2UUCM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uucM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uucM02
5LMNM 4DV5M 4G4NA 4PDIA 4DR1M 2OPFA 1J5EM 3C58A 4GKKM 5BR8M 4DUYM 3SAVA 1HNZM 3SAUA 1N33M 1XNQM 1IBMM 4MB7A 1TDHA 4DR4M 3GP1A 1NNJA 1HNXM 3GQ5A 1MU5A 4PDGA 4X62M 4JI0M 1XMOM 4LF7M 3SATA 3GPPA 4K0KM 4LFCM 4DV6M 3SARA 4DR3M 1XNRM 3A42A 2ZBKB 4JV5M 5ITRA 4DV2M 3A46A 4DV7M 3TWLA 1KFVA 3JR5A 1Z5AA 2UUBM 2UXCM 4X64M 3SBJA 2OQ4A 3U6MA 3GPUA 4G4RA 3J80S 4X65M 1PJIA 1PJJA 4B3SM 4JI5M 3GO8A 4PCZA 3W0FA 2EA0A 4CISA 4B3RM 4JI2M 3J7AS 4KHPM 3JAMS 4YHHM 5LMUM 3TWMA 4LF4M 4JI8M 1K82A 3U6SA 4LF5M 2UU9M 5ITXE 2UUCM 5A2QS 4DR7M 1Q39A 4NXNM 5IWAM 1HR0M 2XZUA 1K3WA 4NRVA 2UXDM 2F5NA 1TDZA 4JYAM 3U6DA 3VK8A 1IBLM 2F5QA 1Z59A 2F4VM 3VK7A 5ITTA 1I94M 4B3TM 1L2BA 3U6EA 1L2DA 4JI6M 4LF8M 2F5OA 1Z5CA 1Z5BA 3U6CA 1FJGM 5ITUA 4PD2A 1Q3CA 5ITXA 3TWKA 4G4OA 2UUAM 1XMQM 2VQEM 4AQYM 4LFBM 3SASA 4NXMM 2F5PA 1HNWM 4DR5M 3GQ4A 4DV3M 4NRWA 4YY3M 2ZM6M 3U6LA 1L1TA 5IT9S 4JI4M 3GPXA 4LF6M 3OTOM 4DV0M 4LFAM 3DOAA 1L1ZA 1L2CA 4JI3M 2XZFA 1XC8A 4OX9M 1N36M 4DV4M 4DR6M 2Q2EB 3A45A 3J81S 1EE8A 4JI7M 2VQFM 1N34M 4GKJM 4DUZM 1K3XA 2UXBM 3JR4A 2E5LM 5ITQA 4B3MM 2HKJA 1R2ZA 2F5SA 4DV1M 4X66M 3T1HM 1PM5A 4JI1M 1Q3BA 1MX0A 5ITYA 3U6OA 3U6PA 3GPYA 3U6QA 3T1YM 1IBKM 4ITQA 4G4QA 1R2YA 4LF9M 4DR2M 1N32M 5FLXS 3SAWA 2HHHM 3GQ3A
chains in the Genus database with same CATH superfamily
3FKEA 4WP2A 4DV5M 3GLFA 1OIPA 1SXJD 2GNOA 3SAUA 2RGHA 3K2LA 3TL4X 1IBMM 2C99A 3E46A 4MB7A 2QP9X 4Z8XA 3U5ZB 1ZQ9A 2C96A 2JY5A 2R62A 1AUAA 3CF6E 5GKNA 1NNJA 5FTKA 1HNXM 1XB2B 3W68A 4I81A 1E94E 4WURA 5DFLA 3HU1A 2OO9A 4GHAA 2G8LA 4RKUF 4DBGB 5KQDA 2CRUA 1QAOA 4DR3M 3KFUG 2CV2A 2Y0TA 2JXNA 3UMMA 3RFWA 4DV2M 2Z7JA 1S3SA 1QUTA 4L6V6 3JR5A 1QZMA 1NY6A 2G3QA 3LQQA 3VKGA 2XSZA 1DO0A 4LJ7A 5E26A 2UUBM 4LGMA 3I01M 5IREB 3U6MA 1NNUC 2LVAA 4TUWA 2MGWA 1ORYB 3J80S 1NHWC 2LVPC 1WHCA 4B3SM 1G3IA 3L25A 3SFZA 4HL4A 4PT5A 2W82A 2KHHA 1KYIA 2HCBA 3BOSA 4KHPM 2I7PA 3RE8A 2UXBM 2Y21A 5EP4A 2VIIA 1OTRA 2WZJA 1HJPA 2UU9M 2DI0A 3KVWA 3L2AA 2BJVA 2QENA 4KODA 5KO3A 3VLFB 3T6PA 3SC3A 1HR0M 3WHKA 5BPVA 3EIHA 4P16A 5JI2E 1EIJA 1PGYA 3KSJA 2QBYB 4OVZA 2F5NA 2YQZA 1TDZA 4JYAM 3U6DA 4LJ8A 2F4VM 4D81A 2XFSA 3CGWA 4B3TM 2XF3A 3PXGA 3U6EA 1IN8A 2G5GX 2F5OA 3U6CA 4Q7JA 4MH0E 1X37A 5ITXA 2J7NA 3KOWE 3TWKA 2DAEA 1XMQM 3T38A 4D82A 3SASA 2AHMA 2XFTA 1WR1B 1VDDA 1EFUB 3DA1A 1QQWA 4M9ZA 4GITA 3GQ4A 4NRWA 4YY3M 2Z3XA 4JN6A 1OKSA 2L4FA 2ZM6M 3U6LA 4KO8A 1PJTA 2K47A 5E6JA 4JI4M 2M60A 2LNHC 2XLJA 4FVMA 4LGYA 1L2CA 2X4AA 2FNAA 3BXWA 1DGGA 3KSXA 1XC8A 3KP0E 2LH0A 3UJNA 1N36M 2L6OA 4DR6M 4B7GA 4NC6A 2ZAOA 2LHCA 3LVVA 8CATA 4FWGA 1HQYE 4I5SA 2VF8A 1GKIA 1WGNA 2CHVA 2ERCA 5ITQA 4NOOB 3HHZA 3FYDA 2DWZB 1QAMA 2LVNC 4X66M 4JI1M 5KPTA 1MX0A 1QDTA 3IG8A 3Q8GA 3SYLA 3GPYA 1MJGM 3U6QA 2C5RA 2WSEF 1R2YA 4IJEA 2DHRA 1WGLA 3H4MA 5KPRA 4EIWA 3AKZA 4FCVA 4REZA 3LCUA 1IY2A 3AV0A 1IFYA 3SMPA 3TQSA 2KNZA 4AW4A 2KEBA 1IXSA 3FTFA 4B7HA 1XXHE 1DGHB 2LVOC 2LVQD 1TH3A 3M0EA 3ZC7B 2OPFA 4GKKM 3HJ8A 3SAVA 1G59A 1G41A 1GL7A 1D2NA 3DZDA 4LZZA 2R44A 3RGPA 2L4EA 2QQ8A 4ANRA 2DWMA 3FUVA 3J27B 1QUSA 2HL7A 3K9OA 4DR4M 3GRYA 3HJSA 3HZJA 1WIVA 3GRUA 4G3OA 2LHGA 2YFQA 2KZSA 4MGKE 3VDUA 3GPPA 4K0KM 1OIZA 1QANA 2QSFX 4DV6M 3R8FA 3KP1E 1NJGA 4BBAA 2DXIA 3UGJA 3E4RA 1XNRM 2BJWA 3ZCBB 1YSYA 1OFHA 1KFVA 3HU2A 4LRTA 1F4IA 4FD2A 1JR3E 4GC5A 3KS8A 3SMSA 2H1RA 2OOAA 2Z4SA 3B7QA 3B89A 4NL4H 2FH0A 2I7NA 5EXTA 4CHTB 2OQ4A 3GLGA 2R6FA 1UM8A 2DAGA 3PFIA 4JXJA 5EQTA 4G4RA 4X65M 3HKPA 1PJJA 4B08A 2P5TA 2QHOB 2EA0A 4LZJA 3MHVC 4LF4M 2X49A 4JI8M 3KW6A 1PJQA 2M5ZA 1NSFA 2KZUA 5EP3A 1ZMUA 4ZPXA 1GABA 5ITXE 3FUXA 5A2QS 2O01F 1T6OA 2HAKA 1YE9A 3HX3A 3KDSE 4QOSA 2Y20A 4IBEA 5EP2A 3FUWA 1N77A 2ZTDA 3VK7A 5ITTA 2FE8A 2WSCF 1YLAA 4LF8M 3FYCA 1G71A 3HJQA 2DHYA 4QOZC 1Q3CA 3GRVA 3T15A 2UUAM 5FTMA 4LCBA 