;  5K20 B;  5IQQ A;  1NK5 A;  1PC5 A;  3M6W A;  4URQ U;  4L3K A;  4Y2A A;  2AEF A;  4C8O A;  2F8H A;  2QGF B;  4OI3 A;  2CJQ A;  5MAO A;  1Q79 A;  4B3S F;  3J81 j;  1O5J A;  1HNV B;  1BWE A;  1Z2Z A;  1RAH B;  4ZP8 A;  2IFX A;  2LDY A;  4F25 A;  4JI7 F;  3E2E A;  3T6B A;  2CJK A;  4Q0B A;  2V68 A;  4CLL A;  4WP8 A;  2DNQ A;  1FDB A;  2VPZ B;  4DS5 A;  4K5S A;  5K8M A;  3L9Z A;  4PUO A;  3I5C A;  2JVO A;  1F2G A;  2UUW A;  1FEE A;  4TN2 A;  4Y2K A;  2GHP A;  2KHC A;  1TL7 B;  2QLB B;  3N6L A;  4M5K A;  5C2G A;  3GV8 B;  3UD4 P;  2OHD A;  2FJA B;  3RBE A;  1FKA F;  3E01 A;  2IJN A;  4KBI A;  2MPU A;  5FII A;  1VQY A;  4H4M B;  2V4R A;  1T9U A;  1RAG B;  2HZA A;  4FS1 A;  1EET A;  3K7R A;  4RW6 B;  2COL A;  1B70 B;  5DGB A;  2CQ4 A;  2F8E X;  1L3S A;  2HHH F;  2EFP A;  1RCO B;  3HJV A;  5C7P A;  2AV5 A;  2NR0 A;  2XHW A;  1GMW A;  1X9M A;  2BA9 A;  2M7S A;  3Q8Y A;  3F0N A;  2GX8 A;  2BM1 A;  1N34 F;  3CJT A;  1YTY A;  2LP4 A;  4A8Y A;  1Q4R A;  3HHD A;  5LSL A;  1Y0H A;  3DLJ A;  5IWA F;  2VQF J;  3BO3 A;  2VFS A;  3PV8 A;  1RUS A;  1SL0 A;  2V8V A;  1A7G E;  2EVZ A;  2QMX A;  3JYT B;  1Q95 G;  1Y5I B;  1ZZN A;  2KVI A;  2EG1 A;  1FDN A;  1S99 A;  2FVC A;  3M1V A;  4USV A;  4CTA A;  3JSM A;  3EXY A;  3OVA A;  1S7I A;  2HRY A;  1NLK L;  1D3W A;  5ITH A;  3KLF A;  3GZ7 A;  3CMA S;  3PFE A;  4OX7 A;  1IWG A;  2RU9 A;  5L1K A;  5CYM A;  3FUY A;  2HNY B;  2B9Y A;  3DHX A;  3VGU A;  2FUG 9;  3NAI A;  4OQJ A;  2HNZ A;  1FD8 A;  4KJI A;  1N54 B;  2AJF E;  3D7S B;  1KLM A;  1R27 B;  2FTR A;  3SDE B;  3HLU A;  1WC4 A;  2PA8 D;  2RIL A;  3DN9 A;  2QSW A;  3MOJ B;  3O8W A;  2XCP A;  3GP9 A;  3DDK A;  1RXO B;  3AJD A;  2E7W A;  5C42 B;  4FDF A;  4UZB A;  1S6P A;  2ZOF A;  3VCD A;  3V6D B;  2YWG A;  1QTM A;  4LF6 F;  3PXG a;  3MM6 A;  3CVK A;  1FD2 A;  2XYH B;  3VVT A;  1N5Q A;  4ZLP A;  4DZ6 A;  4L74 A;  4DSI A;  3AB4 B;  4ZDN A;  3MDF A;  2H54 B;  2D3O 1;  1FES A;  2G0C A;  1VQP S;  1HR0 J;  3DRY A;  3KUH A;  4DL7 A;  5IXU A;  1MG7 A;  3GYX B;  3L7U A;  1Q78 A;  2KM8 B;  1S6Q A;  2IMO A;  2AZ3 A;  4KB7 A;  4RWX A;  5KFJ A;  3D6H B;  1TL1 A;  3K5N A;  