2UUCT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uucT00
4DR7T 5LMNT 4B3TT 1I94T 4K0KT 4LFCT 2UU9T 4LFAT 1HNXT 4DV7T 4NXMT 4JI3T 4X66T 1XNRT 4JI7T 4JI6T 2UUBT 4JI1T 2ZM6T 1N34T 5BR8T 4LFBT 2UUAT 4KHPT 1N33T 4JYAT 4LF7T 4DV4T 5LMUT 4X65T 4JI8T 4LF6T 4DUYT 3T1HT 4DR4T 2HHHT 2E5LT 4DR6T 4DR2T 4B3ST 2UUCT 4YHHT 1J5ET 4DV2T 4DV6T 3OTOT 1IBLT 4LF9T 4YY3T 2UXCT 1XMQT 4DR1T 4X62T 4DV0T 5IWAT 4LF4T 4LF8T 4DR5T 2F4VT 4B3RT 1XNQT 4AQYT 1IBMT 1XMOT 1N32T 4DV1T 1HR0T 4DUZT 4JI0T 4JV5T 1FJGT 4LF5T 4GKKT 2VQET 4JI2T 4JI5T 4B3MT 1HNZT 4DV3T 3T1YT 4X64T 4OX9T 4GKJT 1HNWT 1IBKT 4DV5T 4JI4T 1N36T 2UXDT 4DR3T 2UXBT 2VQFT 4NXNT
chains in the Genus database with same CATH superfamily
1T72A 2C5KT 1E1HB 2MPKA 3CPZA 2B1EA 2V8SV 1IJ5A 1XWMA 4QXHB 4EEDA 4ZZBA 3ZYLA 1I94T 1MIWA 2YU1A 4FI5A 4CN6A 4DO0A 4ILBA 2ZM6T 3AEBA 5J2UE 2UU9T 4AKHA 1Y64B 2C5JA 2YKSA 5JR9A 3N9OA 3VRBA 2CWOA 5FP3A 2WWVA 3WAJA 3RQWA 3MXZA 4U7YA 2PTFA 3Q5WA 1HCIA 5IHYA 2BG9A 3S4UA 4PJJA 2IIUA 4X66T 3TLSA 4UIGA 4YTPA 2ACXA 2LT3A 2XQYA 2V7IA 3W15B 3ZCIA 2K9AA 1UUSA 2WSSV 2YDRA 4JI6T 3C50A 4IHJE 5C3JA 4C90A 2WDRA 3UFGA 2JPFA 4JI1T 3PURA 4IE0A 4MBQA 3AE9A 3OYZA 2W0GA 2LSYA 4PFOA 2ODUA 3PDYA 2QRXA 3E08A 2M6BA 3EHZA 3CX6B 4HWHA 3TLVA 2LSGA 2DNXA 3FXEB 3QOFA 5AQVB 3UU8A 4LF7T 3AA7B 3TLUA 3JC6D 3MZKB 2BS4A 4UVBB 4CI3B 2VKHA 4DV4T 2FJBA 1YW0A 2D0TA 3CQXC 5HWYA 1YQ3A 2JQKA 3ANWA 5L4EA 4IL9A 4ASKA 4YSYA 1HFAA 2H89A 4CQIA 2EHOA 5ABHA 4HTEA 2HHHT 4DR4T 2CLYB 3G06A 4KHZF 4FJOA 3IBPA 2QYWA 4HFDA 2UUCT 1KK7A 3MJXA 3AAAB 4DR2T 4O4IE 5KX5E 2DHRA 2XQ9A 4TV9E 4DV6T 3GN5B 4ZI2C 1W09A 4JUYA 3SFEA 2Y6XA 4E7ZA 3O1HA 5AQRB 1T8BA 3RRWA 4UVAB 5HEHA 4IGUA 3ZC0A 5JDFA 4L9IA 4IDZA 3NWIA 5CGMA 3AA6B 4YLHA 3ZT5A 3FBLA 1KNPA 4TNVA 1SHZC 1WYCA 3AEDA 4PNIA 3ZJ1A 1YQ4A 2A72A 5LXTE 5ABEA 4PJNA 4CXYA 4X62T 2SPCA 2XAHB 3N2KE 3H37A 2XAGB 3BQIA 3FZMB 3ONLC 3QK6A 4X20E 3CQGB 1UCUA 2CXDA 2KNDA 4KBMB 4ILUA 4PAGA 4A5XA 3E22E 4ZI7E 4DR5T 1XNQT 3AECA 1X9BA 2VKJA 2EHOB 2VASA 3AE3A 1XMOT 4OYKA 4H9OC 3RHWA 3ZMUB 4A56A 2KINB 4DV1T 1N32T 2BDEA 2BBJA 3EVYA 5JDQA 1MNDA 3QUJA 5AQSB 3AE7A 4HFIA 4WNKA 3AA0B 5AQFB 4GYRA 2GK9A 3OJAA 5A1LA 1QSDA 2VQET 2A3DA 2BG9B 2XAFB 3FHNA 5JDNA 1LVFA 3AXJB 3C98B 4JI2T 2J4GA 2M67A 2XPKA 2NW7A 3LJCA 5L3CB 1VRBA 2A9UA 4EB6E 3F2EA 4U72A 1G73A 3O1JA 3ZT6A 3N9MA 4CZZB 1FEWA 3T1YT 5AQGB 4Z8XA 3PTRB 1VOMA 3KDSE 4O2AE 3QB5K 2E2AA 1B7TA 1IBKT 2I59A 4J2CA 2XQAA 4HGAA 1D0ZA 1T7SA 4AKIA 1E7PA 3C51A 2XAQB 4I43B 4IL4A 4EZHA 4X1IE 1OWAA 4V1Av 2PFVA 2V7LA 2UXDT 1EZ3A 2IUBA 3ZCJA 1IZNB 3LG7A 4GK5E 4DR3T 2CCQA 3C64A 2LOSA 5H6RB 4WBNE 2UXBT 2XSAA 2YDSA 1WCRA 4ZHQE 5L3EB 5HEUA 2ACZA 2VWAA 3B13A 4ILCA 4WBOA 5HXHA 2FJDA 2J1DG 2E9XD 4PJLA 5HEJA 2PBIA 1DU2A 2JQHA 5LG3A 2Y48B 3H3MA 4TWDA 3UFEA 1WRDA 3ZT7A 3EDVA 4MALA 5M4YA 4AQFA 1WR6A 2W63A 2WBLA 5LBQB 4AKGA 2XQ5A 3DP7A 3N9PA 4Z90A 4K0KT 4GYSA 2L9QA 5ABFA 3CK6A 5KDMC 4KX6A 2N2NA 5AQQB 4C91A 3L8RA 4TNWA 4UELA 3ZN0B 4AKLA 4OHFA 4PFPA 3CMLA 4JI3T 5L3FB 