2UUYA

Structure of a tick tryptase inhibitor in complex with bovine trypsin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title A Tick Protein with a Modified Kunitz Fold Inhibits Human Tryptase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2uuyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2uuyA02
2XBXA 1INCA 1PYTC 2ZA5A 3P8GA 1E35B 2H1UA 1ZHPA 4MNVA 1LHFH 2XW9A 2Z6BD 1WOFA 4JZIA 2FIRH 5FX5A 1Z1IA 3BG4C 1MUEB 2G51A 4ABFA 1JXPA 4TY7A 3CENA 2OC1A 4DJZB 2JKHA 1P9UA 1V2UT 3E8LA 1GVLA 4ZHLU 1KLTA 5LH8A 3ODFA 1K1IA 1WQVH 2W7UA 2G52A 4IC5A 1J9CH 2P3UB 1K28D 2Q6FA 3NXPA 5FPSA 1C5SA 1DLEA 2WYJA 3O8DA 5LPFA 1SOZA 1QY6A 1SR5C 5CHAB 2J95A 1WBGB 4YO9A 2XC5A 5JBCS 2UUYA 3L33A 5JYIA 1ELAA 4X2WA 1QURH 4PROA 1Z8RA 5K7RA 3HATH 2A7CA 2QXJA 1F0SA 1QTFA 5F8XA 5GXPA 2Y82A 2J94A 1EJAA 2BD8A 2IPHA 3N7OA 4VGCC 6CHAC 1H9IE 1O30A 2XYAA 1CO7E 1DANH 3GDVA 1UTMA 3RMLH 1O2WA 3EAJA 2Y80A 5ABWA 1ELGA 1NTPA 1C9TA 3K65B 2VIVA 1VJAU 1AVGH 2SNWA 1ETTH 5DP8A 1ZTKA 5DP3A 3SU1A 2ZDVH 1NRSH 2F9NA 2FXRA 1OYQA 2BOKA 1THSH 1L1GA 1BJVA 5C2ZA 1GJCB 2XNIA 2ZTYA 3AW1A 3SOSA 3U1IB 1FUJA 4RKJB 1O5EH 2FOBA 1AZZA 2O8MA 4LOYH 1O3LA 1V6DA 3MYWA 1GI6A 1O2ZA 3TIUA 1VITG 4KGAA 1DM4B 2A32A 2OD3B 1O2IA 4FXGH 1HAZB 5HMAA 1TMBH 4B1TA 1HAIH 1O35A 5F8TA 1L2EA 1RRKA 5DG6A 3BTHE 1E38B 1SC8U 4H4FA 5E0JA 1XXDA 2ZO3H 2EC9H 2ZQ2A 2QXIA 1LKAA 2GTBA 2BY9X 1HNEE 1K9OE 1HRTH 1NFYA 1YM0A 3QTVH 2XBYA 3TPIZ 2GDEH 1TGCA 1LPZB 4GCHG 1KYNA 5TJXA 1S83A 3ITIA 3BTGE 1W12U 1GBKA 4BTUB 1BT7A 1NT1A 4K3JA 1WTHD 3KQBA 3A8CA 4O3TA 3T26A 2ZPSA 1FAKH 3W95A 5EQRA 1C5QA 3B9FH 5EG4A 1V2KT 1ZMLA 3P6ZB 3KQEA 4CHAC 3RLYH 1F5LA 3D62A 3RXGA 4WMEA 2WPHS 1J14A 1BHXF 3E90B 3FP8E 4NGAH 3UWIA 2H9HA 5AFYH 1UJ1A 5EXMA 1HAHH 1P05A 2C8XB 2M5TA 3ODDA 1G2MA 3GISB 1XUFA 3VXFH 3ZVFA 4AORA 4Z6AH 4D9RA 3TJVA 1C1WH 1IHSH 1GBBA 1GHWH 4ZKRU 2GCTC 2TIOA 3HK3B 3Q3XA 1LTOA 2GT7A 1SGYE 2ZDNA 1Z7KA 1QRWA 3VPKA 3R3GB 5EPYA 1HAVA 1TPAE 4BAOB 4WXVA 2YOLA 3MO9A 4CRGA 1RXPA 5SGAE 1UVSH 2ZGBH 1WCZA 1YF4A 5LPRA 2GVFA 3KQCA 1IQLA 4FUFA 4AGJA 4AYVB 2PUQH 5E2OA 1UTNA 1PJPA 3DHKH 1EJNA 2ZPQA 2BLVA 2OINA 4ZHMU 1P2MA 5JB8S 1ZSLA 1OWIA 4X1RU 2WINI 4ZUHA 5FBEA 2W3IA 2VIPA 2NU1E 1TPPA 2OC0A 2Y81A 1AKSA 1QQ4A 1ID5H 4NA8A 4B71A 2PR3A 4AG1A 1EAUA 3UQOA 2A1DB 2XRCA 1A1RA 1FPCH 2EI6A 1O39A 3RMMH 1GBTA 1MCTA 3SNBA 1ZGIA 1SG8B 3U1JB 1BHXB 1T32A 5EW1H 2B7DH 3A89A 1T8MA 1UTLM 2QN5T 2G81E 1A5GH 1GVKB 4YLQH 4ISNA 1EQ9A 3TJNA 1Y59T 1BTYA 2UWOA 1DSTA 4ISIH 2VH0A 3OU0A 3VB7A 4E7NA 3G01A 2VVCA 3SV9A 2HNTF 1HAOH 1QBVH 2ESTE 1VITH 5JDUB 3S9BA 1SGPE 1Y3UA 1ELEE 1O3NA 1C5PA 1O2VA 2FODA 2KAIA 1YPGH 3MH7A 1HJAC 3FZDA 1Y5AT 3T29A 3WY8A 1ETRH 2ZHWH 3ZZ9A 2P3FH 1AUTC 1E34B 