1IY0A 3AFHA 2CE7A 3GRRA 3HHWA 2QNJA 3KOYE 3B74A 3I4VA 3LMMA 3NBXX 4R7GA 4AQYM 1HNWM 3L28A 3U61A 1NY5A 1OQYA 3GLGB 2CEAA 1OAIA 2KRUA 4L78A 1E9SA 5EXPA 3RGSA 4AKIA 1FNNA 3NBIA 3GPXA 2CP8A 2MJ5B 3DOAA 4LFAM 3VFDA 1IQPA 1PRBA 2MR9A 2YR0A 3W67A 3GLHE 3MJ5A 4OX9M 3HGIA 3J7BA 1C7YA 2FFJA 1NJFA 3A45A 1T3TA 1TTEA 1IXZA 3DFZA 1DV0A 1SG9A 3UZUA 1GO5A 3JR4A 2E5LM 2R4JA 3IG5A 2FS1A 2MH8A 3E21A 4DV1M 3FRHA 1Q3BA 4ITQA 3M7GA 4LF9M 4G4QA 2JY8A 1IN5A 1ZMWA 1NVMA 3TE6A 3U61B 5FLXS 3SAWA 4IJFA 3A98B 3SYKA 2HHHM 2C9OA 4IBCA 4A3VB 1L8QA 3K1JA 1PJSA 3GQ3A 1SXJA 4G4NA 2YNMD 1SXJE 2KNAA 2OOBA 4PDIA 3GLGE 2J5YA 4S12A 4DR1M 1J5EM 3C3EA 3IHPA 3C58A 2D7EA 3QWLA 1HNZM 1I4WA 1E9RA 1JQJC 3FTEA 2Z4RA 3B9PA 3GLIB 1TDHA 3EIEA 4IBKA 1VEJA 3C3DA 2DVWB 3GP1A 2HWJA 3GQ5A 3THGA 1MU5A 4QNMA 3ZH9B 4JI0M 1XMOM 2DWLA 2DZLA 3SATA 1WJ7A 1JB0F 4QHTA 1TF0B 1GLNA 2RGOA 3SARA 2V6ZM 4RNAA 5KPZA 4MGZE 4GMQA 2ZBKB 4LRSA 5FTLA 4HLQA 4JV5M 4DV7M 1VEKA 1WXQA 4P17A 1BVSA 3U5ZA 4LJ6A 3VKHA 1IN7A 2DWNA 1VDLA 4GC9A 4GRIA 3SHGB 2O5RA 2UXCM 2JZ1A 2B3TA 1D0LA 2EO2A 4IBIA 4L4UA 4WW0A 1C1KA 2JP7A 4LJ5A 4M0DA 2DENA 4R71A 3GLFB 2XGNA 3GO8A 3W0FA 4CISA 2R46A 2R65A 1QZEA 1IN6A 4JI2M 3TWMA 4AI6A 1T43A 1R7RA 4MGIE 2RRUA 4M0WA 4XK8F 3U6SA 2JNHA 4II7A 4FCWA 1NO1A 3E9SA 3WHLA 4AG6A 4CIZA 1V92A 4DR7M 3CF2A 1MN3A 2RKOA 4IBFA 2QBYA 1YUBA 3Q8XA 5L8RF 1K3WA 2UXDM 3AOEA 4LJ4A 3VK8A 1IBLM 2F5QA 2KXEA 2ZANA 2JY6B 1P3QQ 3I51A 4KT0F 4JI6M 4FWDA 3LVWA 1JR3A 1DGHA 2C98A 2R0IA 1IXSB 3ZQJA 1H6UA 5EJCA 4G4OA 3AL0C 3J2PB 3PNYA 1JR3D 1IXRC 1R6BX 3GLHB 3H4JA 1HT1E 4LFBM 3MMPA 2D7GA 1OJLA 4DR5M 3L29A 2JA2A 3K92A 2K9DA 2K6BA 1QVRA 3K8ZA 5DYGA 2APLA 1GJSA 5IZ7D 1J7KA 2XSZD 3SHFA 4BB9A 4CJ6A 3V76A 5H37D 3KOZE 7CATA 3AOEC 4CGYB 3OTOM 2CHGA 1OAOC 2H5XA 4DV0M 4LF6M 4M9SA 2A5YB 1R4GA 3U60B 4L16A 4JI3M 5C18A 4B7FA 4IBJA 3UK6A 2J7OA 2XZFA 5F3WA 5FSWA 3FTCA 1G8PA 2JY7A 4M9XA 5DYIA 1EE8A 4JI7M 2DZNB 2VQFM 4GKJM 2EKFA 3MK6A 3R9XB 2HKJA 1R2ZA 2F5SA 3T1HM 1PM5A 1DGBA 5ITYA 3U6PA 3T1YM 1V33A 2CFOA 1Y8GA 1LTMA 1RU3A 3HU3A 4HEOA 1GL6A 3M6AA 4RF0A 4DR2M 3QYBA 3FD9A 4OW0A 2VDBB 3U60A 4LG2A 1XXHA 1TH2A 1W5SA 5LMNM 3FUUA 3FUTA 2N35A 3L27A 5BR8M 3HWSA 4DUYM 2CV0A 1N33M 1DGFA 3FTDA 5DNYA 1XNQM 4F1IA 2ZTCA 4OVZB 1V34A 2Z8YM 4GIPA 4FW9A 1ZMVA 3F92A 1QAQA 2BWEA 2LWXA 4IBGA 2X8AA 4PDGA 4X62M 4LF7M 2LXEA 1ZV1A 2JWSA 3QYEA 1CUKA 4LFCM 4MM3B 2CWBA 3HY5A 1IN4A 4UN2B 3IECA 3A42A 1SXJC 3CF0A 4IIWA 1HQCA 2NQ8C 5ITRA 3A46A 3TWLA 1D0KA 3NWLA 1GVNA 2JZ0A 1Z5AA 2L7HA 3C9PA 1AIPC 4RF1A 2KW0A 3BBZA 4KLNA 2EKKA 4X64M 2EUCA 2JUJA 3SBJA 1LV7A 3GLFE 3GPUA 1IM2A 3LW5F 3LQRA 5EXXA 3KXEC 1OFIA 4IBDA 4NSRA 1PJIA 4JI5M 1E32A 4LJAA 2WSFF 1XXHB 3KS4A 1HT2E 4PCZA 4B3RM 2DNAA 2L2DA 1Z6TA 3J7AS 1VG5A 3JAMS 4YHHM 5LMUM 4GHLA 4AKHA 4OU7A 1K82A 3VDPA 4LF5M 2DZOB 4GH9A 2DKLA 1QDRA 1W5TA 2O25A 1KSFX 4LJ9A 1J09A 1D0MA 1ZAEA 2UUCM 1Q39A 3QAUA 3FE3A 1VEGA 4NXNM 5IWAM 3HHXA 2XZUA 1N78A 1XWIA 2R45A 4L8RC 4NRVA 4I8OA 2V1UA 2R18A 1Z59A 5EXSA 2CHQA 4GEWA 2XH9A 2EJSA 1I94M 1L2BA 1L2DA 4FCTA 2QCUA 1QYRA 1NHGC 1Z5CA 1Z5BA 2L7IA 3TPZA 5ITUA 4AG5A 4PD2A 1FJGM 1Q02A 2V1CA 3B7ZA 2K0BX 1XHBA 2KDLA 5EP1A 5FTNA 2VQEM 4D80A 1UFZA 3D8BA 3L26A 4NXMM 2F5PA 2CUZA 2XEPA 3I4YA 2CV1A 4DV3M 3I04M 2R4EA 3GLIA 5KQ8A 4AKGA 4MGHA 4Y28F 1G4AE 4QNRA 4G6ZA 2DAMA 4F2LA 1NV9A 5JI3E 1L1TA 5IT9S 1TR8A 2BNKA 2L09A 4AZFA 2D7HA 2DAKA 2GQFA 1SXJB 3GLHA 1L1ZA 1A5TA 3FRIA 4QHSA 1N75A 2DAIA 2LBCA 3D8LA 4MGYE 2C9CA 3ILKA 5C1BA 2Q2EB 4DV4M 2KNVA 4NSOB 1DO2A 4FWHA 3J81S 2ZAMA 1NV8A 1R5LA 1TH4A 1N34M 2KA6B 2QZ4A 4XBOA 3HHYA 3GLIE 2KRKA 4IBBA 1GJTA 3AOGA 4BLCA 4DUZM 1K3XA 3W0LB 4B3MM 3K9PA 3KOXE 4I4LA 4LY6A 5FTJA 3U6OA 2FOIC 4Z6YA 1IBKM 1VQ1A 2LTUA 2VF7A 1IY1A 2BWBA 2QPAA 4L15A 1TGUA 3B7NA 1N32M 3AJIB 3PVSA 3LCVB 4XGIA 3PNVA 3CTWB 2MROB 4W5WA 2Y0QA 4R3DA
chains in the Genus database with same CATH topology
