2UUYA

Structure of a tick tryptase inhibitor in complex with bovine trypsin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title A Tick Protein with a Modified Kunitz Fold Inhibits Human Tryptase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2uuyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2uuyA02
1XUFA 4Z6AH 1OX1A 2ZDLA 3I29A 3DFJA 2P8OC 1PJPA 3C27B 2PHBA 3STJA 1ORFA 3KQEA 2FOFA 1GMDF 3EAJA 1EAWA 1LQDB 3U1IB 2BD8A 1TGBA 3UWIA 3P8OA 1TNJA 1E34B 1K28D 3KHVA 3PB1E 3LGWA 3RP2A 1VCQA 3RXUA 1ZPZA 1EJMA 1CGJE 2FP7B 2WV5A 1O5BB 3LC5A 1O2TA 1TQ7B 3MU4A 3BTWE 1KLTA 1GJBB 3MMGA 2ZDKA 5LPEA 4NZQA 1P12E 3MO9A 5ESTE 1P05A 1O3OA 2BQ7B 1UHBA 3QWCH 2WPHS 1CHGA 1KY9A 1QJ7B 3GY4A 4NA8A 5EPNA 4X8TH 3B9FH 2Y82A 1G3EA 1OYQA 3ZZAA 4UONA 3UOPA 3B8JA 1ELGA 1XKBC 4CRCA 2BB4A 1TRYA 2H6MA 1XUKA 5L2YH 3LIWA 3GYMA 1A3BH 3UPEA 1ZHRA 1P03A 6ESTA 1QRWA 5GIBA 2IPHA 1GBEA 2HWLB 4CRBA 2FOEA 4JCNA 3E0NB 1LKBA 1SBWA 1FMGA 2ZPRA 4ZHMU 1QCPA 1QA7A 3A82A 4WJG2 2XC4A 1O3AA 4O9VA 1H9HE 1SOZA 1GL1A 4XBDA 4DW2U 2J34A 4R8TB 3QLPH 3O8RA 2F9OA 1K1PA 5C1XA 2O8WA 3BTQE 3H7OA 1HNEE 2W26A 5JBCS 3SJIA 4INHA 1V2TT 3RXPA 1A0JA 4IW4E 1OSSA 2NU0E 4ABIA 4D9RA 2PLXA 2Z9IA 1DITH 2F9BH 5HYOA 1MMJN 2QXIA 5K7RA 1DANH 1QB9A 2RCEA 4OS2A 3TJVA 1FPCH 1J15A 3QDZB 2PGQB 3OY6U 2VIQA 2Y7XA 4CRFA 4HZHA 5C3NA 1G2MA 4A6LA 1TRNA 2ZKSA 5L2ZH 3E8LA 5ABWA 1BTZA 1C2EA 1MCTA 1O2JA 1S85A 4VGCB 2BY5X 4ABHA 2ZPSA 2BTCE 1NRRH 4UE7H 5BPEA 3A7TA 1FN6A 2VH6A 1UHBB 4WF8A 1GBMA 3K6YA 1FAXA 3SGQE 5EQSA 4JZFH 5J4QA 1YCPH 3ZZ7A 1NESE 3EQ0H 1FI8A 2ZTYA 3ESTA 1ETSH 1O35A 1TOMH 1VITF 1GHAG 2C4FH 3SOSA 2FPZA 4I31A 1HIAA 4JYTA 2AYWA 1ELFA 3HK3B 3STIA 2HALA 2Y7ZA 3B23B 1LKAA 4ZROA 2FESH 4GSOA 4GCHG 4AFUA 4ZH8A 3NKKA 2JH5D 1RIWB 1K9OE 3TGJE 5DP7A 2A1DB 4F4OC 1EOLA 7KMEH 1ZMNA 4ZKNU 1O2ZA 1MTSA 2FI5E 4GPGA 3ZZ4A 1O5CB 1OYTH 1BMNH 2GD4B 4Y76A 1AVWA 3GY7A 2C90B 2VIWA 3MU5A 2P3UB 5B6OA 2VGCC 2PKSB 3SU3A 2HNTE 1G3BA 3GCTF 3SHAH 1YPLH 2XBVA 1UTKA 3BV9B 1GHZA 4CHAC 1YP9A 2VVUA 4X1NU 1DFPA 2FEQH 1DICA 5IDKA 1DXPA 3A89A 2H9EH 1G3CA 1V2NT 3ENSB 2ZFFH 1RGQA 2Z3CA 4JZEH 4CREA 1YF4A 3SU4A 1AZ8A 1ABIH 1NT1A 1ZSJA 1B5GH 1C5ZB 3LGYA 1FAKH 1FUJA 4NA9H 4UDWH 2VIOA 1HV7A 1AFEH 1CGIE 1OXGA 1SVPA 1Z8RA 2R2WU 1QTFA 1EASA 3K65B 3PO1C 1P0SH 3RXAA 1XXDA 1EJNA 1OKXA 3RXOA 2ASUB 9ESTA 1SGYE 4AB8A 3HGPA 1AZZA 1BBRK 3MU0A 4QT8C 4OS1A 2XW9A 1HIAB 1WU1A 1A46H 3BEUA 5K0HA 1TMUH 1P10A 4HTCH 1A5HA 3QX5H 4I8JA 4B2BA 3K6ZA 4X8VH 2ZF0H 4WWYA 3FP8E 1T8OA 1GBLA 1RXPA 5A8XA 2CV3A 2ODQA 4DOQA 1FJSA 1QB6A 3UOUA 1O2KA 3MTYA 1A4WH 1BTWA 3M61U 4Q80A 2GMTC 3RXHA 3O8DA 1E37B 1MTUA 3TGKE 2ZC9H 1FV9A 3ITIA 5AFYH 2A4RA 2FYRA 2D2DA 3LH1A 4MNYA 1MKXH 1TOCB 3FVFB 1OOKB 1NRQH 2UWPA 3SJ9A 4B71A 2ZG0H 2R0KA 1LCYA 2XWAA 1L0ZA 3ATLA 1GI0A 4FUGA 1L2EA 5A09A 2GZ9A 2GV7A 2K1QA 4X8UH 1PPEE 1GDQA 6GCHG 4JYVH 2CMYA 3A86A 1SGCA 1EAIA 2OCVB 2WUBA 1ZHMA 3IITA 1AFQC 3RXJA 1O3KA 1O2SA 2YOLA 1KSNA 1AU8A 5FCRA 3TJUA 4GHQA 3M3VA 4DJZB 2BD4A 4DGJA 1GHBG 2QAAA 2ZDAH 4K1SA 3FZZA 1IQEA 4B76A 1ARCA 3MYWA 1RRKA 1EB2A 2TRMA 2AMQA 2CGAA 1TBQH 3OX7U 3GCHC 1JBUH 4K5ZA 3WY8A 4UD9H 1DVAH 1HJ8A 2VJ1A 4D7GA 5HGGA 1UTPA 1OWEA 3L6PA 2XBYA 1VZQH 2PSXA 5GJ4B 1XX9A 1V2OT 4DT7B 2CN0H 1CHOG 3GCOA 3MI4A 2ZIQH 4H42U 5F03A 3RXDA 1C1PA 3AASA 3V7TA 1SLVB 2SGDE 3QZQA 3SV9A 1AVXA 4K60A 3MNCA 2H5CA 3RXBA 2J9NA 2HPPH 1M9UA 1O5AB 3NXPA 5E2OA 3BG4B 4JK5A 4NIXA 4K8BA 1IOEA 1KXCA 2B5TB 1W11U 1ZSKA 2Q6FA 1C1WH 2QF0A 2AIQA 4LOYH 2Y81A 2QV1A 3SHCH 2VIDA 1SFQB 4MLFB 2CHAC 4NA7A 1MTVA 2BLVA 1VGCC 3IWMA 1FNIA 1MKWK 3LJOA 1P2MA 3L3TA 5AHGH 3U69H 4FUCA 3E0PB 5JPMH 3QTVH 4KP0A 1GHXH 1OP2A 5JBAS 4Q7YA 3O8BA 1TX7A 2DE9A 4WH8A 1GJAB 3LC3A 1MTNB 2W3IA 1S5SA 3ZZ6A 1C5WB 4GLYA 3LT3A 1NU9A 1V2RT 1NY22 1GHWH 1WSSH 2XC5A 3OYPA 7ESTE 3TJOA 2VH0A 1K1NA 3ELAH 1BHXB 2ODPA 3DFLA 1GVKB 1KXFA 3F9HA 1WUNH 2BVSH 7LPRA 4TYDA 3E1XB 4X0WU 3RXIA 1P04A 4A7IB 1DX5M 2ZFTA 4J2YB 1O31A 2Q1JA 2W7UA 1VR1H 2F9NA 2VB0A 1BRBE 2C93B 1BZXE 2Y80A 1C2JA 2ALVA 4UFEH 4MNXA 5TCCA 1AGJA 1C2HA 3GY5A 1SQAA 1BDAA 2BD3A 5H4IB 2FOCA 1UVOA 1P01A 4NG9H 2A7HA 4ZUHA 2GKVE 3RMOH 2THFB 1TRMA 1VJ9U 4XOJA 1DOJA 2BY6X 1P2NA 4Q2KA 4GHTA 3Q76A 5FX5A 4X1QU 1XVMA 1LVMA 1RTKA 4X2WA 3QGNB 5DP3A 3I78A 1KLJH 5HXFA 2GGVB 1HXFH 1HXEH 3TJNA 2BDGA 1ANDA 2ZHWH 2P94A 4XBCA 3RXLA 3U9AH 5GWZA 4ISNA 1EZQA 1C1MA 1GCTB 1O2HA 3D49H 1P57B 2BVRH 1GPZA 1N8OB 1TLDA 3SGAE 1H8DH 1OP0A 1RFNA 2OTVA 3PYHA 1FY8E 2Y5HA 1DWBH 1W3CA 4U30A 1O2VA 1QIXB 5IYTA 5F8XA 4NCYA 2WPMS 1J14A 1FQ3A 1A61H 3IG6B 2ZFSA 1C2GA 2FLBH 2JH6D 5HM2A 1HAGE 2A45B 3HGNA 3PMBB 1PPFE 2ZU5A 6LPRA 1GJ4H 4NWLA 4I32A 1NFWA 2TGPZ 1QB1A 4R0IA 3URCA 8LPRA 1GMDG 3KF2A 2BY7X 1CQQA 4IS5A 2NU1E 3V0XA 1O2PA 4IMQA 3BTFE 2ZU1A 4MPVA 1WAYB 3U1JB 3HKIB 3P8FA 2AGIX 1MQ6A 1AWFH 3FANA 1O34A 3K9XB 1H9IE 3PMAB 5EQQA 1GJ5H 1T7CA 3TPIZ 3GDSA 4CRAA 1ZRKA 3BTKE 2A4QA 3M5MA 2VWOA 3GY8A 2NU3E 3RU4T 1BUIA 3KN2A 1V3XA 4I8KA 3MO3A 5DG6A 1C1TA 1S6HA 1PQ5A 2BZAA 3MNXA 1SLUB 4IGDA 1DUEA 1ZGIA 2GCHF 2D8WA 5T3HA 3U8OH 4AX9H 1YGCH 4DY7B 1MQ5A 