2UUCO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uucO00
3F5TA 2N74A 1IBKO 1XMOO 4JI1O 4DV0O 5LL6Y 1XEQA 4LF9O 1N33O 5BY1A 1HNZO 4OPHA 5BXZA 3SDLA 5H5NA 3J7AU 1FYJA 4JI6O 1G1XB 4JI5O 2AGAA 4X65O 1XMQO 1I94O 1XNRO 3T1YO 1D2DA 2VQEO 2DJVA 2Z0AA 3T1HO 4NXNO 3RT3C 4YHHO 4DR4O 1AB3A 4DV4O 1J5EO 4DV2O 5LMUO 1HR0O 1HNWO 1DK1A 4DR7O 2DOSA 1YZBA 5LMNO 4JI7O 4JI2O 4DR6O 4K0KO 4AQYO 5IT9N 4DV7O 1AILA 5IWAO 4X62O 4LF8O 2ZKOA 4B3RO 2HHHO 4GKKO 1NS1A 4GKJO 1XNQO 2F4VO 1N32O 4DR5O 4B3TO 1R1BA 4LF5O 1N36O 4DUZO 4JI3O 2UUAO 4LF4O 4A5UB 1F7YA 4DV1O 4OX9O 4DV3O 4LF7O 1IBMO 1A32A 3M8AA 4LFCO 4JI4O 4JV5O 2VQFO 2UXCO 4B3MO 5BR8O 4DR1O 4DR2O 4JYAO 2JRIA 1R6TA 2UXBO 5A2QN 4JI0O 3J80N 4KHPO 5FLXN 4YY3O 4B3SO 4LF6O 2LW7A 2UXDO 4OPAA 4DV5O 1FJGO 4DV6O 3OTOO 1X59A 2FKXA 1KUQA 4X64O 3O65A 4DR3O 2UU9O 2E5LO 2UUBO 1IBLO 1HNXO 1N34O 3JAMN 3J81N 2UUCO 4JI8O 2ZM6O 4DUYO 4LFBO 1FKAO 4NXMO 4LFAO 4X66O 3R66A
chains in the Genus database with same CATH superfamily
1VF6C 1L1FA 3ZHUA 4GKKB 1XNQB 1Q5OA 3ETGA 3RN4A 3H9VA 4DR5B 2Q7HA 1JPXA 3WU2Z 1T5EA 3CE2A 3D36A 4EKWA 5CA1B 2Q4PA 3G80A 3FAVB 2CTWA 1TVKA 2P6JA 3M7MX 2PGGA 2YI9A 2DE0X 1NH2D 2Q7EA 4MT8A 4FM0A 4BW5A 2YIBD 1CPYA 5FNVB 4MSWC 1OCZC 2PYLA 2XAGA 1RM1C 2PZSA 4HBNA 3S3WA 3N2KA 3P3PA 4X62O 4ZBMA 1CP9A 3PN1A 4FLYA 1PL0A 2WLMA 4HAMA 4DR3B 2HJDA 5B1OA 4MVOA 1ORQC 2H8PC 4K3AA 5KLVH 2IU3A 1HDJA 5JH7B 2DYSC 4UV8A 1QR8A 3IFXA 4PA4A 2BOBC 5B3SB 4ZOLB 4IT5A 5BR8O 1EZJA 2VRZA 3VQXA 1G4YB 5LP6C 3OMNB 1DTOA 2ZXWC 4GX1A 4ZHQB 4TV8B 5J2TA 5KHIA 3RYHB 1K73W 4PDMA 3JAWB 3K79A 4U3JB 4UXNA 2QEXV 1M9NA 3OEEG 1V54B 1WP7A 3ZMZA 4FJCC 3ASOB 1NVPB 1H2LA 1HR0B 1HNWB 1I5XA 1Q8IA 4UB8Z 2ZCEA 2XAQA 2QGNA 2GUZA 3SPJA 4E4EA 3RVZA 2JGDA 2LFSA 2GDSA 2WSSG 1HNZO 5BXZA 4FFKA 3SJAC 2KSDA 4GX0A 1M4UA 1ZSPA 3H1IH 2ZE8A 5H2FZ 4PDVA 5LA6B 1EBOA 1IBMB 1AI4A 1OCRC 2DJVA 3CXHF 3K57A 3B09A 3B40A 1TAEA 4WFAV 4LH6A 2GV9A 4MVQA 1SQGA 3FB7C 3ABMC 3U0ZA 2BTQB 4YJ3B 1YHQV 3JAKA 4KHPB 3HKCB 1KB9F 2EZPA 5DN6G 3JYCA 4X64B 2UUBB 1JX9A 4DUZO 1Z5WA 3DTUB 2AZ2A 4KP4A 2M7WA 1KD1W 1KQSU 4JAVA 2PF4E 4MTGA 5CBGA 1Y76A 2EX3A 1I7FA 3BA9A 3TGUH 2XUMA 1RPOA 1E79G 4KL1A 4PDLA 1H2GA 4DR1O 4DR2O 1NTZH 2XAHA 5L3EA 5A2QN 4YY3O 5BMVA 3JSLA 4X65B 2YC0A 3E8FA 2VQEB 3O65A 4N21A 3CCMV 1XHZA 3OMIB 4JZGA 4FFBA 2FTKA 5LXTA 1WB8A 3ZMTA 3BEHA 1XI1A 4HNAB 4I7ZB 4P30A 4K0KB 2GTAA 5B5EZ 1FD9A 3R66A 4BWAA 3R65A 4DV0O 4EB6B 1P4RA 5BY1A 5KA6A 4X1YA 1N8RW 2WAMA 2WWWA 1Q7YW 4JI6O 4JI3B 4DW0A 3FB8C 2ETNA 5LOVB 4I50A 4YXWG 2XOKG 4DV3B 4LF7B 3E8BA 1OZ0A 2UXXA 1XHXA 4LFCB 3T1YO 2VS0A 3QO8A 4WBNB 4NXNO 4Q6GA 3S3XA 2NN4A 1PNMA 1YIJV 4O4JA 1J5EO 4IL6Z 3QG5A 4JYAB 2OT5A 3WG7C 3CRQA 3X2QC 5LMNO 1JCHA 4AQYO 1ZLZA 2ZXWB 3LUTB 2OWOA 3KG2A 4CH5A 4DV5B 2PI4A 4R50A 4B3RO 4GKJO 3L70H 4XDKA 1TVKB 3CXCU 1ZL8A 2AHZA 2IM9A 2QWQB 3W7WA 1ZAUA 2P67A 1XILA 5KAIZ 1OCCC 3HKBA 5FPOA 1KKCA 3ZHSA 4PI2A 4JF3A 2VQFO 3N27A 4JI1B 4L87A 1H2MA 4UVAA 3N2KB 1YXBA 3OE7G 4I0XA 3RVYA 2X6AA 2QWNB 4JI0O 4MTOA 1NT2B 2CGOA 4O4LA 4JGSA 2IU0A 4F6EA 1VQNV 1EM1A 2E5LO 2YXLA 4DR4B 3E2EA 2F66C 2RNBA 1AVMA 2Y4TA 3CB2A 1QVFU 4DR7B 3OTFA 4LFBO 5B66Z 1JOYA 1FKAO 4DK0A 1LUWA 4JI7B 2QKSA 2Q73A 5DEDA 3LNNA 2HP8A 5CN0A 2Q9LA 4R7CA 1YEWA 5J2TB 2BCCH 2EINB 2W0XA 4JZ2A 3A2FA 1D5AA 3CMAV 3N2GB 4JI5O 2YSUB 5D5PA 1SQXH 2P7TC 5KHGA 2JIZG 4JASA 2ZINA 1ZUQA 1GN2A 5EC1C 2WA3A 4U7OA 4PV1B 4JI4B 2PYJA 5EBMC 3CSXA 3T2MA 1SESA 2GUZB 5FNVA 1CXZB 2JGDB 5KX5A 3UM7A 2H94A 4LC1A 3KKYA 4K8XA 1KBHA 3M99B 4JI2O 2O57A 2EILC 1VQ7V 2UXDB 2DQ0A 2ZKOA 3C90A 2P4KA 3HKDA 3AK3A 2OCCC 2UUAO 2VWJA 4LF4O 2ZM6B 1NR7A 1U96A 3JD3A 1SQQH 3SJBC 4Z2WA 2BTOA 1G6UA 1Q3EA 3OM3B 2L6LA 3JAKB 1EZVH 4ZOLA 5JQGB 1JJ2U 2UXCO 2MK3A 2Y69B 4RWUA 3IC7A 3SPIA 2JRIA 4BR6A 1AI5A 4NTYA 5GONA 1FXHA 1YI2V 4H37A 4DW1A 4B3SO 4FZ0A 3BAAA 3LSQA 3SJQC 2E75B 3F5WC 3NXSA 1Q6UA 2B1IA 2ATKC 1AR5A 2WLKA 4YHHB 2WLNA 3ABKB 1Y76B 2F93B 4NB5A 4BIUA 2JEXA 4DV7B 4RQFA 3AG2B 2QM4A 1IXBA 3T4DA 3ZN1A 4GT1A 4MVZA 3JARA 1XEQA 5BMVB 3W7TA 5C8YA 1P84F 3A8TA 4UVBA 4FK5C 4G28B 3JALA 1MSWD 4PD4F 3FKSG 2HKOA 4FFBB 1BHBA 3OMAB 3EHBB 3F7YC 1NQTA 1FS0G 4UCUA 5B3SC 4DXWA 5H6RA 3AG7A 4CS3A 2KB1A 4B7KA 5D5QA 2KG7A 3AK2A 4TQDA 2RN9A 1BQ0A 2ZE6A 