1HIAA 3GY7A 4UFGH 3SQHE 1G3DA 3TK9A 3RXIA 2H6MA 1U6QA 1BTXA 1VCQA 4IC6A 1F2SE 1YBWA 1SGFG 1TBRH 1ZRKA 2VH6A 1Y5UT 3VB3A 5FAHA 1QL9A 4KTCA 1EPTC 1FQ3A 3OY5U 1HJ8A 4UFFH 3PO1C 4X1NU 1BJUA 1EATA 3DUXH 1SLUB 4KTSA 2TGTA 1DOJA 4F49A 3UFAA 1Z8JB 3UWJH 3LIWA 4UE7H 3EA7A 3TJUA 1QB1A 4D9QA 5E0HA 3A8AA 1CBWC 3HKIB 1G36A 1O3EA 4U2WA 4Y7AA 1C5LH 2A0QB 2YNAA 2BDYA 1C9PA 5DP5A 4ZKSU 5GCHF 1N8OC 1JWTA 1UTPA 2FWWA 1AB9B 3DFLA 1FONA 2CMYA 2HGTH 3VXEH 2ZECA 1VITF 4K8YA 3T28A 4A5TS 3S69A 1BMMH 1RD3B 1UCYH 1S5SA 2Z9IA 3SU2A 2TGAA 2OQ5A 3RXDA 3M3TA 3GDUA 2HNTE 2ODYB 1T8OA 3EA8A 1TALA 3ZVEA 3VEQB 3PWCA 4MDSA 4I8GA 3MOCA 3PWBA 4CBOA 1TLDA 4INLA 1BTPA 2A2QH 4O97A 1KTTB 1CU1A 1MAYA 4NIVA 1P01A 1W7XH 1IQMA 4NZLA 5E8EH 1EAXA 2ASUB 1CT2E 4GCHF 1LVYA 1O2LA 1GMDF 1TPOA 3P17H 2STAE 3O8RA 1GBIA 4MNWA 4R0IA 1Y3XA 4YOIA 3BV9B 2ILNA 3A7VA 4XDEA 3MH4A 1W7GH 2VU8E 2ZU5A 3RXSA 4SGAE 5AVDA 3SU0A 2JH0D 4CH8B 4K1TA 1YCPM 1O2NA 3F9HA 1T4UH 3GCHC 4NA7A 3P8FA 1EZUC 2XWAA 1UCYK 1WYKA 2BMGB 1EXFA 5A0CA 3SNAA 3RXKA 4X2YA 1GHYH 3JZ2B 2CV3A 2A2XH 3LH1A 5C1UA 3RMOH 4JCNA 2QIQA 1EP5A 4MQAA 1GCTC 1CA0C 3SHCH 1OX1A 1IOEA 2RA3A 1NU9A 1TX8A 1SHHB 3ZV8A 2HPQH 3R0FA 1S6HA 1A7SA 1G3EA 4NIYA 1GGDB 1HAXB 5AHGH 5ETXA 2ZDAH 4YOGA 5HYOA 4AB8A 1NS3A 1MBMA 5DP6A 3H7OA 3RXFA 3MMGA 2ZGXH 4ABEA 3UTUH 4FUDA 3PV4A 1P09A 3UIRA 2RG3A 3OX7U 1C2EA 2ZU4A 2ZU1A 3UR9A 4THNH 3RM2H 1C1TA 4NSVA 1O2TA 4MPWA 3A7YA 3RU4T 2Z94A 3ZZ3A 3M61U 5A8XA 3F68H 1E0FD 3I29A 4ABDA 2XCNA 1MU8B 2ANWA 1D3DB 4GAWA 2TGPZ 1DXPA 3LH3A 2CJIA 1C1OA 2Z7FE 3BTDE 1DICA 2G5NA 1NRNH 2A5KA 5JBAS 5JBTA 2V6NA 4IBLH 1GJ7B 1BRBE 3GCNA 3BTWE 1VZQH 3D49H 4BXWA 2GZ7A 1UHBA 3FAOA 4AB9A 1UCYE 3SNCA 1X7AC 3PB1E 1BRAA 2CF8H 4WMDA 1GMCF 1NRQH 2J34A 5E2PA 1TFXA 2UUJB 3SUFA 2FPZA 1TA6A 2ANMH 1D4PB 1RGQA 5HM2A 2THFB 1FNIA 3RXCA 2BYAX 3SNEA 1ESAA 3M5MA 1F7ZA 1BBRH 4WY3A 4DY7B 1A46H 3O8CA 2AYWA 3AVZA 3RXJA 1SFQB 1C2MA 1K1OA 4Y7BA 1KXBA 4DCDA 1P2KA 3TGKE 4UDWH 1BQYA 3RM0H 1O3MA 3EA9A 5F03A 2JH6D 1UTOA 1HXEH 1QA0A 4X6NA 5FPTA 2C8YB 4ZXYH 3ATLA 2BQ6B 1A2CH 1TNJA 5J4SA 1DXWA 2BXUH 2GZ9A 3M5OA 3KL6A 1DSUA 4BAKB 1BMNH 1MKXK 1P2OA 2BY5X 2XWBI 3RU4D 4FVBA 2G4UA 3SGQE 1ZSJA 3PTBA 4ZH8A 1QJ7B 5C1XA 3M3SA 1C1UH 8KME2 3K9XB 3SUGA 4B74A 3MO3A 3O8BA 4X8UH 3PMAB 2VGCB 1QL7A 3UNSA 2CXVA 1AFQC 1BBRK 3P92A 4Y0ZE 1ZYOA 2P8OB 3VGCB 2VINA 2ZGJA 2C90B 3LGWA 1OWHA 2AIPA 1C4V2 1XUIA 4IN1A 4NIWA 4AFUA 1VGCB 1ZHMA 2R0LA 1W14U 2ZFSA 1BRUP 1P8VC 3TLOA 3SJIA 3LJJA 3ZVBA 1DS2E 1NFXA 2H2ZA 1GMHG 1DWEH 4MNXA 2BLOA 1G2LA 1UVUH 1EJMA 1O2SA 3QO6A 2FOAA 4ZMAH 3TK5A 1TBZH 2O8LA 3F6UH 5BRRE 4OGYA 5GPIB 3QGJA 2D2DA 2A31A 4FUBA 3KIDU 4X2VA 1W3CA 1L4DA 4DT7B 3MFJA 1NZQH 2ZCLP 2ZCKP 1MCVA 2AH4X 2FOEA 1FY5A 3P8OA 4X6MA 1MAXA 3A80A 1MTNC 1C5VA 1S0RA 1EB2A 2PLXA 3QN7A 1G37A 1O2GH 1QQUA 1O2OA 3VB6A 1MU6B 1AFEH 1WU1A 4IW4E 1CVWH 4A1TA 1TMTH 2ODPA 3E91A 3LGYA 3ZZ5A 2XXLA 2FS9A 2AGGX 4LK4A 2PTCE 2ZF0H 2ZDMA 1G32B 2R0KA 1BBRE 1L0ZA 2FDAA 2NU4E 1OSSA 2NU3E 4Y10E 1Z1JA 6CHAB 1CGIE 2F83A 1B7XB 3RP2A 1TX6A 4Y11E 1DVAH 4ABIA 1TA2A 3PYHA 3ATWA 1GHAF 1FY4A 1PPBH 2FO9A 4HFPB 1A0HB 1H8DH 4YESB 2Z3EA 5J4QA 1BB0B 1BTHH 5FPYA 4KP0A 1GDNA 1L1JA 4O03A 1P02A 4JZ1A 3BTKE 1EZSC 5EPNA 4FU8A 2H9TH 1PFXC 3MU5A 1WTGH 2HVXA 3GCTF 4X0WU 1EUFA 3E3TA 1FPHH 1P57B 1TONA 5IDKA 3SV7A 3E6PH 4X2XA 2ALVA 1BDAA 4D7FA 3GYLB 3UNQA 1O5AB 1O5CB 8GCHG 2PWXA 3TNSA 1MD7A 2GV6A 2AFQB 1O33A 3A7XA 8LPRA 4WVPE 3M7QA 2Q6DA 4JYTA 2QCYA 3ZZ6A 2ZCHP 4WJG2 2A4RA 5GCHG 7ESTE 1T8LA 1WUNH 5AFZH 1KDQB 1PPGE 1ZTJA 4X1SU 4Y0YE 4RN6A 5FCRA 1K1NA 1W11U 5BPEA 4IMQA 2D26C 2CHAC 2Y5FA 3MH5A 4OS1A 1RIWC 4Q2KA 1Z6JH 4U01A 2QF3A 1O2KA 1TRMA 1O37A 7LPRA 4D76A 1P3EA 4OS7A 1IQEA 3E16B 1HV7A 4BTIB 1O2RA 2AMPA 2NU0E 1P3CA 3URDA 1D3TB 4WWYA 1RTLA 3LGUA 1F0TA 1G9IE 4R8TB 2BOHB 1GMDG 1A0LA 1O3CA 3SW2B 1GG6C 2VVUA 5ESTE 3V3MA 1QR3E 5EGMA 1ESBA 1WV7H 3Q3KA 3K2UA 3B23B 3IWMA 1O2UA 3AW0A 3SUDA 2SGFE 3P8NA 2FYQA 1GI1A 1P11E 2VB0A 4ESTE 4NA9H 3MU8A 2ZFRH 2J38A 2GGVB 1QRXA 2GCTB 1D3QB 4LZ4B 1ELBA 1TQ7B 1LVOA 2EI7A 3U9AH 1BMLA 1FN8A 1G30B 1GJBB 5T3HA 1LHGH 1SPJA 2PKAB 1AN1E 1GMHF 2GT8A 5T6DA 1QGFA 3SU5A 1GJ8B 2VIDA 1C5UA 1V2OT 1K1LA 2BDIA 4OS6A 1TGNA 5EW2H 4INKA 1A0JA 3AAUA 1C1SA 4NG9H 5LPEA 1ELFA 4NFEA 5G4BA 3TVJB 3A84A 1H9HE 1GBCA 2BHGA 3BG8A 1DY9A 1YKTA 4XE4A 4DG4A 2SGQE 1P10A 1EX3A 3U8RH 1IHTH 1IQGA 3RXQA 3UOPA 3GY2A 3UUZA 1GHVH 2GD4B 1NESE 3NCLA 1C1RA 4CR9A 3MO6A 1NFWA 4TPYA 2A45B 1L4ZA 3Q00A 1K22H 2BDHA 2ZNKH 2UUFB 3QUMP 1O3OA 1AHTH 2VWLA 3P70B 2V3OH 1THRH 3PMBB 1K1JA 1O5GH 1G3CA 3L3TA 1H9LB 2Z9JA 4JZDH 3QWCH 2JETB 2QAAA 4A1XA 2BTCE 2NWNA 1HJAB 1NRRH 1O2PA 6ESTA 5A8YA 2LPRA 4JMYA 1O3IA 3MU4A 4IMZA 4Y79A 2OTVA 1FN6A 4ZAEA 1QJ6B 3SU6A 1P03A 1GMCG 2PHBA 3NK8A 2CGAA 3GY4A 2VNTA 1SL3A 5F8ZA 5K0HA 2IJOB 1B5GH 4MPUA 3VFEA 1TBQH 1DUAA 1FY1A 3LC3A 3M5LA 1EPTB 3MWIU 3ZZAA 3PO1B 2VWMA 1CGHA 2PV9B 3RMNH 5DJ7A 1YPHC 1SGCA 4K69A 3BIVH 4UFDH 2ZG0H 1GI8B 2BDBA 2P59A 1TX7A 2FS8A 3ZV9A 5AF9H 1JRSA 1XUHA 4X6PA 5A2MH 1AI8H 5DKMA 1J15A 2VVVA 4AOQA 3ZZBA 1GI5A 1Z8IB 1N8OB 4OS4A 3ZVDA 1LMWB 1RS0A 1JBUH 2PKSC 3A7WA 1ARBA 2GCHG 2BY6X 2Y5GA 3SGBE 2J9NA 3PLPA 1EAIA 1GPZA 4IS5A 4AN7A 2XC4A 2O8UA 5HGGA 8GCHF 2WUCA 1HB0B 1OYTH 1YLDA 1P2JA 1KXCA 1KIGH 4LZ1H 1C2GA 1MKWH 3SNDA 4DW2U 1C5OH 3CS0A 3M7TA 2QA9E 2RCEA 3LT3A 2AS9A 3FP6E 3RC6A 3JZ1B 4DGJA 2R2MB 3EGKH 4XBBA 4AGKA 1QJ1B 2VIWA 2C8WB 2Z9LA 1DUEA 5GWZA 1GJ4H 1NRPH 1DE7H 1MH0A 4CBNA 2B8OH 5A8ZA 