3FKEA 4DV5M 3GLFA 1SXJD 3SAUA 2RGHA 3K2LA 3TL4X 1IBMM 2C99A 4MB7A 2QP9X 4Z8XA 3U5ZB 1ZQ9A 2C96A 2R62A 3CF6E 5GKNA 1NNJA 5FTKA 1HNXM 4I81A 1E94E 4WURA 3HU1A 4GHAA 2G8LA 5KQDA 1QAOA 4DR3M 3KFUG 2CV2A 2Y0TA 3UMMA 3RFWA 4DV2M 2Z7JA 1S3SA 3JR5A 1QZMA 1NY6A 3LQQA 3VKGA 2XSZA 1DO0A 4LJ7A 5E26A 2UUBM 4LGMA 5IREB 3U6MA 1NNUC 4TUWA 1ORYB 3J80S 1NHWC 4B3SM 3L25A 1G3IA 3SFZA 4HL4A 4PT5A 2W82A 1KYIA 2HCBA 3BOSA 4KHPM 2I7PA 3RE8A 2Y21A 5EP4A 2VIIA 2UU9M 3KVWA 3L2AA 2BJVA 2QENA 4KODA 5KO3A 3VLFB 3SC3A 1HR0M 3WHKA 5BPVA 3EIHA 4P16A 5JI2E 3KSJA 2QBYB 4OVZA 2F5NA 2YQZA 1TDZA 4JYAM 3U6DA 4LJ8A 2F4VM 4D81A 2XFSA 4B3TM 2XF3A 3PXGA 3U6EA 1IN8A 2G5GX 2F5OA 3U6CA 4MH0E 1X37A 5ITXA 2J7NA 3KOWE 3TWKA 1XMQM 3T38A 4D82A 3SASA 2AHMA 2XFTA 3DA1A 1VDDA 1QQWA 4M9ZA 4GITA 3GQ4A 4NRWA 4YY3M 2Z3XA 4JN6A 2ZM6M 3U6LA 4KO8A 5E6JA 2K47A 4JI4M 2M60A 2LNHC 2XLJA 4FVMA 4LGYA 1L2CA 2X4AA 2FNAA 1DGGA 3KSXA 1XC8A 3KP0E 2LH0A 3UJNA 1N36M 2L6OA 4DR6M 4B7GA 2ZAOA 3LVVA 8CATA 4FWGA 1HQYE 4I5SA 1GKIA 2CHVA 2ERCA 5ITQA 4NOOB 3HHZA 3FYDA 2DWZB 1QAMA 4X66M 4JI1M 5KPTA 1MX0A 3IG8A 3SYLA 3U6QA 3GPYA 2C5RA 1R2YA 4IJEA 2DHRA 3H4MA 5KPRA 4EIWA 3AKZA 4FCVA 4REZA 1IY2A 3AV0A 3SMPA 3TQSA 4AW4A 2KEBA 3FTFA 4B7HA 1DGHB 2OPFA 1TH3A 3M0EA 3ZC7B 4GKKM 3HJ8A 3SAVA 1G59A 1G41A 1GL7A 1D2NA 3DZDA 4LZZA 3RGPA 2DWMA 3FUVA 3J27B 2HL7A 4DR4M 3GRYA 3HJSA 3GRUA 2YFQA 2KZSA 4MGKE 3VDUA 3GPPA 4K0KM 1QANA 4DV6M 3R8FA 3KP1E 1NJGA 4BBAA 2DXIA 3UGJA 3E4RA 1XNRM 2BJWA 3ZCBB 1YSYA 1OFHA 1KFVA 3HU2A 4LRTA 4FD2A 3KS8A 4GC5A 3SMSA 2H1RA 2Z4SA 4NL4H 2I7NA 5EXTA 4CHTB 2OQ4A 3GLGA 1UM8A 4JXJA 3PFIA 5EQTA 4G4RA 4X65M 3HKPA 1PJJA 4B08A 2P5TA 2EA0A 4LZJA 3MHVC 4LF4M 2X49A 4JI8M 3KW6A 2M5ZA 1NSFA 2KZUA 5EP3A 4ZPXA 5ITXE 3FUXA 5A2QS 3KDSE 1YE9A 4QOSA 2Y20A 4IBEA 5EP2A 3FUWA 1N77A 3VK7A 5ITTA 2FE8A 4LF8M 3FYCA 3HJQA 4QOZC 1Q3CA 3GRVA 3T15A 2UUAM 5FTMA 4LCBA 1IY0A 3AFHA 2CE7A 3GRRA 3HHWA 3LMMA 3KOYE 4R7GA 3I4VA 4AQYM 1HNWM 3L28A 3U61A 1NY5A 3GLGB 2CEAA 2KRUA 4L78A 1E9SA 5EXPA 3RGSA 4AKIA 1FNNA 3NBIA 3GPXA 3DOAA 4LFAM 3VFDA 1IQPA 2YR0A 3MJ5A 4OX9M 3HGIA 3J7BA 2FFJA 1NJFA 3A45A 1T3TA 1IXZA 3DFZA 3UZUA 3JR4A 2E5LM 2R4JA 3IG5A 4DV1M 1Q3BA 4ITQA 3M7GA 4LF9M 4G4QA 1IN5A 1NVMA 3TE6A 3U61B 5FLXS 3SAWA 4IJFA 3A98B 3SYKA 2HHHM 2C9OA 4IBCA 4A3VB 1L8QA 3K1JA 3GQ3A 1SXJA 4G4NA 2YNMD 1SXJE 4PDIA 4S12A 4DR1M 1J5EM 3C58A 2D7EA 3QWLA 1HNZM 1I4WA 1E9RA 1JQJC 3FTEA 2Z4RA 3B9PA 3GLIB 1TDHA 3EIEA 4IBKA 2DVWB 3GP1A 3GQ5A 3THGA 1MU5A 4QNMA 3ZH9B 4JI0M 1XMOM 2DWLA 3SATA 4QHTA 2RGOA 1GLNA 3SARA 2V6ZM 4RNAA 5KPZA 4MGZE 4GMQA 2ZBKB 4LRSA 5FTLA 4HLQA 4JV5M 4DV7M 1WXQA 3U5ZA 4LJ6A 3VKHA 1IN7A 2DWNA 4GC9A 3SHGB 4GRIA 2UXCM 2O5RA 2EO2A 4IBIA 4L4UA 4WW0A 1C1KA 4LJ5A 4M0DA 3GLFB 2XGNA 3GO8A 3W0FA 4CISA 2R46A 2R65A 4JI2M 1IN6A 3TWMA 4AI6A 1R7RA 4MGIE 4M0WA 3U6SA 4II7A 4FCWA 3E9SA 3WHLA 4AG6A 4DR7M 3CF2A 2RKOA 4IBFA 2QBYA 1YUBA 3Q8XA 1K3WA 2UXDM 3AOEA 4LJ4A 3VK8A 1IBLM 2F5QA 2KXEA 2ZANA 3I51A 4JI6M 4FWDA 3LVWA 1JR3A 1DGHA 2C98A 4G4OA 1IXSB 3AL0C 1H6UA 5EJCA 3J2PB 3PNYA 1JR3D 1IXRC 1R6BX 3GLHB 1HT1E 4LFBM 2D7GA 1OJLA 4DR5M 3L29A 2JA2A 3K92A 1QVRA 3K8ZA 5DYGA 5IZ7D 1J7KA 2XSZD 3SHFA 4BB9A 5H37D 3KOZE 7CATA 3AOEC 4CGYB 3OTOM 2CHGA 4DV0M 4LF6M 4M9SA 2A5YB 3U60B 4L16A 4JI3M 5C18A 4B7FA 4IBJA 3UK6A 2J7OA 2XZFA 5F3WA 5FSWA 3FTCA 1G8PA 4M9XA 5DYIA 1EE8A 4JI7M 2DZNB 2VQFM 4GKJM 3MK6A 3R9XB 2HKJA 1R2ZA 2F5SA 3T1HM 1PM5A 1DGBA 5ITYA 3U6PA 3T1YM 2CFOA 4DR2M 3HU3A 1GL6A 3M6AA 4RF0A 3FD9A 4OW0A 3U60A 4LG2A 1XXHA 1TH2A 1W5SA 5LMNM 3FUUA 3FUTA 3L27A 5BR8M 3HWSA 4DUYM 2CV0A 1N33M 1DGFA 3FTDA 5DNYA 1XNQM 4OVZB 4GIPA 4FW9A 1QAQA 2LWXA 4IBGA 2X8AA 4PDGA 4X62M 4LF7M 2LXEA 4LFCM 4MM3B 1IN4A 3A42A 1SXJC 3CF0A 4IIWA 1HQCA 2NQ8C 5ITRA 3A46A 3TWLA 3NWLA 1GVNA 1Z5AA 2L7HA 4RF1A 2KW0A 4KLNA 4X64M 2EUCA 3SBJA 1LV7A 3GPUA 1IM2A 3LQRA 5EXXA 3KXEC 1OFIA 4IBDA 4NSRA 1PJIA 4JI5M 1E32A 4LJAA 3KS4A 1XXHB 4PCZA 1HT2E 4B3RM 3J7AS 4AKHA 