2UUCT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uucT00
1I94T 4DV5T 4JI6T 4K0KT 3OTOT 1J5ET 4JI1T 1HNWT 2UUAT 4YY3T 4GKKT 5IWAT 4X62T 4DV7T 4JI4T 4JI7T 2E5LT 2UUCT 4X64T 4DR3T 2UXBT 4NXMT 4LF8T 4B3ST 4DUYT 1N34T 3T1YT 1IBMT 4OX9T 4DR2T 2VQET 4DV3T 2HHHT 2UXCT 4LF7T 4LFAT 5BR8T 5LMNT 1FJGT 1N36T 4DV6T 5LMUT 1XNRT 1N33T 4DV1T 3T1HT 1IBLT 4B3TT 1N32T 4DR1T 2UU9T 2UXDT 4LF4T 4JI5T 4GKJT 4JV5T 4JI3T 1XMOT 4JI2T 4AQYT 1XNQT 4DR7T 1IBKT 4DR6T 4LF5T 4DR4T 1HNXT 4DV0T 4JI8T 2UUBT 4B3RT 1HR0T 2ZM6T 1HNZT 4JYAT 4DUZT 4LFCT 4LFBT 4JI0T 4LF9T 4X66T 1XMQT 4NXNT 4B3MT 4YHHT 4X65T 4DR5T 4LF6T 2VQFT 2F4VT 4DV2T 4DV4T 4KHPT
chains in the Genus database with same CATH superfamily
5ABHA 3MXZA 2NW8A 1G73A 4JI1T 5L2LA 1HNWT 3H3AA 3AE7A 4GKKT 2DNXA 2LKHA 1WYBA 2BG9C 4JI7T 3ETVA 1NWMX 4ILUA 1W9RA 4PAGA 1DU2A 2PBIA 3B13A 2MBGA 3P7IA 4UV9B 3O1JA 2AXDS 2WQYA 5LHIB 1N36T 2BG9A 5HAXA 4X1KE 2LSIA 4AKIA 2JMHA 3JC6D 2JQKA 1ZV4X 2X9YA 3MA9A 2H7OA 1OXZA 5FL1A 2W61A 4GIWA 2FJDA 4ZI2C 4JI3T 4HFHA 4BAYB 2LJLA 4UVCB 1UX5A 5AQKB 3LK42 2VURA 4KHZF 5DQWA 2WU2A 2QRXA 4DR4T 4HFVA 1BR2A 1HNZT 4WZXA 4B6XA 1MMDA 2L9QA 2P9BA 3RGLA 2ZM2A 4NXNT 2H7VC 3HL6A 2MAWA 3RPUA 4WNKA 1OEDC 3J9X1 2E8IA 2WMNA 1XDOA 2D0UA 5HXSA 2XM2A 1JNRA 2G0UA 2JPFA 2V7JA 4EEBA 4AKGA 4X64T 4CI3B 3EI0A 4HGAA 4DIDB 3T1YT 3FB2A 2UXNB 5LGUB 3SFDA 4YSXA 4LMKA 4OX9T 3GN5B 3OKQA 3C51A 1OEDA 2HHHT 2CMRA 1SUMB 3AVRA 4DV6T 1WRDA 3KBUA 5E0OA 2D2SA 2Y8DA 3NVOA 3RC3A 4JUYA 1N33T 1YQ3A 5FY7A 2XQ7A 1HS7A 2KWIB 3WAKA 5LG3A 1NEKA 4O8SA 2I6HA 3PUZF 4P1NA 5FP3A 4UEMA 2BG9E 3EVYA 4JEUB 3PURA 4GYRA 4UIGA 3K3OA 1ZOYA 3SS1A 4AQFA 5JRCA 3CQGB 3OBVE 1J1JA 4NUUA 3U3IA 1HG2A 4CXWA 3UU5A 2ZMAA 1YD8G 1HX8A 4X5TA 2X0HA 3ONXA 1I6ZA 4Z91A 5LB7B 3QK6A 4O2BE 3MKDA 2Y6XA 4UF0A 3A7MA 3R84B 4HFIA 3L39A 4X65T 4PNIA 3PUGA 2VQFT 2F4VT 1NENA 1ZHCA 2NTXA 5ADXL 3UFGA 2I59A 2CHOA 1JNZA 3CK6A 5HEUA 3UU3A 4YY3T 1KNZA 4IREA 3P4SA 2JMKA 4UVAB 2CPTA 4P09A 3FZHB 1BR1A 5LXTE 3OPCA 3AXJB 3DJBA 5AQIB 1MIWA 5LG4A 5AQQB 2WU5A 1KFYA 2PTFA 2XAGB 3RRCA 3ZYLA 2VB6A 4PJNA 5EK2A 3CQCB 3UU4A 2HPLA 2ZM0A 3AEGA 1XNRT 4X20E 3T1HT 3P4PA 1WYCA 3PDYA 5DABA 3DTOA 2LT3A 4PJMA 1OEDE 4JV5T 3GWHA 3PUWF 4YFSA 5AQNB 2PJQA 3LDQB 5FNVE 2LE8A 2IW5B 4OYJA 5BMVE 2L8KA 2BBJA 2V5DA 4MFRA 5JDNA 3KV5A 4BA9A 2X9WA 3UUXB 2V1DB 2JJ9A 4EIWA 2MTQA 4TV8E 4Z90A 3KV9A 2XQ4A 1MIYA 2ACXA 5FY1A 4G63A 3W15B 3K8PC 2NWBA 3CX6B 4X62T 4I50E 5AQRB 3AE9A 3N9PA 1E7PA 2LM9A 3VU7H 4JLEA 1D0YA 1M7KA 2BS2A 3AA0B 4HFBA 3JAFA 4DV3T 3KBTA 4FI5A 4P0BA 4DBRA 4LFAT 4LMLA 4JEHB 3RRWA 4QH1A 4U2YA 3PUXF 1MIVA 3BQKA 4DNDA 3RIUA 5LBMA 4DR1T 2UU9T 3ZT5A 2VKHA 4H9SE 4ZI3C 4AXPA 4IE5A 4U2ZA 3ZN1B 5HWXA 1LVKA 4QH4A 1OWAA 2VL0A 4AKHA 2W67A 1KK7A 2UUBT 3VR8A 4KP3C 3Q5XA 3AA6B 5LGNB 2JQQA 3GN5A 5FVLA 2KXPB 5LGTB 4ILBA 2KLQA 4I0UA 4HFCA 4UV8B 2PG8A 4HWCA 2NW9A 1VOMA 1J5ET 3P4QA 5JH7E 2IHR1 3AE5A 1KNPA 1YKEB 2FJEA 3RHWA 4HE8A 4ZZBA 4YJ3E 2XQ9A 1X9BA 2YEVC 3F57A 3HKCE 2OLTA 3AEEA 3ETUA 3P8CD 