2ZPRA 3UPEA 3KQDA 4B75A 4NSYA 5FX6A 2PUXB 4ABGA 3SQEE 4NIXA 4FUEA 1YPEH 3SHAH 1O3BA 3U98H 3GCHB 1ANEA 2ZTZA 2D1JA 1BUIA 1XKBC 1AE8H 3BSQA 1ZMJA 2BDGA 2UUKB 2BY8X 2ZKSA 3NWUA 2J92A 2GMTB 1QNJA 1CE5A 1QB6A 3LGVA 1VCPA 3LGIA 3ESTA 1QBNA 3E1XB 1MKWK 4J2YB 4Q7ZA 4BNRA 3GICB 1GJDB 5JPMH 3RXTA 1AGJA 4AFSA 2C8ZB 1Y3WA 4GHQA 4YT6H 1CA0B 3E0NB 1UK4A 1W10U 1FV9A 2QXGA 2VJ1A 4WH8A 4HTCH 2P16A 3C27B 1UO6A 1ETSH 4Z0KA 1QBOA 1O2XA 2TGDA 1NY22 1C5WB 1DWBH 1QA7A 3Q77A 1N6XA 1TMUH 2OQUA 5F6MA 3KEEA 4Q80A 2WPIS 1UVPA 3CP7A 1CT4E 1LPKB 4JK5A 3BEUA 1KXDA 4CH2B 3TU7H 1MD8A 1HLTH 1SSXA 2ZP0H 3RXMA 4TYDA 1GDUA 1KLJH 1SQOA 5DGJA 4X1PU 4DURA 2DE9A 1ZLRA 1Z6EA 3RUOA 3LOXA 1FJSA 2OC8A 3CS7A 1C4Y2 4MLFB 3EE0B 1ZGVA 2UWPA 1O31A 1Y8TA 1BMAA 3MNCA 1TB6H 3BTFE 4BANB 3RXBA 4B73A 1C2FA 5C1YA 4ASHA 2ZFTA 1FAXA 1GDQA 3LC5A 2GKVE 5CE1A 1GHAG 4O9VA 1GI2A 2ANYA 4E7RG 1ZPCA 3T27A 1BZXE 1CT0E 1TGBA 2OLGA 2H9EH 1V2ST 2A4QA 2F9UA 3Q3YA 2OXSA 1TRYA 1V3XA 4FUGA 2FTLE 1GBEA 1LO6A 3HPTB 1E36B 3GCTG 4YOJA 2ZIQH 4NFFA 3SI4H 3DT0H 1JMOH 3GY8A 1LPGB 4U30A 2ZDLA 2P94A 1FI8A 1SGTA 2G55A 4QT8C 4AFZA 4MNYA 5DP4A 1YPKH 4BXSA 1QRZA 1TWXB 3SUEA 3PMHB 3NPSA 4X6OA 1SHYA 3U8OH 1OP2A 1PPCE 4KKDA 1C1QA 1GHXH 1K2I1 3IG6B 1XKAC 5L2ZH 1O3PB 2FX6A 1C2DA 4CR5A 1KSNA 1TNHA 1A5HA 3A8BA 1S85A 4DOQA 3EQ0H 4YT7H 3MHWU 2HPPH 5EU8A 1MZDA 1ZJDA 2V0BA 1JOUB 1C5XB 1RFNA 1LVMA 5ESBA 1SOTA 3OY6U 2BD7A 1AZ8A 1ZSKA 1AY6H 1C1MA 4YTAA 4BOHA 1AVWA 1BTWA 1EAWA 1OWDA 1T8NA 2HRVA 3U69H 3RC4A 3QZRA 3RLWH 1HPGA 1ZMNA 4F4OC 2ZGCA 3F1SB 1AFQB 2R9PA 1XUGA 2J4IA 4UD9H 2AMQA 1SI5H 1V2RT 2BD9A 4MPVA 2LNCA 4ZHAA 4X8TH 1TNGA 3T2NA 1T4VH 1PQ8A 2GCHF 1BIOA 1S6FA 2ALPA 1Z71A 1SGQE 4FU7A 4X8SH 1C1NA 3SJ8A 1O0DH 2F9BH 3C1KA 1Y3YA 3RXLA 3E0PB 2GDDA 3PMJA 1V2MT 5A09A 2V35A 1F5RA 4YLUA 1IQJA 3EYDA 2ZFPH 5EQQA 2WV5A 5GJ4B 3BTME 2O9QA 1VCWA 3SJKA 2BD2A 2O8WA 2XCFA 3FVFB 1F0UA 1C2JA 4J1YA 1EP6A 3H5CB 3SU3A 1Z8GA 2P95A 1CGJE 4DIIH 5GDSH 1MZAA 1O3KA 1AVXA 3OSYA 4GVUA 1AUJA 4JZEH 1DPOA 3ZZ7A 1QHRB 1PPFE 4AYYB 2WPMS 3OTJE 4IN2A 1XXFA 3RXVA 2FMJA 1GI3A 3V12A 3QLPH 4CRDA 3BG4B 1KXAA 2TPIZ 2WV4A 3TH3H 5C20A 2QF0A 5I25A 3GCOA 1QFKH 4Y8ZA 1LHCH 4NCYA 4RSPA 1GL1A 2UWLA 1YP9A 1UMAH 1A4WH 3UOUA 4GUXA 2SGAA 1NPMA 4I33A 1Y5BT 2P8OC 1OKXA 1NROH 1QL8A 2ZGHA 2SFAA 5FXLA 4AG2A 1SB1H 1YPMH 1CHOF 1Y3VA 3BEFB 2FZZA 2XTTB 1H1BA 1A5IA 3A7ZA 2AMDA 1VGCC 3ENSB 3ZZDA 1P2NA 3RXAA 1S82A 2A5IA 2IN2A 3BIUH 2PSYA 1SGDE 1J17T 3K6ZA 1HAVB 3TH4H 4MTBA 5I46H 2BY7X 2BD4A 3KNXA 1H4WA 1W0ZU 1V2WT 2GP9B 4H6TA 3QZQA 3S9AA 3IITA 4TPIZ 5JB9S 2HLCA 3S7HB 1V2LT 3AASA 3SI3H 4VGCB 2QV1A 1EOLA 2PGQB 1FDPA 1JRTA 2BVXH 4A7IB 1HYLA 1HUTH 1PPEE 1AKSB 1AWFH 1D9IA 4I31A 1E37B 2B5TB 2GX4A 2ULLA 