1Z6TA 3JAMS 4YHHM 5LMUM 4GHLA 4OU7A 1K82A 3VDPA 4LF5M 2DZOB 4GH9A 1N78A 1W5TA 1KSFX 4LJ9A 1J09A 1ZAEA 2UUCM 1Q39A 3QAUA 4NXNM 5IWAM 3HHXA 2XZUA 1XWIA 2R45A 4L8RC 4NRVA 4I8OA 2V1UA 2R18A 1Z59A 5EXSA 2CHQA 2XH9A 1I94M 1L2BA 1L2DA 4FCTA 2QCUA 1QYRA 1NHGC 1Z5CA 1Z5BA 2L7IA 3TPZA 5ITUA 4AG5A 4PD2A 1FJGM 2V1CA 5FTNA 1XHBA 5EP1A 2VQEM 4D80A 3D8BA 3L26A 4NXMM 2F5PA 2CUZA 2XEPA 3I4YA 2CV1A 4DV3M 2R4EA 3GLIA 5KQ8A 4AKGA 4MGHA 1G4AE 4QNRA 4G6ZA 1L1TA 5JI3E 5IT9S 2BNKA 2L09A 4AZFA 2D7HA 1SXJB 3GLHA 1L1ZA 4QHSA 1N75A 3D8LA 4MGYE 2C9CA 3ILKA 5C1BA 2Q2EB 4DV4M 4NSOB 1DO2A 4FWHA 3J81S 2ZAMA 1N34M 1TH4A 2KA6B 2QZ4A 4XBOA 3HHYA 4DUZM 2KRKA 4IBBA 1K3XA 3AOGA 4BLCA 2UXBM 3W0LB 4B3MM 3KOXE 4I4LA 4LY6A 5FTJA 3U6OA 2FOIC 4Z6YA 1IBKM 1IY1A 2QPAA 4L15A 1TGUA 1N32M 3AJIB 3PVSA 4XGIA 3PNVA 3CTWB 4W5WA 2Y0QA 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN M;  4DV5 M;  4G4N A;  4PDI A;  4DR1 M;  2OPF A;  1J5E M;  3C58 A;  4GKK M;  5BR8 M;  4DUY M;  3SAV A;  1HNZ M;  3SAU A;  1N33 M;  1XNQ M;  1IBM M;  4MB7 A;  1TDH A;  4DR4 M;  3GP1 A;  1NNJ A;  1HNX M;  3GQ5 A;  1MU5 A;  4PDG A;  4X62 M;  4JI0 M;  1XMO M;  4LF7 M;  3SAT A;  3GPP A;  4K0K M;  4LFC M;  4DV6 M;  3SAR A;  4DR3 M;  1XNR M;  3A42 A;  2ZBK B;  4JV5 M;  5ITR A;  4DV2 M;  3A46 A;  4DV7 M;  3TWL A;  1KFV A;  3JR5 A;  1Z5A A;  2UUB M;  2UXC M;  4X64 M;  3SBJ A;  2OQ4 A;  3U6M A;  3GPU A;  4G4R A;  3J80 S;  4X65 M;  1PJI A;  1PJJ A;  4B3S M;  4JI5 M;  3GO8 A;  4PCZ A;  3W0F A;  2EA0 A;  4CIS A;  4B3R M;  4JI2 M;  3J7A S;  4KHP M;  3JAM S;  4YHH M;  5LMU M;  3TWM A;  4LF4 M;  4JI8 M;  1K82 A;  3U6S A;  4LF5 M;  2UU9 M;  5ITX E;  2UUC M;  5A2Q S;  4DR7 M;  1Q39 A;  4NXN M;  5IWA M;  1HR0 M;  2XZU A;  1K3W A;  4NRV A;  2UXD M;  2F5N A;  1TDZ A;  4JYA M;  3U6D A;  3VK8 A;  1IBL M;  2F5Q A;  1Z59 A;  2F4V M;  3VK7 A;  5ITT A;  1I94 M;  4B3T M;  1L2B A;  3U6E A;  1L2D A;  4JI6 M;  4LF8 M;  2F5O A;  1Z5C A;  1Z5B A;  3U6C A;  1FJG M;  5ITU A;  4PD2 A;  1Q3C A;  5ITX A;  3TWK A;  4G4O A;  2UUA M;  1XMQ M;  2VQE M;  4AQY M;  4LFB M;  3SAS A;  4NXM M;  2F5P A;  1HNW M;  4DR5 M;  3GQ4 A;  4DV3 M;  4NRW A;  4YY3 M;  2ZM6 M;  3U6L A;  1L1T A;  5IT9 S;  4JI4 M;  3GPX A;  4LF6 M;  3OTO M;  4DV0 M;  4LFA M;  3DOA A;  1L1Z A;  1L2C A;  4JI3 M;  2XZF A;  1XC8 A;  4OX9 M;  1N36 M;  4DV4 M;  4DR6 M;  2Q2E B;  3A45 A;  3J81 S;  1EE8 A;  4JI7 M;  2VQF M;  1N34 M;  4GKJ M;  4DUZ M;  1K3X A;  2UXB M;  3JR4 A;  2E5L M;  5ITQ A;  4B3M M;  2HKJ A;  1R2Z A;  2F5S A;  4DV1 M;  4X66 M;  3T1H M;  1PM5 A;  4JI1 M;  1Q3B A;  1MX0 A;  5ITY A;  3U6O A;  3U6P A;  3GPY A;  3U6Q A;  3T1Y M;  1IBK M;  4ITQ A;  4G4Q A;  1R2Y A;  4LF9 M;  4DR2 M;  1N32 M;  5FLX S;  3SAW A;  2HHH M;  3GQ3 A; 
#chains in the Genus database with same CATH topology
 3FKE A;  4WP2 A;  4DV5 M;  3GLF A;  1OIP A;  1SXJ D;  2GNO A;  3SAU A;  2RGH A;  3K2L A;  3TL4 X;  1IBM M;  2C99 A;  3E46 A;  4MB7 A;  2QP9 X;  4Z8X A;  3U5Z B;  1ZQ9 A;  2C96 A;  2JY5 A;  2R62 A;  1AUA A;  3CF6 E;  5GKN A;  1NNJ A;  5FTK A;  1HNX M;  1XB2 B;  3W68 A;  4I81 A;  1E94 E;  4WUR A;  5DFL A;  3HU1 A;  2OO9 A;  4GHA A;  2G8L A;  4RKU F;  4DBG B;  5KQD A;  2CRU A;  1QAO A;  4DR3 M;  3KFU G;  2CV2 A;  2Y0T A;  2JXN A;  3UMM A;  3RFW A;  4DV2 M;  2Z7J A;  1S3S A;  1QUT A;  4L6V 6;  3JR5 A;  1QZM A;  1NY6 A;  2G3Q A;  3LQQ A;  3VKG A;  2XSZ A;  1DO0 A;  4LJ7 A;  5E26 A;  2UUB M;  4LGM A;  3I01 M;  5IRE B;  3U6M A;  1NNU C;  2LVA A;  4TUW A;  2MGW A;  1ORY B;  3J80 S;  1NHW C;  2LVP C;  1WHC A;  4B3S M;  1G3I A;  3L25 A;  3SFZ A;  4HL4 A;  4PT5 A;  2W82 A;  2KHH A;  1KYI A;  2HCB A;  3BOS A;  4KHP M;  2I7P A;  3RE8 A;  2UXB M;  2Y21 A;  5EP4 A;  2VII A;  1OTR A;  2WZJ A;  1HJP A;  2UU9 M;  2DI0 A;  3KVW A;  3L2A A;  2BJV A;  2QEN A;  4KOD A;  5KO3 A;  3VLF B;  3T6P A;  3SC3 A;  1HR0 M;  3WHK A;  