3E08A 1HX1B 3KINB 2KINB 1QUUA 2D5UA 2HN1A 4XZCA 4A98A 2QA7A 1B7TA 2CRBA 5LMNT 2XM1A 5KX5E 3RYCE 3ZCIA 5C3JA 4BJNA 3UU6A 3BQLA 2E5VA 2K5BB 4QX7B 4DV1T 3PU8A 3AE3A 3N2OA 5L3FB 2K9AA 1WLXA 4L0RA 2YDSA 5CGMA 4GKJT 1CUNA 2WDVA 2WBLA 2XQ3A 3NZPA 5C8YE 4ZI7E 3HKDE 1UURA 4UELA 3ZLIA 4CXYA 3AXJA 3ESLA 2ZM6T 4QXCB 3KVAA 5ETWA 4CXXA 4TN7B 3IEEA 4LF9T 2X51A 2V7IA 2V7LA 3KV4A 4Z8XA 3ZMTB 4DV5T 4K0KT 5JDHA 3A8YC 3PUQA 3HA4A 3RQWA 3OYXA 3ZT6A 3AA1B 3TLTA 3IF8B 1HF8A 1S94A 4ZI2D 1BR4A 4XBFB 2UXBT 2XASB 4B3ST 3LJCA 1N34T 2WDRA 2XSBA 1VCTA 3MK7C 2CM0A 1YKHB 3KV6A 2VQET 2J4GA 2LOPA 4F8HA 2I0MA 3UUBA 3I0QA 2WWVA 4U7YA 4WBOA 3F2EA 4V1Av 4QHOA 2VKJA 3BK9A 3E22E 3SRZA 3RIAA 1D1CA 4X1IE 2V7MA 1MMNA 2N9DA 1XWMA 2E9XC 5JDMA 2IIUA 2W2UA 4CN1A 3O1HA 2RA1A 2V6YA 3QUJA 4KUMB 3N9OA 3SWHA 4DV0T 4TWHA 2GK9A 5KDMC 4YLHA 2DHRA 4QKNA 4O4JE 3N2KE 3PV0F 2VVSA 2K48A 4QH5A 4KI0F 3NRXA 4X1YE 4KHPT 4HWIB 3H3MA 4I55E 3AAAB 2W63A 4IDQA 3VRBA 2MOZA 2YN6A 2H88A 3GMIA 3NBXX 2LRLA 2IAKA 3Q2MA 4U3CA 5FXZA 2XQ5A 3ZSSA 3RX6A 4EEDA 1S35A 1Y01A 4EZ4A 1HFAA 3UUMA 3ZJ2A 5LMUT 3MJXA 3ZSTA 5FXWA 2YINA 4YHJA 2QGSA 1L0VA 4Q25A 3ZMVB 3IBPA 3ZJ1A 4BJMA 3ONJA 4B3TT 4HWHA 4HFEA 2LHNA 4EV6A 2VKDA 2CA5A 3A5XA 4OFZA 4CI1B 3EABA 3JC6C 2C0SA 2X67A 2BKPA 5LJMA 5LYJE 4U31A 4H9PC 3UQ4A 4GK5E 2HPJA 4DMVA 5AQJB 1VRBA 3AEAA 3L3PA 1WFDA 4O4LE 4DMWA 2K3WA 2J47A 4DR5T 3VHLA 2KNDA 1UX4A 2WDQA 4ZS3A 2KT9A 3ZMSB 2BVMA 3HR0A 3OTOT 5HEGA 3UUNA 1BR0A 4ZS2A 2LLYA 5L3CB 4NUVA 2LSYA 4IIJE 2CWYA 2X9HA 4NXMT 2D9DA 5CFBA 2WZHA 4QXHB 3N9NA 2Q9QB 5AQMB 4CI2B 3TLVA 3X1DA 2W0GA 3PU3A 2M6IA 5HXCA 5J2TE 2LKGA 2IMLA 3LK2B 4H9QC 3N5LA 2EHOB 5J1GA 1U4QA 2DCFA 3UU8A 3H37A 2N2NA 4U74A 4LF4T 4OHFA 5AQTB 4LMJA 2LOSA 1FIOA 4C91A 2X66A 2B76A 3CX8B 4DVDA 3RYIE 2XQAA 3O4XE 2FUPA 3CVRA 1LKXA 2WP9A 4DO0A 2YDQA 5L4HA 3V5UA 3ABVA 2WSSV 3SOLA 2BVLA 3AAIA 2R6GF 5EK4A 2WZIA 3VKGA 4H9OC 3OJAA 1O3XA 3ZT7A 3JAEA 3Q9DA 2WS3A 3D0TA 2M6BA 1G8XA 4KBMB 4TUYE 5ABFB 3AE1A 3ZC1A 1LRZA 4ZXLA 4ZI3D 3PUVF 3ANWB 5LNKA 4LF8T 1FMWA 2MYSA 1T8BA 2N1GA 2BKNA 4HN9A 4NPPA 5JDLA 2WCAA 1MMAA 5C2TA 1CHUA 3AEBA 3HI2A 5F3JA 5BR8T 1KNRA 5AQOB 3ZN0B 2RPAA 5AQSB 3C4ZA 3Q5EA 2BS4A 2H89A 3ZYMA 3NZQA 2BKOA 4IDPA 5L47A 3PUSA 3NWIA 2E9XB 1R8IA 2WB5A 5HEJA 4PJLA 2XZEA 5JVDE 3VR9A 2V6XA 1KEYA 3KFWX 3UTKA 4WW0A 5AQGB 3LSVA 2M67A 5HYAA 4K0UA 4LF5T 2DLRA 1HNXT 2XHEB 5AQLB 2LHRA 1UCUA 2WWUA 4AQGA 5JTGA 4AIUA 4LF6T 3I9WA 3S4UA 5LHGB 2DI4A 3N9MA 3TLUA 1E1HB 4PJJA 4YJ2E 2FJAA 3UT5E 1T98A 3UULA 2E5LT 4DR3T 1FEWA 2LSKA 3AE4A 3ONLC 4TZ4C 5HXHA 4ILCA 3EDUA 4DR2T 3LBXB 2VK9A 3PE0A 3ZPOA 2XAHB 4XAXB 2WM9A 2DWGA 4AISA 4I43B 3CMLA 2YDRA 3TLWA 3MZKB 5HWYA 5LHHB 4HKAA 5AQHB 5CB4E 1GQEA 4E7ZA 2Q9QC 2OA5A 3P4WA 4AKRB 4IL9A 3O9XA 4EZHA 2XJ7A 1XZYA 4U72A 4WBNE 4GK0E 1XNQT 3VRAA 3Q5WA 5EK3A 5CA1E 2EHOC 5L3GB 4IDNA 1SA0E 1IAPA 2NTYA 4U33A 3RYHE 3FBLA 3ZCJA 4H9NC 3C4WA 2YKSA 5JDQA 4F6RC 1W0AA 5FXXA 2YU2A 3CIRA 5J0ZA 5LJNA 1I94T 4YTNA 4MALA 3G06A 4EB6E 2OV9A 4UF0B 