2Q43 A;  2DVI A;  1Q53 A;  3GJT B;  4QQB A;  2XGP A;  3I55 S;  2RIJ A;  4J9U E;  3Q0A A;  3EVM A;  3VQT A;  1R0A A;  3UR0 A;  4K0K F;  1NH7 A;  2Z2Z A;  2GVZ A;  1WDT A;  2WHO A;  2AWZ A;  2ABY A;  1BXN A;  1U6Z A;  1Y3J A;  3DGP B;  3IXQ A;  1LW2 A;  2E5I A;  1LWE A;  3OFF A;  2GMH A;  4LSL A;  4O0N A;  2V8P A;  3MM9 B;  3SCL E;  2NZC A;  2ZBC A;  3I0S B;  3VGT A;  1UEU A;  4C3M A;  3PDN A;  4KFB B;  4CO3 A;  5EN1 A;  3Q8V A;  4PRF A;  4ZPW R;  2CWX A;  2F4V F;  2XG8 A;  2N3O A;  4BLG A;  1OWX A;  1HBN B;  1Q8I A;  3WC0 A;  1SXL A;  4IQM A;  4TU9 A;  1YG0 A;  3BGR A;  3IBC B;  3UDC A;  2KFY A;  1XMO J;  1JLA B;  4MYT A;  5KFU A;  2PEH A;  1RYS A;  3FQL A;  1XNQ F;  1IQZ A;  1BQM A;  2DRB A;  2AEJ A;  4WTO B;  4JP8 A;  4P74 A;  2HG4 A;  4EBE A;  2UVW A;  1VQ7 S;  3M6V A;  4M5L A;  2MJU A;  1PYT A;  1NHK L;  3IBW A;  4JYA F;  1X5P A;  1XMQ J;  1X4D A;  4X4Q A;  2O5D A;  2U1A A;  4P73 A;  2LQ8 A;  4USM A;  2NPF A;  1TKT B;  3NBP B;  3HP6 A;  1HI0 P;  3V4I A;  2LKZ A;  2A1B A;  4I64 A;  4ANE A;  3C66 A;  1JLC A;  2E1A A;  3MM8 B;  2WVF A;  3MEG A;  2VB6 A;  3N79 A;  4ES2 A;  3W2W B;  4JI8 J;  1T0T V;  3KLI B;  4JI7 J;  4JI1 J;  1F5C A;  1RU1 A;  2CJ9 A;  4PXB A;  3KK3 A;  3QFH A;  3JTO A;  3PG9 A;  4AD6 A;  4G1I A;  1S0M A;  2E29 A;  3SBM A;  4X66 F;  1Q5Y A;  3FCV A;  4U7U K;  1CS4 A;  2YQ3 A;  3BBC A;  2H65 B;  4MFB B;  5B09 A;  3IRW P;  1BD6 A;  3OVB A;  4QWD A;  1X4G A;  2AJ0 A;  4OZL A;  2E9Z A;  5F8J A;  1BHN A;  2J5A A;  3MMB B;  3DRS B;  3X3U A;  3J7Z T;  2R9L A;  4DFJ A;  2YY3 A;  4WF9 Q;  1RLC L;  1WC1 A;  2ALY B;  3VF0 B;  2PEB A;  1H38 A;  5KFH A;  2HEK A;  4CYU A;  2MKC A;  1WC6 A;  2J0W A;  3MUT P;  2J6S A;  1LWC A;  4UF4 A;  4UOG A;  4Q5V A;  3V6H A;  4C8Y A;  2AP6 A;  4LFC F;  3O5T B;  4EWT A;  1C0T B;  4DEZ A;  2KKH A;  3FJ2 A;  4I7F B;  2XY5 A;  5IWA J;  5G4D A;  2MQO A;  3D54 A;  2W4D A;  3IS9 B;  2ACY A;  2MDA A;  2V8G A;  3FQK A;  3GYN A;  2RML A;  3HHE A;  4L6V 3;  4LRA A;  1W2I A;  3TR5 A;  2F3J A;  3BR9 A;  1ZBT A;  1M5V C;  1S9E A;  5KFG A;  2UUA J;  1JXE A;  1ZTT A;  2G4B A;  1DY3 A;  3CSK A;  4IYQ A;  2K3I A;  