3A0HZ 1SKVA 4MVRA 4FLXA 4X1YB 1FFXB 5IT9N 4TSFG 1M56B 3BVOA 4I50B 2P06A 3LDCA 4UCRA 2YIBA 3JD4A 1V54C 1Y4MA 3ASOC 4BIOA 1YJNV 4X20B 2WLJA 2D3OW 3H01A 3QNEA 1FPOA 1PP9H 4O4JB 4QNHB 2XHBA 1ZX3A 3ABLB 1A32A 5IJ9A 1NKDA 1NBMG 1RSOA 4ABMA 3QTCA 4D7TA 5AG2A 2BOCC 1TGOA 4EFBA 2JVDA 4J9ZB 2CH7A 1K92A 5IYBO 4AHCA 1ZL8B 4JAUA 3J80N 3U11A 4LP8A 4J7ZA 2Y4UA 4PHZA 1URFA 3BPZA 5HFLA 1VQLV 1GM9A 4GCZA 2Z5UA 2CTPA 3ZRVA 3L74H 3CPWU 4DV2B 2OIGA 4XBFA 5LBQA 4MS2A 4FLTA 2Q8VA 4HNAA 4NXMO 1XDCA 4X66O 1PNLA 4BIZA 4H13B 5IWAB 2Q5ZA 4PA9A 2ZQMA 2QA4V 4UCTA 1XMOO 1NZ6A 1EN5A 1R6NA 4LF9O 1N33O 4UVCA 2GBOA 1S76D 3HB3B 3WFVA 3E8GA 1YTFD 3G67A 2JS3A 3G6EV 3B77A 2X6CA 1ENVA 1I94O 2JDIG 4JV5B 2ZDIC 3OUSA 1VF7A 3CCEV 4K8ZA 2ZR3A 3SPCA 3L9DA 3OFNG 5IYDO 2OYQA 1WJZA 1DF4A 3FFQA 1Y74A 3OUFA 4WFGA 1SZXA 1Q43A 2JK5C 4NTXA 4J10A 1W0KG 4LF8O 1FJGB 3LDDA 4DV6B 2LGQA 1EN4A 4RUEA 1NTMH 1FXVA 1IDSA 3HKEB 1THZA 3IC9A 2HFEC 1VQ6V 1R1BA 2X6BA 4DUYB 1XUQA 4LFAB 1F51A 5KX5B 3M8AA 5CBHA 3U10A 5EIBD 1XOUA 4MW3A 3QO7A 3ZMUA 1JVMA 1JFFB 3HKDB 1QQCA 1PD3A 3UQ8A 3JCUZ 4LF6O 2IBZH 1XL6A 4WFBV 4J9YB 3BABA 1AJPA 4UCVA 2QKAA 1IURA 1HNXO 1VQPV 1P49A 3AEIA 3JAMN 3J81N 2UUCO 1WPXA 3D3IA 1N0JA 3UKMA 4DR6B 4FMTA 5GONB 2HLDG 2HVKC 3D36C 1UJWB 1IBKO 2HHHB 5LL6Y 4G27B 4MW8A 2KQXA 3QO5A 3DSQA 3RBZA 1N36B 3N2GA 4TWKA 2IJJA 2IJKA 2XAFA 2HVJC 1G8MA 4OX9B 1JR9A 1XMQO 3L71H 1Q81W 3T1HO 1YITV 4DV4O 5EBWC 2DWEC 2QWPB 3ABTA 3JARB 5JCOA 5L3CA 2AZ0A 5LHGA 1BZKA 3LDEA 1SC5B 2DW4A 1YJ9V 1TA8A 5C8YB 3P32A 4HYOA 3RYFB 5F2VO 3BY6A 3JALB 1EFRG 4YJ2A 4GYCB 1BSMA 3EXAA 1TUBB 2ZE7A 3TJTA 2VWKA 1CEZA 4PJ0Z 1N32O 2GHYA 4LF5O 1K8AW 3T1CA 2KG7B 2MW2B 3ZRSA 3RYIA 4O2BA 2OIEA 2YI8A 5GW7A 3TXQA 4FLZA 5JQGA 2JGUA 4B3MO 5KHKA 4X89A 2EZOA 3OD4A 1M57B 2B1GA 1NH2B 3OAAG 1US6A 2EINC 3P3NA 5JVDB 4F6RA 1N4CA 1MG1A 4P9OA 2HG5C 4X1IA 1WA8B 1YCIA 2ZR2A 1OHHG 1XNRB 1SQPH 3OTOO 2FKXA 4XDLA 3VQYA 4O4HA 1IBLO 2QWOB 5IJ9B 5GTHZ 4DYLA 1RSOB 2IW5A 3CJHA 3IJ4A 4H33A 5FPRA 5JCOC 4CZZA 2CH7B 5LGTA 4WFFA 1E1RG 3T4ZA 2XNDG 5J2UB 3ZRXA 1AP6A 2D2CB 2LW1A 4B3TB 4N23A 3ZN0A 2YDEA 1WAZA 1WPBA 2ZE5A 1VQ9V 4ASUG 5EC2C 1GAXA 1K4DC 3G4SV 4EEQA 4TV9A 3ZRWB 1GTOA 4PA6A 2P5OA 4X88A 1NR1A 4DO2A 2Y69C 1SQFA 2C2AA 4Z1VA 1FFXA 4FVMA 1YVWA 1KP2A 4QGPA 3RYCA 1VMGA 1LUVA 3FX7A 3ABUA 2PUSA 4IHJA 2UU9B 2ZNIA 1PPJH 3CD6V 1HW7A 2QSAA 3H1JH 1L8DA 1MA1A 3ZJZA 3IGAC 1ZTEA 4X20A 3D8CA 3ABKC 1R73A 4IGGA 2AW9A 1Y74B 1VIBA 3D3QA 3AG2C 3E86A 1FFTB 3LSSA 2Y0IA 2B5UA 3STZC 3JCZA 2UXBO 1N34B 2ADQB 3L72H 3TETA 1W0JG 3Q4HB 1SERA 1B06A 3C3SA 5FL7G 2R9IA 2F95B 4UFZA 2QTSA 2Y0PA 4DRXA 4JI8O 1JMKC 1JJOA 4MTFA 1AR4A 1GK9A 4D6TH 1L0NH 5B1BB 4X62B 3B8NA 3CRRA 2EIJB 4RUFA 3IAYA 1M56C 3SDLA 3CC2V 1MSDA 2WLIB 3SJCC 3LNMB 1OCOB 5EZYB 4PELA 2QR4A 4B08A 3AG1B 4C7UA 1FAFA 2JS5A 3ABLC 3TK1A 5L3BA 3RT3C 2QTOA 3OW2U 2EBOA 1AB3A 4CC6A 5BR8B 5LMUO 1K9MW 1DGSA 4X8AA 2R9AA 5DECA 1YZBA 4X1KA 5L3DA 1YDXA 5C93A 2ZIMA 2ZT9B 2GTSA 4NYKA 4GKKO 5LGNA 4O4IA 1XNQO 1K4CC 3HKEA 4H44B 3SPGA 1YF2A 1QHTA 4DR5O 4I5SA 1BS3A 4JTAB 1VP7A 1GN6A 3CCRV 1F7YA 1I0HA 2Q6AA 2RCVA 2N05A 2BE3A 2PY5A 2GSMB 1HNZB 2Q0AA 3ZHTA 4YJ2B 2Q0OC 1R6TA 1QR9A 1JFFA 2QM8A 2DWDC 3OGIB 2QJ1A 1J95A 4QE7A 5EYPA 4KUMA 3O9OA 3RYIB 3A0BZ 4O2BB 1P7BA 4DR3O 4YIOA 2RDCA 1BL8A 1IX9A 2DN9A 3F7VC 2EIMB 4W4KA 2ILMA 2FB5A 4F6RB 3GWKC 3MHHC 3CRAA 4X1IB 3ZIAG 2RQ6A 4MTXA 1AP5A 1HP8A 4IIJA 5KHHA 2ITDC 2DYRB 4NTWA 4JTCB 4DUZB 4CH6A 4UV9A 4O4HB 4NR1A 3K5MA 2PTMA 2Q7GA 4PA7A 3DC5A 2YS8A 2XAJA 3MHSC 2IJIA 3CJHB 1M93A 5H9CA 4FLWA 2UXNA 2CTQA 2FL4A 3APOA 4JPRA 1SQVH 1QBZA 3L73H 3BFRA 3AG3B 4U3FH 2NNUA 4DR2B 1HR0O 1HNWO 1DK1A 3MDSA 5KAFZ 3JD1A 1GO3F 1F4NA 2Q68A 3ZX6A 4TUYB 3RYFA 1MZFA 4YY3B 1AILA 1BCCH 3CCLV 3SGIA 1TUBA 4FLVA 4P2ZA 2XTAA 1XQ8A 5IY5B 1AJNA 1XL4A 4TV9B 1Z2GA 2YXYA 1BMFG 3SYCA 2FYUH 5LYJA 1IBMO 5EBLC 4GX2A 2QKCA 3APQA 4DV0B 3RYCB 5JJJB 3UT5B 1MMMA 4JI6B 5JVDA 4IHJB 3K0DA 3DXRA 2Q69A 4JTDB 4KHPO 1WA8A 2FMLA 4B7EA 2WLLB 2WLHA 3T1YB 4LNUA 1KKDA 4J41A 3MAQA 1MABG 2LJ2A 4X64O 2LO1A 4NXNB 2UUBO 1J5EB 4RAIA 3TCUA 2W6JG 4WCEV 1QCEA 1YSCA 1NU1H 5LMNB 3G71V 3K9AA 4AQYB 4HZ3A 3K0GA 5J2UA 2Z0AA 3FB6C 3K04A 4B3RB 4GKJB 1AROP 4WFEA 1VQOV 4MVUA 1K33A 2IH1C 3K3WA 1H2KA 2A79B 