6CHAB 1OWIA 2O8MA 1PQ7A 5GCHF 3SO3A 3RMMH 1BTXA 1MBMA 1ZSLA 1W7XH 3UR9A 1D3PB 5C20A 3NZIA 4BTUB 3LDXH 2V0BA 1O2IA 1ESAA 4YZUA 3RXGA 4B2CA 3SNBA 5C1UA 1TA2A 2VWLA 1GBCA 1GVLA 1EZSC 2EI7A 2OUAA 3GY6A 1HYLA 2H9TH 2OC8A 2FMJA 2FLRH 1D3DB 3VB5A 1UVTH 2JH0D 1P11E 2NU4E 1D3QB 1NTPA 4FUEA 1C5YB 2GX4A 4ZAEA 3SU6A 4TPIZ 2LNCA 3T62A 1HAHH 2HNTC 1OS8A 2PKAA 3DA9B 3E16B 2QY0B 3MNBA 1C2IA 1IQFA 3QUMP 1MTWA 1UTNA 1W7GH 1DXWA 1J8AA 3VB6A 1ZZZA 3GY3A 3NWUA 2G55A 5F8TA 2A4GA 1ANEA 3ZZ9A 1NM6A 1PQAA 5FAHA 1ELBA 4X2XA 2AGGX 2UWLA 2WINI 4TPYA 1FIZA 1LVBA 1EPTA 4DURA 1CA0B 3T25A 3TLOA 3JZ1B 4I8LA 3S7KB 1UMAH 3OY5U 4THNH 1P2QA 1C1UH 2FX4A 1FPHH 1UTMA 3UTUH 1YLDA 2FOHA 2C8XB 4AG1A 4PROA 2FI3E 3BN9A 3NCLA 3A8AA 3MH4A 4AYVB 3P95A 3S0NA 1GBBA 3ZZDA 1VITG 2WYGA 1EB1H 2ZU4A 1MZDA 5G4BA 3V13A 1C5LH 1O3JA 2BOHB 3A8CA 1AUTC 1GVZA 2OQUA 1W2KH 4AG2A 4E05H 3A8BA 1G2LA 4X2YA 4AFZA 2ZO3H 4OS7A 4B2AA 4NZLA 3MH6A 1KLIH 4E7RG 4Y0ZE 5EW2H 1HJAB 1W0ZU 3A81A 3EA8A 5E0HA 1OPHB 1YPJH 1F7ZA 1GGDB 1PPCE 2WPKS 2FOAA 4FUBA 4YOGA 4BAQB 5F8ZA 1SG8B 2O8TA 2XNIA 3SGBE 1D3TB 3PWCA 2OD3B 3UNRA 1G30B 2PKAB 3GCTG 5HMAA 3SJOA 1AWHB 3SV6A 3ZZBA 3BG4C 5DP6A 1OP8A 1YLCA 4A1XA 4X6OA 2UUKB 1GJ7B 1EP6A 1CVWH 1UVUH 2OC1A 2O8LA 1F0RA 3LH3A 2QXHA 3CS0A 4ZKOU 5L30H 5AVDA 2G51A 1EPTB 4IN1A 5EGMA 2A32A 1C5NH 3LPRA 3QTOH 1XUGA 3FP6E 2C3SA 4DG4A 2HRVA 1BTUA 4AFQA 1HUTH 2BHGA 1TBRH 4O3UA 4K1EA 4TY6A 1MD8A 3M7TA 2ALPA 1IQNA 2GZ7A 1VJAU 2Z3EA 2RA0A 2Y6TA 1C2FA 1C9PA 1O38A 3LJJA 4K8YA 3VB3A 4UFFH 3ZZ5A 7GCHF 2J92A 1YCPK 2GVFA 4ESTE 3EE0B 3SQHE 3GICB 2BX3A 4I8HA 3HKJB 4YO9A 1ANBA 5HM9A 2ZEBA 2ZTZA 4Y11E 4YT7H 3H7TA 4LXBH 2HNTF 1W8BH 3K2UA 1AKSA 1EAUA 4INLA 4NIYA 2V3HH 1UTOA 3ZVDA 1ELTA 1K21H 1FY5A 5L6NH 3P6ZB 2R9PA 1GJ9B 1OWKA 5F6MA 1EAXA 4UFGH 1HAZB 2SNVA 3UQVA 1QBOA 2V35A 1NU7B 4Y6DA 1SGIB 1SGEE 3GDVA 1BOQA 1OWJA 1NROH 1BRCE 4X8SH 2SGPE 2XCNA 1HJ9A 1O3IA 1UVSH 3BEFB 5JB8S 1E36B 3LGVA 1Y3XA 1BITA 1PPHE 1Z6EA 2BXTH 1SHHB 3SN8A 5EW1H 2J4IA 2ZHFH 1K1IA 2BZ6H 3NPSA 1GMHF 1SLWB 4B73A 1IQIA 3VGCC 3QO6A 4ABBA 1ZRBA 1ZYOA 2PV9B 1O3FA 1DLEA 1SGRE 4HGCA 5EQRA 1Q2WA 1B0FA 2FTMA 1QA0A 1O2OA 5EOKA 1SFIA 2GCTC 4A92A 5JBBS 1FDPA 2FTLE 3TK6A 3TNTA 1V2LT 2VU8E 3OU0A 1EOJA 3RMLH 2G8TA 2Z9KA 3RXEA 1JOUB 2ANMH 2A31A 1CBWC 1ZTKA 2ESTE 1ELEE 1Z71A 2A2QH 3ATKA 1QRZA 2JETB 2IOTA 1QQ4A 2XBWA 5C5OA 5A0CA 4MTBA 1ELVA 4Y0YE 3PLBA 2Z9JA 1C1SA 1BJVA 1LQEA 1O3BA 1TABE 1TPAE 3RXKA 3SZNA 1GWAA 4XBBA 4DVAU 3ZYDA 2GP9B 2G4UA 1TGCA 4INKA 5A8ZA 3T29A 1BMAA 2A5KA 2ZU3A 1HAYB 1ZOMA 1SMFE 2DE8A 1AKSB 2SFAA 1HDTH 3U8TH 1AE8H 2ZGBH 2ZDVH 2Z6BD 3D23A 2G81E 1O2RA 4DIHH 3I77A 5E8EH 1AUJA 1GI3A 4ABEA 4I7YH 1PFXC 1O2LA 1LVYA 3SV7A 5CHAC 4FXGH 2YNBA 1HAIH 3EA7A 2VNTA 4NFFA 3GDUA 3SUDA 1MKXK 3Q3KA 4I33A 4YLUA 1VCWA 3F9EA 1B0EA 2ZWLH 3S9AA 3TNSA 3TVJB 4AYYB 1L4ZA 3RXTA 3RXMA 2B7DH 3QZRA 4NWKA 1DUAA 2I6SA 3RMNH 3KGPA 1GI4A 2G00A 2P8OB 3PLKA 1Y5BT 3H5CB 1DDJA 3LKWA 1Y59T 1T8LA 3L33A 3BF6H 3W95A 3AW0A 3M36A 1TFXA 4UFDH 1A5GH 2D1JA 1AB9C 3T5FH 1K22H 1OWDA 4ZXYH 4BANB 1JRSA 1FONA 3O8CA 1ZLRA 5J4SA 4YT6H 1HAOH 1G32B 1XMNB 1TPPA 3UFAA 4ABFA 1T4VH 1K1JA 1UCYH 5E0GA 3LU9B 2BDBA 1O5GH 1TA6A 3GYLB 1GG6C 5GXPA 3PMJA 1ZGVA 4U01A 2H5DA 4GUXA 3A7VA 1BQYA 3GY2A 4IC5A 1T8NA 1HAPH 1C4Y2 1K1OA 1GBKA 1MZAA 3OSYA 2XCFA 1QGFA 1ACBE 2XWBI 2FYQA 1CU1A 2WPJS 1SPJA 2A4OA 3S69A 3NK8A 1CT0E 3SUEA 2OQ5A 1IQJA 4H6TA 2R3YA 4ABGA 4FVBA 3RU4E 1GHVH 3CS7A 2P3FH 4WH6A 1S83A 1A3EH 2QA9E 1V6DA 1INCA 9LPRA 1QJ1B 4BAMB 1B7XB 1TX8A 5PTPA 1ZTJA 3MWIU 2EEKA 2ZHDA 1E35B 3MO6A 3TH4H 2J94A 2UWOA 2OBQA 1GMCF 1GBHA 2WYJA 4OS5A 1O2MA 4MPWA 2A5IA 1T32A 2AERH 1ZJDA 5T6FA 2JKHA 1J16A 1TQ0B 1JMOH 1G36A 1GI6A 1GBTA 1ZMJA 1RS0A 1YPEH 1YPGH 1XUIA 3KNXA 4XDEA 1AQ7A 2VIVA 2XBXA 1JWTA 2OXSA 3M3SA 4ABJA 4JYUH 1MKWH 3SUGA 5A2MH 1HB0B 3SNEA 2D26C 2H2ZA 1UJ1A 1ZPBA 1O37A 1FY1A 1EP5A 2XXLA 4AFSA 2V3OH 3T28A 3TK5A 4UEHH 3RXCA 1DY9A 4TWYA 1IHTH 2HVXA 1ANCA 5DP5A 1NFYA 4M7GA 2UUYA 1GJDB 1C5MD 4XSKU 1UK4A 3PTBA 3LGTA 2AS9A 4IC6A 1SGQE 3RM0H 1O5EH 1HGTH 1GJ8B 3DHKH 3KQDA 1IQLA 1O2XA 4E7NA 4MQAA 3RXSA 3SBKA 1QJ6B 2FM2A 3JZ2B 5FHTA 1C1RA 1S82A 2ZQ1A 2ULLA 1W12U 1MAYA 2GCHG 2UUFB 2PUQH 3P70B 2PTNA 3A84A 1HCGA 1Y3YA 1V2MT 2AMDA 1F2SE 4H6SB 3SUFA 4CR5A 5GCHG 4VGCC 4FU7A 3E6PH 1ZMLA 1H9LB 1JXPA 5T6GA 2SGFE 1TWXB 1S81A 3M7QA 1D6WA 4U2WA 2QC2A 2BD7A 1P2IA 4SGAE 2P59A 1V2UT 1QFKH 1GDUA 1ABJH 1L1GA 2BY8X 2SGEE 2FWWA 3ZZ8A 1Z1IA 1O2NA 1P9SA 4BXWA 1TE0A 1FN8A 2VGCB 2ZTXA 1BT7A 1Q31A 1UO6A 1PQ8A 3F6UH 4CHAB 2F9VA 1LO6A 4YM9A 1YM0A 1P02A 1AN1E 2J2UA 4YTAA 2XYAA 1Y3UA 2CJIA 4A1TA 1KXEA 2GV6A 1ELDE 1L1NA 1RIWC 1T4UH 2BDCA 1HAVA 1Y5AT 1O39A 4HI3A 4D7FA 1D9IA 2ZGHA 1L1JA 3SNAA 4BXSA 4X1PU 1A0HB 2ZU2A 5EG4A 4FU9A 1UCYE 1V2ST 3MU1A 1TIOA 1WOFA 1TALA 1W10U 1NZQH 2F3CE 2BLOA 1XM1A 2PKSC 1MD7A 3AW1A 2TGAA 1SQOA 1C5XB 1BRAA 1A2CH 2BXUH 3CP7A 3RU4D 1SLXB 3BTGE 2IJOB 1N6XA 1KXDA 1C1QA 4FUHA 3TU7H 3LOXA 1DT2A 5DK1A 3VEQB 4JK6A 1EUFA 2V6NA 2FDAA 1SSXA 3RUOA 2FIRH 4NIVA 4RN6A 2GMTB 1TMTH 3TH2H 2PWXA 4AOQA 1KDQA 1SB1H 3TGIE 