3LSVA 4ADZA 2LSJA 2L8KA 2BG9C 5F8PA 3ONXA 5EK3A 3SS1A 3TKLB 4KUMB 2XJ7A 3I0QA 5EZYE 4MFRA 2X9HA 3IEEA 3RF1A 3DJBA 3VR9A 2H88A 4H9RC 4F8HA 4AXPA 5BR8T 5J1GA 1YXRA 2AE9A 2DWGA 2YOEA 2LKHA 2V7MA 3AEFA 3PJAJ 4O4HE 1YKHB 4P0BA 4U3CA 5ABGA 4TN7B 1WYBA 3HKEE 4G63A 3UU3A 4EXTA 2NW9A 1ZKEA 3OYXA 4NPPA 2R6GF 4HFHA 5E0OA 4EIWA 3RC3A 4H63H 2RPAA 4TWFA 2N9DA 2DI4A 4A97A 3N9QA 2CM0A 3J7Yq 2HH7A 2WMOA 2E8IA 3GN5A 4I50E 3VKGA 4HE8A 3RH3A 4GK0E 5HAXA 2X9WA 2WS3A 3CX7B 3ZYKA 4DR6T 4HFEA 3P4PA 1OXZA 4HFVA 1BR2A 4B3ST 3EUHA 3UU5A 3P7IA 5L3BB 4YJ3E 3ZSTA 1M7KA 1OEDC 5AFUL 4YHHT 1J5ET 3PUGA 3BK9A 4BJNA 3A8YC 2K5BB 2CEAA 5L4HA 3X1DA 1BR0A 2ZMAA 4PW8A 1VCSA 2Y8DA 3ZEFB 2YDQA 5JTGA 2JMHA 3AE5A 2LKGA 3PUAA 3AA1B 3A5XA 4HFCA 5DABA 5HCMA 4DBRA 4JI7T 1US7B 4LF9T 2X66A 2XQ3A 5JQGE 2L3LA 5EK2A 2D0UA 4QXCB 2IHR1 1BR1A 1UX5A 2IAKA 3AVSA 2BBHA 3KV4A 4O4JE 3U78A 5L2LA 4QH5A 5CA1E 4DR1T 3UT5E 4DV0T 5AQMB 2IMLA 3J9X1 4BAYB 5IWAT 1MNEA 1Z0PA 5LCYA 2WU2A 4YJ2E 4LF8T 2V6YA 1KF6A 1FIOA 5LGUB 2C5IT 2QA7A 2UUAT 2NR4A 2JIWA 5LHGB 2J47A 5LJMA 4AQYT 3AVRA 4LMKA 4UF0B 1KEYA 5FXVA 2Q9QB 2QVAA 1KNRA 1MMDA 3VRAA 4IDPA 2PG8A 4IDNA 3AXJA 4AIUA 3HKDE 3NZQA 3TLWA 2FJEA 4DMWA 1NWMX 4DNDA 1FJGT 2P9BA 2M6IA 1E2AA 1GQEA 4H9SE 4TUYE 4IE7A 5FNVE 5AQNB 2HN1A 2MAWA 4PK5A 5JREA 1ZP0A 2X0YA 2NTXA 3RX6A 4JI5T 4EAHA 3AE1A 3K3OA 2AXDS 2XM2A 3UULA 4CXXA 4IE6A 2KXPB 2EHOD 5EK4A 3KV6A 2OV9A 1UGOA 3BQLA 3N5LA 3I1AA 3PUVF 2XQ4A 2WB5A 2IW5B 3ETVA 4QXBB 1OEDB 3FBZA 2K48A 2V7JA 3K3QC 3JADA 2ES0A 3N9LA 4WZXA 4JI4T 5FY0A 2V5DA 2ZM8A 1MMNA 2XASB 3I9WA 4JLEA 2CXFA 3UQ7A 2D9DA 3M65A 3PU8A 4XZCA 2Z6EA 4ZS3A 3RYHE 1V9DA 2IC6A 1LKXA 2RA1A 2WMNA 2XQ6A 3ONJA 4X1KE 3MK7C 3RIFA 5L47A 3UU6A 3HR0A 1MMAA 3RIUA 5LHHB 2V6XA 1XDOA 2LRKA 3PE0A 2D2SA 3K3NA 3N2GE 4TZ4C 2H7OA 1U5PA 3FZHB 3HI2A 3ZMSB 3NRYA 1HX1B 3AAIA 1HTJF 2K3WA 2X9YA 3T8OA 4ANJA 1UX4A 2CMRA 4DR7T 1MMGA 5LGNB 2XTLA 1X79A 3JCFA 2Q9QC 3QNUA 2ZM2A 3FXDB 3LBXB 3RGLA 2V7KA 3UQ4A 5AQKB 2BZBA 2VL8A 3Q2MA 4EEBA 4DV7T 4NXMT 5AQUB 3GA8A 2HPLA 4ZXLA 2V5CA 3RKOA 4QX7B 3PUSA 3RI5A 2E9XA 2I0MA 3N2OA 2NW8A 3QB5A 5TAOA 2CA5A 2VK9A 3CKDA 3RIUC 2LRLA 4DMVA 1S94A 5JH7E 1SE7A 4QH4A 3MA9A 2UXNB 1CUNA 5H6QB 1N34T 2DCFA 3FZFB 3O4XE 5JRCA 3EABA 2YK0A 4YSZA 2DWKA 2K24A 3NKZA 5LP6E 4WYVA 2UXXB 5HXRA 3WI3A 4NUVA 5ABFB 1OEDE 1D0XA 1IAPA 2JQQA 4P0AA 4X65T 1QLBA 2NOXA 3Q5EA 5KXJA 5FL0A 4JI8T 4L0RA 2W00A 2YU2A 3E0ZA 3KV9A 4G2AA 4UV9B 5AQHB 5LJNA 3IA3A 3M3ZB 4UV8B 3K8PC 3GWHA 1L0VA 3CX8B 2XUEA 3EAMA 3ZN1B 2WM9A 1NENA 4HWFA 3PU3A 2N1GA 4YHJA 2BKNA 4LMJA 5HEGA 5LGTB 4QX8B 3AEGA 2W67A 3RPUA 4DV2T 2VB6A 2G0UA 2XSBA 3NVOA 3CVRA 3OBVE 2DLRA 5CA0E 4HEAA 4O8SA 3UUMA 3ZMVB 2BS2A 5FXWA 3NZPA 2LLYA 3V5UA 3HKBE 2FBWA 4EOZB 5AQIB 4N78D 1ZHCA 4ISTA 3OVUA 2JMKA 4K0UA 2WAUA 2LHRA 5ETWA 2WQYA 4Q25A 1Z8UA 3AE6A 3MACA 3VU7H 3UU4A 4GKKT 4YY3T 4XBFB 4B6XA 2MYSA 2OLTA 2MTQA 4MHCA 3TLTA 4I55E 4AKRB 5HYAA 4HWIB 5L3GB 4LF4T 5IYZE 1W0AA 5LB7B 3I0OA 3ZJ2A 1U4QA 3EDUA 1CHUA 2WCAA 