2ZDKA 2ZZUH 4Q7YA 4ZKOU 5PTPA 4AZ2B 3SORA 1OXGA 3MI4A 3ZVCA 1O3FA 1EZXC 2A4OA 1GHZA 2ZHDA 1GBDA 1O5BB 3HK6B 1EZQA 3RDZA 2OP9A 4IGDA 1O3JA 3I78A 3ATIA 4X8VH 1GL0E 1LKBA 1SQAA 1C2IA 4KELA 1GVZA 2EA3A 2G5VA 2ZI2H 1O2QA 1P0SH 2BVRH 1C5RA 5C3NA 2CHAB 2BZ6H 1RIWB 2KAIB 1K1PA 1LHDH 4Y8YA 5H4IB 3S0NA 2AERH 1JIRA 2R2WU 5CHAC 1T7CA 1F0RA 1GHBG 1QIXB 2Y5HA 5IYTA 3QDZB 2VWOA 4ABAA 1YCPH 2ZHQH 1HIAB 3GYMA 1D3PB 1RJXB 3M7UA 3U8TH 4BAHB 3DD2H 1PQ5A 2BVSH 2ZWLH 5EXNA 1ZRBA 2RDLA 4LXBH 1MBQA 5B6OA 2AEIH 3ZVGA 2H5CA 1ZHRA 1W0YH 4D7GA 1WSSH 2Y7ZA 2QC2A 1GG6B 1MTSA 2ZFQH 1GBLA 2ZQ1A 3ZZ8A 1MMJN 3SO3A 1ELTA 4XFQA 4UEHH 1EB1H 3V13A 2V3HH 5HM9A 1N6YA 2STBE 2BX4A 1LQEA 1NO9H 1XMNB 5A0AE 1NN6A 1J16A 1FIZA 3TNTA 4CHAB 1SFIA 4I8HA 1W13U 1C5MD 1NM6A 4FUHA 5JBBS 3ZZ4A 3BTEE 2W7SA 4ZXXH 1UTKA 3STIA 2OBQA 2P3TB 4CRCA 3S9CA 1YCPK 1DT2A 5HXFA 1LVBA 3KGPA 4ISHH 2PW8H 2B0FA 2BLQA 5EXLA 1YLCA 1TYNA 3A83A 2OBOA 1XVOA 1ORFA 1S0QA 2FLRH 3A85A 1OWKA 1TPSA 4NZQA 1V2PT 2Q6GA 3RXPA 4ABHA 2A5AA 2R3UA 1ZR0A 2C4FH 2F9VA 4CREA 1MTVA 1ZOMA 1G3BA 4XBCA 2OUAA 1FXYA 3MH6A 4H42U 4ABJA 1JIMA 2Z9GA 1AU8A 1LDTT 4Q7XA 2PTNA 1TGTA 1PQ7A 2FOFA 3AAVA 1HDTH 1GJ6A 3SN8A 1S81A 2I6SA 4RKOB 5DO4H 2VWNA 2CN0H 1ZPZA 1ACBE 3A7TA 3SV2H 3LGTA 3RXEA 1QCPA 3KHVA 4E06H 1B0FA 1YGCH 3HGNA 1WQSA 4K1SA 1O3AA 4OS5A 4Y6DA 4GSOA 2WPLS 1IQIA 2ZU2A 4K5ZA 2DUCA 1SGFA 1AWHB 3B8JA 4FUJA 1O3DA 3S7KB 1F5KU 2F9OA 1XVMA 2J2UA 4ZROA 1BOQA 2HALA 3GY6A 4GLYA 4SGBE 3FFGA 4U32A 4TWWA 1OWJA 2I6QA 4K1EA 3T25A 2ZEBA 1O32A 1KTSB 4K8BA 1DY8A 2HOBA 1MQ5A 4YM9A 1RTKA 4HI3A 1N1LA 5C5NA 5CMXH 1YPHE 3HGPA 1NC6A 1ANBA 5DP7A 1KY9A 2G8TA 1O5DH 1DDJA 1UVOA 1MTUA 1TOMH 1ZPBA 3TH2H 4DIHH 3PTNA 2H5DA 1SVPA 1TQ0B 1ANCA 1EKBB 3RU4E 1VR1H 1THPB 1HAPH 1OS8A 3VB4A 3A87A 1GI4A 1UK3A 1GBAA 1GBJA 3UREA 1YPLH 2ZHFH 1PYTD 1V2TT 3Q76A 3ZYDA 1WAYB 1OPHB 1ZTLA 2OC7A 3GY5A 4KTUA 5L30H 2PKSB 2WPKS 3KF2A 3VB5A 1UTQA 2FP7B 4OGXA 2SGPE 1A61H 4ZKNU 1K1MA 3M37A 4I8JA 2Z3CA 4B2CA 6GCHG 1DWCH 1ZJKA 3ATKA 2BX3A 4MG3A 1TNLA 3MTYA 5DPAA 1A3EH 1UHBB 2ZFFH 1CBWB 1PQAA 2A7HA 2FYRA 2G00A 3RXRA 5E0GA 3TGIE 2CF9H 3M35A 4ISOA 4NWLA 4A92A 2FLBH 2FM2A 1GWAA 1LCYA 2Z9KA 2JETC 4Y76A 5C5OA 1V2QT 1O2JA 4D8NA 2ZU3A 1XUKA 3EDXB 4WF8A 2FEQH 2FX4A 1SQTA 1A3BH 2Y6TA 3F9GA 4M7GA 3UY9A 2RA0A 4CRBA 1D6WA 1GHBF 1AQ7A 5FBIA 1EASA 1KDQA 1TAWA 1S84A 1AE5A 3V7TA 3BTQE 2DE8A 4A1VA 7GCHG 1GI9B 5GIBA 1Q31A 3PROA 4CRFA 1IQFA 8ESTE 1PPHE 2XBWA 3NUMA 5LGOA 3W94A 4XBDA 3ATMA 2XC0A 5EOKA 1MTWA 1Q3XA 4XOJA 3STJA 3RXHA 2R3YA 2FI4E 3LONA 4INHA 2FTMA 4I32A 2BQ7B 3KCGH 1BTUA 2AGIX 1MQ6A 1HGTH 2QXHA 1P2IA 3QK1A 5L2YH 3PLKA 2VIOA 4Y71A 2BLWA 3MNSA 4TWYA 1FY3A 1CQQA 1SGNE 3T62A 1M9UA 4UONA 2FI5E 2BQWB 1ABIH 