1COWG 2AGAA 3SPHA 1O9HA 4ZI7A 4DRXB 3I55V 3CMEV 3AK1A 4X65O 2DQ3A 2V7QG 2VQFB 2VQEO 3ZRWA 4OXSA 1S5HC 1S0VA 1M57C 4IYHA 5IJ0A 3W7XA 4K0KO 1H8HG 4JI0B 3VQWA 5KA5A 2XASA 2G38A 4PI0A 1DF5A 1LNQA 1S72V 5A9GA 1S77D 1NVPD 2E5LB 5HFMA 1R6KA 1Q82W 2ZD9A 4O2AA 4JI3O 3CCUV 4FM1A 1HWYA 4FPPA 1OJHA 4LFBB 4BW9A 1IVSA 5K1PA 4RQEA 2A9HA 1VQKV 4DV3O 4LF7O 3OT7A 5CB4A 2Q67A 5KMGA 2R9RB 2W0FC 3SR2C 3K59A 4LFCO 3CCVV 1QLEB 4X1KB 4JYBA 2Z3YA 3ICXA 2H3OA 4PDRA 1SQBH 2EULA 3I5DA 4JYAO 3SYQA 4O4IB 3TXSA 1F23A 5FLXN 1FXKB 3AG4B 2JJ2G 3FYEB 1R3KC 3Q4HA 4QPJA 4DV5O 5LP6A 2NLJC 2F23A 4XDJA 3SYOA 1D5NA 4I4TB 4UB6Z 1JA8A 2K1EA 1N34O 2X7RB 3I56V 4JI2B 2OTJV 5K1XA 3CWBH 4CH3A 2JJ1G 1GM8A 4H0LB 1Q6IA 2E3CA 4JI1O 5L3GA 1PKXA 5H5NA 5EYPB 1KECA 4U7NA 2WLIA 2UUAB 5EZYA 4LF4B 1KC8W 4JAAA 1SETA 4UCSA 1K7DA 1VF5B 1W2BU 5ITZB 2UXCB 1QLNA 1AI6A 3STLC 4DR4O 2LGWA 4R6ZA 1K5SA 5IDJA 2HEPA 1Q90D 3E83A 2CAZC 2F4VB 2ARHA 4DR7O 1OV9A 4NVPA 4IIJB 1EN6A 1UFIA 4JI7O 2P22C 1NI8A 3OR6C 4J7JA 4B3SB 3H1LH 1H2NA 1NTKH 1BE3H 5J9PC 3ZCCA 4DV1B 1VQ5V 1AJQA 1DLBA 2BSKA 4J7KA 2LQTA 3K5OA 3BCCH 3K5NA 5KUMA 1R3JC 4J11A 1RP3B 1GKFA 1YTFB 3L75H 3OEHG 1P7GA 2RJZA 2NR5A 4JI4O 5B1BC 3WB2A 2EIJC 2CGNA 4CBCA 3E35A 2EIKB 5JJNB 1MOFA 4LCUC 3JASA 3K06A 1U97A 1OCOC 2UXDO 3AG1C 3ASNB 3ZHVA 1S5LZ 5CA0A 5LYJB 3KCYA 2ZM6O 3JD0A 3JATB 1Q6HA 2AXTZ 3JSNA 1VEWA 1L0LH 2N74A 3CRMA 3DXRB 4ZIBA 4LNUB 1V55B 3B8MA 2L35A 3EFFK 3ETEA 2P4VA 5BZBA 4GZRB 1SA0B 5B1NA 3A0RA 4ICGA 4LWSA 4YHHO 3WB1A 1IZ3A 3C3TA 1MZEA 5H6QA 5DM6V 4WF9V 2DOSA 2E76B 4TUYA 1WN7A 5B1AB 5EK0A 2F43G 4DV7O 4TQFA 3FB5C 4Z1MG 3G6BA 5CA3A 3H1KH 1Z5VA 4ZI7B 1MNGA 5KUKA 5IYCO 1K34A 4WFHA 5KHJA 3CCJV 2YXHA 5IYZA 1BT8A 1SRYA 4QE9A 4NXMB 3ZS8C 4X66B 2ADPA 4EFEA 2WA4A 2EIMC 2LP7A 4LBEC 5L3FA 5IJ0B 4Q20A 1XMOB 2QE7G 1N33B 4LF9B 3WB0A 1OCZB 2CTRA 1H8EG 3UT5A 2DYRC 3GWOA 4GUNA 2ITCC 1RM1B 2DMXA 4ZKIA 1Y67A 4O2AB 4P9PA 1TUEB 2WLLA 1I94B 1X59A 5JJEB 1PM9A 5CB4B 5KMGB 4QPKA 2P90A 2E74B 1VQMV 3AG3C 1AI7A 2AHYA 2DYSB 1BGYH 3P30A 1K5QA 3JD2A 1B3QA 1VQ8V 2OTLV 2QDOA 1Y6XA 1PL4A 4LF8B 3CC7V 2A0LA 1E1QG 4J80A 2CDYA 1N0NA 1VQ4V 3KCXA 5LP6B 4CC5A 2YEVA 5IY5C 4I9WA 4I55A 3CYOA 1LR1A 1I5YA 4QJFB 1WP8A 3LSUA 1D2DA 3ZHQA 1H38A 1F4MA 3RFRA 3CEIA 1GRJA 1KYOF 1XBLA 4F4LA 3QVNA 1BHAA 4DV2O 1IXMA 4X9QA 3K9SA 3E22A 2IJHA 4LR3A 4LF6B 2CUGA 5IWAO 3ZMSA 5CBFA 1I08A 1NS1A 2CK3G 2PI5A 1HNXB 1KU9A 2UUCB 4JYCA 3RW0A 1X4TA 4MVMA 2B9ZA 3VBBA 2HR3A 3UO3A 1AR1B 1OCRB 3W7UA 4NKGB 2Y48A 4JV5O 4L8JA 1IBKB 1GH6A 3RGBA 4I9QA 3ABMB 2BSKB 4IYIA 1FXKA 1WLEA 1JQ0A 1XMQB 1O9GA 1FJGO 3ETQA 4DV6O 1KUQA 4FIPC 4I4TA 4CS4A 3T1HB 1ROPA 2YICA 3ML0A 5CA1A 1YJWV 3FAVA 4DV4B 3CC4V 4CS2A 1GN4A 4W4LA 1KMIZ 3BRCA 4DUYO 3VQVA 4GLXA 4LFAO 3MD0A 3QF7A 3JASB 3F5TA 3OR7C 2V4DA 4AILC 3DGEA 4OPHA 3J7AU 1N32B 1Y66A 1SS3A 4LF5B 2ODMA 5CA0B 1G1XB 2A7WA 1KP3A 1SF9A 1K97A 3GVMA 4K35A 3CCQV 5ITZA 2A3QA 1QLEC 1K3EA 3CHXA 4B3MB 1M1KW 1R3IC 2YIDA 4PA3A 5JH7A 3HPLC 4RO2A 4DR6O 1FXKC 3AG4C 3OTOB 3ZBHA 2HHHO 3CP1A 2F4VO 4KXRA 1IBLB 4TOIA 2KKWA 4ZHQA 4TV8A 2XT9A 1N36O 1R3LC 4LWSB 3RYHA 3B2EE 4A5UB 3JAWA 4U3JA 3ZHRA 4TT3G 3RWRD 5JWPA 4DV1O 4DR1B 4OX9O 3H1HH 3FD9A 3SYPA 1B04A 3WG7B 2A06H 3X2QB 3GB7C 3FYIB 1GM7A 2LFRA 2F1MA 5IYZB 5E79Z 2LW7A 5CMUA 1ZWIC 4FM2A 1VARA 1WNSA 2K9PA 1M5IA 4DK1A 1UPGA 1B6QA 1H2SB 3BHPA 1OCCB 5LA6A 2R72A 5LXTB 3JATA 4G2KA 1RFYA 1M90W 3UCSC 3K58A 2YIAA 2BTQA 4YJ3A 1FYJA 3ZEDA 2WPDG 3HKCA 5E1AC 2QM7A 3B4SA 3W7SA 4CH4A 2V1DA 2HJFC 5TISZ 3CS5A 4GX5A 1S5JA 1QNMA 1SA0A 2W6IG 1NJIW 1XNRO 3NR7A 3E8HA 3K5LA 3CX5F 4FLUA 2ZIOA 1S3JA 2ZDIA 4R8CA 2UXBB 2EIKC 3DC6A 3THOA 1GN3A 3E89A 3VOUA 1VF6A 2EJRA 5GTIZ 3PJSK 2YUAA 2YEVB 4I55B 3BA8A 2JEUA 3ASNC 4D7SA 1Q86W 4B3TO 2CE4A 3OGCC 3UO2A 4JI8B 1PNKA 2M6YA 1GMGA 3HKBB 3ZMVA 3HR0A 2ZNJA 2OCHA 1RPRA 2RMKB 4J42A 2N04A 4QIWF 1QVGU 2X0LA 1XREA 3CRCA 5LHHA 1BQZA 3K03A 3E22B 5LHIA 4FZ1A 4UUJC 1W59A 5EIBC 4I0XB 1WB7A 1V55C 5IE9A 2EILB 3CCSV 2R70A 4YIPA 4EB6A 4UCOA 4KFMA 4O4LB 2EJ7A 4OPAA 5LGUA 4E2LA 2IH3C 4LH7A 2QWRB 4BAYA 4OGQB 2UU9O 1SZTA 2OCCB 5LOVA 5LMUB 3EVKA 1V9PA 1QU7A 1PV0A 3SYAA 4AI8A 3K08A 4WBNA 3ETDA 3KZIZ 4JYYA 5B1AC 4MVSA 4JI5B
chains in the Genus database with same CATH topology