1DPOA 1BA8B 3P17H 3ZVAA 2LPRA 1NC6A 1RD3B 4K3JA 3F1SB 1HAXB 4WMEA 5I46H 2H1UA 2GT7A 3CENA 1GL0E 5EXNA 4WMDA 1S0QA 2ZP0H 2O9QA 1DWCH 2ZDNA 4K1TA 1CT2E 4BNRA 1C5QA 2AGEX 3MH7A 2OBOA 3FAOA 2CF8H 2PFEA 1F0TA 2TIOA 1MU8B 3FP7E 1TGNA 2ANKH 2OP9A 1EQ9A 1O3NA 2ODYB 2BDIA 1AI8H 2P16A 1IQKA 4LZ4B 1ESTA 2R3UA 1O3CA 4NIWA 3ZVEA 4JZ1A 1HAVB 1SR5C 5EPYA 2VWNA 1AFQB 1TB6H 5FCKA 1O2UA 4CH8B 4NFEA 1O2WA 1PPZA 3PROA 4CBNA 3URDA 1YKTA 1Z8IB 2RG3A 3PV4A 4BOHA 2G52A 2WPIS 5FX6A 1GBIA 2BOKA 3LGUA 3ZZ3A 5DP9A 4U32A 5SGAE 1AE5A 3GCHB 1F92A 1FY3A 1O5FH 2C8YB 1Z8JB 1THRH 1A7SA 1GBJA 2GT8A 4YOJA 1CSOE 2WV4A 1TNLA 3SV2H 5BRRE 1HPGA 2ZHEH 1W0YH 1Z8GA 2Y5GA 1F0UA 1F5RA 1Z1JA 1J9CH 7GCHG 1GDNA 4O3TA 1NS3A 3UNSA 1ETTH 5DGJA 3SI4H 1LPKB 3ATIA 4GAWA 1JIMA 1DM4B 1AIXH 1KDQB 5FBIA 4ISIH 5TCAA 3Q77A 3T26A 4O97A 4HFPB 3HK6B 4OS4A 2ILNA 1TGSZ 5CE1A 1QL9A 4F49A 1UTQA 4O03A 3BTDE 5I25A 2OC0A 3ZVCA 3T2NA 3DD2H 2CHAB 3BIUH 2BYAX 2W3KA 8GCHF 1O2QA 1DY8A 1VGCB 4ISHH 4Y8YA 1QBVH 1C5PA 4ZMAH 2SGAA 5T6DA 1O3PB 1C1NA 3A87A 1K2I1 2BM2A 2ZHQH 5DP8A 4A1VA 1AD8H 3MOCA 2GDEH 3KIDU 3Q00A 1Y5UT 5JYIA 2PW8H 3GISB 5LH8A 4BTIB 1NN6A 2FOBA 2OC7A 5EXLA 1O30A 1N1LA 4Y10E 2Y5FA 3AAVA 2RDLA 1MU6B 3MH5A 1O2GH 1PPBH 1O5DH 1SGNE 1P09A 3ATWA 1GMHG 4Q7ZA 1W14U 3MNSA 1C2LA 3PLPA 1IAUA 4RKOB 1BMLA 4X6PA 2AIPA 3PMHB 3ZV8A 2HPQH 4WXVA 3M5NA 1UTJA 2ZCLP 2HOBA 3OTJE 1P2JA 1TPSA 1XVOA 5JB9S 3UR6A 4Y7BA 3M35A 2FO9A 3RLYH 2Z9GA 5DO4H 2FOMB 2BLQA 2QF3A 2WPLS 1MTNC 1VCPA 1GI8B 2WUCA 3BSQA 4AN7A 2GTBA 2VIPA 1WYKA 1KTSB 1FY4A 1DSUA 2A2XH 2ZPQA 5FBEA 5E2PA 4H4FA 1GCDA 1AHTH 4KTSA 1S6FA 1NFXA 1LHDH 1S84A 3PTNA 1NPMA 1GI7B 1NRNH 1THPB 1C2MA 4NGAH 1V2VT 2J95A 3RXFA 1LHGH 3QN7A 2AH4X 2C8ZB 5LPRA 1DLKB 1BCUH 2XRCA 2QYIA 1SGDE 1OWHA 1BJUA 4FU8A 1QHRB 3AAUA 4X1SU 1GI5A 3TK9A 3V3MA 5FPTA 2ZI2H 4OGYA 3KQBA 4YESB 2EI8A 3EGKH 2ZGXH 3RC4A 4Z0KA 1THSH 1UK3A 1MUEB 2B9LA 1P9UA 1KXAA 2BDHA 1IHSH 3BTTE 2HLCA 4MVNA 2XC0A 1TNIA 3AVZA 2ZGCA 1GJCB 1V2QT 1GI1A 5FPSA 3SNDA 3DT0H 2VVCA 3KL6A 3KCGH 2F9PA 4Y8XA 1LVOA 1MCVA 2EC9H 2BX4A 3A7XA 2ZDMA 1WBGB 4Y71A 3FZDA 4CRDA 3RXRA 3SU0A 3ZVGA 1C1OA 1GCTC 2NWNA 2VWMA 2CXVA 1N8OC 4FUDA 1WV7H 2BVXH 3N7OA 1PYTC 1TONA 4CR9A 5E0JA 4E06H 2HGTH 1A5IA 1ID5H 2VVVA 3E91A 2YNAA 1FZZA 1G9IE 2G4TA 3SV8A 3ZVFA 2SGQE 1SGTA 2BD5A 2W5EA 3PM3A 1TYNA 3A7ZA 3A8DA 1LDTT 3BG8A 2F91A 3RC5A 2FZZA 1T31A 1E0FD 1RTFB 2FS9A 2A5AA 8KME2 3UY9A 3KEEA 4LZ1H 1BTPA 1EZXC 2B8OH 1U6QA 1C5TA 4KTCA 3SORA 1P3EA 2ZA5A 3GCNA 1NRPH 1QQUA 2STBE 1EJAA 1BBRH 1Q3XA 3SU1A 1MH0A 3SNCA 3U8RH 2KAIA 3E3TA 1V2KT 1ZTLA 2PGBB 2ZECA 1QR3E 1O3EA 3PWBA 4WMFA 4JZDH 4XE4A 1GHAF 5C2ZA 1O3GA 1NFUA 4X6NA 2QXJA 4ZHAA 3W94A 1WCZA 5ESBA 1P8VC 1MAXA 3Q3XA 1GMCG 1GI9B 3UNQA 1SC8U 6CHAC 5EXMA 1SGFG 2QN5T 4GCHF 1QL8A 1LPGB 3QGJA 1WTHD 2QGRA 2RA3A 1D4PB 1TMBH 4FUFA 4WVPE 2IN2A 4ZKSU 5JBTA 4DCDA 4DIIH 1Y3VA 4FVDA 4TWWA 1XUHA 3SQEE 1EKBB 4FUIA 1CGHA 2ZNKH 1FXYA 5DKMA 3ODFA 1FIWA 4JMYA 3D65E 3FFGA 1P2OA 4KKDA 3BTEE 1EZUC 4AGKA 5A8YA 1GJ6A 1ZR0A 2P3TB 4K2YA 5CMXH 4MNWA 3M5OA 5C67A 1BHXF 1YBWA 1A0LA 1TBZH 3P8NA 3UREA 5A0AE 5FXLA 2PTCE 2EA3A 1AO5A 1BB0B 1UCYK 1EXFA 1GBFA 2C8WB 4AB9A 2QXGA 4ZXXH 5DJ7A 2I6QA 2AEIH 2ZFQH 2R2MB 4LK4A 3RXQA 4ASHA 1C2KA 1BMMH 2G5NA 1YPHC 3D62A 4MNVA 3BTME 2AFQB 3EDXB 3Q3YA 4NSVA 1A1RA 2PR3A 4WY3A 1YC0A 1O36A 5EU8A 4B75A 3ZZCA 2ZQ2A 1C5RA 2VINA 2Z94A 2H9HA 1F5LA 2BLWA 3MHWU 3RM2H 3SU5A 3ATMA 1QRXA 5AFZH 1DS2E 1KXBA 2ANYA 2CF9H 2ZCKP 4MG3A 3V12A 1AVGH 1CA0C 2KAIB 2SNWA 4AGJA 3A85A 1C5OH 1K1LA 3ZV9A 3VXEH 1TPOA 3DUXH 4MPXA 3T27A 5C5NA 2W7SA 1YCPM 3P92A 4YLQH 1F5KU 1W13U 2G5VA 4ZHLU 1H8IH 3HATH 1DWEH 4K69A 2Z7FE 3ZYEA 1BTYA 1KTTB 4IBLH 2BQWB 3RXVA 1P2KA 5LPFA 1C9TA 1NRSH 1IQGA 5DP4A 1KIGH 2PSYA 1O3MA 1ARBA 1SI5H 2GZ8A 4Q7XA 2UUJB 1HLTH 2FOGA 3U98H 1KYNA 1WQSA 1HRTH 2Z3DA 1HJAC 5ETXA 3TH3H 2GDDA 2FS8A 3S7HB 1E38B 1GHYH 1G3DA 1GGDC 4I8GA 1AY6H 3VB7A 3EA9A 3BTHE 4X2VA 1SGFA 3UWJH 3BIVH 1V2JT 1CO7E 3GOVB 3LONA 4X6MA 4B74A 2Z9LA 3C1KA 1TX6A 3A7YA 1ETRH 3NUMA 2Q6GA 1AMHA 6GCHF 1LHFH 3SU2A 1QY6A 3S9CA 2ZGJA 3A88A 3R0FA 1DSTA 2STAE 4YOIA 1GHBF 4CH2B 1MBQA 3SI3H 3UIRA 3BEIB 3F9GA 4ABDA 1N6YA 1TGTA 1BBRE 1EPTC 3RDZA 2ZFPH 2BQ6B 4IN2A 4Y79A 5LGOA 2F83A 1SL3A 2BDAA 1EX3A 1XXFA 4MPUA 1T8MA 4WXIA 1Z7KA 1EATA 1HFDA 4SGBE 1ELAA 2P93A 1CHOF 2FODA 4MDSA 3M37A 5DPAA 1H1BA 1L4DA 5A0BA 3A80A 4GVUA 4BAKB 1UK2A 1S0RA 4JZIA 4BAHB 1LTOA 3A83A 3S9BA 3VB4A 3KQCA 2ZFRH 1J17T 1GI2A 1SHYA 1YPMH 4CBOA 1LPZB 4A5TS 1C4U2 2M5TA 1CE5A 1ELCA 2TGDA 5JDUB 3UQOA 3SJ8A 4KTUA 1O2YA 1O0DH 2BMGB 4AZ2B 3M7UA 1QL7A 1O3HA 3R3GB 1QNJA 2Q6DA 4ISLA 1X7AC 4J1YA 4NSYA 1UTLM 2TGTA 2BDYA 3P8GA 3VPKA 3MU8A 3VGCB 2AMPA 3VFEA 1JRTA 4BAOB 1NO9H 2P95A 1LHEH 1O3LA 4FUJA 3VXFH 1HBTH 3F68H 1WQVH 2ANWA 2GCTB 3M3TA 2ZCHP 1O3DA 3HPTB 1QBNA 3PO1B 3M5LA 2XTTB 4ABAA 1CBWB 3G01A 3SJKA 2A0QB 1K1MA 2QIQA 1ESBA 1TNHA 2DUCA 4TY7A 1XKAC 1C4V2 4OS6A 4AORA 1CT4E 4ISOA 1YPHE 1DE7H 1LHCH 1JIRA 3QK1A 2BD2A 4OGXA 1QURH 5C1YA 1O32A 3F9FA 4RKJB 1TAWA 1SOTA 1SGPE 1ZHPA 1BRUP 1O33A 1WTGH 1FLEE 3RLWH 3SW2B 5GDSH 1YYY1 4Y7AA 3RC6A 4B1TA 4ZKRU 2QCYA 1TNKA 3E90B 4X1RU 2BY9X 2J38A 1CA8B 1PPGE 2PUXB 1IQHA 1GBAA 2ZZUH 5CHAB 1GBDA 2JETC 8GCHG 5TJXA 1C5SA 4Y8ZA 4CRGA 3MFJA 4D8NA 2A7CA 2NU2E 1IQMA 5GPIB 1Y8TA 2B0FA 5FPYA 4D9QA 1YPKH 2TBSA 1G37A 3ODDA 2BD9A 4D76A 2EI6A 1RJXB 1C5UA 1C5VA 2FX6A 1PYTD 5EODA 4RSPA 4KGAA 3UUZA 2R0LA 1Y3WA 2A7JA 1C1VH 1LMWB 1UVPA 5AF9H 4BTTB 2F9UA 3TITA 3LGIA 1C2DA 4IMZA 1P06A 1D6RA 1AB9B 2OLGA 1H4WA 4XFQA 1RTLA 3ZVBA 4KELA 8ESTE 1ZJKA 1VITH 1F0SA 1P3CA 2FI4E 1BTHH 1Z6JH 2OINA 2TPIZ 3EYDA 1DWDH 3A7WA 1ZPCA 1V2WT 3TIUA 1BIOA 1GG6B 2O8UA 2FXRA 1V2PT 1TNGA 1SQTA 1XUJA