2V1DB 4UR9A 5FXXA 2F4VT 3RIAA 3AE8A 5FYMA 3LK3B 3O9XA 3LK2B 3ESLA 4A98A 2XQ7A 3P4SA 1YD8G 4F6RC 1IBMT 4MLKA 3MKDA 3AE4A 3Q5XA 2X0HA 2X68A 3PUXF 4KP3C 1MIYA 3ABVA 4L5GA 4M1PA 5HCJA 3B57A 2LM2A 2VURA 1SA0E 4ZZCA 3P50A 4JEUB 5HXEA 4DUZT 1HR0T 4JI0T 3FZKB 1QUUA 1ZV4X 2KLQA 1D0YA 4LF5T 2PJQA 3L09A 3ZSSA 2NWBA 2KMFA 3AAEB 4IREA 3Q9DA 4B3MT 2YN6A 3VHLA 3ZMTB 1HNZT 4DV3T 2WY2A 4TX5A 1XZYA 5AQJB 3KINB 2CBIA 1HNWT 5LG4A 1HF8A 4ZEYA 5J2TE 2VVNA 4YFSA 3SOLA 3CQCB 4UVCB 4LFBT 1MIVA 2WZIA 5ADXL 2WDVA 4TWHA 3A7MA 4PK4A 2XY8B 2NTYA 4IE4A 3AEEA 4JBWF 2A2FX 5JR9B 3H3AA 2LM9A 2I6HA 2X0LB 2CHNA 2W62A 3FZLB 5DJQC 4ZI3C 3R84B 3UUXB 3KFWX 4OFZA 3N9NA 1H7CA 4NUUA 4YSXA 3C4WA 3L39A 2WDQA 1S35A 2J62A 3P8CD 4H9NC 3ZLIA 2QGSA 4U31A 4BA9A 4EYYR 3OKQA 2CWYA 4ISSA 2H7VC 5L3DB 3FB2A 4CXWA 4QHOA 2ODVA 5FY1A 3VR8A 5C8YE 2YEVC 1KFYA 3P4RA 3L3PA 4AQFC 2CBJA 2LOPA 5LMNT 1WLXA 3JAFA 1NEKA 4B3TT 2CPTA 4UXNB 2JJ9A 1HX8A 2KZ7B 5JR9C 3I9YA 4IDQA 3EI0A 2FUPA 4P1NA 4LFCT 1WR0A 2X51A 4P09A 4LFAT 3HA4A 3ZC1A 3C4ZA 1HNXT 4CI1B 2LEHA 3SWHA 1VCTA 3DTOA 5LNKA 3PV0F 1HG2A 4JEHB 5IUXA 2LE8A 4H9QC 1FMVA 1XNRT 4U2YA 2CXLA 3PJAA 4IIJE 4EV6A 1W9RA 2UUBT 2XQ8A 1JNRA 4IE5A 4XAXB 5LA6E 4H9PC 1Y01A 4ILAA 2E5VA 2BKOA 4U74A 3F57A 2XAJB 2YINA 5FXZA 4YXDA 2JQ9A 2XZEA 3PUWF 2X67A 3UUNA 4O4LE 2Q9QA 4I4TE 3KVBA 4UF0A 4ZOLE 4CI2B 4KHPT 1BR4A 5LOVE 2NP9A 5AQPB 3AEAA 1ZOYA 3KVAA 3RLFF 1NAFA 3PUQA 4GIWA 5HWXA 5JDLA 1N33T 4JYAT 1I6ZA 4EGWA 5FKYA 3V5SA 5LMUT 3CIRA 3Q5DA 5LBMA 2Q9QD 1D1CA 4HN9A 5JDGA 5FY7A 4DUYT 4LF6T 2EHOC 1HS7A 3T1HT 4HFBA 3F31A 3P4WA 4YTMA 1LRZA 4U2ZA 4QH1A 2E5LT 2CRBA 4NIQA 5HXCA 2MBGA 4WW0A 2WZHA 1D1BA 1M62A 2LHNA 3AB3B 3LDQB 3QC9A 4YT0A 5GONE 3ZKRA 2W2UA 3NRXA 3RRCA 4DVDA 4AI6A 4YTNA 3ANWB 4X5TA 4I0UA 2W66A 2XM1A 4COFA 5JRCB 1FMWA 3D0TA 1OEDA 2XHEB 3OTOT 1AJ3A 2KWIB 2LSIA 3C4XA 3KV5A 3KBTA 5BMVE 4U33A 4AISA 5CFBA 1IBLT 2KWHA 2KSRA 4DIDB 2KT9A 3B5MA 5J0ZA 4U7IA 3RYFE 2BVLA 4PJMA 4BJMA 4ZS2A 4CN4A 3PUZF 2W61A 3JAEA 2DL1A 2C0SA 4Z91A 1KNZA 2LJLA 1T98A 3UUBA 1W0BA 2UXCT 2CLYC 5HEOA 1XMQT 3RC8A 4IDOA 3HL6A 2OA5A 2X9XA 5JDMA 4LMLA 3U3IA 2BS3A 3LBXA 4QWNB 2WU5A 2IDOB 3OPCA 2IC9A 1J5WA 4IT4A 3ZMZB 3ZYMA 4B3RT 2MOZA 2CHOA 3CWZB 1O3XA 2V26A 2B76A 1UURA 1ZEEA 2CE7A 1WFDA 2BVMA 3IHRA 1LVKA 5C2TA 5KMGP 3PUYF 1D1AA 2VKDA 1UK5A 2BKPA 2V6YB 3K1SA 4E7SA 5LHIB 2D5UA 3VKHA 2W4XA 1J1JA 2HN2A 4JV5T 4QKNA 2JRKA 4DBQA 4AQGA 4CN1A 3O1IA 2H3RA 2E9XC 3AE2A 5F3JA 5FL1A 4PK6A 3IF8B 4X1YE 2RP4A 1SUMB 3LK42 3UTKA 1IJ6A 2ZM0A 5LYJE 5AQOB 3P4QA 3RQUA 4X64T 4OX9T 4GKJT 2FJAA 4KI0F 4UEMA 3RYIE 2VKOA 3HKCE 4ERRA 2ZLYA 4ZI3D 4HWDA 4OYJA 2WWUA 2WP9A 4HKAA 4HWCA 4O2BE 4DV5T 5JVDE 4EYUA 4TV8E 5CB4E 3RYCE 3WAKA 1JNZA 5AQLB 1N36T 4KMCA 4H63V 5FVLA 2HPJA 5CJ5A 1R8IA 2LSKA 3GMIA 5HXSA 3SFDA 3ZPOA 2VQFT 5FVKA 1XDPA 2BG9E 2E9XB 3KBUA 5DQVA 2VL0A 3NBXX 5AQTB 3ETUA 5DQWA 3SRZA 4EZ4A 5JDHA 1G8XA 4ZI2D 5F5WA 3BQKA 4GOUA 3JC6C 3LFMA 4NXNT 1YKEB 4OK0A 5FMNA 3R6NA 2VVSA 1HG5A 3RKGA