3F5TA 2N74A 1IBKO 1XMOO 4JI1O 4DV0O 5LL6Y 1XEQA 4LF9O 1N33O 5BY1A 1HNZO 4OPHA 5BXZA 3SDLA 5H5NA 3J7AU 1FYJA 4JI6O 1G1XB 4JI5O 2AGAA 4X65O 1XMQO 1I94O 1XNRO 3T1YO 1D2DA 2VQEO 2DJVA 2Z0AA 3T1HO 4NXNO 3RT3C 4YHHO 4DR4O 1AB3A 4DV4O 1J5EO 4DV2O 5LMUO 1HR0O 1HNWO 1DK1A 4DR7O 2DOSA 1YZBA 5LMNO 4JI7O 4JI2O 4DR6O 4K0KO 4AQYO 5IT9N 4DV7O 1AILA 5IWAO 4X62O 4LF8O 2ZKOA 4B3RO 2HHHO 4GKKO 1NS1A 4GKJO 1XNQO 2F4VO 1N32O 4DR5O 4B3TO 1R1BA 4LF5O 1N36O 4DUZO 4JI3O 2UUAO 4LF4O 4A5UB 1F7YA 4DV1O 4OX9O 4DV3O 4LF7O 1IBMO 1A32A 3M8AA 4LFCO 4JI4O 4JV5O 2VQFO 2UXCO 4B3MO 5BR8O 4DR1O 4DR2O 4JYAO 2JRIA 1R6TA 2UXBO 5A2QN 4JI0O 3J80N 4KHPO 5FLXN 4YY3O 4B3SO 4LF6O 2LW7A 2UXDO 4OPAA 4DV5O 1FJGO 4DV6O 3OTOO 1X59A 2FKXA 1KUQA 4X64O 3O65A 4DR3O 2UU9O 2E5LO 2UUBO 1IBLO 1HNXO 1N34O 3JAMN 3J81N 2UUCO 4JI8O 2ZM6O 4DUYO 4LFBO 1FKAO 4NXMO 4LFAO 4X66O 3R66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5T A;  2N74 A;  1IBK O;  1XMO O;  4JI1 O;  4DV0 O;  5LL6 Y;  1XEQ A;  4LF9 O;  1N33 O;  5BY1 A;  1HNZ O;  4OPH A;  5BXZ A;  3SDL A;  5H5N A;  3J7A U;  1FYJ A;  4JI6 O;  1G1X B;  4JI5 O;  2AGA A;  4X65 O;  1XMQ O;  1I94 O;  1XNR O;  3T1Y O;  1D2D A;  2VQE O;  2DJV A;  2Z0A A;  3T1H O;  4NXN O;  3RT3 C;  4YHH O;  4DR4 O;  1AB3 A;  4DV4 O;  1J5E O;  4DV2 O;  5LMU O;  1HR0 O;  1HNW O;  1DK1 A;  4DR7 O;  2DOS A;  1YZB A;  5LMN O;  4JI7 O;  4JI2 O;  4DR6 O;  4K0K O;  4AQY O;  5IT9 N;  4DV7 O;  1AIL A;  5IWA O;  4X62 O;  4LF8 O;  2ZKO A;  4B3R O;  2HHH O;  4GKK O;  1NS1 A;  4GKJ O;  1XNQ O;  2F4V O;  1N32 O;  4DR5 O;  4B3T O;  1R1B A;  4LF5 O;  1N36 O;  4DUZ O;  4JI3 O;  2UUA O;  4LF4 O;  4A5U B;  1F7Y A;  4DV1 O;  4OX9 O;  4DV3 O;  4LF7 O;  1IBM O;  1A32 A;  3M8A A;  4LFC O;  4JI4 O;  4JV5 O;  2VQF O;  2UXC O;  4B3M O;  5BR8 O;  4DR1 O;  4DR2 O;  4JYA O;  2JRI A;  1R6T A;  2UXB O;  5A2Q N;  4JI0 O;  3J80 N;  4KHP O;  5FLX N;  4YY3 O;  4B3S O;  4LF6 O;  2LW7 A;  2UXD O;  4OPA A;  4DV5 O;  1FJG O;  4DV6 O;  3OTO O;  1X59 A;  2FKX A;  1KUQ A;  4X64 O;  3O65 A;  4DR3 O;  2UU9 O;  2E5L O;  2UUB O;  1IBL O;  1HNX O;  1N34 O;  3JAM N;  3J81 N;  2UUC O;  4JI8 O;  2ZM6 O;  4DUY O;  4LFB O;  1FKA O;  4NXM O;  4LFA O;  4X66 O;  3R66 A; 
#chains in the Genus database with same CATH topology
 1VF6 C;  1L1F A;  3ZHU A;  4GKK B;  1XNQ B;  1Q5O A;  3ETG A;  3RN4 A;  3H9V A;  4DR5 B;  2Q7H A;  1JPX A;  3WU2 Z;  1T5E A;  3CE2 A;  3D36 A;  4EKW A;  5CA1 B;  2Q4P A;  3G80 A;  3FAV B;  2CTW A;  1TVK A;  2P6J A;  3M7M X;  2PGG A;  2YI9 A;  2DE0 X;  1NH2 D;  2Q7E A;  4MT8 A;  4FM0 A;  4BW5 A;  2YIB D;  1CPY A;  5FNV B;  4MSW C;  1OCZ C;  2PYL A;  2XAG A;  1RM1 C;  2PZS A;  4HBN A;  3S3W A;  3N2K A;  3P3P A;  4X62 O;  4ZBM A;  1CP9 A;  3PN1 A;  4FLY A;  1PL0 A;  2WLM A;  4HAM A;  4DR3 B;  2HJD A;  5B1O A;  4MVO A;  1ORQ C;  2H8P C;  4K3A A;  5KLV H;  2IU3 A;  1HDJ A;  5JH7 B;  2DYS C;  4UV8 A;  1QR8 A;  3IFX A;  4PA4 A;  2BOB C;  5B3S B;  4ZOL B;  4IT5 A;  5BR8 O;  1EZJ A;  2VRZ A;  3VQX A;  1G4Y B;  5LP6 C;  3OMN B;  1DTO A;  2ZXW C;  4GX1 A;  4ZHQ B;  4TV8 B;  5J2T A;  5KHI A;  3RYH B;  1K73 W;  4PDM A;  3JAW B;  3K79 A;  4U3J B;  4UXN A;  2QEX V;  1M9N A;  3OEE G;  1V54 B;  1WP7 A;  3ZMZ A;  4FJC C;  3ASO B;  1NVP B;  1H2L A;  1HR0 B;  1HNW B;  1I5X A;  1Q8I A;  4UB8 Z;  2ZCE A;  2XAQ A;  2QGN A;  2GUZ A;  3SPJ A;  4E4E A;  3RVZ A;  2JGD A;  2LFS A;  2GDS A;  2WSS G;  1HNZ O;  5BXZ A;  4FFK A;  3SJA C;  2KSD A;  4GX0 A;  1M4U A;  1ZSP A;  3H1I H;  2ZE8 A;  5H2F Z;  4PDV A;  5LA6 B;  1EBO A;  1IBM B;  1AI4 A;  1OCR C;  2DJV A;  3CXH F;  3K57 A;  3B09 A;  3B40 A;  1TAE A;  4WFA V;  4LH6 A;  2GV9 A;  4MVQ A;  1SQG A;  3FB7 C;  3ABM C;  3U0Z A;  2BTQ B;  4YJ3 B;  1YHQ V;  3JAK A;  4KHP B;  3HKC B;  1KB9 F;  2EZP A;  5DN6 G;  3JYC A;  4X64 B;  2UUB B;  1JX9 A;  4DUZ O;  1Z5W A;  3DTU B;  2AZ2 A;  4KP4 A;  2M7W A;  1KD1 W;  1KQS U;  4JAV A;  2PF4 E;  4MTG A;  5CBG A;  1Y76 A;  2EX3 A;  1I7F A;  3BA9 A;  3TGU H;  2XUM A;  1RPO A;  1E79 G;  4KL1 A;  4PDL A;  1H2G A;  4DR1 O;  4DR2 O;  1NTZ H;  2XAH A;  5L3E A;  5A2Q N;  4YY3 O;  5BMV A;  3JSL A;  4X65 B;  2YC0 A;  3E8F A;  2VQE B;  3O65 A;  4N21 A;  3CCM V;  1XHZ A;  3OMI B;  4JZG A;  4FFB A;  2FTK A;  5LXT A;  1WB8 A;  3ZMT A;  3BEH A;  1XI1 A;  4HNA B;  4I7Z B;  4P30 A;  4K0K B;  2GTA A;  5B5E Z;  1FD9 A;  3R66 A;  4BWA A;  3R65 A;  4DV0 O;  4EB6 B;  1P4R A;  5BY1 A;  5KA6 A;  4X1Y A;  1N8R W;  2WAM A;  2WWW A;  1Q7Y W;  4JI6 O;  4JI3 B;  4DW0 A;  3FB8 C;  2ETN A;  5LOV B;  4I50 A;  4YXW G;  2XOK G;  4DV3 B;  4LF7 B;  3E8B A;  1OZ0 A;  2UXX A;  1XHX A;  4LFC B;  3T1Y O;  2VS0 A;  3QO8 A;  4WBN B;  4NXN O;  4Q6G A;  3S3X A;  2NN4 A;  1PNM A;  1YIJ V;  4O4J A;  1J5E O;  4IL6 Z;  3QG5 A;  4JYA B;  2OT5 A;  3WG7 C;  3CRQ A;  3X2Q C;  5LMN O;  1JCH A;  4AQY O;  1ZLZ A;  2ZXW B;  3LUT B;  2OWO A;  3KG2 A;  4CH5 A;  4DV5 B;  2PI4 A;  4R50 A;  4B3R O;  4GKJ O;  3L70 H;  4XDK A;  1TVK B;  3CXC U;  1ZL8 A;  2AHZ A;  2IM9 A;  2QWQ B;  3W7W A;  1ZAU A;  2P67 A;  1XIL A;  5KAI Z;  1OCC C;  3HKB A;  5FPO A;  1KKC A;  3ZHS A;  4PI2 A;  4JF3 A;  2VQF O;  3N27 A;  4JI1 B;  4L87 A;  1H2M A;  4UVA A;  3N2K B;  1YXB A;  3OE7 G;  4I0X A;  3RVY A;  2X6A A;  2QWN B;  4JI0 O;  4MTO A;  1NT2 B;  2CGO A;  4O4L A;  4JGS A;  2IU0 A;  4F6E A;  1VQN V;  1EM1 A;  2E5L O;  2YXL A;  4DR4 B;  3E2E A;  2F66 C;  2RNB A;  1AVM A;  2Y4T A;  3CB2 A;  1QVF U;  4DR7 B;  3OTF A;  4LFB O;  5B66 Z;  1JOY A;  1FKA O;  4DK0 A;  1LUW A;  4JI7 B;  2QKS A;  2Q73 A;  5DED A;  3LNN A;  2HP8 A;  5CN0 A;  2Q9L A;  4R7C A;  1YEW A;  5J2T B;  2BCC H;  2EIN B;  2W0X A;  4JZ2 A;  3A2F A;  1D5A A;  3CMA V;  3N2G B;  4JI5 O;  2YSU B;  5D5P A;  1SQX H;  2P7T C;  5KHG A;  2JIZ G;  4JAS A;  2ZIN A;  1ZUQ A;  1GN2 A;  5EC1 C;  2WA3 A;  4U7O A;  4PV1 B;  4JI4 B;  2PYJ A;  5EBM C;  3CSX A;  3T2M A;  1SES A;  2GUZ B;  5FNV A;  1CXZ B;  2JGD B;  5KX5 A;  3UM7 A;  2H94 A;  4LC1 A;  3KKY A;  4K8X A;  1KBH A;  3M99 B;  4JI2 O;  2O57 A;  2EIL C;  1VQ7 V;  2UXD B;  2DQ0 A;  2ZKO A;  3C90 A;  2P4K A;  3HKD A;  3AK3 A;  2OCC C;  2UUA O;  2VWJ A;  4LF4 O;  2ZM6 B;  1NR7 A;  1U96 A;  3JD3 A;  1SQQ H;  3SJB C;  4Z2W A;  2BTO A;  1G6U A;  1Q3E A;  3OM3 B;  2L6L A;  3JAK B;  1EZV H;  4ZOL A;  5JQG B;  1JJ2 U;  2UXC O;  2MK3 A;  2Y69 B;  4RWU A;  3IC7 A;  3SPI A;  2JRI A;  4BR6 A;  1AI5 A;  4NTY A;  5GON A;  1FXH A;  1YI2 V;  4H37 A;  4DW1 A;  4B3S O;  4FZ0 A;  3BAA A;  3LSQ A;  3SJQ C;  2E75 B;  3F5W C;  3NXS A;  1Q6U A;  2B1I A;  2ATK C;  1AR5 A;  2WLK A;  4YHH B;  2WLN A;  3ABK B;  1Y76 B;  2F93 B;  4NB5 A;  4BIU A;  2JEX A;  4DV7 B;  4RQF A;  3AG2 B;  2QM4 A;  1IXB A;  3T4D A;  3ZN1 A;  4GT1 A;  4MVZ A;  3JAR A;  1XEQ A;  5BMV B;  3W7T A;  5C8Y A;  1P84 F;  3A8T A;  4UVB A;  4FK5 C;  4G28 B;  3JAL A;  1MSW D;  4PD4 F;  3FKS G;  2HKO A;  4FFB B;  1BHB A;  3OMA B;  3EHB B;  3F7Y C;  1NQT A;  1FS0 G;  4UCU A;  5B3S C;  4DXW A;  5H6R A;  3AG7 A;  4CS3 A;  2KB1 A;  4B7K A;  5D5Q A;  2KG7 A;  3AK2 A;  4TQD A;  2RN9 A;  1BQ0 A;  2ZE6 A;  3A0H Z;  1SKV A;  4MVR A;  4FLX A;  4X1Y B;  1FFX B;  5IT9 N;  4TSF G;  1M56 B;  3BVO A;  4I50 B;  2P06 A;  3LDC A;  4UCR A;  2YIB A;  3JD4 A;  1V54 C;  1Y4M A;  3ASO C;  4BIO A;  1YJN V;  4X20 B;  2WLJ A;  2D3O W;  3H01 A;  3QNE A;  1FPO A;  1PP9 H;  4O4J B;  4QNH B;  2XHB A;  1ZX3 A;  3ABL B;  1A32 A;  5IJ9 A;  1NKD A;  1NBM G;  1RSO A;  4ABM A;  3QTC A;  4D7T A;  5AG2 A;  2BOC C;  1TGO A;  4EFB A;  2JVD A;  4J9Z B;  2CH7 A;  1K92 A;  5IYB O;  4AHC A;  1ZL8 B;  4JAU A;  3J80 N;  3U11 A;  4LP8 A;  4J7Z A;  2Y4U A;  4PHZ A;  1URF A;  3BPZ A;  5HFL A;  1VQL V;  1GM9 A;  4GCZ A;  2Z5U A;  2CTP A;  3ZRV A;  3L74 H;  3CPW U;  4DV2 B;  2OIG A;  4XBF A;  5LBQ A;  4MS2 A;  4FLT A;  2Q8V A;  4HNA A;  4NXM O;  1XDC A;  4X66 O;  1PNL A;  4BIZ A;  4H13 B;  5IWA B;  2Q5Z A;  4PA9 A;  2ZQM A;  2QA4 V;  4UCT A;  1XMO O;  1NZ6 A;  1EN5 A;  1R6N A;  4LF9 O;  1N33 O;  4UVC A;  2GBO A;  1S76 D;  3HB3 B;  3WFV A;  3E8G A;  1YTF D;  3G67 A;  2JS3 A;  3G6E V;  3B77 A;  2X6C A;  1ENV A;  1I94 O;  2JDI G;  4JV5 B;  2ZDI C;  3OUS A;  1VF7 A;  3CCE V;  4K8Z A;  2ZR3 A;  3SPC A;  3L9D A;  3OFN G;  5IYD O;  2OYQ A;  1WJZ A;  1DF4 A;  3FFQ A;  1Y74 A;  3OUF A;  4WFG A;  1SZX A;  1Q43 A;  2JK5 C;  4NTX A;  4J10 A;  1W0K G;  4LF8 O;  1FJG B;  3LDD A;  4DV6 B;  2LGQ A;  1EN4 