5BPV A;  3EIH A;  4P16 A;  5JI2 E;  1EIJ A;  1PGY A;  3KSJ A;  2QBY B;  4OVZ A;  2F5N A;  2YQZ A;  1TDZ A;  4JYA M;  3U6D A;  4LJ8 A;  2F4V M;  4D81 A;  2XFS A;  3CGW A;  4B3T M;  2XF3 A;  3PXG A;  3U6E A;  1IN8 A;  2G5G X;  2F5O A;  3U6C A;  4Q7J A;  4MH0 E;  1X37 A;  5ITX A;  2J7N A;  3KOW E;  3TWK A;  2DAE A;  1XMQ M;  3T38 A;  4D82 A;  3SAS A;  2AHM A;  2XFT A;  1WR1 B;  1VDD A;  1EFU B;  3DA1 A;  1QQW A;  4M9Z A;  4GIT A;  3GQ4 A;  4NRW A;  4YY3 M;  2Z3X A;  4JN6 A;  1OKS A;  2L4F A;  2ZM6 M;  3U6L A;  4KO8 A;  1PJT A;  2K47 A;  5E6J A;  4JI4 M;  2M60 A;  2LNH C;  2XLJ A;  4FVM A;  4LGY A;  1L2C A;  2X4A A;  2FNA A;  3BXW A;  1DGG A;  3KSX A;  1XC8 A;  3KP0 E;  2LH0 A;  3UJN A;  1N36 M;  2L6O A;  4DR6 M;  4B7G A;  4NC6 A;  2ZAO A;  2LHC A;  3LVV A;  8CAT A;  4FWG A;  1HQY E;  4I5S A;  2VF8 A;  1GKI A;  1WGN A;  2CHV A;  2ERC A;  5ITQ A;  4NOO B;  3HHZ A;  3FYD A;  2DWZ B;  1QAM A;  2LVN C;  4X66 M;  4JI1 M;  5KPT A;  1MX0 A;  1QDT A;  3IG8 A;  3Q8G A;  3SYL A;  3GPY A;  1MJG M;  3U6Q A;  2C5R A;  2WSE F;  1R2Y A;  4IJE A;  2DHR A;  1WGL A;  3H4M A;  5KPR A;  4EIW A;  3AKZ A;  4FCV A;  4REZ A;  3LCU A;  1IY2 A;  3AV0 A;  1IFY A;  3SMP A;  3TQS A;  2KNZ A;  4AW4 A;  2KEB A;  1IXS A;  3FTF A;  4B7H A;  1XXH E;  1DGH B;  2LVO C;  2LVQ D;  1TH3 A;  3M0E A;  3ZC7 B;  2OPF A;  4GKK M;  3HJ8 A;  3SAV A;  1G59 A;  1G41 A;  1GL7 A;  1D2N A;  3DZD A;  4LZZ A;  2R44 A;  3RGP A;  2L4E A;  2QQ8 A;  4ANR A;  2DWM A;  3FUV A;  3J27 B;  1QUS A;  2HL7 A;  3K9O A;  4DR4 M;  3GRY A;  3HJS A;  3HZJ A;  1WIV A;  3GRU A;  4G3O A;  2LHG A;  2YFQ A;  2KZS A;  4MGK E;  3VDU A;  3GPP A;  4K0K M;  1OIZ A;  1QAN A;  2QSF X;  4DV6 M;  3R8F A;  3KP1 E;  1NJG A;  4BBA A;  2DXI A;  3UGJ A;  3E4R A;  1XNR M;  2BJW A;  3ZCB B;  1YSY A;  1OFH A;  1KFV A;  3HU2 A;  4LRT A;  1F4I A;  4FD2 A;  1JR3 E;  4GC5 A;  3KS8 A;  3SMS A;  2H1R A;  2OOA A;  2Z4S A;  3B7Q A;  3B89 A;  4NL4 H;  2FH0 A;  2I7N A;  5EXT A;  4CHT B;  2OQ4 A;  3GLG A;  2R6F A;  1UM8 A;  2DAG A;  3PFI A;  4JXJ A;  5EQT A;  4G4R A;  4X65 M;  3HKP A;  1PJJ A;  4B08 A;  2P5T A;  2QHO B;  2EA0 A;  4LZJ A;  3MHV C;  4LF4 M;  2X49 A;  4JI8 M;  3KW6 A;  1PJQ A;  2M5Z A;  1NSF A;  2KZU A;  5EP3 A;  1ZMU A;  4ZPX A;  1GAB A;  5ITX E;  3FUX A;  5A2Q S;  2O01 F;  1T6O A;  2HAK A;  1YE9 A;  3HX3 A;  3KDS E;  4QOS A;  2Y20 A;  4IBE A;  5EP2 A;  3FUW A;  1N77 A;  2ZTD A;  3VK7 A;  5ITT A;  2FE8 A;  2WSC F;  1YLA A;  4LF8 M;  3FYC A;  1G71 A;  3HJQ A;  2DHY A;  4QOZ C;  1Q3C A;  3GRV A;  3T15 A;  2UUA M;  5FTM A;  4LCB A;  1IY0 A;  3AFH A;  2CE7 A;  3GRR A;  3HHW A;  2QNJ A;  3KOY E;  3B74 A;  3I4V A;  3LMM A;  3NBX X;  4R7G A;  4AQY M;  1HNW M;  3L28 A;  3U61 A;  1NY5 A;  1OQY A;  3GLG B;  2CEA A;  1OAI A;  2KRU A;  4L78 A;  1E9S A;  5EXP A;  3RGS A;  4AKI A;  1FNN A;  3NBI A;  3GPX A;  2CP8 A;  2MJ5 B;  3DOA A;  4LFA M;  3VFD A;  1IQP A;  1PRB A;  2MR9 A;  2YR0 A;  3W67 A;  3GLH E;  3MJ5 A;  4OX9 M;  3HGI A;  3J7B A;  1C7Y A;  2FFJ A;  1NJF A;  3A45 A;  1T3T A;  1TTE A;  1IXZ A;  3DFZ A;  1DV0 A;  1SG9 A;  3UZU A;  1GO5 A;  3JR4 A;  2E5L M;  2R4J A;  3IG5 A;  2FS1 A;  2MH8 A;  3E21 A;  4DV1 M;  3FRH A;  1Q3B A;  4ITQ A;  3M7G A;  4LF9 M;  4G4Q A;  2JY8 A;  1IN5 A;  1ZMW A;  1NVM A;  3TE6 A;  3U61 B;  5FLX S;  3SAW A;  4IJF A;  3A98 B;  3SYK A;  2HHH M;  2C9O A;  4IBC A;  4A3V B;  1L8Q A;  3K1J A;  1PJS A;  3GQ3 A;  1SXJ A;  4G4N A;  2YNM D;  1SXJ E;  2KNA A;  2OOB A;  4PDI A;  3GLG E;  2J5Y A;  4S12 A;  4DR1 M;  1J5E M;  3C3E A;  3IHP A;  3C58 A;  2D7E A;  3QWL A;  1HNZ M;  1I4W A;  1E9R A;  1JQJ C;  3FTE A;  2Z4R A;  3B9P A;  3GLI B;  1TDH A;  3EIE A;  4IBK A;  1VEJ A;  3C3D A;  2DVW B;  3GP1 A;  2HWJ A;  3GQ5 A;  3THG A;  1MU5 A;  4QNM A;  3ZH9 B;  4JI0 M;  1XMO M;  2DWL A;  2DZL A;  3SAT A;  1WJ7 A;  1JB0 F;  4QHT