chains in the Genus database with same CATH superfamily
1XUFA 4Z6AH 1OX1A 2ZDLA 3I29A 4DT4A 3DFJA 2P8OC 1PJPA 3C27B 2PHBA 3STJA 1ORFA 3KQEA 2FOFA 1GMDF 3EAJA 1EAWA 1LQDB 3U1IB 2BD8A 1TGBA 3UWIA 3P8OA 1TNJA 1E34B 1K28D 3KHVA 3PB1E 3LGWA 5F53A 3RP2A 1VCQA 3RXUA 1ZPZA 1EJMA 1CGJE 2FP7B 2WV5A 1O5BB 2WV9A 3LC5A 1O2TA 1TQ7B 3MU4A 3BTWE 1KLTA 1GJBB 3MMGA 2ZDKA 5T1VA 5LPEA 4NZQA 1P12E 3MO9A 5ESTE 1P05A 1O3OA 2BQ7B 1UHBA 3QWCH 2WPHS 1CHGA 1KY9A 3OEHD 1QJ7B 3GY4A 4NA8A 5EPNA 4X8TH 3B9FH 2Y82A 1G3EA 1OYQA 3ZZAA 4UONA 3UOPA 3B8JA 1ELGA 1XKBC 4CRCA 2BB4A 1TRYA 2H6MA 1XUKA 5L2YH 3LIWA 3GYMA 1A3BH 3UPEA 1ZHRA 1P03A 6ESTA 3ZIAD 1QRWA 5GIBA 2IPHA 1GBEA 2HWLB 4CRBA 2FOEA 4JCNA 3E0NB 1LKBA 1SBWA 1FMGA 2ZPRA 5DN6D 4ZHMU 1QCPA 1QA7A 3A82A 4WJG2 2XC4A 2JIZD 1O3AA 4O9VA 1H9HE 1SOZA 1GL1A 4XBDA 4DW2U 2VBCA 2J34A 4R8TB 3QLPH 3O8RA 2F9OA 1K1PA 4I86A 5C1XA 2O8WA 3BTQE 3H7OA 1HNEE 2W26A 5JBCS 3SJIA 4INHA 1V2TT 3RXPA 1A0JA 3H09A 1OSSA 2NU0E 4IW4E 4ABIA 4D9RA 2PLXA 2Z9IA 1DITH 2F9BH 5HYOA 1MMJN 2QXIA 5K7RA 1DANH 1QB9A 2RCEA 4OS2A 3TJVA 2WSSD 1FPCH 1J15A 3QDZB 2PGQB 3OY6U 2VIQA 2Y7XA 4CRFA 4HZHA 5C3NA 1G2MA 4A6LA 1TRNA 2ZKSA 5L2ZH 3E8LA 5ABWA 1BTZA 1C2EA 1MCTA 1O2JA 1S85A 4VGCB 2BY5X 4ABHA 2ZPSA 2BTCE 1NRRH 4UE7H 5BPEA 3A7TA 1FN6A 2VH6A 1UHBB 3WW7A 4WF8A 1GBMA 3K6YA 1FAXA 3SGQE 5EQSA 4JZFH 5J4QA 4Q63A 1YCPH 3ZZ7A 2GJGA 1NESE 3EQ0H 1FI8A 2ZTYA 3ESTA 1ETSH 1O35A 1TOMH 1VITF 1GHAG 2C4FH 3SOSA 2FPZA 4I31A 3W1EA 1HIAA 4JYTA 4XRNA 2AYWA 1ELFA 3HK3B 3STIA 2HALA 2Y7ZA 3B23B 1LKAA 4ZROA 2FESH 4GSOA 4GCHG 4AFUA 4ZH8A 3NKKA 2JH5D 1RIWB 1K9OE 3TGJE 5DP7A 2A1DB 4F4OC 1EOLA 7KMEH 1ZMNA 4ZKNU 1O2ZA 4OM9A 1MTSA 2FI5E 4GPGA 3ZZ4A 2J98A 1O5CB 1OYTH 1BMNH 2GD4B 4Y76A 1AVWA 3GY7A 2C90B 5DSFA 2VIWA 3MU5A 2P3UB 3N99A 2VGCC 5B6OA 2PKSB 3SU3A 2HNTE 1G3BA 3GCTF 3SHAH 1YPLH 2XBVA 1UTKA 2J97A 3BV9B 1GHZA 4CHAC 1YP9A 2VVUA 4X1NU 1DFPA 2FEQH 1DICA 5IDKA 1E1QD 1DXPA 3A89A 2H9EH 1G3CA 1V2NT 3ENSB 2ZFFH 1RGQA 2Z3CA 4JZEH 4CREA 1YF4A 3SU4A 1AZ8A 1ABIH 1NT1A 1ZSJA 1B5GH 1C5ZB 3LGYA 1FAKH 1FUJA 4NA9H 4UDWH 2VIOA 1HV7A 1AFEH 1CGIE 1OXGA 1SVPA 1KMHB 1Z8RA 5GNDA 2R2WU 1QTFA 1EASA 3K65B 3PO1C 1P0SH 3RXAA 1XXDA 1EJNA 1OKXA 3RXOA 2ASUB 2QE7D 9ESTA 1SGYE 4AB8A 3HGPA 1AZZA 1QZ8A 1BBRK 3MU0A 4QT8C 4OS1A 2XW9A 1HIAB 1WU1A 2RDEA 1A46H 3BEUA 5K0HA 1TMUH 1P10A 4HTCH 1A5HA 3QX5H 4I8JA 4B2BA 3K6ZA 4X8VH 2ZF0H 5EJZA 4WWYA 4FOUC 3FP8E 1T8OA 1GBLA 1RXPA 5A8XA 2CV3A 3FN8A 2ODQA 4DOQA 1FJSA 1QB6A 3UOUA 1O2KA 3MTYA 1A4WH 1BTWA 3M61U 4Q80A 1NBME 2GMTC 3RXHA 3O8DA 1E37B 1MTUA 3TGKE 2ZC9H 1FV9A 2J98B 3ITIA 5AFYH 2A4RA 2FYRA 2D2DA 3LH1A 4MNYA 1MKXH 1TOCB 3FVFB 1OOKB 1NRQH 2UWPA 3SJ9A 4B71A 2ZG0H 2R0KA 1LCYA 2XWAA 1L0ZA 3ATLA 1GI0A 4FUGA 1L2EA 5A09A 2GZ9A 2GV7A 2K1QA 4X8UH 1PPEE 1GDQA 6GCHG 4JYVH 2CMYA 3A86A 1SGCA 1EAIA 2OCVB 2WUBA 1ZHMA 3IITA 2EY4C 1AFQC 3RXJA 1O3KA 1O2SA 2YOLA 1KSNA 1AU8A 5FCRA 3TJUA 4GHQA 3M3VA 4DJZB 2BD4A 4DGJA 1GHBG 2QAAA 2ZDAH 4K1SA 3FZZA 1IQEA 4B76A 1ARCA 3MYWA 1E1RD 1RRKA 1EB2A 2TRMA 2AMQA 2CGAA 1TBQH 3OX7U 3GCHC 1JBUH 4K5ZA 3WY8A 4UD9H 1DVAH 1HJ8A 2VJ1A 4D7GA 5HGGA 1UTPA 1OWEA 3L6PA 2XBYA 1VZQH 2PSXA 5GJ4B 1XX9A 1V2OT 4DT7B 2CN0H 1CHOG 3GCOA 3MI4A 2ZIQH 4H42U 5F03A 3RXDA 1C1PA 3AASA 3V7TA 1SLVB 2SGDE 3QZQA 3SV9A 1AVXA 4K60A 3MNCA 1SKYE 2H5CA 3RXBA 2J9NA 2HPPH 1M9UA 1O5AB 3NXPA 5E2OA 3BG4B 4JK5A 4NIXA 2KCYA 1IOEA 4K8BA 1KXCA 2B5TB 1W11U 1ZSKA 2Q6FA 1C1WH 2QF0A 2AIQA 4LOYH 2Y81A 2QV1A 3SHCH 2VIDA 1SFQB 4MLFB 2CHAC 4NA7A 1MTVA 3WWFA 2BLVA 1VGCC 3IWMA 1FNIA 1MKWK 3LJOA 1P2MA 3L3TA 5AHGH 3U69H 4FUCA 3E0PB 5JPMH 3QTVH 4KP0A 1GHXH 1OP2A 5JBAS 4Q7YA 3O8BA 1TX7A 2DE9A 4WH8A 1GJAB 3LC3A 1MTNB 2W3IA 1S5SA 3ZZ6A 1C5WB 4GLYA 3LT3A 1NU9A 1V2RT 1NY22 1GHWH 1WSSH 2XC5A 3OYPA 7ESTE 3TJOA 2VH0A 1K1NA 3ELAH 1BHXB 2ODPA 3DFLA 1GVKB 1KXFA 3F9HA 1WUNH 2BVSH 1SQRA 7LPRA 4TYDA 3E1XB 4X0WU 3RXIA 1P04A 4A7IB 1DX5M 2ZFTA 4J2YB 1O31A 2Q1JA 2W7UA 1VR1H 2F9NA 2QF4A 2VB0A 1BRBE 2C93B 1BZXE 2Y80A 1C2JA 2ALVA 4UFEH 1MABB 4MNXA 5TCCA 1AGJA 1C2HA 3GY5A 1SQAA 1BDAA 1NBMD 2BD3A 5H4IB 2FOCA 1UVOA 1P01A 1W0JD 4NG9H 2A7HA 4ZUHA 2GKVE 3RMOH 2THFB 1TRMA 1VJ9U 4XOJA 5KECA 1DOJA 2BY6X 1P2NA 2YMSC 4Q2KA 4GHTA 3Q76A 5FX5A 4X1QU 1XVMA 1LVMA 1RTKA 4X2WA 3QGNB 5DP3A 3I78A 1KLJH 5HXFA 2GGVB 1HXFH 1HXEH 3TJNA 2BDGA 1ANDA 2ZHWH 4RT1A 2P94A 4XBCA 3RXLA 3U9AH 5GWZA 4ISNA 1EZQA 1C1MA 1GCTB 1O2HA 3D49H 1P57B 2BVRH 1GPZA 1N8OB 1TLDA 3SGAE 1H8DH 1OP0A 