A;  4RUE A;  1NTM H;  1FXV A;  1IDS A;  3HKE B;  1THZ A;  3IC9 A;  2HFE C;  1VQ6 V;  1R1B A;  2X6B A;  4DUY B;  1XUQ A;  4LFA B;  1F51 A;  5KX5 B;  3M8A A;  5CBH A;  3U10 A;  5EIB D;  1XOU A;  4MW3 A;  3QO7 A;  3ZMU A;  1JVM A;  1JFF B;  3HKD B;  1QQC A;  1PD3 A;  3UQ8 A;  3JCU Z;  4LF6 O;  2IBZ H;  1XL6 A;  4WFB V;  4J9Y B;  3BAB A;  1AJP A;  4UCV A;  2QKA A;  1IUR A;  1HNX O;  1VQP V;  1P49 A;  3AEI A;  3JAM N;  3J81 N;  2UUC O;  1WPX A;  3D3I A;  1N0J A;  3UKM A;  4DR6 B;  4FMT A;  5GON B;  2HLD G;  2HVK C;  3D36 C;  1UJW B;  1IBK O;  2HHH B;  5LL6 Y;  4G27 B;  4MW8 A;  2KQX A;  3QO5 A;  3DSQ A;  3RBZ A;  1N36 B;  3N2G A;  4TWK A;  2IJJ A;  2IJK A;  2XAF A;  2HVJ C;  1G8M A;  4OX9 B;  1JR9 A;  1XMQ O;  3L71 H;  1Q81 W;  3T1H O;  1YIT V;  4DV4 O;  5EBW C;  2DWE C;  2QWP B;  3ABT A;  3JAR B;  5JCO A;  5L3C A;  2AZ0 A;  5LHG A;  1BZK A;  3LDE A;  1SC5 B;  2DW4 A;  1YJ9 V;  1TA8 A;  5C8Y B;  3P32 A;  4HYO A;  3RYF B;  5F2V O;  3BY6 A;  3JAL B;  1EFR G;  4YJ2 A;  4GYC B;  1BSM A;  3EXA A;  1TUB B;  2ZE7 A;  3TJT A;  2VWK A;  1CEZ A;  4PJ0 Z;  1N32 O;  2GHY A;  4LF5 O;  1K8A W;  3T1C A;  2KG7 B;  2MW2 B;  3ZRS A;  3RYI A;  4O2B A;  2OIE A;  2YI8 A;  5GW7 A;  3TXQ A;  4FLZ A;  5JQG A;  2JGU A;  4B3M O;  5KHK A;  4X89 A;  2EZO A;  3OD4 A;  1M57 B;  2B1G A;  1NH2 B;  3OAA G;  1US6 A;  2EIN C;  3P3N A;  5JVD B;  4F6R A;  1N4C A;  1MG1 A;  4P9O A;  2HG5 C;  4X1I A;  1WA8 B;  1YCI A;  2ZR2 A;  1OHH G;  1XNR B;  1SQP H;  3OTO O;  2FKX A;  4XDL A;  3VQY A;  4O4H A;  1IBL O;  2QWO B;  5IJ9 B;  5GTH Z;  4DYL A;  1RSO B;  2IW5 A;  3CJH A;  3IJ4 A;  4H33 A;  5FPR A;  5JCO C;  4CZZ A;  2CH7 B;  5LGT A;  4WFF A;  1E1R G;  3T4Z A;  2XND G;  5J2U B;  3ZRX A;  1AP6 A;  2D2C B;  2LW1 A;  4B3T B;  4N23 A;  3ZN0 A;  2YDE A;  1WAZ A;  1WPB A;  2ZE5 A;  1VQ9 V;  4ASU G;  5EC2 C;  1GAX A;  1K4D C;  3G4S V;  4EEQ A;  4TV9 A;  3ZRW B;  1GTO A;  4PA6 A;  2P5O A;  4X88 A;  1NR1 A;  4DO2 A;  2Y69 C;  1SQF A;  2C2A A;  4Z1V A;  1FFX A;  4FVM A;  1YVW A;  1KP2 A;  4QGP A;  3RYC A;  1VMG A;  1LUV A;  3FX7 A;  3ABU A;  2PUS A;  4IHJ A;  2UU9 B;  2ZNI A;  1PPJ H;  3CD6 V;  1HW7 A;  2QSA A;  3H1J H;  1L8D A;  1MA1 A;  3ZJZ A;  3IGA C;  1ZTE A;  4X20 A;  3D8C A;  3ABK C;  1R73 A;  4IGG A;  2AW9 A;  1Y74 B;  1VIB A;  3D3Q A;  3AG2 C;  3E86 A;  1FFT B;  3LSS A;  2Y0I A;  2B5U A;  3STZ C;  3JCZ A;  2UXB O;  1N34 B;  2ADQ B;  3L72 H;  3TET A;  1W0J G;  3Q4H B;  1SER A;  1B06 A;  3C3S A;  5FL7 G;  2R9I A;  2F95 B;  4UFZ A;  2QTS A;  2Y0P A;  4DRX A;  4JI8 O;  1JMK C;  1JJO A;  4MTF A;  1AR4 A;  1GK9 A;  4D6T H;  1L0N H;  5B1B B;  4X62 B;  3B8N A;  3CRR A;  2EIJ B;  4RUF A;  3IAY A;  1M56 C;  3SDL A;  3CC2 V;  1MSD A;  2WLI B;  3SJC C;  3LNM B;  1OCO B;  5EZY B;  4PEL A;  2QR4 A;  4B08 A;  3AG1 B;  4C7U A;  1FAF A;  2JS5 A;  3ABL C;  3TK1 A;  5L3B A;  3RT3 C;  2QTO A;  3OW2 U;  2EBO A;  1AB3 A;  4CC6 A;  5BR8 B;  5LMU O;  1K9M W;  1DGS A;  4X8A A;  2R9A A;  5DEC A;  1YZB A;  4X1K A;  5L3D A;  1YDX A;  5C93 A;  2ZIM A;  2ZT9 B;  2GTS A;  4NYK A;  4GKK O;  5LGN A;  4O4I A;  1XNQ O;  1K4C C;  3HKE A;  4H44 B;  3SPG A;  1YF2 A;  1QHT A;  4DR5 O;  4I5S A;  1BS3 A;  4JTA B;  1VP7 A;  1GN6 A;  3CCR V;  1F7Y A;  1I0H A;  2Q6A A;  2RCV A;  2N05 A;  2BE3 A;  2PY5 A;  2GSM B;  1HNZ B;  2Q0A A;  3ZHT A;  4YJ2 B;  2Q0O C;  1R6T A;  1QR9 A;  1JFF A;  2QM8 A;  2DWD C;  3OGI B;  2QJ1 A;  1J95 A;  4QE7 A;  5EYP A;  4KUM A;  3O9O A;  3RYI B;  3A0B Z;  4O2B B;  1P7B A;  4DR3 O;  4YIO A;  2RDC A;  1BL8 A;  1IX9 A;  2DN9 A;  3F7V C;  2EIM B;  4W4K A;  2ILM A;  2FB5 A;  4F6R B;  3GWK C;  3MHH C;  3CRA A;  4X1I B;  3ZIA G;  2RQ6 A;  4MTX A;  1AP5 A;  1HP8 A;  4IIJ A;  5KHH A;  2ITD C;  2DYR B;  4NTW A;  4JTC B;  4DUZ B;  4CH6 A;  4UV9 A;  4O4H B;  4NR1 A;  3K5M A;  2PTM A;  2Q7G A;  4PA7 A;  3DC5 A;  2YS8 A;  2XAJ A;  3MHS C;  2IJI A;  3CJH B;  1M93 A;  5H9C A;  4FLW A;  2UXN A;  2CTQ A;  2FL4 A;  3APO A;  4JPR A;  1SQV H;  1QBZ A;  3L73 H;  3BFR A;  3AG3 B;  4U3F H;  2NNU A;  4DR2 B;  1HR0 O;  1HNW O;  1DK1 A;  3MDS A;  5KAF Z;  3JD1 A;  1GO3 F;  1F4N A;  2Q68 A;  3ZX6 A;  4TUY B;  3RYF A;  1MZF A;  