4ED2 A;  5B0E A;  3TYT A;  2JEJ A;  1LW0 B;  1TKZ A;  2RB7 A;  3E8O A;  2W9B A;  3KTQ A;  2ZNZ A;  2YPZ A;  3BSA A;  1P6T A;  1KQK A;  1BE4 A;  3B8H A;  2Y9H A;  4KO0 A;  1GXL A;  2FYX A;  2MY7 A;  3GYG A;  3MAA B;  4WII A;  2EKN A;  5KFY A;  4DV0 F;  4DOZ A;  1H2T Z;  2BZ2 A;  3KDN A;  4HT5 A;  3NMA A;  1RZM A;  4KV8 A;  4OX8 A;  4Z2X A;  1RTJ B;  3GU0 A;  1PO6 A;  5G0R B;  1N6Q B;  1GXT A;  4E2F B;  2RNE A;  2RH3 A;  1U1L A;  1PKU A;  3BM7 A;  3H2U B;  4B9L A;  3TQ1 A;  4CH0 S;  2R7X A;  2M52 A;  2WW4 A;  1FVS A;  3ONQ A;  1M1H A;  5LMN J;  2EG2 A;  1UA1 A;  4DUY J;  3TRG A;  1Q7L B;  4Q2M A;  5KFL A;  3DRP B;  4IRC A;  4IRK A;  1X4H A;  1FWK A;  1YJT A;  1A0O B;  2OTL S;  3FRY A;  1EX8 A;  3J7Y U;  4TY8 B;  3V6K A;  2IRY A;  1VBK A;  4OZJ A;  2W7P A;  1T03 A;  4QBU A;  4RLE A;  1WSR A;  4TLR A;  4DQP A;  3FMW A;  4NCB A;  3NNC A;  1SC3 B;  2NUH A;  3FBF A;  4NA3 A;  4F0M A;  4G3I A;  1DZ5 A;  4RUA A;  3GII A;  3CMQ A;  5B0A A;  4LR9 A;  2I38 A;  3K58 A;  3HJF A;  1OYE A;  4F2S A;  2IAJ A;  2QFI A;  4X4N A;  1U26 A;  3RB4 A;  4CH7 A;  1NJW A;  3L95 X;  4OZ0 A;  1HBO B;  4RWW A;  4OZN A;  4B02 A;  3PR4 A;  2R3V A;  4HLB A;  2QA4 G;  4DV3 J;  1HQU B;  2XZT B;  4WIQ A;  5DDQ C;  4N77 A;  5DLG A;  4DR6 J;  2CAD A;  2UZA A;  1X0P A;  5ETR A;  2KL8 A;  1CJK B;  1EB0 A;  3OXL A;  5T7L A;  4LF1 A;  4PXD A;  1GMV A;  1RAB B;  4RBT A;  1T9V A;  3AD8 C;  5THW A;  3W5Z A;  2ASL A;  1VHI A;  3SFU A;  2B4V A;  1NO8 A;  1T9T A;  1M5S A;  2CWK A;  2LXI A;  2B6A A;  3G2X A;  3POT B;  4HDG A;  3JAM Y;  1JK9 B;  3TO8 A;  3VV2 B;  1URR A;  2ASD A;  4K4V A;  1WI6 A;  1FNO A;  2CPI A;  3FMB A;  1GX6 A;  3M30 A;  4ZOS A;  5IV3 A;  4JYA J;  1E6V B;  1FER A;  3KK1 A;  2E5J A;  4J5O A;  5LT5 A;  2L9W A;  2CG8 A;  3UN3 A;  2GJF A;  4Y00 A;  5DGA A;  2AQ4 A;  2R8I A;  2RHQ B;  4ES1 A;  3NGT A;  5KT6 A;  5CYQ A;  2IJF A;  5JVH Q;  1HWJ A;  2CPH A;  3OJU A;  3C19 A;  1QE1 A;  1WSV A;  2J9D A;  3D6M B;  1IJF B;  1GXU A;  3HD1 A;  2XO6 A;  1VC0 A;  4DWI A;  2KB2 A;  2QL5 B;  1XR6 A;  2ZJP Q;  1UKU A;  1V3R A;  1EQM A;  4QZV B;  4RR5 A;  4UOH A;  1QD1 A;  2J8S A;  