1RFNA 2OTVA 3PYHA 1FY8E 2Y5HA 1DWBH 1W3CA 4U30A 1O2VA 1QIXB 5IYTA 5F8XA 2JJ2D 2WPMS 4NCYA 1J14A 1EFRD 1A61H 1FQ3A 2ZFSA 1C2GA 2FLBH 3IG6B 2JH6D 5HM2A 1YLNA 1HAGE 2A45B 3HGNA 3PMBB 1PPFE 2ZU5A 6LPRA 1GJ4H 4NWLA 4I32A 5EJ1A 1NFWA 2TGPZ 1QB1A 4R0IA 3URCA 8LPRA 1GMDG 3KF2A 2BY7X 1CQQA 4IS5A 2NU1E 3V0XA 1O2PA 4IMQA 3BTFE 2ZU1A 4MPVA 1WAYB 3U1JB 3HKIB 3P8FA 2AGIX 1MQ6A 1AWFH 3FANA 1O34A 3K9XB 1H9IE 3PMAB 5EQQA 1GJ5H 1T7CA 3TPIZ 3GDSA 4CRAA 1ZRKA 3BTKE 2A4QA 3M5MA 2VWOA 3GY8A 2NU3E 3RU4T 1BUIA 3KN2A 1V3XA 4I8KA 3MO3A 5DG6A 1C1TA 1S6HA 1PQ5A 2BZAA 3MNXA 1SLUB 4IGDA 1DUEA 1ZGIA 2GCHF 2D8WA 5T3HA 3U8OH 3FOAA 4AX9H 1YGCH 4DY7B 1MQ5A 6CHAB 1OWIA 2O8MA 1PQ7A 5GCHF 3SO3A 3RMMH 1BTXA 1MBMA 1ZSLA 1W7XH 3OEED 3NRLA 3UR9A 1D3PB 5C20A 3NZIA 4BTUB 3LDXH 2V0BA 4F55A 1O2IA 1ESAA 4YZUA 3RXGA 4B2CA 3SNBA 5C1UA 1TA2A 2VWLA 1GBCA 4TT3D 1GVLA 1EZSC 2EI7A 2QF5A 2OUAA 3GY6A 1HYLA 2H9TH 2OC8A 2FMJA 2FLRH 1D3DB 3VB5A 1UVTH 2JH0D 1P11E 2NU4E 1D3QB 1NTPA 4FUEA 1C5YB 2GX4A 4ZAEA 3SU6A 4TPIZ 2LNCA 3T62A 1HAHH 2HNTC 1OS8A 2PKAA 3DA9B 3E16B 2QY0B 3MNBA 1C2IA 1IQFA 3QUMP 1MTWA 1UTNA 1W7GH 1DXWA 1J8AA 3VB6A 1ZZZA 3GY3A 3NWUA 2G55A 5F8TA 2A4GA 1ANEA 3ZZ9A 1NM6A 1PQAA 5FAHA 1ELBA 4X2XA 2AGGX 2UWLA 2WINI 4TPYA 1FIZA 1LVBA 2LELA 1EPTA 4DURA 1CA0B 3T25A 3TLOA 3JZ1B 4I8LA 3S7KB 1UMAH 3OY5U 4THNH 1P2QA 1C1UH 2FX4A 1FPHH 1UTMA 3N7EA 3UTUH 1YLDA 2FOHA 2C8XB 4AG1A 4PROA 2FI3E 3BN9A 3NCLA 3A8AA 3MH4A 4AYVB 4XD7D 3P95A 3S0NA 1GBBA 3ZZDA 1VITG 2KZ4A 2WYGA 1EB1H 2ZU4A 1MZDA 5G4BA 3V13A 1C5LH 1O3JA 2BOHB 3A8CA 1AUTC 1GVZA 2OQUA 1W2KH 4AG2A 4E05H 5KEDA 3A8BA 1G2LA 4X2YA 4AFZA 5HIZA 2ZO3H 4OS7A 4B2AA 4NZLA 3MH6A 1KLIH 4E7RG 4Y0ZE 5EW2H 1HJAB 1W0ZU 3A81A 3EA8A 5E0HA 5HKKD 1OPHB 1YPJH 1F7ZA 4RI0A 1GGDB 1PPCE 2WPKS 3F2FA 2FOAA 4FUBA 4YOGA 4BAQB 5F8ZA 1SG8B 2O8TA 2XNIA 3SGBE 1D3TB 3PWCA 1VKYA 2OD3B 3UNRA 1G30B 2PKAB 3GCTG 5HMAA 3SJOA 1AWHB 3SV6A 3ZZBA 5EIYA 3BG4C 3DSGA 5DP6A 1OP8A 1YLCA 4A1XA 4X6OA 2HLDD 2LP6A 2UUKB 1GJ7B 1EP6A 1CVWH 1UVUH 2OC1A 2O8LA 1F0RA 3LH3A 2QXHA 4Z1MD 3CS0A 4ZKOU 5L30H 5AVDA 2G51A 1EPTB 4IN1A 5EGMA 2A32A 1C5NH 3LPRA 3QTOH 1XUGA 3FP6E 2C3SA 4DG4A 2HRVA 1BTUA 4AFQA 1HUTH 2BHGA 1TBRH 4O3UA 1H8HD 3DCLA 4K1EA 4TY6A 1MD8A 3M7TA 2ALPA 1IQNA 2GZ7A 1VJAU 2Z3EA 2RA0A 2Y6TA 1C2FA 1C9PA 4P00A 1O38A 3LJJA 4K8YA 3VB3A 4UFFH 3ZZ5A 7GCHF 2WZQA 2J92A 1YCPK 2GVFA 4ESTE 3EE0B 3SQHE 3GICB 2BX3A 4I8HA 3HKJB 4YO9A 1ANBA 3EE7A 5HM9A 2ZEBA 2ZTZA 4Y11E 4YT7H 3H7TA 4LXBH 2HNTF 2XOKD 1W8BH 3K2UA 1AKSA 1EAUA 4INLA 4NIYA 2V3HH 1UTOA 2KX4A 3ZVDA 1ELTA 1K21H 1FY5A 5L6NH 3P6ZB 2R9PA 1GJ9B 1OWKA 5F6MA 1EAXA 4UFGH 1HAZB 2SNVA 3UQVA 1QBOA 2V35A 3MQKC 1NU7B 4Y6DA 1SGIB 1SGEE 3GDVA 1BOQA 1OWJA 1NROH 1BRCE 4X8SH 2SGPE 2XCNA 1HJ9A 1O3IA 1UVSH 3BEFB 5JB8S 1E36B 3LGVA 1Y3XA 1BITA 1PPHE 1Z6EA 2AHME 2BXTH 1SHHB 3SN8A 5EW1H 2J4IA 2ZHFH 1K1IA 2BZ6H 3NPSA 1GMHF 1SLWB 4B73A 1IQIA 3VGCC 3QO6A 1UW7A 4ABBA 1ZRBA 1ZYOA 2PV9B 1O3FA 1DLEA 1SGRE 1WDIA 4HGCA 5EQRA 1Q2WA 1B0FA 2FTMA 1QA0A 1O2OA 5EOKA 1SFIA 4F48B 3DSPA 2GCTC 4A92A 5JBBS 1FDPA 2FTLE 3TK6A 3TNTA 3VG8A 1V2LT 2VU8E 3OU0A 1EOJA 2YMSD 4P02A 3RMLH 2G8TA 2Z9KA 3RXEA 1JOUB 2ANMH 3F3BA 2A31A 1CBWC 1ZTKA 2ESTE 1ELEE 1Z71A 2A2QH 3ATKA 1QRZA 2JETB 2IOTA 1QQ4A 2XBWA 5C5OA 5A0CA 4MTBA 1ELVA 4Y0YE 3PLBA 2Z9JA 1C1SA 1BJVA 1LQEA 1O3BA 1TABE 1TPAE 3RXKA 3SZNA 1GWAA 4XBBA 4DVAU 3ZYDA 2GP9B 2G4UA 1TGCA 4INKA 5A8ZA 3T29A 1BMAA 2A5KA 2ZU3A 1HAYB 1ZOMA 1SMFE 2DE8A 1AKSB 2SFAA 1HDTH 3U8TH 1AE8H 2ZGBH 2ZDVH 2Z6BD 3D23A 2G81E 1O2RA 4DIHH 3I77A 5E8EH 2WHXA 1AUJA 1GI3A 4ABEA 4I7YH 1PFXC 1O2LA 1LVYA 3SV7A 5CHAC 4FXGH 2YNBA 1HAIH 3EA7A 2VNTA 4NFFA 3GDUA 3SUDA 1MKXK 3Q3KA 4I33A 4YLUA 1VCWA 3F9EA 1B0EA 2ZWLH 3S9AA 3TNSA 3TVJB 4AYYB 1L4ZA 3RXTA 3RXMA 2B7DH 3QZRA 4NWKA 1DUAA 5HIYA 2I6SA 3RMNH 3KGPA 1GI4A 2G00A 2P8OB 3PLKA 1Y5BT 3H5CB 1DDJA 3LKWA 1Y59T 1T8LA 3L33A 3BF6H 3W95A 3AW0A 3M36A 1TFXA 4UFDH 1A5GH 2D1JA 1AB9C 2OK5A 3T5FH 1K22H 1OWDA 5C17A 4ZXYH 4BANB 1JRSA 1FONA 3O8CA 1ZLRA 2EQNA 5J4SA 4YT6H 1HAOH 1G32B 1XMNB 5B6LA 1TPPA 4M9FA 3UFAA 4ABFA 1T4VH 1K1JA 1UCYH 4B6EA 5E0GA 3LU9B 2BDBA 1O5GH 1TA6A 3GYLB 1GG6C 5GXPA 3PMJA 1ZGVA 4U01A 2H5DA 2KCPA 4GUXA 3A7VA 1BQYA 3GY2A 4IC5A 1T8NA 1HAPH 1C4Y2 1K1OA 1GBKA 1MZAA 3OSYA 2XCFA 1QGFA 3DSOA 1ACBE 2XWBI 2FYQA 1CU1A 2WPJS 1SPJA 2A4OA 3S69A 3NK8A 1CT0E 4TSFD 3SUEA 2OQ5A 1IQJA 4H6TA 2R3YA 4ABGA 4FVBA 3RU4E 1GHVH 3CS7A 2P3FH 4WH6A 1S83A 2K8IA 1A3EH 2QA9E 1V6DA 2CK3D 1INCA 9LPRA 1QJ1B 4BAMB 1B7XB 1TX8A 5PTPA 1ZTJA 3MWIU 4Q4LA 2EEKA 2ZHDA 1E35B 3MO6A 3TH4H 2J94A 2UWOA 2OBQA 1GMCF 1GBHA 2WYJA 4OS5A 1O2MA 4MPWA 2A5IA 1T32A 2AERH 1ZJDA 5T6FA 2JKHA 1J16A 1TQ0B 1JMOH 1G36A 1GI6A 1GBTA 1ZMJA 1RS0A 1YPEH 1YPGH 1XUIA 3KNXA 4XDEA 1AQ7A 2VIVA 2XBXA 1JWTA 2OXSA 3M3SA 4ABJA 2KM0A 1MKWH 4JYUH 3SUGA 5A2MH 1HB0B 3SNEA 2D26C 2H2ZA 1UJ1A 1ZPBA 1O37A 1FY1A 1EP5A 2XXLA 4AFSA 2V3OH 3T28A 3TK5A 4UEHH 3RXCA 1DY9A 4TWYA 1IHTH 2HVXA 1ANCA 5DP5A 1NFYA 4M7GA 2UUYA 1GJDB 1C5MD 4XSKU 3SZEA 1UK4A 3PTBA 3LGTA 2AS9A 4IC6A 1SGQE 3RM0H 1O5EH 1HGTH 1GJ8B 3DHKH 