chains in the Genus database with same CATH topology
4DR7T 5LMNT 4B3TT 1I94T 4K0KT 4LFCT 2UU9T 4LFAT 1HNXT 4DV7T 4NXMT 4JI3T 4X66T 1XNRT 4JI7T 4JI6T 2UUBT 4JI1T 2ZM6T 1N34T 5BR8T 4LFBT 2UUAT 4KHPT 1N33T 4JYAT 4LF7T 4DV4T 5LMUT 4X65T 4JI8T 4LF6T 4DUYT 3T1HT 4DR4T 2HHHT 2E5LT 4DR6T 4DR2T 4B3ST 2UUCT 4YHHT 1J5ET 4DV2T 4DV6T 3OTOT 1IBLT 4LF9T 4YY3T 2UXCT 1XMQT 4DR1T 4X62T 4DV0T 5IWAT 4LF4T 4LF8T 4DR5T 2F4VT 4B3RT 1XNQT 4AQYT 1IBMT 1XMOT 1N32T 4DV1T 1HR0T 4DUZT 4JI0T 4JV5T 1FJGT 4LF5T 4GKKT 2VQET 4JI2T 4JI5T 4B3MT 1HNZT 4DV3T 3T1YT 4X64T 4OX9T 4GKJT 1HNWT 1IBKT 4DV5T 4JI4T 1N36T 2UXDT 4DR3T 2UXBT 2VQFT 4NXNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 T;  5LMN T;  4B3T T;  1I94 T;  4K0K T;  4LFC T;  2UU9 T;  4LFA T;  1HNX T;  4DV7 T;  4NXM T;  4JI3 T;  4X66 T;  1XNR T;  4JI7 T;  4JI6 T;  2UUB T;  4JI1 T;  2ZM6 T;  1N34 T;  5BR8 T;  4LFB T;  2UUA T;  4KHP T;  1N33 T;  4JYA T;  4LF7 T;  4DV4 T;  5LMU T;  4X65 T;  4JI8 T;  4LF6 T;  4DUY T;  3T1H T;  4DR4 T;  2HHH T;  2E5L T;  4DR6 T;  4DR2 T;  4B3S T;  2UUC T;  4YHH T;  1J5E T;  4DV2 T;  4DV6 T;  3OTO T;  1IBL T;  4LF9 T;  4YY3 T;  2UXC T;  1XMQ T;  4DR1 T;  4X62 T;  4DV0 T;  5IWA T;  4LF4 T;  4LF8 T;  4DR5 T;  2F4V T;  4B3R T;  1XNQ T;  4AQY T;  1IBM T;  1XMO T;  1N32 T;  4DV1 T;  1HR0 T;  4DUZ T;  4JI0 T;  4JV5 T;  1FJG T;  4LF5 T;  4GKK T;  2VQE T;  4JI2 T;  4JI5 T;  4B3M T;  1HNZ T;  4DV3 T;  3T1Y T;  4X64 T;  4OX9 T;  4GKJ T;  1HNW T;  1IBK T;  4DV5 T;  4JI4 T;  1N36 T;  2UXD T;  4DR3 T;  2UXB T;  2VQF T;  4NXN T; 
#chains in the Genus database with same CATH topology
 1T72 A;  2C5K T;  1E1H B;  2MPK A;  3CPZ A;  2B1E A;  2V8S V;  1IJ5 A;  1XWM A;  4QXH B;  4EED A;  4ZZB A;  3ZYL A;  1I94 T;  1MIW A;  2YU1 A;  4FI5 A;  4CN6 A;  4DO0 A;  4ILB A;  2ZM6 T;  3AEB A;  5J2U E;  2UU9 T;  4AKH A;  1Y64 B;  2C5J A;  2YKS A;  5JR9 A;  3N9O A;  3VRB A;  2CWO A;  5FP3 A;  2WWV A;  3WAJ A;  3RQW A;  3MXZ A;  4U7Y A;  2PTF A;  3Q5W A;  1HCI A;  5IHY A;  2BG9 A;  3S4U A;  4PJJ A;  2IIU A;  4X66 T;  3TLS A;  4UIG A;  4YTP A;  2ACX A;  2LT3 A;  2XQY A;  2V7I A;  3W15 B;  3ZCI A;  2K9A A;  1UUS A;  2WSS V;  2YDR A;  4JI6 T;  3C50 A;  4IHJ E;  5C3J A;  4C90 A;  2WDR A;  3UFG A;  2JPF A;  4JI1 T;  3PUR A;  4IE0 A;  4MBQ A;  3AE9 A;  3OYZ A;  2W0G A;  2LSY A;  4PFO A;  2ODU A;  3PDY A;  2QRX A;  3E08 A;  2M6B A;  3EHZ A;  3CX6 B;  4HWH A;  3TLV A;  2LSG A;  2DNX A;  3FXE B;  3QOF A;  5AQV B;  3UU8 A;  4LF7 T;  3AA7 B;  3TLU A;  3JC6 D;  3MZK B;  2BS4 A;  4UVB B;  4CI3 B;  2VKH A;  4DV4 T;  2FJB A;  1YW0 A;  2D0T A;  3CQX C;  5HWY A;  1YQ3 A;  2JQK A;  3ANW A;  5L4E A;  4IL9 A;  4ASK A;  4YSY A;  1HFA A;  2H89 A;  4CQI A;  2EHO A;  5ABH A;  4HTE A;  2HHH T;  4DR4 T;  2CLY B;  3G06 A;  4KHZ F;  4FJO A;  3IBP A;  2QYW A;  4HFD A;  2UUC T;  1KK7 A;  3MJX A;  3AAA B;  4DR2 T;  4O4I E;  5KX5 E;  2DHR A;  2XQ9 A;  4TV9 E;  4DV6 T;  3GN5 B;  4ZI2 C;  1W09 A;  4JUY A;  3SFE A;  2Y6X A;  4E7Z