4DL3 A;  1IM4 A;  2DNG A;  4QYR A;  4JI1 F;  2Y8Y A;  2UUC F;  4F67 A;  2OAU A;  4FYW B;  4DV5 F;  2BW2 A;  3PRV A;  1HNI B;  1YRX A;  3EXC X;  4GVB A;  4OYI A;  3ZFV A;  1RWW B;  6AT1 B;  3EPG A;  1XC9 A;  2KFZ A;  4F3Q A;  4K4Y A;  3W9I A;  3CJQ A;  4X66 J;  1K0V A;  3G9C A;  4IG0 A;  3W66 A;  1KEK A;  1HPZ B;  3QT7 A;  2MZQ A;  3RG6 A;  2KT2 A;  3H5Y A;  2FDN A;  1LW2 B;  2Z4P A;  1XBW A;  4LJM A;  1N88 A;  4ZP9 A;  3RAM A;  4RNO A;  3LP0 A;  4RW9 B;  3QO9 A;  3HHN B;  2QZ8 A;  3EE3 A;  3NGK A;  2W2O P;  3CJK B;  2N7C A;  1OIA A;  4KGV B;  2MGZ B;  4DV6 J;  2BR0 A;  4B3O B;  2QLF B;  3D6F B;  3TEH B;  4F4Z A;  1S5Z A;  2D41 A;  1XJW B;  2PFD A;  2XS7 A;  3CCQ S;  4X65 J;  4ZIW A;  1S76 D;  1RLD A;  3GQC A;  2F9J A;  4LBH A;  4F4K A;  4ECY A;  1S1W A;  2CUY A;  5D77 A;  3T1H J;  4LF5 F;  1QLN A;  3RB3 A;  3BKT A;  1LWX A;  1X5T A;  4O3O A;  2XGQ A;  4WYL A;  3MMJ A;  1X9S A;  2YNF A;  1IBM J;  2HBR B;  3PEH A;  4OV1 A;  4B9S A;  1MWQ A;  5GAH I;  4J91 A;  3U27 A;  1VQ4 S;  4NA1 A;  1H98 A;  4C6A A;  1UPM B;  4USI A;  2MQN A;  3HHL A;  1K47 A;  1TKT A;  1TMM A;  2MSS A;  2VPY B;  3NBP A;  4J7C A;  4QR0 A;  4TVA B;  4MK7 A;  4X4P A;  2GML A;  1HIY A;  4DV0 J;  3NKY A;  3PM9 A;  1OSD A;  2D7S A;  5F8G A;  1Q16 B;  1CJT B;  2Y0S D;  3MEG B;  4HTJ A;  1VIO A;  3IFE A;  1VRQ C;  2FIU A;  1L3U A;  1YDL A;  2AJ1 A;  1ZM9 A;  4M5H A;  2APO A;  2K06 A;  4TY9 A;  1DTQ B;  2XI2 A;  3LTO A;  4I0W A;  3RRK A;  4R8U B;  1J5O B;  1NME B;  1ULR A;  4ED5 A;  1X8D A;  1KC8 T;  5E0O A;  3OTO F;  3M32 B;  5GAD U;  4LR8 A;  5EWG A;  4JI4 F;  3DLG A;  4C3L A;  2LCW A;  4DUY F;  2MLZ A;  5HBM A;  1RAC B;  2VOP A;  3K5L A;  5J2Q B;  2IM0 A;  1PC4 A;  5HL7 Q;  3C6U B;  3OLA A;  2XQC A;  1NJX A;  4IH5 A;  1KDN A;  1KN6 A;  4ZVR B;  3KHR A;  2AEM A;  1FRH A;  2MEW A;  3R5C A;  3UNY A;  2J6T A;  4ZVH A;  1LWF A;  1CLF A;  2C3M A;  3AQP A;  2CQ1 A;  4WFA Q;  3CDU A;  1IN0 A;  3QLH A;  5KFE A;  1FKP B;  3JXO A;  2KG1 A;  3K17 A;  4F04 B;  1NJY A;  3C3L A;  1X4F A;  3B6B A;  1QUP A;  2RDJ A;  2YWH A;  2HGM A;  4EO8 A;  4Q45 A;  1SJ4 P;  3BBB A;  4IR1 A;  5T41 A;  4PG4 