3KQDA 1IQLA 1O2XA 4E7NA 4MQAA 3RXSA 3SBKA 1QJ6B 2FM2A 3OTPA 3JZ2B 5FHTA 1C1RA 1S82A 2ZQ1A 2ULLA 1W12U 1MAYA 2GCHG 2UUFB 2PUQH 3P70B 2PTNA 3A84A 1HCGA 1Y3YA 1V2MT 2AMDA 3AK5A 1F2SE 4H6SB 3SUFA 4CR5A 5GCHG 5CDFE 4VGCC 4FU7A 3E6PH 1ZMLA 1H9LB 1JXPA 5T6GA 2SGFE 1TWXB 1S81A 3M7QA 1D6WA 4U2WA 2QC2A 2BD7A 1P2IA 4SGAE 2P59A 1V2UT 1QFKH 1GDUA 1ABJH 1L1GA 2BY8X 2SGEE 2FWWA 3ZZ8A 1Z1IA 1O2NA 1P9SA 4BXWA 1TE0A 1FN8A 2VGCB 2ZTXA 1BT7A 1Q31A 1UO6A 1PQ8A 3F6UH 4CHAB 2F9VA 1LO6A 4YM9A 1YM0A 1P02A 1AN1E 2J2UA 4YTAA 2XYAA 1Y3UA 2CJIA 4A1TA 1KXEA 2GV6A 1ELDE 1L1NA 1RIWC 1T4UH 2BDCA 1HAVA 1Y5AT 1O39A 4HI3A 4D7FA 1D9IA 2ZGHA 1L1JA 3SNAA 4BXSA 4X1PU 1A0HB 2ZU2A 5EG4A 4FU9A 1UCYE 1V2ST 3MU1A 1FX0B 1S6LA 1TIOA 1WOFA 1TALA 2J5UA 1W10U 1NZQH 2F3CE 2BLOA 1XM1A 2PKSC 1MD7A 3AW1A 2TGAA 1SQOA 1C5XB 1BRAA 1A2CH 2BXUH 3CP7A 3RU4D 1SLXB 5IK2D 3BTGE 2IJOB 1N6XA 1KXDA 1C1QA 4FUHA 3TU7H 3LOXA 1DT2A 5DK1A 3VEQB 4JK6A 1EUFA 2V6NA 2FDAA 5C0TA 1SSXA 3RUOA 2FIRH 4NIVA 4RN6A 2GMTB 1TMTH 3TH2H 2PWXA 4AOQA 1KDQA 1SB1H 3TGIE 1DPOA 1BA8B 3P17H 3ZVAA 2LPRA 1NC6A 1E79D 1RD3B 4K3JA 3F1SB 1HAXB 4WMEA 5I46H 2H1UA 2GT7A 3CENA 1GL0E 5EXNA 3PV5A 4WMDA 1S0QA 2ZP0H 2O9QA 1DWCH 2ZDNA 4K1TA 3F0OA 1CT2E 4BNRA 1C5QA 2AGEX 2W6ID 3MH7A 3F2HA 2OBOA 3FAOA 2CF8H 2PFEA 1F0TA 2TIOA 1MU8B 3FP7E 1TGNA 2ANKH 2OP9A 1EQ9A 1O3NA 2ODYB 2BDIA 1AI8H 2P16A 1IQKA 4LZ4B 1ESTA 2R3UA 1O3CA 3FKSD 4NIWA 3ZVEA 4JZ1A 1HAVB 1SR5C 5EPYA 2PP6A 2VWNA 5C94A 1AFQB 2WPDD 1TB6H 5FCKA 1O2UA 2KCOA 4CH8B 1YWUA 4NFEA 1O2WA 1PPZA 2F43B 2JJ1D 3PROA 4CBNA 3URDA 1YKTA 1Z8IB 2RG3A 3PV4A 4BOHA 2G52A 2WPIS 5FX6A 1GBIA 5FL7D 2BOKA 5CHBA 3LGUA 3ZZ3A 5DP9A 4U32A 5SGAE 1AE5A 3GCHB 2V3MA 1F92A 1FY3A 1O5FH 2C8YB 1Z8JB 1THRH 1A7SA 1GBJA 2GT8A 4YOJA 1CSOE 2WV4A 1TNLA 3SV2H 5BRRE 1HPGA 2IPQX 2ZHEH 1W0YH 1Z8GA 2Y5GA 1F0UA 1F5RA 1Z1JA 1J9CH 2F4LA 7GCHG 1GDNA 4O3TA 1NS3A 3UNSA 4HG6A 1ETTH 5DGJA 3SI4H 1LPKB 2RFKC 3ATIA 4GAWA 2KCAA 3U28C 1JIMA 1DM4B 1AIXH 1KDQB 5FBIA 4ISIH 5TCAA 3Q77A 3T26A 4O97A 4HFPB 3HK6B 4OS4A 2ILNA 1TGSZ 5CE1A 1QL9A 4F49A 1UTQA 4O03A 3BTDE 5I25A 2OC0A 3ZVCA 3T2NA 3DD2H 2CHAB 3BIUH 2BYAX 2W3KA 8GCHF 1O2QA 1DY8A 1VGCB 4ISHH 4Y8YA 1QBVH 3PRDA 1C5PA 4ZMAH 2SGAA 5T6DA 1O3PB 1C1NA 3A87A 1K2I1 2BM2A 2ZHQH 5DP8A 4A1VA 1AD8H 3MOCA 2GDEH 3KIDU 3Q00A 2KR7A 1Y5UT 3PV2A 5JYIA 2PW8H 3GISB 5LH8A 4BTIB 1NN6A 2FOBA 2OC7A 5EXLA 1O30A 1N1LA 4Y10E 2Y5FA 3AAVA 2RDLA 1MU6B 3MH5A 1O2GH 1PPBH 1O5DH 1SGNE 1P09A 3ATWA 1GMHG 4Q7ZA 1W14U 3MNSA 1C2LA 3PLPA 1IAUA 4RKOB 1BMLA 4X6PA 2AIPA 3PMHB 3ZV8A 2HPQH 4WXVA 3M5NA 1UTJA 2ZCLP 2HOBA 3OTJE 1P2JA 1TPSA 1XVOA 5JB9S 3UR6A 4Y7BA 3M35A 1K0HA 2FO9A 3RLYH 2Z9GA 5DO4H 2FOMB 2BLQA 2QF3A 2WPLS 1MTNC 1VCPA 1GI8B 2WUCA 3BSQA 4AN7A 2GTBA 3F0PA 2VIPA 1WYKA 1KTSB 1FY4A 1DSUA 2A2XH 2ZPQA 5FBEA 5E2PA 4H4FA 1GCDA 1AHTH 4KTSA 2YMSB 1S6FA 1NFXA 1LHDH 1S84A 3PTNA 1NPMA 1GI7B 1NRNH 1THPB 4ZCNA 1C2MA 4NGAH 1V2VT 2J95A 3RXFA 4ACBA 1LHGH 3QN7A 2AH4X 2C8ZB 5LPRA 1DLKB 1BCUH 2XRCA 2QYIA 1SGDE 1OWHA 4FETA 1BJUA 4FU8A 1QHRB 3AAUA 4X1SU 1GI5A 3TK9A 2KFWA 3V3MA 5FPTA 2ZI2H 3GS9A 4OGYA 3KQBA 4YESB 2EI8A 3EGKH 2ZGXH 3RC4A 4Z0KA 1THSH 1UK3A 1MUEB 2B9LA 1P9UA 1KXAA 2BDHA 1IHSH 3BTTE 2HLCA 4MVNA 2XC0A 1TNIA 3AVZA 2ZGCA 1GJCB 1V2QT 4YXWD 5EJLA 1GI1A 5FPSA 3SNDA 3DT0H 2VVCA 3KL6A 3KCGH 2F9PA 4Y8XA 1LVOA 1MCVA 2EC9H 2BX4A 3A7XA 2ZDMA 1WBGB 4Y71A 3FZDA 3PRBA 4CRDA 1OHHD 3RXRA 3SU0A 3ZVGA 1C1OA 1GCTC 2NWNA 2VWMA 2CXVA 1N8OC 4FUDA 1WV7H 2BVXH 3N7OA 1PYTC 1TONA 4CR9A 5E0JA 4E06H 2HGTH 1A5IA 1ID5H 2VVVA 3E91A 2YNAA 1FZZA 1G9IE 2G4TA 3SV8A 3ZVFA 2SGQE 1SGTA 2BD5A 2W5EA 3PM3A 1TYNA 3A7ZA 2M2AA 4ACAA 3A8DA 1LDTT 3BG8A 2F91A 3RC5A 3N7DA 2FZZA 1T31A 1E0FD 1RTFB 2FS9A 2A5AA 8KME2 3UY9A 3KEEA 4LZ1H 1BTPA 1EZXC 2B8OH 1U6QA 1C5TA 4KTCA 3SORA 1P3EA 2ZA5A 3GCNA 3UAIC 1NRPH 1QQUA 2STBE 1EJAA 1BBRH 1Q3XA 3SU1A 1MH0A 3SNCA 3U8RH 3F2GA 2KAIA 3E3TA 1V2KT 1ZTLA 2PGBB 2W6JD 2ZECA 4RT0A 1QR3E 1O3EA 3PWBA 4WMFA 4JZDH 4XE4A 1GHAF 5C2ZA 1O3GA 1NFUA 4X6NA 2QXJA 4ZHAA 3W94A 1WCZA 5ESBA 1P8VC 1MAXA 3Q3XA 1GMCG 1GI9B 3UNQA 1SC8U 6CHAC 5EXMA 1SGFG 2QN5T 4GCHF 1QL8A 1LPGB 3QGJA 1WTHD 2QGRA 2RA3A 1D4PB 1TMBH 4FUFA 4WVPE 2IN2A 4ZKSU 5JBTA 4DCDA 4DIIH 1Y3VA 4FVDA 4TWWA 1XUHA 3SQEE 1EKBB 4FUIA 1CGHA 2ZNKH 1FXYA 5DKMA 3ODFA 1FIWA 4JMYA 3D65E 3FFGA 1P2OA 4KKDA 3BTEE 1YY3A 1EZUC 4AGKA 5A8YA 1GJ6A 1ZR0A 3OE7D 2P3TB 4K2YA 5CMXH 3CNRA 4MNWA 3M5OA 5C67A 1BHXF 1YBWA 3KYGA 1A0LA 1TBZH 3P8NA 3FO8D 3UREA 5A0AE 5FXLA 2PTCE 2EA3A 1AO5A 1BB0B 1UCYK 1EXFA 1GBFA 2C8WB 4AB9A 2QXGA 4ZXXH 5DJ7A 2I6QA 2AEIH 2ZFQH 2R2MB 4LK4A 3RXQA 4ASHA 1C2KA 1BMMH 2G5NA 1YPHC 3D62A 4MNVA 3BTME 2AFQB 3EDXB 3Q3YA 4NSVA 1A1RA 2PR3A 4WY3A 1YC0A 1O36A 5EU8A 4B75A 3ZZCA 2ZQ2A 1C5RA 2VINA 2Z94A 2H9HA 1F5LA 2BLWA 3MHWU 3RM2H 3SU5A 3ATMA 1QRXA 5AFZH 1DS2E 1KXBA 2ANYA 2CF9H 2ZCKP 4MG3A 3V12A 1AVGH 1CA0C 2KAIB 2SNWA 4AGJA 3A85A 1C5OH 1K1LA 3ZV9A 3VXEH 1TPOA 3DUXH 4MPXA 3T27A 5C5NA 2W7SA 1YCPM 3P92A 4YLQH 1F5KU 1W13U 2G5VA 4ZHLU 1H8IH 3OAAD 3HATH 1DWEH 4K69A 2Z7FE 3ZYEA 1BTYA 3KQ5A 1KTTB 4IBLH 2BQWB 