A;  1TF0 B;  1GLN A;  2RGO A;  3SAR A;  2V6Z M;  4RNA A;  5KPZ A;  4MGZ E;  4GMQ A;  2ZBK B;  4LRS A;  5FTL A;  4HLQ A;  4JV5 M;  4DV7 M;  1VEK A;  1WXQ A;  4P17 A;  1BVS A;  3U5Z A;  4LJ6 A;  3VKH A;  1IN7 A;  2DWN A;  1VDL A;  4GC9 A;  4GRI A;  3SHG B;  2O5R A;  2UXC M;  2JZ1 A;  2B3T A;  1D0L A;  2EO2 A;  4IBI A;  4L4U A;  4WW0 A;  1C1K A;  2JP7 A;  4LJ5 A;  4M0D A;  2DEN A;  4R71 A;  3GLF B;  2XGN A;  3GO8 A;  3W0F A;  4CIS A;  2R46 A;  2R65 A;  1QZE A;  1IN6 A;  4JI2 M;  3TWM A;  4AI6 A;  1T43 A;  1R7R A;  4MGI E;  2RRU A;  4M0W A;  4XK8 F;  3U6S A;  2JNH A;  4II7 A;  4FCW A;  1NO1 A;  3E9S A;  3WHL A;  4AG6 A;  4CIZ A;  1V92 A;  4DR7 M;  3CF2 A;  1MN3 A;  2RKO A;  4IBF A;  2QBY A;  1YUB A;  3Q8X A;  5L8R F;  1K3W A;  2UXD M;  3AOE A;  4LJ4 A;  3VK8 A;  1IBL M;  2F5Q A;  2KXE A;  2ZAN A;  2JY6 B;  1P3Q Q;  3I51 A;  4KT0 F;  4JI6 M;  4FWD A;  3LVW A;  1JR3 A;  1DGH A;  2C98 A;  2R0I A;  1IXS B;  3ZQJ A;  1H6U A;  5EJC A;  4G4O A;  3AL0 C;  3J2P B;  3PNY A;  1JR3 D;  1IXR C;  1R6B X;  3GLH B;  3H4J A;  1HT1 E;  4LFB M;  3MMP A;  2D7G A;  1OJL A;  4DR5 M;  3L29 A;  2JA2 A;  3K92 A;  2K9D A;  2K6B A;  1QVR A;  3K8Z A;  5DYG A;  2APL A;  1GJS A;  5IZ7 D;  1J7K A;  2XSZ D;  3SHF A;  4BB9 A;  4CJ6 A;  3V76 A;  5H37 D;  3KOZ E;  7CAT A;  3AOE C;  4CGY B;  3OTO M;  2CHG A;  1OAO C;  2H5X A;  4DV0 M;  4LF6 M;  4M9S A;  2A5Y B;  1R4G A;  3U60 B;  4L16 A;  4JI3 M;  5C18 A;  4B7F A;  4IBJ A;  3UK6 A;  2J7O A;  2XZF A;  5F3W A;  5FSW A;  3FTC A;  1G8P A;  2JY7 A;  4M9X A;  5DYI A;  1EE8 A;  4JI7 M;  2DZN B;  2VQF M;  4GKJ M;  2EKF A;  3MK6 A;  3R9X B;  2HKJ A;  1R2Z A;  2F5S A;  3T1H M;  1PM5 A;  1DGB A;  5ITY A;  3U6P A;  3T1Y M;  1V33 A;  2CFO A;  1Y8G A;  1LTM A;  1RU3 A;  3HU3 A;  4HEO A;  1GL6 A;  3M6A A;  4RF0 A;  4DR2 M;  3QYB A;  3FD9 A;  4OW0 A;  2VDB B;  3U60 A;  4LG2 A;  1XXH A;  1TH2 A;  1W5S A;  5LMN M;  3FUU A;  3FUT A;  2N35 A;  3L27 A;  5BR8 M;  3HWS A;  4DUY M;  2CV0 A;  1N33 M;  1DGF A;  3FTD A;  5DNY A;  1XNQ M;  4F1I A;  2ZTC A;  4OVZ B;  1V34 A;  2Z8Y M;  4GIP A;  4FW9 A;  1ZMV A;  3F92 A;  1QAQ A;  2BWE A;  2LWX A;  4IBG A;  2X8A A;  4PDG A;  4X62 M;  4LF7 M;  2LXE A;  1ZV1 A;  2JWS A;  3QYE A;  1CUK A;  4LFC M;  4MM3 B;  2CWB A;  3HY5 A;  1IN4 A;  4UN2 B;  3IEC A;  3A42 A;  1SXJ C;  3CF0 A;  4IIW A;  1HQC A;  2NQ8 C;  5ITR A;  3A46 A;  3TWL A;  1D0K A;  3NWL A;  1GVN A;  2JZ0 A;  1Z5A A;  2L7H A;  3C9P A;  1AIP C;  4RF1 A;  2KW0 A;  3BBZ A;  4KLN A;  2EKK A;  4X64 M;  2EUC A;  2JUJ A;  3SBJ A;  1LV7 A;  3GLF E;  3GPU A;  1IM2 A;  3LW5 F;  3LQR A;  5EXX A;  3KXE C;  1OFI A;  4IBD A;  4NSR A;  1PJI A;  4JI5 M;  1E32 A;  4LJA A;  2WSF F;  1XXH B;  3KS4 A;  1HT2 E;  4PCZ A;  4B3R M;  2DNA A;  2L2D A;  1Z6T A;  3J7A S;  1VG5 A;  3JAM S;  4YHH M;  5LMU M;  4GHL A;  4AKH A;  4OU7 A;  1K82 A;  3VDP A;  4LF5 M;  2DZO B;  4GH9 A;  2DKL A;  1QDR A;  1W5T A;  2O25 A;  1KSF X;  4LJ9 A;  1J09 A;  1D0M A;  1ZAE A;  2UUC M;  1Q39 A;  3QAU A;  3FE3 A;  1VEG A;  4NXN M;  5IWA M;  3HHX A;  2XZU A;  1N78 A;  1XWI A;  2R45 A;  4L8R C;  4NRV A;  4I8O A;  2V1U A;  2R18 A;  1Z59 A;  5EXS A;  2CHQ A;  4GEW A;  2XH9 A;  2EJS A;  1I94 M;  1L2B A;  1L2D A;  4FCT A;  2QCU A;  1QYR A;  1NHG C;  1Z5C A;  1Z5B A;  2L7I A;  3TPZ A;  5ITU A;  4AG5 A;  4PD2 A;  1FJG M;  1Q02 A;  2V1C A;  3B7Z A;  2K0B X;  1XHB A;  2KDL A;  5EP1 A;  5FTN A;  2VQE M;  4D80 A;  1UFZ A;  3D8B A;  3L26 A;  4NXM M;  2F5P A;  2CUZ A;  2XEP A;  3I4Y A;  2CV1 A;  4DV3 M;  3I04 M;  2R4E A;  3GLI A;  5KQ8 A;  4AKG A;  4MGH A;  4Y28 F;  1G4A E;  4QNR A;  4G6Z A;  2DAM A;  4F2L A;  1NV9 A;  5JI3 E;  1L1T A;  5IT9 S;  1TR8 A;  2BNK A;  2L09 A;  4AZF A;  2D7H A;  2DAK A;  2GQF A;  1SXJ B;  3GLH A;  1L1Z A;  1A5T A;  3FRI A;  4QHS A;  1N75 A;  2DAI A;  2LBC A;  3D8L A;  4MGY E;  2C9C A;  3ILK A;  5C1B A;  2Q2E B;  4DV4 M;  2KNV A;  4NSO B;  1DO2 A;  4FWH A;  3J81 S;  2ZAM A;  1NV8 A;  1R5L A;  1TH4 A;  1N34 M;  2KA6 B;  2QZ4 A;  4XBO A;  3HHY A;  3GLI E;  2KRK A;  4IBB A;  1GJT A;  3AOG A;  4BLC A;  4DUZ M;  1K3X A;  3W0L B;  4B3M M;  3K9P A;  3KOX E;  4I4L A;  4LY6 A;  5FTJ A;  3U6O A;  2FOI C;  4Z6Y A;  1IBK M;  1VQ1 A;  2LTU A;  2VF7 A;  1IY1 A;  2BWB A;  2QPA A;  4L15 A;  1TGU A;  3B7N A;  1N32 M;  3AJI B;  3PVS A;  3LCV B;  4XGI A;  3PNV A;  3CTW B;  2MRO B;  4W5W A;  2Y0Q A;  4R3D A; 