4YY3 B;  1AIL A;  1BCC H;  3CCL V;  3SGI A;  1TUB A;  4FLV A;  4P2Z A;  2XTA A;  1XQ8 A;  5IY5 B;  1AJN A;  1XL4 A;  4TV9 B;  1Z2G A;  2YXY A;  1BMF G;  3SYC A;  2FYU H;  5LYJ A;  1IBM O;  5EBL C;  4GX2 A;  2QKC A;  3APQ A;  4DV0 B;  3RYC B;  5JJJ B;  3UT5 B;  1MMM A;  4JI6 B;  5JVD A;  4IHJ B;  3K0D A;  3DXR A;  2Q69 A;  4JTD B;  4KHP O;  1WA8 A;  2FML A;  4B7E A;  2WLL B;  2WLH A;  3T1Y B;  4LNU A;  1KKD A;  4J41 A;  3MAQ A;  1MAB G;  2LJ2 A;  4X64 O;  2LO1 A;  4NXN B;  2UUB O;  1J5E B;  4RAI A;  3TCU A;  2W6J G;  4WCE V;  1QCE A;  1YSC A;  1NU1 H;  5LMN B;  3G71 V;  3K9A A;  4AQY B;  4HZ3 A;  3K0G A;  5J2U A;  2Z0A A;  3FB6 C;  3K04 A;  4B3R B;  4GKJ B;  1ARO P;  4WFE A;  1VQO V;  4MVU A;  1K33 A;  2IH1 C;  3K3W A;  1H2K A;  2A79 B;  1COW G;  2AGA A;  3SPH A;  1O9H A;  4ZI7 A;  4DRX B;  3I55 V;  3CME V;  3AK1 A;  4X65 O;  2DQ3 A;  2V7Q G;  2VQF B;  2VQE O;  3ZRW A;  4OXS A;  1S5H C;  1S0V A;  1M57 C;  4IYH A;  5IJ0 A;  3W7X A;  4K0K O;  1H8H G;  4JI0 B;  3VQW A;  5KA5 A;  2XAS A;  2G38 A;  4PI0 A;  1DF5 A;  1LNQ A;  1S72 V;  5A9G A;  1S77 D;  1NVP D;  2E5L B;  5HFM A;  1R6K A;  1Q82 W;  2ZD9 A;  4O2A A;  4JI3 O;  3CCU V;  4FM1 A;  1HWY A;  4FPP A;  1OJH A;  4LFB B;  4BW9 A;  1IVS A;  5K1P A;  4RQE A;  2A9H A;  1VQK V;  4DV3 O;  4LF7 O;  3OT7 A;  5CB4 A;  2Q67 A;  5KMG A;  2R9R B;  2W0F C;  3SR2 C;  3K59 A;  4LFC O;  3CCV V;  1QLE B;  4X1K B;  4JYB A;  2Z3Y A;  3ICX A;  2H3O A;  4PDR A;  1SQB H;  2EUL A;  3I5D A;  4JYA O;  3SYQ A;  4O4I B;  3TXS A;  1F23 A;  5FLX N;  1FXK B;  3AG4 B;  2JJ2 G;  3FYE B;  1R3K C;  3Q4H A;  4QPJ A;  4DV5 O;  5LP6 A;  2NLJ C;  2F23 A;  4XDJ A;  3SYO A;  1D5N A;  4I4T B;  4UB6 Z;  1JA8 A;  2K1E A;  1N34 O;  2X7R B;  3I56 V;  4JI2 B;  2OTJ V;  5K1X A;  3CWB H;  4CH3 A;  2JJ1 G;  1GM8 A;  4H0L B;  1Q6I A;  2E3C A;  4JI1 O;  5L3G A;  1PKX A;  5H5N A;  5EYP B;  1KEC A;  4U7N A;  2WLI A;  2UUA B;  5EZY A;  4LF4 B;  1KC8 W;  4JAA A;  1SET A;  4UCS A;  1K7D A;  1VF5 B;  1W2B U;  5ITZ B;  2UXC B;  1QLN A;  1AI6 A;  3STL C;  4DR4 O;  2LGW A;  4R6Z A;  1K5S A;  5IDJ A;  2HEP A;  1Q90 D;  3E83 A;  2CAZ C;  2F4V B;  2ARH A;  4DR7 O;  1OV9 A;  4NVP A;  4IIJ B;  1EN6 A;  1UFI A;  4JI7 O;  2P22 C;  1NI8 A;  3OR6 C;  4J7J A;  4B3S B;  3H1L H;  1H2N A;  1NTK H;  1BE3 H;  5J9P C;  3ZCC A;  4DV1 B;  1VQ5 V;  1AJQ A;  1DLB A;  2BSK A;  4J7K A;  2LQT A;  3K5O A;  3BCC H;  3K5N A;  5KUM A;  1R3J C;  4J11 A;  1RP3 B;  1GKF A;  1YTF B;  3L75 H;  3OEH G;  1P7G A;  2RJZ A;  2NR5 A;  4JI4 O;  5B1B C;  3WB2 A;  2EIJ C;  2CGN A;  4CBC A;  3E35 A;  2EIK B;  5JJN B;  1MOF A;  4LCU C;  3JAS A;  3K06 A;  1U97 A;  1OCO C;  2UXD O;  3AG1 C;  3ASN B;  3ZHV A;  1S5L Z;  5CA0 A;  5LYJ B;  3KCY A;  2ZM6 O;  3JD0 A;  3JAT B;  1Q6H A;  2AXT Z;  3JSN A;  1VEW A;  1L0L H;  2N74 A;  3CRM A;  3DXR B;  4ZIB A;  4LNU B;  1V55 B;  3B8M A;  2L35 A;  3EFF K;  3ETE A;  2P4V A;  5BZB A;  4GZR B;  1SA0 B;  5B1N A;  3A0R A;  4ICG A;  4LWS A;  4YHH O;  3WB1 A;  1IZ3 A;  3C3T A;  1MZE A;  5H6Q A;  5DM6 V;  4WF9 V;  2DOS A;  2E76 B;  4TUY A;  1WN7 A;  5B1A B;  5EK0 A;  2F43 G;  4DV7 O;  4TQF A;  3FB5 C;  4Z1M G;  3G6B A;  5CA3 A;  3H1K H;  1Z5V A;  4ZI7 B;  1MNG A;  5KUK A;  5IYC O;  1K34 A;  4WFH A;  5KHJ A;  3CCJ V;  2YXH A;  5IYZ A;  1BT8 A;  1SRY A;  4QE9 A;  4NXM B;  3ZS8 C;  4X66 B;  2ADP A;  4EFE A;  2WA4 A;  2EIM C;  2LP7 A;  4LBE C;  5L3F A;  5IJ0 B;  4Q20 A;  1XMO B;  2QE7 G;  1N33 B;  4LF9 B;  3WB0 A;  1OCZ B;  2CTR A;  1H8E G;  3UT5 A;  2DYR C;  3GWO A;  4GUN A;  2ITC C;  1RM1 B;  2DMX A;  4ZKI A;  1Y67 A;  4O2A B;  4P9P A;  1TUE B;  2WLL A;  1I94 B;  1X59 A;  5JJE B;  1PM9 A;  5CB4 B;  5KMG B;  4QPK A;  2P90 A;  2E74 B;  1VQM V;  3AG3 C;  1AI7 A;  2AHY A;  2DYS B;  1BGY H;  3P30 A;  1K5Q A;  3JD2 A;  1B3Q A;  1VQ8 V;  2OTL V;  2QDO A;  1Y6X A;  1PL4 A;  4LF8 B;  3CC7 V;  2A0L A;  1E1Q G;  4J80 A;  2CDY A;  1N0N A;  1VQ4 V;  3KCX A;  5LP6 B;  4CC5 A;  2YEV A;  5IY5 C;  4I9W A;  4I55 A;  3CYO A;  1LR1 A;  1I5Y A;  4QJF B;  1WP8 A;  3LSU A;  1D2D A;  3ZHQ A;  1H38 A;  1F4M A;  3RFR A;  3CEI A;  1GRJ A;  1KYO F;  1XBL A;  4F4L A;  3QVN A;  1BHA A;  4DV2 O;  