4AC9A 3RXVA 1P2KA 5LPFA 1C9TA 1NRSH 1IQGA 5DP4A 1KIGH 2PSYA 1O3MA 1ARBA 1SI5H 2GZ8A 4Q7XA 2UUJB 1HLTH 2FOGA 3U98H 1KYNA 1WQSA 1HRTH 2Z3DA 1HJAC 5ETXA 3TH3H 2GDDA 2FS8A 3S7HB 1E38B 1W0KD 1GHYH 1G3DA 3SYJA 1GGDC 4I8GA 1AY6H 3VB7A 2XNDD 3EA9A 3BTHE 4X2VA 1SGFA 3UWJH 3BIVH 1V2JT 1CO7E 3GOVB 3LONA 4X6MA 4B74A 2Z9LA 3C1KA 1TX6A 3A7YA 1ETRH 3NUMA 2Q6GA 1AMHA 6GCHF 1LHFH 3SU2A 1QY6A 3S9CA 2ZGJA 3A88A 3R0FA 1DSTA 2L74A 2STAE 4YOIA 1GHBF 4CH2B 1MBQA 3SI3H 3UIRA 3BEIB 3F9GA 4ABDA 1N6YA 1TGTA 1BBRE 1EPTC 3RDZA 2ZFPH 2BQ6B 4IN2A 4Y79A 5LGOA 2F83A 1SL3A 2BDAA 1EX3A 1XXFA 4MPUA 1T8MA 4WXIA 1Z7KA 1EATA 1HFDA 4SGBE 1ELAA 2P93A 1CHOF 2FODA 4MDSA 3M37A 5DPAA 1H1BA 1L4DA 5A0BA 3A80A 4GVUA 4BAKB 1UK2A 1S0RA 4JZIA 4BAHB 1LTOA 3A83A 3S9BA 3VB4A 3KQCA 2ZFRH 1J17T 1GI2A 1SHYA 1YPMH 4CBOA 1LPZB 4A5TS 1C4U2 2M5TA 1CE5A 1ELCA 2JDID 1BMFD 2TGDA 3UQOA 3SJ8A 5JDUB 4KTUA 1O2YA 1O0DH 2BMGB 4AZ2B 3M7UA 1QL7A 1O3HA 3R3GB 1QNJA 2Q6DA 4ISLA 1X7AC 4J1YA 4NSYA 1UTLM 2TGTA 2BDYA 3P8GA 3VPKA 3MU8A 3VGCB 2AMPA 3VFEA 1JRTA 4BAOB 5KGOA 1NO9H 2P95A 1LHEH 1O3LA 4FUJA 3VXFH 1HBTH 3F68H 1WQVH 2ANWA 2GCTB 3M3TA 2ZCHP 1O3DA 3HPTB 1QBNA 3PO1B 3M5LA 2XTTB 4ABAA 1CBWB 3G01A 3SJKA 2A0QB 1K1MA 2QIQA 1ESBA 1TNHA 2V7QD 2K0QA 2DUCA 4TY7A 1XKAC 1C4V2 4OS6A 4AORA 1CT4E 4ISOA 1YPHE 1DE7H 1LHCH 4B6FA 1JIRA 2L6OA 3QK1A 2BD2A 1H8ED 4OGXA 1QURH 5C1YA 1O32A 3F9FA 4RKJB 1TAWA 1SOTA 1SGPE 1ZHPA 1BRUP 1O33A 1WTGH 3WWBA 1FLEE 3RLWH 3SW2B 5GDSH 1YYY1 4Y7AA 3RC6A 4B1TA 4ZKRU 2QCYA 1TNKA 2HVYB 3E90B 4X1RU 2BY9X 2J38A 1CA8B 1PPGE 2PUXB 1IQHA 1GBAA 2ZZUH 5CHAB 2IJD1 1GBDA 2JETC 8GCHG 5TJXA 1C5SA 4Y8ZA 4CRGA 3MFJA 4D8NA 2A7CA 2NU2E 1IQMA 5GPIB 1Y8TA 3OFND 2B0FA 5C0UA 5FPYA 4D9QA 4ASUD 1YPKH 2TBSA 1G37A 1COWD 3ODDA 2BD9A 4D76A 2EI6A 1RJXB 1C5UA 1C5VA 2FX6A 1PYTD 5EODA 4RSPA 4KGAA 3UUZA 2R0LA 1Y3WA 2A7JA 3KYFA 1C1VH 1LMWB 1UVPA 5AF9H 4BTTB 2F9UA 3TITA 3LGIA 1C2DA 4IMZA 3UB0A 1P06A 1D6RA 1AB9B 2OLGA 1H4WA 4XFQA 1RTLA 3ZVBA 4KELA 8ESTE 1ZJKA 1VITH 1F0SA 1P3CA 2FI4E 1BTHH 1Z6JH 2OINA 2TPIZ 3EYDA 1DWDH 3A7WA 1ZPCA 1V2WT 3TIUA 1BIOA 1GG6B 2O8UA 2FXRA 1V2PT 1TNGA 1SQTA 1WXRA 1XUJA
chains in the Genus database with same CATH topology
1XUFA 4Z6AH 1OX1A 2ZDLA 3I29A 3DFJA 2P8OC 1PJPA 3C27B 2PHBA 3STJA 1ORFA 3KQEA 2FOFA 1GMDF 3EAJA 1EAWA 1LQDB 3U1IB 2BD8A 1TGBA 3UWIA 3P8OA 1TNJA 1E34B 1K28D 3KHVA 3PB1E 3LGWA 3RP2A 1VCQA 3RXUA 1ZPZA 1EJMA 1CGJE 2FP7B 2WV5A 1O5BB 3LC5A 1O2TA 1TQ7B 3MU4A 3BTWE 1KLTA 1GJBB 3MMGA 2ZDKA 5LPEA 4NZQA 1P12E 3MO9A 5ESTE 1P05A 1O3OA 2BQ7B 1UHBA 3QWCH 2WPHS 1CHGA 1KY9A 1QJ7B 3GY4A 4NA8A 5EPNA 4X8TH 3B9FH 2Y82A 1G3EA 1OYQA 3ZZAA 4UONA 3UOPA 3B8JA 1ELGA 1XKBC 4CRCA 2BB4A 1TRYA 2H6MA 1XUKA 5L2YH 3LIWA 3GYMA 1A3BH 3UPEA 1ZHRA 1P03A 6ESTA 1QRWA 5GIBA 2IPHA 1GBEA 2HWLB 4CRBA 2FOEA 4JCNA 3E0NB 1LKBA 1SBWA 1FMGA 2ZPRA 4ZHMU 1QCPA 1QA7A 3A82A 4WJG2 2XC4A 1O3AA 4O9VA 1H9HE 1SOZA 1GL1A 4XBDA 4DW2U 2J34A 4R8TB 3QLPH 3O8RA 2F9OA 1K1PA 5C1XA 2O8WA 3BTQE 3H7OA 1HNEE 2W26A 5JBCS 3SJIA 4INHA 1V2TT 3RXPA 1A0JA 4IW4E 1OSSA 2NU0E 4ABIA 4D9RA 2PLXA 2Z9IA 1DITH 2F9BH 5HYOA 1MMJN 2QXIA 5K7RA 1DANH 1QB9A 2RCEA 4OS2A 3TJVA 1FPCH 1J15A 3QDZB 2PGQB 3OY6U 2VIQA 2Y7XA 4CRFA 4HZHA 5C3NA 1G2MA 4A6LA 1TRNA 2ZKSA 5L2ZH 3E8LA 5ABWA 1BTZA 1C2EA 1MCTA 1O2JA 1S85A 4VGCB 2BY5X 4ABHA 2ZPSA 2BTCE 1NRRH 4UE7H 5BPEA 3A7TA 1FN6A 2VH6A 1UHBB 4WF8A 1GBMA 3K6YA 1FAXA 3SGQE 5EQSA 4JZFH 5J4QA 1YCPH 3ZZ7A 1NESE 3EQ0H 1FI8A 2ZTYA 3ESTA 1ETSH 1O35A 1TOMH 1VITF 1GHAG 2C4FH 3SOSA 2FPZA 4I31A 1HIAA 4JYTA 2AYWA 1ELFA 3HK3B 3STIA 2HALA 2Y7ZA 3B23B 1LKAA 4ZROA 2FESH 4GSOA 4GCHG 4AFUA 4ZH8A 3NKKA 2JH5D 1RIWB 1K9OE 3TGJE 5DP7A 2A1DB 4F4OC 1EOLA 7KMEH 1ZMNA 4ZKNU 1O2ZA 1MTSA 2FI5E 4GPGA 3ZZ4A 1O5CB 1OYTH 1BMNH 2GD4B 4Y76A 1AVWA 3GY7A 2C90B 2VIWA 3MU5A 2P3UB 5B6OA 2VGCC 2PKSB 3SU3A 2HNTE 1G3BA 3GCTF 3SHAH 1YPLH 2XBVA 1UTKA 3BV9B 1GHZA 4CHAC 1YP9A 2VVUA 4X1NU 1DFPA 2FEQH 1DICA 5IDKA 1DXPA 3A89A 2H9EH 1G3CA 1V2NT 3ENSB 2ZFFH 1RGQA 2Z3CA 4JZEH 4CREA 1YF4A 3SU4A 1AZ8A 1ABIH 1NT1A 1ZSJA 1B5GH 1C5ZB 3LGYA 1FAKH 1FUJA 4NA9H 4UDWH 2VIOA 1HV7A 1AFEH 1CGIE 1OXGA 1SVPA 1Z8RA 2R2WU 1QTFA 1EASA 3K65B 3PO1C 1P0SH 3RXAA 1XXDA 1EJNA 1OKXA 3RXOA 2ASUB 9ESTA 1SGYE 4AB8A 3HGPA 1AZZA 1BBRK 3MU0A 4QT8C 4OS1A 2XW9A 1HIAB 1WU1A 1A46H 3BEUA 5K0HA 1TMUH 1P10A 4HTCH 1A5HA 3QX5H 4I8JA 4B2BA 3K6ZA 4X8VH 2ZF0H 4WWYA 3FP8E 1T8OA 1GBLA 1RXPA 5A8XA 2CV3A 2ODQA 4DOQA 1FJSA 1QB6A 3UOUA 1O2KA 3MTYA 1A4WH 1BTWA 3M61U 4Q80A 2GMTC 3RXHA 3O8DA 1E37B 1MTUA 3TGKE 2ZC9H 1FV9A 3ITIA 5AFYH 2A4RA 2FYRA 2D2DA 3LH1A 4MNYA 1MKXH 1TOCB 3FVFB 1OOKB 1NRQH 2UWPA 3SJ9A 4B71A 2ZG0H 2R0KA 1LCYA 2XWAA 1L0ZA 3ATLA 1GI0A 4FUGA 1L2EA 5A09A 2GZ9A 2GV7A 2K1QA 4X8UH 1PPEE 1GDQA 6GCHG 4JYVH 2CMYA 3A86A 1SGCA 1EAIA 2OCVB 2WUBA 1ZHMA 3IITA 1AFQC 3RXJA 1O3KA 1O2SA 2YOLA 1KSNA 1AU8A 5FCRA 3TJUA 4GHQA 3M3VA 4DJZB 2BD4A 4DGJA 1GHBG 2QAAA 2ZDAH 4K1SA 3FZZA 1IQEA 4B76A 1ARCA 3MYWA 1RRKA 1EB2A 2TRMA 2AMQA 2CGAA 1TBQH 3OX7U 3GCHC 1JBUH 4K5ZA 3WY8A 4UD9H 1DVAH 1HJ8A 2VJ1A 4D7GA 5HGGA 1UTPA 1OWEA 3L6PA 2XBYA 