3B57A 2NP9A 4IDZA 3FXEB 4DV7T 4YT0A 3N9LA 1D1BA 1MNDA 3HKEE 1MNEA 1UUSA 4DUYT 2CE7A 1U5PA 1HTJF 4NIQA 4QXBB 5HEHA 5TAOA 3P50A 2E2AA 4COFA 3QB5A 3PUYF 5JREA 3AE6A 2UXXB 3IA3A 5AFUL 4I4TE 4YSZA 4MLKA 4DBQA 3EAMA 2VL8A 3B5MA 3OVUA 2XAQB 3QB5K 4HFDA 3DP7A 4PK6A 2D0TA 2Y48B 5LA6E 2FBWA 2QVAA 1Y64B 1IBKT 2WAUA 4UXNB 3ANWA 2KSRA 2WY2A 4B3RT 2LEHA 4IE7A 4M1PA 3N2GE 5LBQB 2WMOA 4JYAT 1D0XA 2ZM8A 3FZFB 3ZKRA 2VASA 4DV2T 5LOVE 3AEDA 3HKBE 4PK4A 5JDGA 3LFMA 2LRKA 2V7KA 4JI4T 4N78D 5FMNA 2H3RA 3FZMB 2E9XA 5GONE 1IJ5A 3EHZA 5JR9B 2A3DA 5KMGP 4H63V 3UFEA 2QYWA 3E0ZA 1KF6A 2A72A 3MACA 2W00A 4HTEA 4KMCA 4O2AE 4LF7T 4H9RC 2DL1A 5FXVA 2CBIA 1MMGA 2SPCA 5AQUB 4YXDA 3PUAA 2JQHA 4EYUA 1N32T 1NAFA 4P0AA 2UXDT 4JI5T 2IUBA 4ILAA 4QWNB 3VKHA 4J2CA 3FHNA 4AKLA 4AQYT 3RYFE 4IHJE 4DR6T 2HH7A 2DWKA 5IYZE 3V5SA 4TV9E 2XTLA 3BQIA 5ABEA 5HEOA 1D1AA 2A9UA 4ADZA 2L3LA 3PJAJ 5JDFA 4TNVA 2JQ9A 4DUZT 2ES0A 2W4XA 4GOUA 2CXDA 3LBXA 3L09A 5AQVB 1LVFA 3C50A 2ODVA 4FJOA 1X79A 4ISSA 2XUEA 3K3NA 5A1LA 2AE9A 4EOZB 1QSDA 3NRYA 4YTMA 5FY0A 2X0LB 4PFOA 2W62A 1Z0PA 3CWZB 4AQFC 3AEFA 3RQUA 1HG5A 2FJBA 3ZMUB 1W0BA 5FKYA 1T7SA 3NKZA 5JQGE 2CEAA 1FJGT 2JRKA 2MPKA 2V5CA 1T72A 3J7Yq 3AAEB 4EAHA 5ABGA 3ZEFB 4E7SA 1YXRA 5FVKA 2CLYC 2X0YA 2BDEA 5H6QB 2YOEA 5CJ5A 3UQ7A 4DR7T 2V26A 4CZZB 2CHNA 1WCRA 2LM2A 1HR0T 3RKGA 1ZEEA 2KWHA 2CWOA 1Z8UA 4DV4T 5KXJA 4JI6T 2LSJA 3CKDA 1ZP0A 1SE7A 1YW0A 3C98B 5IUXA 2VWAA 4CN6A 3FZLB 4ISTA 4ERRA 3RIFA 3KVBA 3QNUA 4JBWF 2IC9A 3L8RA 4H63H 2XAJB 3FBZA 2X68A 4PK5A 3FZKB 2B1EA 3PJAA 4IE4A 1J5WA 2XQYA 1VCSA 3ZYKA 3TLSA 3C4XA 5IHYA 3ZMZB 3Q5DA 4O4IE 3WAJA 5FL0A 5JR9C 1IBLT 2IDOB 2JIWA 4U7IA 3R6NA 3RI5A 3AB3B 1US7B 3AECA 2C5KT 4ZOLE 2YU1A 3ZC0A 1AJ3A 3K3QC 4OYKA 4ZEYA 3RKOA 5AQPB 2NOXA 2C5IT 4JI8T 1ZKEA 2CXFA 5JR9A 3FXDB 2CBJA 5L4EA 2BG9B 4O4HE 1WR0A 4WYVA 2V6YB 3M65A 1XMQT 2HN2A 2BBHA 4YHHT 2KZ7B 3RIUC 3P4RA 3I0OA 5M4YA 2UUAT 1FMVA 2Q9QD 3OYZA 3PTRB 4ZHQE 4EGWA 1HCIA 4ANJA 1IJ6A 3I9YA 3K1SA 5HCMA 2VVNA 3I1AA 2EHOD 3SFEA 4KX6A 4TWDA 2UXCT 2NW7A 3WI3A 1XDPA 3O1IA 4C90A 5AQFB 5LCYA 2A2FX 1YQ4A 4TX5A 4AI6A 5J2UE 4L5GA 1EZ3A 3LK3B 4IGUA 5F8PA 1XMOT 4A5XA 4JI2T 5LP6E 3QOFA 3T8OA 2BS3A 4YTPA 2W66A 3F31A 1OEDB 1SHZC 3QC9A 1H7CA 3EUHA 1E2AA 3CX7B 4YSYA 2BZBA 4ZZCA 1UK5A 3RF1A 4X66T 3C64A 5L3BB 3N9QA 4B3MT 2ACZA 4A97A 2X9XA 3RH3A 1V9DA 2CCQA 5L3EB 2Q9QA 5IWAT 4IE6A 3AA7B 2J1DG 2J62A 4L9IA 2XAFB 3JADA 4EXTA 2PFVA 5DJQC 4EYYR 2UUCT 5JRCB 2C5JA 1M62A 3AE2A 5DQVA 1IBMT 1WR6A 1UGOA 2XY8B 2EHOA 4HWDA 4PFPA 4IDOA 4IL4A 3U78A 2Z6EA 3CPZA 2ZLYA 5L3DB 4G2AA 5FYMA 5EZYE 2E9XD 4ASKA 2XPKA 3RC8A 2LSGA 3KDSE 2CXLA 4CN4A 5F5WA 4A56A 2XQ8A 2NR4A 1IZNB 2VKOA 5HCJA 1QLBA 2V8SV 2CLYB 5HXRA 1W09A 4GYSA 2XSAA 2K24A 3GA8A 4MBQA 2ODUA 2IC6A 3AVSA 4OK0A 4TNWA 3LG7A 4QX8B 4UR9A 3IHRA 5CA0E 3EDVA 3M3ZB 4MHCA 5HXEA 2XQ6A 3TKLB 3JCFA 5H6RB 4CQIA 4IT4A 1D0ZA 4PW8A 4IE0A 4UVBB 4LFCT 4LFBT 4TWFA 2KMFA 4JI0T 2RP4A 2YK0A 4HEAA 4HWFA 3CQXC 3RLFF 5ABFA 3AE8A