#chains in the Genus database with same CATH homology
 3FKE A;  4DV5 M;  3GLF A;  1SXJ D;  3SAU A;  2RGH A;  3K2L A;  3TL4 X;  1IBM M;  2C99 A;  4MB7 A;  2QP9 X;  4Z8X A;  3U5Z B;  1ZQ9 A;  2C96 A;  2R62 A;  3CF6 E;  5GKN A;  1NNJ A;  5FTK A;  1HNX M;  4I81 A;  1E94 E;  4WUR A;  3HU1 A;  4GHA A;  2G8L A;  5KQD A;  1QAO A;  4DR3 M;  3KFU G;  2CV2 A;  2Y0T A;  3UMM A;  3RFW A;  4DV2 M;  2Z7J A;  1S3S A;  3JR5 A;  1QZM A;  1NY6 A;  3LQQ A;  3VKG A;  2XSZ A;  1DO0 A;  4LJ7 A;  5E26 A;  2UUB M;  4LGM A;  5IRE B;  3U6M A;  1NNU C;  4TUW A;  1ORY B;  3J80 S;  1NHW C;  4B3S M;  3L25 A;  1G3I A;  3SFZ A;  4HL4 A;  4PT5 A;  2W82 A;  1KYI A;  2HCB A;  3BOS A;  4KHP M;  2I7P A;  3RE8 A;  2Y21 A;  5EP4 A;  2VII A;  2UU9 M;  3KVW A;  3L2A A;  2BJV A;  2QEN A;  4KOD A;  5KO3 A;  3VLF B;  3SC3 A;  1HR0 M;  3WHK A;  5BPV A;  3EIH A;  4P16 A;  5JI2 E;  3KSJ A;  2QBY B;  4OVZ A;  2F5N A;  2YQZ A;  1TDZ A;  4JYA M;  3U6D A;  4LJ8 A;  2F4V M;  4D81 A;  2XFS A;  4B3T M;  2XF3 A;  3PXG A;  3U6E A;  1IN8 A;  2G5G X;  2F5O A;  3U6C A;  4MH0 E;  1X37 A;  5ITX A;  2J7N A;  3KOW E;  3TWK A;  1XMQ M;  3T38 A;  4D82 A;  3SAS A;  2AHM A;  2XFT A;  3DA1 A;  1VDD A;  1QQW A;  4M9Z A;  4GIT A;  3GQ4 A;  4NRW A;  4YY3 M;  2Z3X A;  4JN6 A;  2ZM6 M;  3U6L A;  4KO8 A;  5E6J A;  2K47 A;  4JI4 M;  2M60 A;  2LNH C;  2XLJ A;  4FVM A;  4LGY A;  1L2C A;  2X4A A;  2FNA A;  1DGG A;  3KSX A;  1XC8 A;  3KP0 E;  2LH0 A;  3UJN A;  1N36 M;  2L6O A;  4DR6 M;  4B7G A;  2ZAO A;  3LVV A;  8CAT A;  4FWG A;  1HQY E;  4I5S A;  1GKI A;  2CHV A;  2ERC A;  5ITQ A;  4NOO B;  3HHZ A;  3FYD A;  2DWZ B;  1QAM A;  4X66 M;  4JI1 M;  5KPT A;  1MX0 A;  3IG8 A;  3SYL A;  3U6Q A;  3GPY A;  2C5R A;  1R2Y A;  4IJE A;  2DHR A;  3H4M A;  5KPR A;  4EIW A;  3AKZ A;  4FCV A;  4REZ A;  1IY2 A;  3AV0 A;  3SMP A;  3TQS A;  4AW4 A;  2KEB A;  3FTF A;  4B7H A;  1DGH B;  2OPF A;  1TH3 A;  3M0E A;  3ZC7 B;  4GKK M;  3HJ8 A;  3SAV A;  1G59 A;  1G41 A;  1GL7 A;  1D2N A;  3DZD A;  4LZZ A;  3RGP A;  2DWM A;  3FUV A;  3J27 B;  2HL7 A;  4DR4 M;  3GRY A;  3HJS A;  3GRU A;  2YFQ A;  2KZS A;  4MGK E;  3VDU A;  3GPP A;  4K0K M;  1QAN A;  4DV6 M;  3R8F A;  3KP1 E;  1NJG A;  4BBA A;  2DXI A;  3UGJ A;  3E4R A;  1XNR M;  2BJW A;  3ZCB B;  1YSY A;  1OFH A;  1KFV A;  3HU2 A;  4LRT A;  4FD2 A;  3KS8 A;  4GC5 A;  3SMS A;  2H1R A;  2Z4S A;  4NL4 H;  2I7N A;  5EXT A;  4CHT B;  2OQ4 A;  3GLG A;  1UM8 A;  4JXJ A;  3PFI A;  5EQT A;  4G4R A;  4X65 M;  3HKP A;  1PJJ A;  4B08 A;  2P5T A;  2EA0 A;  4LZJ A;  3MHV C;  4LF4 M;  2X49 A;  4JI8 M;  3KW6 A;  2M5Z A;  1NSF A;  2KZU A;  5EP3 A;  4ZPX A;  5ITX E;  3FUX A;  5A2Q S;  3KDS E;  1YE9 A;  4QOS A;  2Y20 A;  4IBE A;  5EP2 A;  3FUW A;  1N77 A;  3VK7 A;  5ITT A;  2FE8 A;  4LF8 M;  3FYC A;  3HJQ A;  4QOZ C;  1Q3C A;  3GRV A;  3T15 A;  2UUA M;  5FTM A;  4LCB A;  1IY0 A;  3AFH A;  2CE7 A;  3GRR A;  3HHW A;  3LMM A;  3KOY E;  4R7G A;  3I4V A;  4AQY M;  1HNW M;  3L28 A;  3U61 A;  1NY5 A;  3GLG B;  2CEA A;  2KRU A;  4L78 A;  1E9S A;  5EXP A;  3RGS A;  4AKI A;  1FNN A;  3NBI A;  3GPX A;  3DOA A;  4LFA M;  3VFD A;  1IQP A;  2YR0 A;  3MJ5 A;  4OX9 M;  3HGI A;  3J7B A;  2FFJ A;  1NJF A;  3A45 A;  1T3T A;  1IXZ A;  3DFZ A;  3UZU A;  3JR4 A;  2E5L M;  2R4J A;  3IG5 A;  4DV1 M;  1Q3B A;  4ITQ A;  3M7G A;  4LF9 M;  