A;  1B0T A;  3A4T A;  4LF7 J;  1NDL A;  3AHP A;  4URS A;  1VLY A;  4Y2C A;  3JSM B;  2C3Y A;  2XLJ A;  4I6A A;  3CJ5 A;  2OD6 A;  3M8Q B;  4DR6 F;  2MXY A;  1KVK A;  2CZ4 A;  4YR0 A;  2JX2 A;  1WC5 A;  2R4F A;  4A8O A;  5IQ6 A;  4WKY A;  3AY0 A;  4ZVS B;  4U96 A;  2YKM B;  2Q6C A;  1CJU A;  3ETM A;  2BUN A;  3LGM A;  1WG5 A;  4EBD A;  1T9Y A;  1Q8B A;  4PEO A;  4R5P A;  4FF4 A;  4CLW A;  5L9X A;  2L41 A;  3VAG A;  3OLB A;  2RKI B;  3EGW B;  1NZ8 A;  4WXW A;  2Q1L A;  1HYS B;  2MQP A;  3L7O A;  4ZCM A;  1U1R A;  3ILJ A;  3NOG A;  1JMT A;  2KJW A;  4PYD A;  2B8P A;  8ATC B;  4O23 A;  3DI6 B;  4QU7 A;  1TL3 B;  3DM2 B;  3Q89 A;  3BSN A;  8RUC A;  2AJQ A;  1MLA A;  3GPA A;  3H90 A;  2DNZ A;  4O3Q A;  2BKN A;  2H1Y A;  4ZCI A;  2V4Q A;  3BO2 A;  5LMU J;  2FLP A;  2I2Y A;  3EGZ A;  5LJ3 Y;  4P71 A;  4Q44 A;  1WG4 A;  2Q3P A;  1HHQ A;  1YI2 S;  1JLA A;  4F50 A;  1PG5 B;  1SJ1 A;  1L3V A;  3CDB A;  4I1T A;  2Y3Y A;  5LSR A;  1VQ8 S;  1AZS B;  2W25 A;  1SC4 B;  1ZPW X;  1JKH B;  3MOZ A;  4U8Y A;  2EKY A;  4OHZ A;  3IM8 A;  5C24 B;  6FDR A;  4KE5 A;  3U7J A;  1DQA A;  2DNN A;  3M8P A;  3BZQ A;  1YRU A;  2WBR A;  3MMC B;  2BJ3 A;  1VI7 A;  1JXV A;  4AQY F;  4DL4 A;  4MJK A;  2LEB A;  3MXH P;  2UUB J;  3BF4 A;  4GVL A;  3NLC A;  4HI1 A;  3MM8 A;  3NOC A;  1WF0 A;  5KFA A;  5HJY A;  4NX9 A;  1FE0 A;  4NA2 A;  1SQE A;  4KY3 A;  2J0S D;  4PXE A;  3IO1 A;  3SIP B;  1O6X A;  4P2F A;  2B6A B;  2GGP B;  3AOB A;  1FEH A;  2OSR A;  1RAJ A;  4ZPA A;  2PMZ D;  1Y9O A;  3BH6 B;  1OY9 A;  2HIY A;  1FRK A;  1HQE B;  2VL1 A;  1HNZ F;  3D4J A;  3D9B A;  2W2N P;  2B51 A;  3B4D A;  4IUF A;  1Y10 A;  2IVY A;  2MKY A;  2B5J A;  3NXZ A;  2YH1 A;  4ZPD A;  2YWW A;  2RF2 A;  3K5O A;  3ET6 B;  5HP1 A;  4U6P A;  4AL7 A;  1SUQ B;  2NYH A;  3DOM A;  4JI5 J;  2P6S A;  3GIK A;  1G2E A;  1G7C B;  1HL6 A;  3H5X A;  3R5J B;  1RHJ B;  2JHE A;  3KG0 A;  1FRJ A;  2V4J A;  4BWM A;  3VGV A;  3PFO A;  2AMC B;  1TU0 B;  3E51 A;  5E3C A;  1VIX A;  4ZVF A;  4BCA A;  1D09 B;  3N6M A;  4HDH A;  1RBO B;  4OZ2 A;  4UOC A;  2UUT A;  2VUG A;  4WXO A;  2D3Z A;  2DJW A;  4WK3 A;  1DAX A;  2BX6 