2BB4A 3FP7E 3FANA 2O8TA 4FUCA 1XUJA 4Y8XA 1LHEH 1DFPA 1GCTB 1C2HA 2WYGA 1BA8B 2F9PA 1BTZA 3ZVAA 5FHTA 2W3KA 2ODQA 2K1QA 1AB9C 1CHOG 5T6GA 1IQHA 1C5ZB 2F3CE 3UNRA 3GOVB 3D65E 2PKAA 1GJAB 1YYY1 3GY3A 1B0EA 1O3HA 2W26A 2Q1JA 3SGAE 2AGEX 1SLXB 2W5EA 1BRCE 3KN2A 4UFEH 1UVTH 1GBHA 1UTJA 2F91A 4X1QU 4WH6A 2FOGA 3BN9A 1O2MA 1AMHA 1HCGA 1TGSZ 1O3GA 3LJOA 1TRNA 2HNTC 3MNBA 4JZFH 4XSKU 5TCAA 3SZNA 1BCUH 2FOHA 2GMTC 4BAMB 1LQDB 1O2HA 4I8LA 3UQVA 4I7YH 2WPJS 4CRAA 4BTTB 2PFEA 3HKJB 5EQSA 1IQKA 3PLBA 1HFDA 4FU9A 2BZAA 3LDXH 5C67A 2BM2A 1C2KA 1C5YB 1ARCA 3M3VA 1DLKB 1C5NH 4JYVH 2BXTH 2SNVA 3A86A 1O34A 3PM3A 3I77A 4H6SB 4A6LA 1P12E 1P2QA 1P9SA 1GJ5H 3L6PA 3M36A 3MU0A 1HAGE 4B2AA 1DX5M 1W2KH 4HGCA 9LPRA 1RTFB 2ZTXA 3BF6H 3SV6A 1F92A 4ISLA 3URCA 3FZZA 2XBVA 3P95A 5FCKA 3DA9B 1KXEA 2C3SA 1YC0A 3OYPA 3UR6A 3GDSA 1GBMA 2ZHEH 2HWLB 1TIOA 1IAUA 2AIQA 5DK1A 4AFQA 2C93B 3ZYEA 2SGEE 1GGDC 3SU4A 1J8AA 1HXFH 1TOCB 3LKWA 1H8IH 1AO5A 4K60A 1ELVA 3V0XA 3D23A 7KMEH 1EPTA 2P93A 4GPGA 1HAYB 4O3UA 1C4U2 3QX5H 4BAQB 1TNIA 3F9EA 4DVAU 2QY0B 3A88A 2JH5D 2PSXA 2IOTA 2ZC9H 2FOMB 3QTOH 3BEIB 3F9FA 1IQNA 2QGRA 2GZ8A 1SLVB 6GCHF 1GJ9B 1MKXH 1SGIB 2FESH 9ESTA 1ESTA 1TE0A 4E05H 1KXFA 5EODA 3SJOA 1HJ9A 3M5NA 1O38A 1C5TA 1UK2A 1GCDA 1SBWA 1FY8E 1C1PA 5DP9A 1V2VT 2Y7XA 1ELDE 1FLEE 3TITA 1FMGA 2FI3E 2GV7A 5A0BA 3TJOA 3A8DA 1ELCA 1ABJH 1D6RA 4GHTA 1NFUA 4MVNA 4OS2A 3A81A 3RXOA 3MNXA 5L6NH 1PPZA 1VJ9U 1C2LA 1FIWA 3SJ9A 1GI0A 1YPJH 2WUBA 1OP8A 1L1NA 3A82A 3LU9B 1SGEE 3QGNB 1W8BH 2D8WA 1C1VH 3H7TA 7GCHF 2FOCA 1V2JT 1O5FH 2EI8A 2ANKH 1DWDH 1CHGA 1ANDA 3ELAH 6LPRA 1EOJA 1FZZA 1SLWB 2TBSA 1OWEA 3SBKA 1Q2WA 2B9LA 1SGRE 1TNKA 1XX9A 1GBFA 2BDCA 4JYUH 2BDAA 4YZUA 4WXIA 2SGDE 2YNBA 3BTTE 1OP0A 1MTNB 3NZIA 3T5FH 2NU2E 4AX9H 2EEKA 3SV8A 5TCCA 1XM1A 4MPXA 1V2NT 3ZZCA 4FUIA 2TRMA 3TK6A 3K6YA 3RC5A 4B76A 3NKKA 2PGBB 1BITA 1DITH 2A7JA 2BD5A 1T31A 1O2YA 4I8KA 1CSOE 2BD3A 1P06A 2VGCC 2VIQA 3TGJE 4JK6A 4K2YA 3DFJA 4NWKA 3RXUA 4HZHA 2OCVB 1KLIH 2G4TA 3VGCC 3LPRA 1CA8B 1QB9A 1TABE 1P04A 1ZZZA 4ABBA 1SMFE 1HBTH 2A4GA 4FVDA 1AD8H 3MU1A 1OOKB 1NU7B 4WMFA 1GI7B 1K21H 4TY6A 4B2BA 1O36A 5T6FA 1AIXH 2QYIA 2Z3DA
chains in the Genus database with same CATH superfamily
2XBXA 1INCA 1PYTC 2ZA5A 3P8GA 1E35B 2H1UA 1ZHPA 4MNVA 3FN8A 1LHFH 2XW9A 2Z6BD 1WOFA 4JZIA 2FIRH 2LP6A 5FX5A 1Z1IA 3BG4C 1MUEB 2G51A 4ABFA 1JXPA 4TY7A 3CENA 2OC1A 4DJZB 2JKHA 1P9UA 1V2UT 3E8LA 1GVLA 4ZHLU 1KLTA 2JJ1D 5LH8A 3ODFA 1K1IA 1WQVH 2W7UA 2G52A 4IC5A 1J9CH 2P3UB 1K28D 2Q6FA 3NXPA 5FPSA 1C5SA 1DLEA 2WYJA 3O8DA 5LPFA 1SOZA 1QY6A 1SR5C 5CHAB 2J95A 1WBGB 4YO9A 2XC5A 5JBCS 2PP6A 1OHHD 2UUYA 3L33A 5JYIA 1ELAA 1YLNA 4X2WA 1QURH 4PROA 1Z8RA 5K7RA 3HATH 