A;  3O1H A;  5AQR B;  1T8B A;  3RRW A;  4UVA B;  5HEH A;  4IGU A;  3ZC0 A;  5JDF A;  4L9I A;  4IDZ A;  3NWI A;  5CGM A;  3AA6 B;  4YLH A;  3ZT5 A;  3FBL A;  1KNP A;  4TNV A;  1SHZ C;  1WYC A;  3AED A;  4PNI A;  3ZJ1 A;  1YQ4 A;  2A72 A;  5LXT E;  5ABE A;  4PJN A;  4CXY A;  4X62 T;  2SPC A;  2XAH B;  3N2K E;  3H37 A;  2XAG B;  3BQI A;  3FZM B;  3ONL C;  3QK6 A;  4X20 E;  3CQG B;  1UCU A;  2CXD A;  2KND A;  4KBM B;  4ILU A;  4PAG A;  4A5X A;  3E22 E;  4ZI7 E;  4DR5 T;  1XNQ T;  3AEC A;  1X9B A;  2VKJ A;  2EHO B;  2VAS A;  3AE3 A;  1XMO T;  4OYK A;  4H9O C;  3RHW A;  3ZMU B;  4A56 A;  2KIN B;  4DV1 T;  1N32 T;  2BDE A;  2BBJ A;  3EVY A;  5JDQ A;  1MND A;  3QUJ A;  5AQS B;  3AE7 A;  4HFI A;  4WNK A;  3AA0 B;  5AQF B;  4GYR A;  2GK9 A;  3OJA A;  5A1L A;  1QSD A;  2VQE T;  2A3D A;  2BG9 B;  2XAF B;  3FHN A;  5JDN A;  1LVF A;  3AXJ B;  3C98 B;  4JI2 T;  2J4G A;  2M67 A;  2XPK A;  2NW7 A;  3LJC A;  5L3C B;  1VRB A;  2A9U A;  4EB6 E;  3F2E A;  4U72 A;  1G73 A;  3O1J A;  3ZT6 A;  3N9M A;  4CZZ B;  1FEW A;  3T1Y T;  5AQG B;  4Z8X A;  3PTR B;  1VOM A;  3KDS E;  4O2A E;  3QB5 K;  2E2A A;  1B7T A;  1IBK T;  2I59 A;  4J2C A;  2XQA A;  4HGA A;  1D0Z A;  1T7S A;  4AKI A;  1E7P A;  3C51 A;  2XAQ B;  4I43 B;  4IL4 A;  4EZH A;  4X1I E;  1OWA A;  4V1A v;  2PFV A;  2V7L A;  2UXD T;  1EZ3 A;  2IUB A;  3ZCJ A;  1IZN B;  3LG7 A;  4GK5 E;  4DR3 T;  2CCQ A;  3C64 A;  2LOS A;  5H6R B;  4WBN E;  2UXB T;  2XSA A;  2YDS A;  1WCR A;  4ZHQ E;  5L3E B;  5HEU A;  2ACZ A;  2VWA A;  3B13 A;  4ILC A;  4WBO A;  5HXH A;  2FJD A;  2J1D G;  2E9X D;  4PJL A;  5HEJ A;  2PBI A;  1DU2 A;  2JQH A;  5LG3 A;  2Y48 B;  3H3M A;  4TWD A;  3UFE A;  1WRD A;  3ZT7 A;  3EDV A;  4MAL A;  5M4Y A;  4AQF A;  1WR6 A;  2W63 A;  2WBL A;  5LBQ B;  4AKG A;  2XQ5 A;  3DP7 A;  3N9P A;  4Z90 A;  4K0K T;  4GYS A;  2L9Q A;  5ABF A;  3CK6 A;  5KDM C;  4KX6 A;  2N2N A;  5AQQ B;  4C91 A;  3L8R A;  4TNW A;  4UEL A;  3ZN0 B;  4AKL A;  4OHF A;  4PFP A;  3CML A;  4JI3 T;  5L3F B;  3LSV A;  4ADZ A;  2LSJ A;  2L8K A;  2BG9 C;  5F8P A;  3ONX A;  5EK3 A;  3SS1 A;  3TKL B;  4KUM B;  2XJ7 A;  3I0Q A;  5EZY E;  4MFR A;  2X9H A;  3IEE A;  3RF1 A;  3DJB A;  3VR9 A;  2H88 A;  4H9R C;  4F8H A;  4AXP A;  5BR8 T;  5J1G A;  1YXR A;  2AE9 A;  2DWG A;  2YOE A;  2LKH A;  2V7M A;  3AEF A;  3PJA J;  4O4H E;  1YKH B;  4P0B A;  4U3C A;  5ABG A;  4TN7 B;  1WYB A;  3HKE E;  4G63 A;  3UU3 A;  4EXT A;  2NW9 A;  1ZKE A;  3OYX A;  4NPP A;  2R6G F;  4HFH A;  5E0O A;  4EIW A;  3RC3 A;  4H63 H;  2RPA A;  4TWF A;  2N9D A;  2DI4 A;  4A97 A;  3N9Q A;  2CM0 A;  3J7Y q;  2HH7 A;  2WMO A;  2E8I A;  3GN5 A;  4I50 E;  3VKG A;  4HE8 A;  3RH3 A;  4GK0 E;  5HAX A;  2X9W A;  2WS3 A;  3CX7 B;  3ZYK A;  4DR6 T;  4HFE A;  3P4P A;  1OXZ A;  4HFV A;  1BR2 A;  4B3S T;  3EUH A;  3UU5 A;  3P7I A;  5L3B B;  4YJ3 E;  3ZST A;  1M7K A;  1OED C;  5AFU L;  4YHH T;  1J5E T;  3PUG A;  3BK9 A;  4BJN A;  3A8Y C;  2K5B B;  2CEA A;  