A;  5HAN A;  3T6J A;  3OTO J;  3VAL A;  2ADC A;  2UVU A;  1RT5 A;  1NRK A;  2VDI A;  3IR6 B;  4LBP A;  2CRL A;  4QWA A;  1AYE A;  5L39 A;  1RJJ A;  2HVI A;  4GMK A;  3ILO A;  4CO5 A;  5K5M A;  2C2M B;  1R6Y A;  1C1B B;  4KKO B;  4GKK F;  3G82 A;  2WAQ D;  4OYB A;  4ECV A;  2PFF B;  4P72 A;  3TJ8 A;  2F40 A;  1UL3 A;  3J80 Y;  5LOQ A;  1RT6 A;  1WDD A;  4ZPB A;  2N82 B;  2VFU A;  4KGM A;  2MQQ A;  3W3S A;  4CM2 A;  2F5G A;  2HVD A;  1GMU A;  4LSZ B;  5HMX A;  4DQI A;  1GH8 A;  1IKV A;  2CQ0 A;  4LF5 J;  4MYU A;  1EZZ B;  1I6J A;  2L3M A;  3GFX A;  4OI2 A;  3BJY A;  2C2R A;  5HN0 A;  3IGN A;  2NZ4 A;  2CZV C;  4DR5 J;  7FDR A;  2VG7 A;  3M2R B;  4QW8 A;  1CUL A;  3H59 A;  2MHE A;  3D0G E;  1IKY A;  2QFJ A;  3EX7 B;  4DV7 J;  3HSZ A;  4NLR A;  1KOH A;  1NPP A;  2JEF A;  4QIW D;  4LF8 J;  1FXR A;  2VBX A;  1U1K A;  1D9D A;  1YLX A;  1W26 A;  1WKK A;  3CDW A;  2DPJ A;  1Z1Z A;  4NOH A;  4F4X A;  3W2V B;  2HYI B;  1NSP A;  1BGX T;  4DF4 A;  4JI2 J;  4TY8 A;  3I31 A;  4R0J A;  4RW8 B;  4XDD A;  4CT9 A;  3H25 A;  1RTH A;  4LFB F;  1BC6 A;  2LEC A;  3TAN A;  2E9T A;  2EC0 A;  3FEY B;  5D4N A;  3R5G A;  4NCA A;  1BUX A;  1JLG B;  2KXH A;  3NGR A;  4NLY A;  1J5O A;  1TUW A;  3JSR A;  2HZV A;  2VV5 A;  5IT9 Y;  4JV2 A;  2HBY B;  3I9V 9;  2J9D E;  2B9E A;  1BQX A;  3BGU A;  3QWU A;  2HWH A;  2BAC A;  1UJ5 A;  2XZW A;  2KVQ E;  1AA1 B;  3DLG B;  3HSG A;  3VQS A;  3Q8R B;  3C15 A;  4H4M A;  1WOP A;  2NXU A;  1IBL J;  1UVN A;  2GQQ A;  3G4S S;  3DRP A;  2CQC A;  2EEY A;  4OYA A;  2P2C B;  1TV6 A;  4BDP A;  2BV3 A;  2MY8 A;  3C14 B;  5A8W B;  5CCM A;  3OUY B;  1UWB A;  3SQG B;  4F4A A;  3OW2 R;  1LWF B;  2BVZ A;  4C11 B;  2BQ3 A;  2W2Q P;  1B64 A;  3FBE A;  2ZHO A;  5KFN A;  4C8Z A;  4CZC A;  2VG5 A;  1F9H A;  3I4P A;  3LA0 A;  2VF3 A;  4ED3 A;  5D4P A;  1T95 A;  3ILI A;  3KJV B;  5HLF B;  2EBG A;  1HFE L;  5HMZ A;  3A1Y G;  3K5M A;  1YJ9 S;  4WTY A;  2VOO A;  2AX1 A;  4H4K A;  3PO4 A;  1UFW A;  3JQJ A;  5ETN A;  4GKJ F;  2XMJ A;  5FLX U;  4DF8 A;  2AYM A;  1EKS A;  2AYE A;  5CYQ B;  3US5 A;  1HBM A;  1RT4 B;  4DR4 F;  5K14 B;  5J2M B;  3EMT A;  2V8H