2A7CA 2QXJA 1F0SA 3W1EA 5EIYA 1QTFA 5F8XA 5GXPA 2Y82A 2J94A 1EJAA 2BD8A 2IPHA 3N7OA 4VGCC 2J98A 1H9IE 1O30A 2XYAA 6CHAC 1CO7E 1DANH 4YXWD 3GDVA 1UTMA 3F0OA 3RMLH 3OTPA 1O2WA 3EAJA 2Y80A 5ABWA 1ELGA 1KMHB 1C9TA 1NTPA 3K65B 2VIVA 1VJAU 1AVGH 2SNWA 1ETTH 5DP8A 2YMSC 1ZTKA 5DP3A 3SU1A 2ZDVH 1NRSH 2F9NA 2FXRA 1OYQA 3PV5A 2BOKA 1THSH 1L1GA 1BJVA 5C2ZA 1GJCB 2XNIA 2ZTYA 3AW1A 3SOSA 3U1IB 1FUJA 4RKJB 1O5EH 2FOBA 1AZZA 2O8MA 4FOUC 4LOYH 1O3LA 1V6DA 3MYWA 1GI6A 1O2ZA 3TIUA 1VITG 2KX4A 4KGAA 1DM4B 2A32A 2OD3B 1O2IA 4FXGH 1HAZB 5HMAA 1TMBH 4B1TA 1HAIH 1O35A 5F8TA 1L2EA 1RRKA 5DG6A 3BTHE 1E38B 1SC8U 4H4FA 5E0JA 1XXDA 2ZO3H 2EC9H 2ZQ2A 2QXIA 1LKAA 2GTBA 2BY9X 1HNEE 1K9OE 1HRTH 1NFYA 1YM0A 3QTVH 2XBYA 3TPIZ 2GDEH 1TGCA 1LPZB 4GCHG 1KYNA 5TJXA 1S83A 3ITIA 2J97A 3BTGE 1W12U 1GBKA 4BTUB 1BT7A 1NT1A 4K3JA 1WTHD 3KQBA 3A8CA 4O3TA 3T26A 2ZPSA 1FAKH 3W95A 5EQRA 1C5QA 3B9FH 5EG4A 1V2KT 1ZMLA 3P6ZB 3KQEA 4CHAC 3RLYH 1F5LA 3D62A 3RXGA 4WMEA 2WPHS 1J14A 1BHXF 3E90B 3FP8E 4NGAH 3UWIA 2H9HA 5AFYH 1UJ1A 5EXMA 1HAHH 1P05A 2C8XB 2M5TA 3ODDA 1G2MA 1EFRD 3GISB 1XUFA 3VXFH 3ZVFA 4AORA 4Z6AH 4D9RA 3TJVA 2AHME 1C1WH 1IHSH 1GBBA 1GHWH 4ZKRU 2GCTC 2TIOA 3HK3B 3Q3XA 1LTOA 2GT7A 1SGYE 2ZDNA 1Z7KA 4RI0A 1QRWA 3VPKA 3R3GB 5EPYA 1HAVA 1TPAE 4BAOB 4WXVA 2YOLA 3MO9A 4CRGA 1RXPA 5SGAE 1UVSH 2ZGBH 1WCZA 1YF4A 5LPRA 4P02A 2GVFA 3KQCA 1IQLA 4FUFA 4AGJA 4AYVB 2PUQH 5E2OA 1UTNA 1PJPA 3DHKH 1EJNA 2ZPQA 2BLVA 2OINA 4ZHMU 1P2MA 5JB8S 5CHBA 1ZSLA 1OWIA 4X1RU 2WINI 4ZUHA 5FBEA 2W3IA 2VIPA 2NU1E 1TPPA 2OC0A 2Y81A 1AKSA 1QQ4A 1ID5H 2M2AA 4NA8A 4B71A 2PR3A 4AG1A 1EAUA 3UQOA 2A1DB 2XRCA 1A1RA 4DT4A 1FPCH 2EI6A 1O39A 3RMMH 1GBTA 1MCTA 3SNBA 1ZGIA 1SG8B 3U1JB 1E79D 1BHXB 1T32A 1VKYA 3H09A 5EW1H 2B7DH 4Z1MD 3A89A 1T8MA 1UTLM 2WPDD 2QN5T 2G81E 1A5GH 1GVKB 4YLQH 4ISNA 1EQ9A 3TJNA 1Y59T 1BTYA 2UWOA 1DSTA 4ISIH 2VH0A 3OU0A 3VB7A 4E7NA 3G01A 2VVCA 3SV9A 2HNTF 1HAOH 1QBVH 2ESTE 1VITH 5JDUB 3S9BA 1SGPE 1Y3UA 1ELEE 1O3NA 1C5PA 1O2VA 2FODA 2KAIA 1YPGH 3MH7A 1HJAC 3FZDA 1Y5AT 3T29A 3WY8A 1ETRH 1COWD 2ZHWH 3ZZ9A 2P3FH 1AUTC 1E34B 1HIAA 3GY7A 2QF5A 4UFGH 3SQHE 1G3DA 3TK9A 3RXIA 2H6MA 1U6QA 1BTXA 1VCQA 2JIZD 5C17A 4IC6A 1F2SE 1YBWA 1SGFG 1TBRH 1ZRKA 2VH6A 1Y5UT 3VB3A 5FAHA 1QL9A 4KTCA 1EPTC 1FQ3A 3OY5U 1HJ8A 4UFFH 3PO1C 4X1NU 1BJUA 1EATA 3F3BA 3DUXH 1SLUB 4KTSA 2TGTA 1DOJA 4F49A 3UFAA 1Z8JB 3UWJH 3LIWA 4UE7H 3EA7A 3TJUA 1QB1A 4D9QA 5E0HA 3A8AA 1CBWC 3HKIB 1G36A 1O3EA 4U2WA 4Y7AA 1C5LH 2A0QB 2YNAA 2BDYA 1C9PA 5DP5A 4ZKSU 5GCHF 1N8OC 1JWTA 1UTPA 2FWWA 1AB9B 3DFLA 3KQ5A 1FONA 2CMYA 2HGTH 3VXEH 2ZECA 1VITF 4K8YA 3T28A 4A5TS 3S69A 1BMMH 1RD3B 1UCYH 1S5SA 2Z9IA 3SU2A 2TGAA 2OQ5A 3RXDA 3M3TA 3GDUA 2HNTE 2ODYB 1T8OA 