chains in the Genus database with same CATH topology
1I94T 4DV5T 4JI6T 4K0KT 3OTOT 1J5ET 4JI1T 1HNWT 2UUAT 4YY3T 4GKKT 5IWAT 4X62T 4DV7T 4JI4T 4JI7T 2E5LT 2UUCT 4X64T 4DR3T 2UXBT 4NXMT 4LF8T 4B3ST 4DUYT 1N34T 3T1YT 1IBMT 4OX9T 4DR2T 2VQET 4DV3T 2HHHT 2UXCT 4LF7T 4LFAT 5BR8T 5LMNT 1FJGT 1N36T 4DV6T 5LMUT 1XNRT 1N33T 4DV1T 3T1HT 1IBLT 4B3TT 1N32T 4DR1T 2UU9T 2UXDT 4LF4T 4JI5T 4GKJT 4JV5T 4JI3T 1XMOT 4JI2T 4AQYT 1XNQT 4DR7T 1IBKT 4DR6T 4LF5T 4DR4T 1HNXT 4DV0T 4JI8T 2UUBT 4B3RT 1HR0T 2ZM6T 1HNZT 4JYAT 4DUZT 4LFCT 4LFBT 4JI0T 4LF9T 4X66T 1XMQT 4NXNT 4B3MT 4YHHT 4X65T 4DR5T 4LF6T 2VQFT 2F4VT 4DV2T 4DV4T 4KHPT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  4DV5 T;  4JI6 T;  4K0K T;  3OTO T;  1J5E T;  4JI1 T;  1HNW T;  2UUA T;  4YY3 T;  4GKK T;  5IWA T;  4X62 T;  4DV7 T;  4JI4 T;  4JI7 T;  2E5L T;  2UUC T;  4X64 T;  4DR3 T;  2UXB T;  4NXM T;  4LF8 T;  4B3S T;  4DUY T;  1N34 T;  3T1Y T;  1IBM T;  4OX9 T;  4DR2 T;  2VQE T;  4DV3 T;  2HHH T;  2UXC T;  4LF7 T;  4LFA T;  5BR8 T;  5LMN T;  1FJG T;  1N36 T;  4DV6 T;  5LMU T;  1XNR T;  1N33 T;  4DV1 T;  3T1H T;  1IBL T;  4B3T T;  1N32 T;  4DR1 T;  2UU9 T;  2UXD T;  4LF4 T;  4JI5 T;  4GKJ T;  4JV5 T;  4JI3 T;  1XMO T;  4JI2 T;  4AQY T;  1XNQ T;  4DR7 T;  1IBK T;  4DR6 T;  4LF5 T;  4DR4 T;  1HNX T;  4DV0 T;  4JI8 T;  2UUB T;  4B3R T;  1HR0 T;  2ZM6 T;  1HNZ T;  4JYA T;  4DUZ T;  4LFC T;  4LFB T;  4JI0 T;  4LF9 T;  4X66 T;  1XMQ T;  4NXN T;  4B3M T;  4YHH T;  4X65 T;  4DR5 T;  4LF6 T;  2VQF T;  2F4V T;  4DV2 T;  4DV4 T;  4KHP T; 
#chains in the Genus database with same CATH topology
 5ABH A;  3MXZ A;  2NW8 A;  1G73 A;  4JI1 T;  5L2L A;  1HNW T;  3H3A A;  3AE7 A;  4GKK T;  2DNX A;  2LKH A;  1WYB A;  2BG9 C;  4JI7 T;  3ETV A;  1NWM X;  4ILU A;  1W9R A;  4PAG A;  1DU2 A;  2PBI A;  3B13 A;  2MBG A;  3P7I A;  4UV9 B;  3O1J A;  2AXD S;  2WQY A;  5LHI B;  1N36 T;  2BG9 A;  5HAX A;  4X1K E;  2LSI A;  4AKI A;  2JMH A;  3JC6 D;  2JQK A;  1ZV4 X;  2X9Y A;  3MA9 A;  2H7O A;  1OXZ A;  5FL1 A;  2W61 A;  4GIW A;  2FJD A;  4ZI2 C;  4JI3 T;  4HFH A;  4BAY B;  2LJL A;  4UVC B;  1UX5 A;  5AQK B;  3LK4 2;  2VUR A;  4KHZ F;  5DQW A;  2WU2 A;  2QRX A;  4DR4 T;  4HFV A;  1BR2 A;  1HNZ T;  4WZX A;  4B6X A;  1MMD A;  2L9Q A;  2P9B A;  3RGL A;  2ZM2 A;  4NXN T;  2H7V C;  3HL6 A;  2MAW A;  3RPU A;  4WNK A;  1OED C;  3J9X 1;  2E8I A;  2WMN A;  1XDO A;  2D0U A;  5HXS A;  2XM2 A;  1JNR A;  2G0U A;  2JPF A;  2V7J A;  4EEB A;  4AKG A;  4X64 T;  4CI3 B;  3EI0 A;  4HGA A;  4DID B;  3T1Y T;  3FB2 A;  2UXN B;  5LGU B;  3SFD A;  4YSX A;  4LMK A;  4OX9 T;  3GN5 B;  3OKQ A;  3C51 A;  1OED A;  2HHH T;  2CMR A;  1SUM B;  3AVR A;  4DV6 T;  1WRD A;  3KBU A;  5E0O A;  2D2S A;  2Y8D A;  3NVO A;  3RC3 A;  4JUY A;  1N33 T;  1YQ3 A;  5FY7 A;  2XQ7 A;  1HS7 A;  2KWI B;  3WAK A;  5LG3 A;  1NEK A;  4O8S A;  2I6H A;  3PUZ F;  4P1N A;  5FP3 A;  4UEM A;  2BG9 E;  3EVY A;  4JEU B;  3PUR A;  4GYR A;  4UIG A;  3K3O A;  1ZOY A;  3SS1 