A;  1Y11 A;  2K1R A;  3TVY A;  5KFQ A;  4PXC A;  4YR3 A;  5ETM A;  3PW7 A;  1S97 A;  2HRT A;  1TK5 A;  4JI3 J;  1Q82 T;  4QU6 A;  3K8V A;  1CJU B;  1J2V A;  2GJ2 A;  5KTQ A;  2VQE J;  2UXC F;  1RI7 A;  4I2Q A;  1FNX H;  1VBY A;  2OFG X;  3A13 A;  5GAD I;  4M1K A;  4P6Q A;  1LK7 A;  2EXU A;  1HNI A;  1RB0 A;  2NCK L;  3DDN A;  3BN7 A;  3H2V E;  3ISZ A;  4QWC A;  4P2M A;  3M1V B;  5FDL B;  4DV1 J;  4XIU A;  2CG4 A;  1WOR A;  3AOC A;  3O1L A;  3OTC A;  2YKP A;  1HNZ J;  4TU8 A;  4XO0 A;  4EZ6 A;  2DRA A;  4IG0 B;  3GJQ B;  3M9O B;  2AYB A;  3ILL A;  2AT1 B;  4EI2 A;  1XIQ A;  5B0G A;  4DLG A;  4JV0 A;  3T1Y J;  5GMD A;  2R8G A;  3ISN D;  3J7A N;  1RT2 A;  2CXE A;  2HNY A;  2EK6 A;  2HLU A;  1BMQ B;  3TX0 A;  4CLS A;  4I69 A;  3SSR A;  3PX0 A;  1FHT A;  1KFS A;  3UDL A;  5JMN A;  1TL1 B;  5H9F J;  1RTI A;  3IN5 A;  3PKM A;  1RBA A;  3OPK A;  3H5U A;  2ROP A;  3VVU A;  4AE5 A;  4DXL A;  5GVQ A;  3D67 A;  4Q7A A;  1RCX B;  1M5H A;  2CVI A;  3MI7 X;  3JSB A;  1VGY A;  4C97 A;  2PGC A;  2IC3 A;  5E5N A;  1FXD A;  2LEP A;  3MM6 B;  3OT9 A;  5C24 A;  4ZMM A;  4J9Q A;  1CC8 A;  2M3D A;  2ZDP A;  3IM9 A;  3OBI A;  1RHM B;  2HVE A;  4ZVP B;  1H3D A;  5HVF A;  4DFP A;  2ZWP A;  1UJ6 A;  4ELV A;  2JDJ A;  2QSF A;  2BKP A;  2DGQ A;  3FZB A;  5B0F A;  4QOT A;  5BJR A;  1NKB A;  2CQI A;  1R3N A;  2G1D A;  4OI6 A;  5F3T A;  5SZT A;  4DR7 F;  2CAJ A;  2KO1 A;  5KFF A;  4DX8 H;  1S1W B;  1EAY C;  2DO0 A;  2J76 E;  4IDK B;  4DPO A;  1U1O A;  4B3T F;  1LV5 A;  3PYG A;  1NK8 A;  4J9O A;  2ZNY A;  4ECQ A;  3R7B B;  1FT8 A;  1EJ7 L;  1LWE B;  2H4W B;  2HQC A;  1R0B G;  2DO4 A;  2G2Z A;  4LSL B;  4AUK A;  2BJ8 A;  5H9E K;  2R8K A;  4K4Z A;  3PZP A;  2OLW A;  1WEZ A;  3ZZP A;  2ZVI A;  1WEL A;  2PMW A;  3Q83 A;  5J1E B;  3K59 A;  2W9A A;  2OPQ A;  2B5J B;  1BLU A;  3K2Y A;  3P8B B;  2V8D A;  3UVJ B;  3V81 B;  5A8K A;  5HP1 B;  1V5V A;  2WSC C;  4RNN A;  2Y1R I;  1S0O A;  1WKJ A;  1VDH A;  4L73 A;  2CPF A;  3U1M A;  1ZAV A;  1HD1 A;  2PC6 A;  4NCG A;  5HK4 A;  2E5H A;  1SJ3 P;  4K7Q A;  2EC2 A;  2Z56 B;  1QAI A;  4ECW A;  1IVZ A;  2R42 A;  5KT5 A;  1N48 A;  2ZC3 A;  