1IXM A;  4X9Q A;  3K9S A;  3E22 A;  2IJH A;  4LR3 A;  4LF6 B;  2CUG A;  5IWA O;  3ZMS A;  5CBF A;  1I08 A;  1NS1 A;  2CK3 G;  2PI5 A;  1HNX B;  1KU9 A;  2UUC B;  4JYC A;  3RW0 A;  1X4T A;  4MVM A;  2B9Z A;  3VBB A;  2HR3 A;  3UO3 A;  1AR1 B;  1OCR B;  3W7U A;  4NKG B;  2Y48 A;  4JV5 O;  4L8J A;  1IBK B;  1GH6 A;  3RGB A;  4I9Q A;  3ABM B;  2BSK B;  4IYI A;  1FXK A;  1WLE A;  1JQ0 A;  1XMQ B;  1O9G A;  1FJG O;  3ETQ A;  4DV6 O;  1KUQ A;  4FIP C;  4I4T A;  4CS4 A;  3T1H B;  1ROP A;  2YIC A;  3ML0 A;  5CA1 A;  1YJW V;  3FAV A;  4DV4 B;  3CC4 V;  4CS2 A;  1GN4 A;  4W4L A;  1KMI Z;  3BRC A;  4DUY O;  3VQV A;  4GLX A;  4LFA O;  3MD0 A;  3QF7 A;  3JAS B;  3F5T A;  3OR7 C;  2V4D A;  4AIL C;  3DGE A;  4OPH A;  3J7A U;  1N32 B;  1Y66 A;  1SS3 A;  4LF5 B;  2ODM A;  5CA0 B;  1G1X B;  2A7W A;  1KP3 A;  1SF9 A;  1K97 A;  3GVM A;  4K35 A;  3CCQ V;  5ITZ A;  2A3Q A;  1QLE C;  1K3E A;  3CHX A;  4B3M B;  1M1K W;  1R3I C;  2YID A;  4PA3 A;  5JH7 A;  3HPL C;  4RO2 A;  4DR6 O;  1FXK C;  3AG4 C;  3OTO B;  3ZBH A;  2HHH O;  3CP1 A;  2F4V O;  4KXR A;  1IBL B;  4TOI A;  2KKW A;  4ZHQ A;  4TV8 A;  2XT9 A;  1N36 O;  1R3L C;  4LWS B;  3RYH A;  3B2E E;  4A5U B;  3JAW A;  4U3J A;  3ZHR A;  4TT3 G;  3RWR D;  5JWP A;  4DV1 O;  4DR1 B;  4OX9 O;  3H1H H;  3FD9 A;  3SYP A;  1B04 A;  3WG7 B;  2A06 H;  3X2Q B;  3GB7 C;  3FYI B;  1GM7 A;  2LFR A;  2F1M A;  5IYZ B;  5E79 Z;  2LW7 A;  5CMU A;  1ZWI C;  4FM2 A;  1VAR A;  1WNS A;  2K9P A;  1M5I A;  4DK1 A;  1UPG A;  1B6Q A;  1H2S B;  3BHP A;  1OCC B;  5LA6 A;  2R72 A;  5LXT B;  3JAT A;  4G2K A;  1RFY A;  1M90 W;  3UCS C;  3K58 A;  2YIA A;  2BTQ A;  4YJ3 A;  1FYJ A;  3ZED A;  2WPD G;  3HKC A;  5E1A C;  2QM7 A;  3B4S A;  3W7S A;  4CH4 A;  2V1D A;  2HJF C;  5TIS Z;  3CS5 A;  4GX5 A;  1S5J A;  1QNM A;  1SA0 A;  2W6I G;  1NJI W;  1XNR O;  3NR7 A;  3E8H A;  3K5L A;  3CX5 F;  4FLU A;  2ZIO A;  1S3J A;  2ZDI A;  4R8C A;  2UXB B;  2EIK C;  3DC6 A;  3THO A;  1GN3 A;  3E89 A;  3VOU A;  1VF6 A;  2EJR A;  5GTI Z;  3PJS K;  2YUA A;  2YEV B;  4I55 B;  3BA8 A;  2JEU A;  3ASN C;  4D7S A;  1Q86 W;  4B3T O;  2CE4 A;  3OGC C;  3UO2 A;  4JI8 B;  1PNK A;  2M6Y A;  1GMG A;  3HKB B;  3ZMV A;  3HR0 A;  2ZNJ A;  2OCH A;  1RPR A;  2RMK B;  4J42 A;  2N04 A;  4QIW F;  1QVG U;  2X0L A;  1XRE A;  3CRC A;  5LHH A;  1BQZ A;  3K03 A;  3E22 B;  5LHI A;  4FZ1 A;  4UUJ C;  1W59 A;  5EIB C;  4I0X B;  1WB7 A;  1V55 C;  5IE9 A;  2EIL B;  3CCS V;  2R70 A;  4YIP A;  4EB6 A;  4UCO A;  4KFM A;  4O4L B;  2EJ7 A;  4OPA A;  5LGU A;  4E2L A;  2IH3 C;  4LH7 A;  2QWR B;  4BAY A;  4OGQ B;  2UU9 O;  1SZT A;  2OCC B;  5LOV A;  5LMU B;  3EVK A;  1V9P A;  1QU7 A;  1PV0 A;  3SYA A;  4AI8 A;  3K08 A;  4WBN A;  3ETD A;  3KZI Z;  4JYY A;  5B1A C;  4MVS A;  4JI5 B; 
#chains in the Genus database with same CATH homology
 3F5T A;  2N74 A;  1IBK O;  1XMO O;  4JI1 O;  4DV0 O;  5LL6 Y;  1XEQ A;  4LF9 O;  1N33 O;  5BY1 A;  1HNZ O;  4OPH A;  5BXZ A;  3SDL A;  5H5N A;  3J7A U;  1FYJ A;  4JI6 O;  1G1X B;  4JI5 O;  2AGA A;  4X65 O;  1XMQ O;  1I94 O;  1XNR O;  3T1Y O;  1D2D A;  2VQE O;  2DJV A;  2Z0A A;  3T1H O;  4NXN O;  3RT3 C;  4YHH O;  4DR4 O;  1AB3 A;  4DV4 O;  1J5E O;  4DV2 O;  5LMU O;  1HR0 O;  1HNW O;  1DK1 A;  4DR7 O;  2DOS A;  1YZB A;  5LMN O;  4JI7 O;  4JI2 O;  4DR6 O;  4K0K O;  4AQY O;  5IT9 N;  4DV7 O;  1AIL A;  5IWA O;  4X62 O;  4LF8 O;  2ZKO A;  4B3R O;  2HHH O;  4GKK O;  1NS1 A;  4GKJ O;  1XNQ O;  2F4V O;  1N32 O;  4DR5 O;  4B3T O;  1R1B A;  4LF5 O;  1N36 O;  4DUZ O;  4JI3 O;  2UUA O;  4LF4 O;  4A5U B;  1F7Y A;  4DV1 O;  4OX9 O;  4DV3 O;  4LF7 O;  1IBM O;  1A32 A;  3M8A A;  4LFC O;  4JI4 O;  4JV5 O;  2VQF O;  2UXC O;  4B3M O;  5BR8 O;  4DR1 O;  4DR2 O;  4JYA O;  2JRI A;  1R6T A;  2UXB O;  5A2Q N;  4JI0 O;  3J80 N;  4KHP O;  5FLX N;  4YY3 O;  4B3S O;  4LF6 O;  2LW7 A;  2UXD O;  4OPA A;  4DV5 O;  1FJG O;  4DV6 O;  3OTO O;  1X59 A;  2FKX A;  1KUQ A;  4X64 O;  3O65 A;  4DR3 O;  2UU9 O;  2E5L O;  2UUB O;  1IBL O;  1HNX O;  1N34 O;  3JAM N;  3J81 N;  2UUC O;  4JI8 O;  2ZM6 O;  4DUY O;  4LFB O;  1FKA O;  4NXM O;  4LFA O;  4X66 O;  3R66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...