A;  4AQF A;  5JRC A;  3CQG B;  3OBV E;  1J1J A;  4NUU A;  3U3I A;  1HG2 A;  4CXW A;  3UU5 A;  2ZMA A;  1YD8 G;  1HX8 A;  4X5T A;  2X0H A;  3ONX A;  1I6Z A;  4Z91 A;  5LB7 B;  3QK6 A;  4O2B E;  3MKD A;  2Y6X A;  4UF0 A;  3A7M A;  3R84 B;  4HFI A;  3L39 A;  4X65 T;  4PNI A;  3PUG A;  2VQF T;  2F4V T;  1NEN A;  1ZHC A;  2NTX A;  5ADX L;  3UFG A;  2I59 A;  2CHO A;  1JNZ A;  3CK6 A;  5HEU A;  3UU3 A;  4YY3 T;  1KNZ A;  4IRE A;  3P4S A;  2JMK A;  4UVA B;  2CPT A;  4P09 A;  3FZH B;  1BR1 A;  5LXT E;  3OPC A;  3AXJ B;  3DJB A;  5AQI B;  1MIW A;  5LG4 A;  5AQQ B;  2WU5 A;  1KFY A;  2PTF A;  2XAG B;  3RRC A;  3ZYL A;  2VB6 A;  4PJN A;  5EK2 A;  3CQC B;  3UU4 A;  2HPL A;  2ZM0 A;  3AEG A;  1XNR T;  4X20 E;  3T1H T;  3P4P A;  1WYC A;  3PDY A;  5DAB A;  3DTO A;  2LT3 A;  4PJM A;  1OED E;  4JV5 T;  3GWH A;  3PUW F;  4YFS A;  5AQN B;  2PJQ A;  3LDQ B;  5FNV E;  2LE8 A;  2IW5 B;  4OYJ A;  5BMV E;  2L8K A;  2BBJ A;  2V5D A;  4MFR A;  5JDN A;  3KV5 A;  4BA9 A;  2X9W A;  3UUX B;  2V1D B;  2JJ9 A;  4EIW A;  2MTQ A;  4TV8 E;  4Z90 A;  3KV9 A;  2XQ4 A;  1MIY A;  2ACX A;  5FY1 A;  4G63 A;  3W15 B;  3K8P C;  2NWB A;  3CX6 B;  4X62 T;  4I50 E;  5AQR B;  3AE9 A;  3N9P A;  1E7P A;  2LM9 A;  3VU7 H;  4JLE A;  1D0Y A;  1M7K A;  2BS2 A;  3AA0 B;  4HFB A;  3JAF A;  4DV3 T;  3KBT A;  4FI5 A;  4P0B A;  4DBR A;  4LFA T;  4LML A;  4JEH B;  3RRW A;  4QH1 A;  4U2Y A;  3PUX F;  1MIV A;  3BQK A;  4DND A;  3RIU A;  5LBM A;  4DR1 T;  2UU9 T;  3ZT5 A;  2VKH A;  4H9S E;  4ZI3 C;  4AXP A;  4IE5 A;  4U2Z A;  3ZN1 B;  5HWX A;  1LVK A;  4QH4 A;  1OWA A;  2VL0 A;  4AKH A;  2W67 A;  1KK7 A;  2UUB T;  3VR8 A;  4KP3 C;  3Q5X A;  3AA6 B;  5LGN B;  2JQQ A;  3GN5 A;  5FVL A;  2KXP B;  5LGT B;  4ILB A;  2KLQ A;  4I0U A;  4HFC A;  4UV8 B;  2PG8 A;  4HWC A;  2NW9 A;  1VOM A;  1J5E T;  3P4Q A;  5JH7 E;  2IHR 1;  3AE5 A;  1KNP A;  1YKE B;  2FJE A;  3RHW A;  4HE8 A;  4ZZB A;  4YJ3 E;  2XQ9 A;  1X9B A;  2YEV C;  3F57 A;  3HKC E;  2OLT A;  3AEE A;  3ETU A;  3P8C D;  3E08 A;  1HX1 B;  3KIN B;  2KIN B;  1QUU A;  2D5U A;  2HN1 A;  4XZC A;  4A98 A;  2QA7 A;  1B7T A;  2CRB A;  5LMN T;  2XM1 A;  5KX5 E;  3RYC E;  3ZCI A;  5C3J A;  4BJN A;  3UU6 A;  3BQL A;  2E5V A;  2K5B B;  4QX7 B;  4DV1 T;  3PU8 A;  3AE3 A;  3N2O A;  5L3F B;  2K9A A;  1WLX A;  4L0R A;  2YDS A;  5CGM A;  4GKJ T;  1CUN A;  2WDV A;  2WBL A;  2XQ3 A;  3NZP A;  5C8Y E;  4ZI7 E;  3HKD E;  1UUR A;  4UEL A;  3ZLI A;  4CXY A;  3AXJ A;  3ESL A;  2ZM6 T;  4QXC B;  3KVA A;  5ETW A;  4CXX A;  4TN7 B;  3IEE A;  4LF9 T;  2X51 A;  2V7I A;  2V7L A;  3KV4 A;  4Z8X A;  3ZMT B;  4DV5 T;  4K0K T;  5JDH A;  3A8Y C;  3PUQ A;  3HA4 A;  3RQW A;  3OYX A;  3ZT6 A;  3AA1 B;  3TLT A;  3IF8 B;  1HF8 A;  1S94 A;  4ZI2 D;  1BR4 A;  4XBF B;  2UXB T;  2XAS B;  4B3S T;  3LJC A;  1N34 T;  2WDR A;  2XSB A;  1VCT A;  3MK7 C;  2CM0 A;  1YKH B;  3KV6 A;  2VQE T;  2J4G A;  2LOP A;  4F8H A;  2I0M A;  3UUB A;  3I0Q A;  2WWV A;  4U7Y A;  4WBO