5L4H A;  3X1D A;  1BR0 A;  2ZMA A;  4PW8 A;  1VCS A;  2Y8D A;  3ZEF B;  2YDQ A;  5JTG A;  2JMH A;  3AE5 A;  2LKG A;  3PUA A;  3AA1 B;  3A5X A;  4HFC A;  5DAB A;  5HCM A;  4DBR A;  4JI7 T;  1US7 B;  4LF9 T;  2X66 A;  2XQ3 A;  5JQG E;  2L3L A;  5EK2 A;  2D0U A;  4QXC B;  2IHR 1;  1BR1 A;  1UX5 A;  2IAK A;  3AVS A;  2BBH A;  3KV4 A;  4O4J E;  3U78 A;  5L2L A;  4QH5 A;  5CA1 E;  4DR1 T;  3UT5 E;  4DV0 T;  5AQM B;  2IML A;  3J9X 1;  4BAY B;  5IWA T;  1MNE A;  1Z0P A;  5LCY A;  2WU2 A;  4YJ2 E;  4LF8 T;  2V6Y A;  1KF6 A;  1FIO A;  5LGU B;  2C5I T;  2QA7 A;  2UUA T;  2NR4 A;  2JIW A;  5LHG B;  2J47 A;  5LJM A;  4AQY T;  3AVR A;  4LMK A;  4UF0 B;  1KEY A;  5FXV A;  2Q9Q B;  2QVA A;  1KNR A;  1MMD A;  3VRA A;  4IDP A;  2PG8 A;  4IDN A;  3AXJ A;  4AIU A;  3HKD E;  3NZQ A;  3TLW A;  2FJE A;  4DMW A;  1NWM X;  4DND A;  1FJG T;  2P9B A;  2M6I A;  1E2A A;  1GQE A;  4H9S E;  4TUY E;  4IE7 A;  5FNV E;  5AQN B;  2HN1 A;  2MAW A;  4PK5 A;  5JRE A;  1ZP0 A;  2X0Y A;  2NTX A;  3RX6 A;  4JI5 T;  4EAH A;  3AE1 A;  3K3O A;  2AXD S;  2XM2 A;  3UUL A;  4CXX A;  4IE6 A;  2KXP B;  2EHO D;  5EK4 A;  3KV6 A;  2OV9 A;  1UGO A;  3BQL A;  3N5L A;  3I1A A;  3PUV F;  2XQ4 A;  2WB5 A;  2IW5 B;  3ETV A;  4QXB B;  1OED B;  3FBZ A;  2K48 A;  2V7J A;  3K3Q C;  3JAD A;  2ES0 A;  3N9L A;  4WZX A;  4JI4 T;  5FY0 A;  2V5D A;  2ZM8 A;  1MMN A;  2XAS B;  3I9W A;  4JLE A;  2CXF A;  3UQ7 A;  2D9D A;  3M65 A;  3PU8 A;  4XZC A;  2Z6E A;  4ZS3 A;  3RYH E;  1V9D A;  2IC6 A;  1LKX A;  2RA1 A;  2WMN A;  2XQ6 A;  3ONJ A;  4X1K E;  3MK7 C;  3RIF A;  5L47 A;  3UU6 A;  3HR0 A;  1MMA A;  3RIU A;  5LHH B;  2V6X A;  1XDO A;  2LRK A;  3PE0 A;  2D2S A;  3K3N A;  3N2G E;  4TZ4 C;  2H7O A;  1U5P A;  3FZH B;  3HI2 A;  3ZMS B;  3NRY A;  1HX1 B;  3AAI A;  1HTJ F;  2K3W A;  2X9Y A;  3T8O A;  4ANJ A;  1UX4 A;  2CMR A;  4DR7 T;  1MMG A;  5LGN B;  2XTL A;  1X79 A;  3JCF A;  2Q9Q C;  3QNU A;  2ZM2 A;  3FXD B;  3LBX B;  3RGL A;  2V7K A;  3UQ4 A;  5AQK B;  2BZB A;  2VL8 A;  3Q2M A;  4EEB A;  4DV7 T;  4NXM T;  5AQU B;  3GA8 A;  2HPL A;  4ZXL A;  2V5C A;  3RKO A;  4QX7 B;  3PUS A;  3RI5 A;  2E9X A;  2I0M A;  3N2O A;  2NW8 A;  3QB5 A;  5TAO A;  2CA5 A;  2VK9 A;  3CKD A;  3RIU C;  2LRL A;  4DMV A;  1S94 A;  5JH7 E;  1SE7 A;  4QH4 A;  3MA9 A;  2UXN B;  1CUN A;  5H6Q B;  1N34 T;  2DCF A;  3FZF B;  3O4X E;  5JRC A;  3EAB A;  2YK0 A;  4YSZ A;  2DWK A;  2K24 A;  3NKZ A;  5LP6 E;  4WYV A;  2UXX B;  5HXR A;  3WI3 A;  4NUV A;  5ABF B;  1OED E;  1D0X A;  1IAP A;  2JQQ A;  4P0A A;  4X65 T;  1QLB A;  2NOX A;  3Q5E A;  5KXJ A;  5FL0 A;  4JI8 T;  4L0R A;  2W00 A;  2YU2 A;  3E0Z A;  3KV9 A;  4G2A A;  4UV9 B;  5AQH B;  5LJN A;  3IA3 A;  3M3Z B;  4UV8 B;  3K8P C;  3GWH A;  1L0V A;  3CX8 B;  2XUE A;  3EAM A;  3ZN1 B;  2WM9 A;  1NEN A;  4HWF A;  3PU3 A;  2N1G A;  4YHJ A;  2BKN A;  4LMJ A;  5HEG A;  5LGT B;  4QX8 B;  3AEG A;  2W67 A;  3RPU A;  4DV2 T;  2VB6 A;  2G0U A;  2XSB A;  3NVO A;  3CVR