1VZQH 2PSXA 5GJ4B 1XX9A 1V2OT 4DT7B 2CN0H 1CHOG 3GCOA 3MI4A 2ZIQH 4H42U 5F03A 3RXDA 1C1PA 3AASA 3V7TA 1SLVB 2SGDE 3QZQA 3SV9A 1AVXA 4K60A 3MNCA 2H5CA 3RXBA 2J9NA 2HPPH 1M9UA 1O5AB 3NXPA 5E2OA 3BG4B 4JK5A 4NIXA 4K8BA 1IOEA 1KXCA 2B5TB 1W11U 1ZSKA 2Q6FA 1C1WH 2QF0A 2AIQA 4LOYH 2Y81A 2QV1A 3SHCH 2VIDA 1SFQB 4MLFB 2CHAC 4NA7A 1MTVA 2BLVA 1VGCC 3IWMA 1FNIA 1MKWK 3LJOA 1P2MA 3L3TA 5AHGH 3U69H 4FUCA 3E0PB 5JPMH 3QTVH 4KP0A 1GHXH 1OP2A 5JBAS 4Q7YA 3O8BA 1TX7A 2DE9A 4WH8A 1GJAB 3LC3A 1MTNB 2W3IA 1S5SA 3ZZ6A 1C5WB 4GLYA 3LT3A 1NU9A 1V2RT 1NY22 1GHWH 1WSSH 2XC5A 3OYPA 7ESTE 3TJOA 2VH0A 1K1NA 3ELAH 1BHXB 2ODPA 3DFLA 1GVKB 1KXFA 3F9HA 1WUNH 2BVSH 7LPRA 4TYDA 3E1XB 4X0WU 3RXIA 1P04A 4A7IB 1DX5M 2ZFTA 4J2YB 1O31A 2Q1JA 2W7UA 1VR1H 2F9NA 2VB0A 1BRBE 2C93B 1BZXE 2Y80A 1C2JA 2ALVA 4UFEH 4MNXA 5TCCA 1AGJA 1C2HA 3GY5A 1SQAA 1BDAA 2BD3A 5H4IB 2FOCA 1UVOA 1P01A 4NG9H 2A7HA 4ZUHA 2GKVE 3RMOH 2THFB 1TRMA 1VJ9U 4XOJA 1DOJA 2BY6X 1P2NA 4Q2KA 4GHTA 3Q76A 5FX5A 4X1QU 1XVMA 1LVMA 1RTKA 4X2WA 3QGNB 5DP3A 3I78A 1KLJH 5HXFA 2GGVB 1HXFH 1HXEH 3TJNA 2BDGA 1ANDA 2ZHWH 2P94A 4XBCA 3RXLA 3U9AH 5GWZA 4ISNA 1EZQA 1C1MA 1GCTB 1O2HA 3D49H 1P57B 2BVRH 1GPZA 1N8OB 1TLDA 3SGAE 1H8DH 1OP0A 1RFNA 2OTVA 3PYHA 1FY8E 2Y5HA 1DWBH 1W3CA 4U30A 1O2VA 1QIXB 5IYTA 5F8XA 4NCYA 2WPMS 1J14A 1FQ3A 1A61H 3IG6B 2ZFSA 1C2GA 2FLBH 2JH6D 5HM2A 1HAGE 2A45B 3HGNA 3PMBB 1PPFE 2ZU5A 6LPRA 1GJ4H 4NWLA 4I32A 1NFWA 2TGPZ 1QB1A 4R0IA 3URCA 8LPRA 1GMDG 3KF2A 2BY7X 1CQQA 4IS5A 2NU1E 3V0XA 1O2PA 4IMQA 3BTFE 2ZU1A 4MPVA 1WAYB 3U1JB 3HKIB 3P8FA 2AGIX 1MQ6A 1AWFH 3FANA 1O34A 3K9XB 1H9IE 3PMAB 5EQQA 1GJ5H 1T7CA 3TPIZ 3GDSA 4CRAA 1ZRKA 3BTKE 2A4QA 3M5MA 2VWOA 3GY8A 2NU3E 3RU4T 1BUIA 3KN2A 1V3XA 4I8KA 3MO3A 5DG6A 1C1TA 1S6HA 1PQ5A 2BZAA 3MNXA 1SLUB 4IGDA 1DUEA 1ZGIA 2GCHF 2D8WA 5T3HA 3U8OH 4AX9H 1YGCH 4DY7B 1MQ5A 6CHAB 1OWIA 2O8MA 1PQ7A 5GCHF 3SO3A 3RMMH 1BTXA 1MBMA 1ZSLA 1W7XH 3UR9A 1D3PB 5C20A 3NZIA 4BTUB 3LDXH 2V0BA 1O2IA 1ESAA 4YZUA 3RXGA 4B2CA 3SNBA 5C1UA 1TA2A 2VWLA 1GBCA 1GVLA 1EZSC 2EI7A 2OUAA 3GY6A 1HYLA 2H9TH 2OC8A 2FMJA 2FLRH 1D3DB 3VB5A 1UVTH 2JH0D 1P11E 2NU4E 1D3QB 1NTPA 4FUEA 1C5YB 2GX4A 4ZAEA 3SU6A 4TPIZ 2LNCA 3T62A 1HAHH 2HNTC 1OS8A 2PKAA 3DA9B 3E16B 2QY0B 3MNBA 1C2IA 1IQFA 3QUMP 1MTWA 1UTNA 1W7GH 1DXWA 1J8AA 3VB6A 1ZZZA 3GY3A 3NWUA 2G55A 5F8TA 2A4GA 1ANEA 3ZZ9A 1NM6A 1PQAA 5FAHA 1ELBA 4X2XA 2AGGX 2UWLA 2WINI 4TPYA 1FIZA 1LVBA 1EPTA 4DURA 1CA0B 3T25A 3TLOA 3JZ1B 4I8LA 3S7KB 1UMAH 3OY5U 4THNH 1P2QA 1C1UH 2FX4A 1FPHH 1UTMA 3UTUH 1YLDA 2FOHA 2C8XB 4AG1A 4PROA 2FI3E 3BN9A 3NCLA 3A8AA 3MH4A 4AYVB 3P95A 3S0NA 1GBBA 3ZZDA 1VITG 2WYGA 1EB1H 2ZU4A 1MZDA 5G4BA 3V13A 1C5LH 1O3JA 2BOHB 3A8CA 1AUTC 1GVZA 2OQUA 1W2KH 4AG2A 4E05H 3A8BA 1G2LA 4X2YA 4AFZA 2ZO3H 4OS7A 4B2AA 4NZLA 3MH6A 1KLIH 4E7RG 4Y0ZE 5EW2H 1HJAB 1W0ZU 3A81A 3EA8A 5E0HA 1OPHB 1YPJH 1F7ZA 1GGDB 1PPCE 2WPKS 2FOAA 4FUBA 4YOGA 4BAQB 5F8ZA 1SG8B 2O8TA 2XNIA 3SGBE 1D3TB 3PWCA 2OD3B 3UNRA 1G30B 2PKAB 3GCTG 5HMAA 3SJOA 1AWHB 3SV6A 3ZZBA 3BG4C 5DP6A 1OP8A 1YLCA 4A1XA 4X6OA 2UUKB 1GJ7B 1EP6A 1CVWH 1UVUH 2OC1A 2O8LA 1F0RA 3LH3A 2QXHA 3CS0A 4ZKOU 5L30H 5AVDA 2G51A 1EPTB 4IN1A 5EGMA 2A32A 1C5NH 3LPRA 3QTOH 1XUGA 3FP6E 2C3SA 4DG4A 2HRVA 1BTUA 4AFQA 1HUTH 2BHGA 1TBRH 4O3UA 4K1EA 4TY6A 1MD8A 3M7TA 2ALPA 1IQNA 2GZ7A 1VJAU 2Z3EA 2RA0A 2Y6TA 1C2FA 1C9PA 1O38A 3LJJA 4K8YA 3VB3A 4UFFH 3ZZ5A 7GCHF 2J92A 1YCPK 2GVFA 4ESTE 3EE0B 3SQHE 3GICB 2BX3A 4I8HA 3HKJB 4YO9A 1ANBA 5HM9A 2ZEBA 2ZTZA 4Y11E 4YT7H 3H7TA 4LXBH 2HNTF 1W8BH 3K2UA 1AKSA 1EAUA 4INLA 4NIYA 2V3HH 1UTOA 3ZVDA 1ELTA 1K21H 1FY5A 5L6NH 3P6ZB 2R9PA 1GJ9B 1OWKA 5F6MA 1EAXA 4UFGH 1HAZB 2SNVA 3UQVA 1QBOA 2V35A 1NU7B 4Y6DA 1SGIB 1SGEE 3GDVA 1BOQA 1OWJA 1NROH 1BRCE 4X8SH 2SGPE 2XCNA 1HJ9A 1O3IA 1UVSH 3BEFB 5JB8S 1E36B 3LGVA 1Y3XA 1BITA 1PPHE 1Z6EA 2BXTH 1SHHB 3SN8A 5EW1H 2J4IA 2ZHFH 1K1IA 2BZ6H 3NPSA 1GMHF 1SLWB 4B73A 1IQIA 3VGCC 3QO6A 4ABBA 1ZRBA 1ZYOA 2PV9B 1O3FA 1DLEA 1SGRE 4HGCA 5EQRA 1Q2WA 1B0FA 2FTMA 1QA0A 1O2OA 5EOKA 1SFIA 2GCTC 4A92A 5JBBS 1FDPA 2FTLE 3TK6A 3TNTA 1V2LT 2VU8E 3OU0A 1EOJA 3RMLH 2G8TA 2Z9KA 3RXEA 1JOUB 2ANMH 2A31A 1CBWC 1ZTKA 2ESTE 1ELEE 1Z71A 2A2QH 3ATKA 1QRZA 2JETB 2IOTA 1QQ4A 2XBWA 5C5OA 5A0CA 4MTBA 1ELVA 4Y0YE 3PLBA 2Z9JA 1C1SA 1BJVA 1LQEA 1O3BA 1TABE 1TPAE 3RXKA 3SZNA 1GWAA 4XBBA 4DVAU 3ZYDA 2GP9B 2G4UA 1TGCA 4INKA 5A8ZA 3T29A 1BMAA 2A5KA 2ZU3A 1HAYB 1ZOMA 1SMFE 2DE8A 1AKSB 2SFAA 1HDTH 3U8TH 1AE8H 2ZGBH 2ZDVH 2Z6BD 3D23A 2G81E 1O2RA 4DIHH 3I77A 5E8EH 1AUJA 1GI3A 4ABEA 4I7YH 1PFXC 1O2LA 1LVYA 3SV7A 5CHAC 4FXGH 2YNBA 1HAIH 3EA7A 2VNTA 4NFFA 3GDUA 3SUDA 1MKXK 3Q3KA 4I33A 4YLUA 1VCWA 3F9EA 1B0EA 2ZWLH 3S9AA 3TNSA 3TVJB 4AYYB 1L4ZA 3RXTA 3RXMA 2B7DH 3QZRA 4NWKA 1DUAA 2I6SA 3RMNH 3KGPA 1GI4A 2G00A 2P8OB 3PLKA 1Y5BT 3H5CB 1DDJA 3LKWA 1Y59T 1T8LA 3L33A 3BF6H 3W95A 3AW0A 3M36A 1TFXA 4UFDH 1A5GH 2D1JA 1AB9C 3T5FH 1K22H 1OWDA 4ZXYH 4BANB 1JRSA 1FONA 3O8CA 1ZLRA 5J4SA 4YT6H 1HAOH 1G32B 1XMNB 1TPPA 3UFAA 4ABFA 1T4VH 1K1JA 1UCYH 5E0GA 3LU9B 2BDBA 1O5GH 1TA6A 3GYLB 1GG6C 5GXPA