A;  3F2E A;  4V1A v;  4QHO A;  2VKJ A;  3BK9 A;  3E22 E;  3SRZ A;  3RIA A;  1D1C A;  4X1I E;  2V7M A;  1MMN A;  2N9D A;  1XWM A;  2E9X C;  5JDM A;  2IIU A;  2W2U A;  4CN1 A;  3O1H A;  2RA1 A;  2V6Y A;  3QUJ A;  4KUM B;  3N9O A;  3SWH A;  4DV0 T;  4TWH A;  2GK9 A;  5KDM C;  4YLH A;  2DHR A;  4QKN A;  4O4J E;  3N2K E;  3PV0 F;  2VVS A;  2K48 A;  4QH5 A;  4KI0 F;  3NRX A;  4X1Y E;  4KHP T;  4HWI B;  3H3M A;  4I55 E;  3AAA B;  2W63 A;  4IDQ A;  3VRB A;  2MOZ A;  2YN6 A;  2H88 A;  3GMI A;  3NBX X;  2LRL A;  2IAK A;  3Q2M A;  4U3C A;  5FXZ A;  2XQ5 A;  3ZSS A;  3RX6 A;  4EED A;  1S35 A;  1Y01 A;  4EZ4 A;  1HFA A;  3UUM A;  3ZJ2 A;  5LMU T;  3MJX A;  3ZST A;  5FXW A;  2YIN A;  4YHJ A;  2QGS A;  1L0V A;  4Q25 A;  3ZMV B;  3IBP A;  3ZJ1 A;  4BJM A;  3ONJ A;  4B3T T;  4HWH A;  4HFE A;  2LHN A;  4EV6 A;  2VKD A;  2CA5 A;  3A5X A;  4OFZ A;  4CI1 B;  3EAB A;  3JC6 C;  2C0S A;  2X67 A;  2BKP A;  5LJM A;  5LYJ E;  4U31 A;  4H9P C;  3UQ4 A;  4GK5 E;  2HPJ A;  4DMV A;  5AQJ B;  1VRB A;  3AEA A;  3L3P A;  1WFD A;  4O4L E;  4DMW A;  2K3W A;  2J47 A;  4DR5 T;  3VHL A;  2KND A;  1UX4 A;  2WDQ A;  4ZS3 A;  2KT9 A;  3ZMS B;  2BVM A;  3HR0 A;  3OTO T;  5HEG A;  3UUN A;  1BR0 A;  4ZS2 A;  2LLY A;  5L3C B;  4NUV A;  2LSY A;  4IIJ E;  2CWY A;  2X9H A;  4NXM T;  2D9D A;  5CFB A;  2WZH A;  4QXH B;  3N9N A;  2Q9Q B;  5AQM B;  4CI2 B;  3TLV A;  3X1D A;  2W0G A;  3PU3 A;  2M6I A;  5HXC A;  5J2T E;  2LKG A;  2IML A;  3LK2 B;  4H9Q C;  3N5L A;  2EHO B;  5J1G A;  1U4Q A;  2DCF A;  3UU8 A;  3H37 A;  2N2N A;  4U74 A;  4LF4 T;  4OHF A;  5AQT B;  4LMJ A;  2LOS A;  1FIO A;  4C91 A;  2X66 A;  2B76 A;  3CX8 B;  4DVD A;  3RYI E;  2XQA A;  3O4X E;  2FUP A;  3CVR A;  1LKX A;  2WP9 A;  4DO0 A;  2YDQ A;  5L4H A;  3V5U A;  3ABV A;  2WSS V;  3SOL A;  2BVL A;  3AAI A;  2R6G F;  5EK4 A;  2WZI A;  3VKG A;  4H9O C;  3OJA A;  1O3X A;  3ZT7 A;  3JAE A;  3Q9D A;  2WS3 A;  3D0T A;  2M6B A;  1G8X A;  4KBM B;  4TUY E;  5ABF B;  3AE1 A;  3ZC1 A;  1LRZ A;  4ZXL A;  4ZI3 D;  3PUV F;  3ANW B;  5LNK A;  4LF8 T;  1FMW A;  2MYS A;  1T8B A;  2N1G A;  2BKN A;  4HN9 A;  4NPP A;  5JDL A;  2WCA A;  1MMA A;  5C2T A;  1CHU A;  3AEB A;  3HI2 A;  5F3J A;  5BR8 T;  1KNR A;  5AQO B;  3ZN0 B;  2RPA A;  5AQS B;  3C4Z A;  3Q5E A;  2BS4 A;  2H89 A;  3ZYM A;  3NZQ A;  2BKO A;  4IDP A;  5L47 A;  3PUS A;  3NWI A;  2E9X B;  1R8I A;  2WB5 A;  5HEJ A;  4PJL A;  2XZE A;  5JVD E;  3VR9 A;  2V6X A;  1KEY A;  3KFW X;  3UTK A;  4WW0 A;  5AQG B;  3LSV A;  2M67 A;  5HYA A;  4K0U A;  4LF5 T;  2DLR A;  1HNX T;  2XHE B;  5AQL B;  2LHR A;  1UCU A;  2WWU A;  4AQG A;  5JTG A;  4AIU A;  4LF6 T;  3I9W A;  3S4U A;  5LHG B;  2DI4 A;  3N9M A;  3TLU A;  1E1H B;  4PJJ A;  4YJ2 E;  2FJA A;  3UT5 E;  1T98 A;  3UUL A;  2E5L T;  4DR3 T;  1FEW A;  2LSK A;  3AE4 A;  3ONL C;  4TZ4 C;  5HXH A;  4ILC A;  3EDU A;  4DR2 T;  3LBX B;  2VK9 A;  3PE0 A;  3ZPO A;  2XAH B;  4XAX B;  2WM9 A;  2DWG A;  4AIS A;  4I43 B;  