1L5U A;  2WRM A;  3P3D A;  2DKO B;  1S77 D;  3I0R A;  3R5B A;  4L72 B;  4AND A;  5ADZ A;  1QDU B;  3BEG B;  4RJV A;  1N36 F;  1H73 A;  2I5J A;  2WW8 A;  2ADB A;  3ZZR A;  1CVJ A;  1T9X A;  3TW0 A;  2MMY A;  2PI4 A;  4KAI A;  5GMK a;  3IRX B;  4NI2 B;  4CLZ A;  4WKR A;  1S4E A;  1C1B A;  2HFU A;  4K4X A;  4AL5 A;  4K2J A;  2IVM A;  4A8S A;  1VQ5 S;  4B9V A;  2DNK A;  2P8I A;  5B7W A;  4LF9 J;  2QEX S;  1REG X;  1RHQ B;  2D74 B;  2RUG A;  3BH7 B;  3OTD A;  2OEK A;  2QA2 A;  1HWI A;  1UCN A;  2HSE B;  3CCR S;  4HVZ A;  2K7J A;  2DTJ A;  5LM7 E;  5DZ7 A;  2FB0 A;  4FYV B;  2JRS A;  3W7B A;  4ZLL A;  4IO9 Q;  2P9E A;  4EEY A;  3KLG B;  3BQ2 A;  1MSW D;  2CNL B;  4FS2 A;  1CUL B;  1H7W A;  1SIZ A;  4EUV A;  4G6V B;  3D28 A;  3ENQ A;  5EWE A;  2IJR A;  2HBQ B;  5M2P A;  2EK1 A;  2LU1 A;  2OGU A;  2LA4 A;  2Z30 B;  4V19 X;  3TEG A;  1B0V A;  2MZJ A;  3H4B A;  4KV8 B; 
#chains in the Genus database with same CATH homology
 4JI3 J;  4YY3 J;  4NXM J;  4KY3 A;  4LFC J;  4X65 J;  1N34 J;  4JI5 J;  2VQE J;  2UXC J;  5IWA J;  3T1H J;  2VQF J;  4DR3 J;  2HHH J;  4LF5 J;  1IBM J;  4DV1 J;  4NXN J;  2UUA J;  1HNZ J;  4X62 J;  4JV5 J;  3T1Y J;  3J81 U;  3J7A N;  4DV0 J;  2MTL A;  4KYZ A;  2UXD J;  4OX9 J;  3JAM U;  4JI0 J;  1HNW J;  4LFA J;  4PWW A;  3OTO J;  1N33 J;  5LMN J;  1I94 J;  4JI4 J;  4DUY J;  1J5E J;  4YHH J;  4LF6 J;  4DUZ J;  2UXB J;  3R2C J;  1IBK J;  4GKK J;  1HR0 J;  2MEW A;  2MQ8 A;  4DR7 J;  4B3T J;  4K0K J;  3IMQ J;  4KHP J;  4DR5 J;  1HNX J;  4LF7 J;  1FJG J;  4DV3 J;  4LF4 J;  4DV7 J;  4DR6 J;  4LF8 J;  2KL8 A;  2F4V J;  4HHU A;  4NEY A;  2E5L J;  3R2D J;  1XNR J;  3W1Y C;  4JI2 J;  1N32 J;  3J80 U;  1XMO J;  4LFB J;  4JI6 J;  4V1A k;  1XNQ J;  3D3B J;  4DR2 J;  4X64 J;  5IT9 U;  5A2Q U;  4JYA J;  1XMQ J;  2KVQ E;  1IBL J;  4RJV A;  1N36 J;  5LMU J;  4DR1 J;  4B3S J;  2ZM6 J;  4DV2 J;  4JI8 J;  4LF9 J;  4JI7 J;  4JI1 J;  2UUC J;  4DV5 J;  3D3C J;  4NEZ A;  4B3M J;  5LM7 E;  5AJ3 J;  4X66 J;  4DV4 J;  2UU9 J;  4GKJ J;  5BR8 J;  5FLX U;  4AQY J;  4DV6 J;  4DR4 J;  2UUB J;  4B3R J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...