4G4Q A;  1IN5 A;  1NVM A;  3TE6 A;  3U61 B;  5FLX S;  3SAW A;  4IJF A;  3A98 B;  3SYK A;  2HHH M;  2C9O A;  4IBC A;  4A3V B;  1L8Q A;  3K1J A;  3GQ3 A;  1SXJ A;  4G4N A;  2YNM D;  1SXJ E;  4PDI A;  4S12 A;  4DR1 M;  1J5E M;  3C58 A;  2D7E A;  3QWL A;  1HNZ M;  1I4W A;  1E9R A;  1JQJ C;  3FTE A;  2Z4R A;  3B9P A;  3GLI B;  1TDH A;  3EIE A;  4IBK A;  2DVW B;  3GP1 A;  3GQ5 A;  3THG A;  1MU5 A;  4QNM A;  3ZH9 B;  4JI0 M;  1XMO M;  2DWL A;  3SAT A;  4QHT A;  2RGO A;  1GLN A;  3SAR A;  2V6Z M;  4RNA A;  5KPZ A;  4MGZ E;  4GMQ A;  2ZBK B;  4LRS A;  5FTL A;  4HLQ A;  4JV5 M;  4DV7 M;  1WXQ A;  3U5Z A;  4LJ6 A;  3VKH A;  1IN7 A;  2DWN A;  4GC9 A;  3SHG B;  4GRI A;  2UXC M;  2O5R A;  2EO2 A;  4IBI A;  4L4U A;  4WW0 A;  1C1K A;  4LJ5 A;  4M0D A;  3GLF B;  2XGN A;  3GO8 A;  3W0F A;  4CIS A;  2R46 A;  2R65 A;  4JI2 M;  1IN6 A;  3TWM A;  4AI6 A;  1R7R A;  4MGI E;  4M0W A;  3U6S A;  4II7 A;  4FCW A;  3E9S A;  3WHL A;  4AG6 A;  4DR7 M;  3CF2 A;  2RKO A;  4IBF A;  2QBY A;  1YUB A;  3Q8X A;  1K3W A;  2UXD M;  3AOE A;  4LJ4 A;  3VK8 A;  1IBL M;  2F5Q A;  2KXE A;  2ZAN A;  3I51 A;  4JI6 M;  4FWD A;  3LVW A;  1JR3 A;  1DGH A;  2C98 A;  4G4O A;  1IXS B;  3AL0 C;  1H6U A;  5EJC A;  3J2P B;  3PNY A;  1JR3 D;  1IXR C;  1R6B X;  3GLH B;  1HT1 E;  4LFB M;  2D7G A;  1OJL A;  4DR5 M;  3L29 A;  2JA2 A;  3K92 A;  1QVR A;  3K8Z A;  5DYG A;  5IZ7 D;  1J7K A;  2XSZ D;  3SHF A;  4BB9 A;  5H37 D;  3KOZ E;  7CAT A;  3AOE C;  4CGY B;  3OTO M;  2CHG A;  4DV0 M;  4LF6 M;  4M9S A;  2A5Y B;  3U60 B;  4L16 A;  4JI3 M;  5C18 A;  4B7F A;  4IBJ A;  3UK6 A;  2J7O A;  2XZF A;  5F3W A;  5FSW A;  3FTC A;  1G8P A;  4M9X A;  5DYI A;  1EE8 A;  4JI7 M;  2DZN B;  2VQF M;  4GKJ M;  3MK6 A;  3R9X B;  2HKJ A;  1R2Z A;  2F5S A;  3T1H M;  1PM5 A;  1DGB A;  5ITY A;  3U6P A;  3T1Y M;  2CFO A;  4DR2 M;  3HU3 A;  1GL6 A;  3M6A A;  4RF0 A;  3FD9 A;  4OW0 A;  3U60 A;  4LG2 A;  1XXH A;  1TH2 A;  1W5S A;  5LMN M;  3FUU A;  3FUT A;  3L27 A;  5BR8 M;  3HWS A;  4DUY M;  2CV0 A;  1N33 M;  1DGF A;  3FTD A;  5DNY A;  1XNQ M;  4OVZ B;  4GIP A;  4FW9 A;  1QAQ A;  2LWX A;  4IBG A;  2X8A A;  4PDG A;  4X62 M;  4LF7 M;  2LXE A;  4LFC M;  4MM3 B;  1IN4 A;  3A42 A;  1SXJ C;  3CF0 A;  4IIW A;  1HQC A;  2NQ8 C;  5ITR A;  3A46 A;  3TWL A;  3NWL A;  1GVN A;  1Z5A A;  2L7H A;  4RF1 A;  2KW0 A;  4KLN A;  4X64 M;  2EUC A;  3SBJ A;  1LV7 A;  3GPU A;  1IM2 A;  3LQR A;  5EXX A;  3KXE C;  1OFI A;  4IBD A;  4NSR A;  1PJI A;  4JI5 M;  1E32 A;  4LJA A;  3KS4 A;  1XXH B;  4PCZ A;  1HT2 E;  4B3R M;  3J7A S;  4AKH A;  1Z6T A;  3JAM S;  4YHH M;  5LMU M;  4GHL A;  4OU7 A;  1K82 A;  3VDP A;  4LF5 M;  2DZO B;  4GH9 A;  1N78 A;  1W5T A;  1KSF X;  4LJ9 A;  1J09 A;  1ZAE A;  2UUC M;  1Q39 A;  3QAU A;  4NXN M;  5IWA M;  3HHX A;  2XZU A;  1XWI A;  2R45 A;  4L8R C;  4NRV A;  4I8O A;  2V1U A;  2R18 A;  1Z59 A;  5EXS A;  2CHQ A;  2XH9 A;  1I94 M;  1L2B A;  1L2D A;  4FCT A;  2QCU A;  1QYR A;  1NHG C;  1Z5C A;  1Z5B A;  2L7I A;  3TPZ A;  5ITU A;  4AG5 A;  4PD2 A;  1FJG M;  2V1C A;  5FTN A;  1XHB A;  5EP1 A;  2VQE M;  4D80 A;  3D8B A;  3L26 A;  4NXM M;  2F5P A;  2CUZ A;  2XEP A;  3I4Y A;  2CV1 A;  4DV3 M;  2R4E A;  3GLI A;  5KQ8 A;  4AKG A;  4MGH A;  1G4A E;  4QNR A;  4G6Z A;  1L1T A;  5JI3 E;  5IT9 S;  2BNK A;  2L09 A;  4AZF A;  2D7H A;  1SXJ B;  3GLH A;  1L1Z A;  4QHS A;  1N75 A;  3D8L A;  4MGY E;  2C9C A;  3ILK A;  5C1B A;  2Q2E B;  4DV4 M;  4NSO B;  1DO2 A;  4FWH A;  3J81 S;  2ZAM A;  1N34 M;  1TH4 A;  2KA6 B;  2QZ4 A;  4XBO A;  3HHY A;  4DUZ M;  2KRK A;  4IBB A;  1K3X A;  3AOG A;  4BLC A;  2UXB M;  3W0L B;  4B3M M;  3KOX E;  4I4L A;  4LY6 A;  5FTJ A;  3U6O A;  2FOI C;  4Z6Y A;  1IBK M;  1IY1 A;  2QPA A;  4L15 A;  1TGU A;  1N32 M;  3AJI B;  3PVS A;  4XGI A;  3PNV A;  3CTW B;  4W5W A;  2Y0Q A;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...