3CML A;  2YDR A;  3TLW A;  3MZK B;  5HWY A;  5LHH B;  4HKA A;  5AQH B;  5CB4 E;  1GQE A;  4E7Z A;  2Q9Q C;  2OA5 A;  3P4W A;  4AKR B;  4IL9 A;  3O9X A;  4EZH A;  2XJ7 A;  1XZY A;  4U72 A;  4WBN E;  4GK0 E;  1XNQ T;  3VRA A;  3Q5W A;  5EK3 A;  5CA1 E;  2EHO C;  5L3G B;  4IDN A;  1SA0 E;  1IAP A;  2NTY A;  4U33 A;  3RYH E;  3FBL A;  3ZCJ A;  4H9N C;  3C4W A;  2YKS A;  5JDQ A;  4F6R C;  1W0A A;  5FXX A;  2YU2 A;  3CIR A;  5J0Z A;  5LJN A;  1I94 T;  4YTN A;  4MAL A;  3G06 A;  4EB6 E;  2OV9 A;  4UF0 B;  3B57 A;  2NP9 A;  4IDZ A;  3FXE B;  4DV7 T;  4YT0 A;  3N9L A;  1D1B A;  1MND A;  3HKE E;  1MNE A;  1UUS A;  4DUY T;  2CE7 A;  1U5P A;  1HTJ F;  4NIQ A;  4QXB B;  5HEH A;  5TAO A;  3P50 A;  2E2A A;  4COF A;  3QB5 A;  3PUY F;  5JRE A;  3AE6 A;  2UXX B;  3IA3 A;  5AFU L;  4I4T E;  4YSZ A;  4MLK A;  4DBQ A;  3EAM A;  2VL8 A;  3B5M A;  3OVU A;  2XAQ B;  3QB5 K;  4HFD A;  3DP7 A;  4PK6 A;  2D0T A;  2Y48 B;  5LA6 E;  2FBW A;  2QVA A;  1Y64 B;  1IBK T;  2WAU A;  4UXN B;  3ANW A;  2KSR A;  2WY2 A;  4B3R T;  2LEH A;  4IE7 A;  4M1P A;  3N2G E;  5LBQ B;  2WMO A;  4JYA T;  1D0X A;  2ZM8 A;  3FZF B;  3ZKR A;  2VAS A;  4DV2 T;  5LOV E;  3AED A;  3HKB E;  4PK4 A;  5JDG A;  3LFM A;  2LRK A;  2V7K A;  4JI4 T;  4N78 D;  5FMN A;  2H3R A;  3FZM B;  2E9X A;  5GON E;  1IJ5 A;  3EHZ A;  5JR9 B;  2A3D A;  5KMG P;  4H63 V;  3UFE A;  2QYW A;  3E0Z A;  1KF6 A;  2A72 A;  3MAC A;  2W00 A;  4HTE A;  4KMC A;  4O2A E;  4LF7 T;  4H9R C;  2DL1 A;  5FXV A;  2CBI A;  1MMG A;  2SPC A;  5AQU B;  4YXD A;  3PUA A;  2JQH A;  4EYU A;  1N32 T;  1NAF A;  4P0A A;  2UXD T;  4JI5 T;  2IUB A;  4ILA A;  4QWN B;  3VKH A;  4J2C A;  3FHN A;  4AKL A;  4AQY T;  3RYF E;  4IHJ E;  4DR6 T;  2HH7 A;  2DWK A;  5IYZ E;  3V5S A;  4TV9 E;  2XTL A;  3BQI A;  5ABE A;  5HEO A;  1D1A A;  2A9U A;  4ADZ A;  2L3L A;  3PJA J;  5JDF A;  4TNV A;  2JQ9 A;  4DUZ T;  2ES0 A;  2W4X A;  4GOU A;  2CXD A;  3LBX A;  3L09 A;  5AQV B;  1LVF A;  3C50 A;  2ODV A;  4FJO A;  1X79 A;  4ISS A;  2XUE A;  3K3N A;  5A1L A;  2AE9 A;  4EOZ B;  1QSD A;  3NRY A;  4YTM A;  5FY0 A;  2X0L B;  4PFO A;  2W62 A;  1Z0P A;  3CWZ B;  4AQF C;  3AEF A;  3RQU A;  1HG5 A;  2FJB A;  3ZMU B;  1W0B A;  5FKY A;  1T7S A;  3NKZ A;  5JQG E;  2CEA A;  1FJG T;  2JRK A;  2MPK A;  2V5C A;  1T72 A;  3J7Y q;  3AAE B;  4EAH A;  5ABG A;  3ZEF B;  4E7S A;  1YXR A;  5FVK A;  2CLY C;  2X0Y A;  2BDE A;  5H6Q B;  2YOE A;  5CJ5 A;  3UQ7 A;  4DR7 T;  2V26 A;  4CZZ B;  2CHN A;  1WCR A;  2LM2 A;  1HR0 T;  3RKG A;  1ZEE A;  2KWH A;  2CWO A;  1Z8U A;  4DV4 T;  5KXJ A;  4JI6 T;  2LSJ A;  3CKD A;  1ZP0 A;  1SE7 A;  1YW0 A;  3C98 B;  5IUX A;  2VWA A;  4CN6 A;  3FZL B;  4IST A;  4ERR A;  3RIF A;  3KVB A;  3QNU A;  4JBW F;  2IC9 A;  3L8R A;  4H63 H;  2XAJ B;  3FBZ A;  2X68 A;  4PK5 A;  3FZK B;  2B1E A;  3PJA A;  4IE4 A;  1J5W A;  2XQY A;  1VCS A;  3ZYK A;  3TLS A;  3C4X A;  5IHY A;  3ZMZ B;  3Q5D A;  4O4I E;  3WAJ A;  5FL0 A;  5JR9 C;  1IBL