A;  3OBV E;  2DLR A;  5CA0 E;  4HEA A;  4O8S A;  3UUM A;  3ZMV B;  2BS2 A;  5FXW A;  3NZP A;  2LLY A;  3V5U A;  3HKB E;  2FBW A;  4EOZ B;  5AQI B;  4N78 D;  1ZHC A;  4IST A;  3OVU A;  2JMK A;  4K0U A;  2WAU A;  2LHR A;  5ETW A;  2WQY A;  4Q25 A;  1Z8U A;  3AE6 A;  3MAC A;  3VU7 H;  3UU4 A;  4GKK T;  4YY3 T;  4XBF B;  4B6X A;  2MYS A;  2OLT A;  2MTQ A;  4MHC A;  3TLT A;  4I55 E;  4AKR B;  5HYA A;  4HWI B;  5L3G B;  4LF4 T;  5IYZ E;  1W0A A;  5LB7 B;  3I0O A;  3ZJ2 A;  1U4Q A;  3EDU A;  1CHU A;  2WCA A;  2V1D B;  4UR9 A;  5FXX A;  2F4V T;  3RIA A;  3AE8 A;  5FYM A;  3LK3 B;  3O9X A;  3LK2 B;  3ESL A;  4A98 A;  2XQ7 A;  3P4S A;  1YD8 G;  4F6R C;  1IBM T;  4MLK A;  3MKD A;  3AE4 A;  3Q5X A;  2X0H A;  2X68 A;  3PUX F;  4KP3 C;  1MIY A;  3ABV A;  4L5G A;  4M1P A;  5HCJ A;  3B57 A;  2LM2 A;  2VUR A;  1SA0 E;  4ZZC A;  3P50 A;  4JEU B;  5HXE A;  4DUZ T;  1HR0 T;  4JI0 T;  3FZK B;  1QUU A;  1ZV4 X;  2KLQ A;  1D0Y A;  4LF5 T;  2PJQ A;  3L09 A;  3ZSS A;  2NWB A;  2KMF A;  3AAE B;  4IRE A;  3Q9D A;  4B3M T;  2YN6 A;  3VHL A;  3ZMT B;  1HNZ T;  4DV3 T;  2WY2 A;  4TX5 A;  1XZY A;  5AQJ B;  3KIN B;  2CBI A;  1HNW T;  5LG4 A;  1HF8 A;  4ZEY A;  5J2T E;  2VVN A;  4YFS A;  3SOL A;  3CQC B;  4UVC B;  4LFB T;  1MIV A;  2WZI A;  5ADX L;  2WDV A;  4TWH A;  3A7M A;  4PK4 A;  2XY8 B;  2NTY A;  4IE4 A;  3AEE A;  4JBW F;  2A2F X;  5JR9 B;  3H3A A;  2LM9 A;  2I6H A;  2X0L B;  2CHN A;  2W62 A;  3FZL B;  5DJQ C;  4ZI3 C;  3R84 B;  3UUX B;  3KFW X;  4OFZ A;  3N9N A;  1H7C A;  4NUU A;  4YSX A;  3C4W A;  3L39 A;  2WDQ A;  1S35 A;  2J62 A;  3P8C D;  4H9N C;  3ZLI A;  2QGS A;  4U31 A;  4BA9 A;  4EYY R;  3OKQ A;  2CWY A;  4ISS A;  2H7V C;  5L3D B;  3FB2 A;  4CXW A;  4QHO A;  2ODV A;  5FY1 A;  3VR8 A;  5C8Y E;  2YEV C;  1KFY A;  3P4R A;  3L3P A;  4AQF C;  2CBJ A;  2LOP A;  5LMN T;  1WLX A;  3JAF A;  1NEK A;  4B3T T;  2CPT A;  4UXN B;  2JJ9 A;  1HX8 A;  2KZ7 B;  5JR9 C;  3I9Y A;  4IDQ A;  3EI0 A;  2FUP A;  4P1N A;  4LFC T;  1WR0 A;  2X51 A;  4P09 A;  4LFA T;  3HA4 A;  3ZC1 A;  3C4Z A;  1HNX T;  4CI1 B;  2LEH A;  3SWH A;  1VCT A;  3DTO A;  5LNK A;  3PV0 F;  1HG2 A;  4JEH B;  5IUX A;  2LE8 A;  4H9Q C;  1FMV A;  1XNR T;  4U2Y A;  2CXL A;  3PJA A;  4IIJ E;  4EV6 A;  1W9R A;  2UUB T;  2XQ8 A;  1JNR A;  4IE5 A;  4XAX B;  5LA6 E;  4H9P C;  1Y01 A;  4ILA A;  2E5V A;  2BKO A;  4U74 A;  3F57 A;  2XAJ B;  2YIN A;  5FXZ A;  4YXD A;  2JQ9 A;  2XZE A;  3PUW F;  2X67 A;  3UUN A;  4O4L E;  2Q9Q A;  4I4T E;  3KVB A;  4UF0 A;  4ZOL E;  4CI2 B;  4KHP T;  1BR4 A;  5LOV E;  2NP9 A;  5AQP B;  3AEA A;  1ZOY A;  3KVA A;  3RLF F;  1NAF A;  3PUQ A;  4GIW A;  5HWX A;  5JDL A;  1N33 T;  4JYA T;  1I6Z A;  4EGW A;  5FKY A;  3V5S A;  5LMU T;  3CIR A;  3Q5D A;  5LBM A;  2Q9Q D;  1D1C A;  4HN9 A;  5JDG A;  5FY7 A;  4DUY T;  4LF6 T;  2EHO C;  1HS7 A;  3T1H T;  4HFB A;  3F31 A;  3P4W A;  4YTM A;  1LRZ A;  4U2Z A;  4QH1 A;  2E5L T;  2CRB A;  4NIQ A;  5HXC A;  2MBG A;  