T;  2IDO B;  2JIW A;  4U7I A;  3R6N A;  3RI5 A;  3AB3 B;  1US7 B;  3AEC A;  2C5K T;  4ZOL E;  2YU1 A;  3ZC0 A;  1AJ3 A;  3K3Q C;  4OYK A;  4ZEY A;  3RKO A;  5AQP B;  2NOX A;  2C5I T;  4JI8 T;  1ZKE A;  2CXF A;  5JR9 A;  3FXD B;  2CBJ A;  5L4E A;  2BG9 B;  4O4H E;  1WR0 A;  4WYV A;  2V6Y B;  3M65 A;  1XMQ T;  2HN2 A;  2BBH A;  4YHH T;  2KZ7 B;  3RIU C;  3P4R A;  3I0O A;  5M4Y A;  2UUA T;  1FMV A;  2Q9Q D;  3OYZ A;  3PTR B;  4ZHQ E;  4EGW A;  1HCI A;  4ANJ A;  1IJ6 A;  3I9Y A;  3K1S A;  5HCM A;  2VVN A;  3I1A A;  2EHO D;  3SFE A;  4KX6 A;  4TWD A;  2UXC T;  2NW7 A;  3WI3 A;  1XDP A;  3O1I A;  4C90 A;  5AQF B;  5LCY A;  2A2F X;  1YQ4 A;  4TX5 A;  4AI6 A;  5J2U E;  4L5G A;  1EZ3 A;  3LK3 B;  4IGU A;  5F8P A;  1XMO T;  4A5X A;  4JI2 T;  5LP6 E;  3QOF A;  3T8O A;  2BS3 A;  4YTP A;  2W66 A;  3F31 A;  1OED B;  1SHZ C;  3QC9 A;  1H7C A;  3EUH A;  1E2A A;  3CX7 B;  4YSY A;  2BZB A;  4ZZC A;  1UK5 A;  3RF1 A;  4X66 T;  3C64 A;  5L3B B;  3N9Q A;  4B3M T;  2ACZ A;  4A97 A;  2X9X A;  3RH3 A;  1V9D A;  2CCQ A;  5L3E B;  2Q9Q A;  5IWA T;  4IE6 A;  3AA7 B;  2J1D G;  2J62 A;  4L9I A;  2XAF B;  3JAD A;  4EXT A;  2PFV A;  5DJQ C;  4EYY R;  2UUC T;  5JRC B;  2C5J A;  1M62 A;  3AE2 A;  5DQV A;  1IBM T;  1WR6 A;  1UGO A;  2XY8 B;  2EHO A;  4HWD A;  4PFP A;  4IDO A;  4IL4 A;  3U78 A;  2Z6E A;  3CPZ A;  2ZLY A;  5L3D B;  4G2A A;  5FYM A;  5EZY E;  2E9X D;  4ASK A;  2XPK A;  3RC8 A;  2LSG A;  3KDS E;  2CXL A;  4CN4 A;  5F5W A;  4A56 A;  2XQ8 A;  2NR4 A;  1IZN B;  2VKO A;  5HCJ A;  1QLB A;  2V8S V;  2CLY B;  5HXR A;  1W09 A;  4GYS A;  2XSA A;  2K24 A;  3GA8 A;  4MBQ A;  2ODU A;  2IC6 A;  3AVS A;  4OK0 A;  4TNW A;  3LG7 A;  4QX8 B;  4UR9 A;  3IHR A;  5CA0 E;  3EDV A;  3M3Z B;  4MHC A;  5HXE A;  2XQ6 A;  3TKL B;  3JCF A;  5H6R B;  4CQI A;  4IT4 A;  1D0Z A;  4PW8 A;  4IE0 A;  4UVB B;  4LFC T;  4LFB T;  4TWF A;  2KMF A;  4JI0 T;  2RP4 A;  2YK0 A;  4HEA A;  4HWF A;  3CQX C;  3RLF F;  5ABF A;  3AE8 A; 
#chains in the Genus database with same CATH homology
 1I94 T;  4DV5 T;  4JI6 T;  4K0K T;  3OTO T;  1J5E T;  4JI1 T;  1HNW T;  2UUA T;  4YY3 T;  4GKK T;  5IWA T;  4X62 T;  4DV7 T;  4JI4 T;  4JI7 T;  2E5L T;  2UUC T;  4X64 T;  4DR3 T;  2UXB T;  4NXM T;  4LF8 T;  4B3S T;  4DUY T;  1N34 T;  3T1Y T;  1IBM T;  4OX9 T;  4DR2 T;  2VQE T;  4DV3 T;  2HHH T;  2UXC T;  4LF7 T;  4LFA T;  5BR8 T;  5LMN T;  1FJG T;  1N36 T;  4DV6 T;  5LMU T;  1XNR T;  1N33 T;  4DV1 T;  3T1H T;  1IBL T;  4B3T T;  1N32 T;  4DR1 T;  2UU9 T;  2UXD T;  4LF4 T;  4JI5 T;  4GKJ T;  4JV5 T;  4JI3 T;  1XMO T;  4JI2 T;  4AQY T;  1XNQ T;  4DR7 T;  1IBK T;  4DR6 T;  4LF5 T;  4DR4 T;  1HNX T;  4DV0 T;  4JI8 T;  2UUB T;  4B3R T;  1HR0 T;  2ZM6 T;  1HNZ T;  4JYA T;  4DUZ T;  4LFC T;  4LFB T;  4JI0 T;  4LF9 T;  4X66 T;  1XMQ T;  4NXN T;  4B3M T;  4YHH T;  4X65 T;  4DR5 T;  4LF6 T;  2VQF T;  2F4V T;  4DV2 T;  4DV4 T;  4KHP T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...