4WW0 A;  2WZH A;  1D1B A;  1M62 A;  2LHN A;  3AB3 B;  3LDQ B;  3QC9 A;  4YT0 A;  5GON E;  3ZKR A;  2W2U A;  3NRX A;  3RRC A;  4DVD A;  4AI6 A;  4YTN A;  3ANW B;  4X5T A;  4I0U A;  2W66 A;  2XM1 A;  4COF A;  5JRC B;  1FMW A;  3D0T A;  1OED A;  2XHE B;  3OTO T;  1AJ3 A;  2KWI B;  2LSI A;  3C4X A;  3KV5 A;  3KBT A;  5BMV E;  4U33 A;  4AIS A;  5CFB A;  1IBL T;  2KWH A;  2KSR A;  4DID B;  2KT9 A;  3B5M A;  5J0Z A;  4U7I A;  3RYF E;  2BVL A;  4PJM A;  4BJM A;  4ZS2 A;  4CN4 A;  3PUZ F;  2W61 A;  3JAE A;  2DL1 A;  2C0S A;  4Z91 A;  1KNZ A;  2LJL A;  1T98 A;  3UUB A;  1W0B A;  2UXC T;  2CLY C;  5HEO A;  1XMQ T;  3RC8 A;  4IDO A;  3HL6 A;  2OA5 A;  2X9X A;  5JDM A;  4LML A;  3U3I A;  2BS3 A;  3LBX A;  4QWN B;  2WU5 A;  2IDO B;  3OPC A;  2IC9 A;  1J5W A;  4IT4 A;  3ZMZ B;  3ZYM A;  4B3R T;  2MOZ A;  2CHO A;  3CWZ B;  1O3X A;  2V26 A;  2B76 A;  1UUR A;  1ZEE A;  2CE7 A;  1WFD A;  2BVM A;  3IHR A;  1LVK A;  5C2T A;  5KMG P;  3PUY F;  1D1A A;  2VKD A;  1UK5 A;  2BKP A;  2V6Y B;  3K1S A;  4E7S A;  5LHI B;  2D5U A;  3VKH A;  2W4X A;  1J1J A;  2HN2 A;  4JV5 T;  4QKN A;  2JRK A;  4DBQ A;  4AQG A;  4CN1 A;  3O1I A;  2H3R A;  2E9X C;  3AE2 A;  5F3J A;  5FL1 A;  4PK6 A;  3IF8 B;  4X1Y E;  2RP4 A;  1SUM B;  3LK4 2;  3UTK A;  1IJ6 A;  2ZM0 A;  5LYJ E;  5AQO B;  3P4Q A;  3RQU A;  4X64 T;  4OX9 T;  4GKJ T;  2FJA A;  4KI0 F;  4UEM A;  3RYI E;  2VKO A;  3HKC E;  4ERR A;  2ZLY A;  4ZI3 D;  4HWD A;  4OYJ A;  2WWU A;  2WP9 A;  4HKA A;  4HWC A;  4O2B E;  4DV5 T;  5JVD E;  4EYU A;  4TV8 E;  5CB4 E;  3RYC E;  3WAK A;  1JNZ A;  5AQL B;  1N36 T;  4KMC A;  4H63 V;  5FVL A;  2HPJ A;  5CJ5 A;  1R8I A;  2LSK A;  3GMI A;  5HXS A;  3SFD A;  3ZPO A;  2VQF T;  5FVK A;  1XDP A;  2BG9 E;  2E9X B;  3KBU A;  5DQV A;  2VL0 A;  3NBX X;  5AQT B;  3ETU A;  5DQW A;  3SRZ A;  4EZ4 A;  5JDH A;  1G8X A;  4ZI2 D;  5F5W A;  3BQK A;  4GOU A;  3JC6 C;  3LFM A;  4NXN T;  1YKE B;  4OK0 A;  5FMN A;  3R6N A;  2VVS A;  1HG5 A;  3RKG A; 
#chains in the Genus database with same CATH homology
 4DR7 T;  5LMN T;  4B3T T;  1I94 T;  4K0K T;  4LFC T;  2UU9 T;  4LFA T;  1HNX T;  4DV7 T;  4NXM T;  4JI3 T;  4X66 T;  1XNR T;  4JI7 T;  4JI6 T;  2UUB T;  4JI1 T;  2ZM6 T;  1N34 T;  5BR8 T;  4LFB T;  2UUA T;  4KHP T;  1N33 T;  4JYA T;  4LF7 T;  4DV4 T;  5LMU T;  4X65 T;  4JI8 T;  4LF6 T;  4DUY T;  3T1H T;  4DR4 T;  2HHH T;  2E5L T;  4DR6 T;  4DR2 T;  4B3S T;  2UUC T;  4YHH T;  1J5E T;  4DV2 T;  4DV6 T;  3OTO T;  1IBL T;  4LF9 T;  4YY3 T;  2UXC T;  1XMQ T;  4DR1 T;  4X62 T;  4DV0 T;  5IWA T;  4LF4 T;  4LF8 T;  4DR5 T;  2F4V T;  4B3R T;  1XNQ T;  4AQY T;  1IBM T;  1XMO T;  1N32 T;  4DV1 T;  1HR0 T;  4DUZ T;  4JI0 T;  4JV5 T;  1FJG T;  4LF5 T;  4GKK T;  2VQE T;  4JI2 T;  4JI5 T;  4B3M T;  1HNZ T;  4DV3 T;  3T1Y T;  4X64 T;  4OX9 T;  4GKJ T;  1HNW T;  1IBK T;  4DV5 T;  4JI4 T;  1N36 T;  2UXD T;  4DR3 T;  2UXB T;  2VQF T;  4NXN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...