3EA8A 1TALA 3ZVEA 3VEQB 3PWCA 4MDSA 4I8GA 3MOCA 3PWBA 4CBOA 1TLDA 4INLA 1BTPA 2A2QH 4O97A 1KTTB 1CU1A 1MAYA 4NIVA 1P01A 1W7XH 1IQMA 4NZLA 5E8EH 1EAXA 2ASUB 1CT2E 4GCHF 1LVYA 1O2LA 1GMDF 1TPOA 3P17H 2STAE 3O8RA 1GBIA 4MNWA 2K8IA 4R0IA 1Y3XA 4YOIA 3BV9B 2ILNA 3A7VA 4XDEA 3MH4A 1W7GH 2VU8E 2ZU5A 3RXSA 4SGAE 5AVDA 3SU0A 2JH0D 4CH8B 4K1TA 5C0TA 1YCPM 1O2NA 3F9HA 1T4UH 3GCHC 4NA7A 3P8FA 1EZUC 2XWAA 1UCYK 1WYKA 2BMGB 1EXFA 5A0CA 3SNAA 5DSFA 3RXKA 4X2YA 1GHYH 3JZ2B 4ZCNA 2CV3A 2A2XH 3LH1A 5C1UA 3RMOH 4JCNA 2QIQA 1SQRA 1EP5A 4MQAA 3UAIC 1GCTC 1CA0C 3SHCH 1OX1A 1IOEA 2RA3A 5KEDA 1NU9A 1TX8A 1SHHB 3ZV8A 2HPQH 3R0FA 1S6HA 2JJ2D 1A7SA 3GS9A 1G3EA 4NIYA 1GGDB 1HAXB 5AHGH 5ETXA 2ZDAH 4YOGA 5HYOA 4AB8A 1NS3A 1MBMA 1WXRA 5DP6A 3H7OA 3RXFA 3MMGA 2ZGXH 4ABEA 3UTUH 4FUDA 3PV4A 1P09A 3UIRA 2RG3A 3OX7U 1C2EA 2ZU4A 2ZU1A 3UR9A 4THNH 3RM2H 1C1TA 4NSVA 1O2TA 4MPWA 3A7YA 3RU4T 2Z94A 3ZZ3A 3M61U 5A8XA 3F68H 1E0FD 3I29A 4ABDA 5F53A 2XCNA 1MU8B 2ANWA 1D3DB 4GAWA 2TGPZ 1DXPA 3LH3A 2CJIA 1C1OA 2Z7FE 3BTDE 1DICA 4RT0A 2L74A 2G5NA 1NRNH 2A5KA 5JBAS 5JBTA 2V6NA 4IBLH 1GJ7B 1BRBE 3GCNA 3BTWE 3SZEA 1VZQH 3D49H 4BXWA 2GZ7A 1UHBA 3FAOA 4AB9A 1UCYE 3SNCA 1X7AC 3PB1E 1BRAA 2CF8H 4WMDA 1GMCF 1NRQH 2J34A 5E2PA 1TFXA 2UUJB 4F55A 3SUFA 2FPZA 1TA6A 2ANMH 1D4PB 1RGQA 5HM2A 2THFB 1FNIA 3RXCA 2BYAX 3SNEA 2V7QD 1ESAA 3M5MA 1F7ZA 2RDEA 1BBRH 4WY3A 4DY7B 1A46H 3O8CA 2AYWA 3AVZA 3F2GA 3RXJA 1SFQB 1C2MA 1K1OA 4Y7BA 1KXBA 4DCDA 1P2KA 3TGKE 4UDWH 1BQYA 3RM0H 1O3MA 3EA9A 5F03A 2JH6D 1W0KD 1UTOA 1HXEH 1QA0A 4X6NA 5FPTA 2C8YB 4ZXYH 3ATLA 2HVYB 2BQ6B 1A2CH 1TNJA 5J4SA 1DXWA 2BXUH 2GZ9A 3M5OA 3KL6A 2HLDD 1DSUA 4BAKB 1BMNH 1MKXK 4B6FA 1P2OA 2BY5X 2XWBI 3RU4D 4FVBA 2G4UA 3SGQE 1ZSJA 3PTBA 4ZH8A 1QJ7B 5C1XA 3M3SA 1C1UH 8KME2 3K9XB 3SUGA 4B74A 3MO3A 3O8BA 4X8UH 3PMAB 2VGCB 1QL7A 3UNSA 2CXVA 1AFQC 1BBRK 3P92A 4Y0ZE 1ZYOA 2P8OB 3VGCB 2VINA 2ZGJA 3PRDA 2C90B 3LGWA 1OWHA 2AIPA 1C4V2 1XUIA 4IN1A 4NIWA 4AFUA 1VGCB 1ZHMA 2R0LA 1W14U 2ZFSA 1BRUP 1P8VC 3TLOA 3SJIA 3LJJA 3ZVBA 1DS2E 1NFXA 2H2ZA 1GMHG 1DWEH 4MNXA 2BLOA 1G2LA 2CK3D 3EE7A 1UVUH 1EJMA 1O2SA 3QO6A 2FOAA 4ZMAH 3TK5A 1TBZH 2O8LA 3F6UH 5BRRE 4OGYA 5GPIB 3QGJA 2D2DA 2A31A 3WWFA 4FUBA 3KIDU 4X2VA 1W3CA 2IJD1 1L4DA 4DT7B 3MFJA 1H8ED 1NZQH 2ZCLP 2ZCKP 1MCVA 2AH4X 2FOEA 1FY5A 3P8OA 4X6MA 1MAXA 3A80A 1MTNC 1C5VA 1S0RA 1EB2A 2PLXA 3QN7A 1G37A 1O2GH 3N99A 1QQUA 1O2OA 3VB6A 1MU6B 1AFEH 1WU1A 4IW4E 1CVWH 2WZQA 4A1TA 1TMTH 5KECA 2ODPA 3E91A 3LGYA 3ZZ5A 2XXLA 2FS9A 4F48B 2AGGX 4LK4A 2PTCE 2ZF0H 2ZDMA 1G32B 2R0KA 1BBRE 1L0ZA 2FDAA 3FOAA 2NU4E 1OSSA 2NU3E 4Y10E 4XD7D 1Z1JA 6CHAB 1CGIE 2F83A 1B7XB 3RP2A 1TX6A 4Y11E 1DVAH 2WHXA 4ABIA 1TA2A 3PYHA 3ATWA 1GHAF 1FY4A 1PPBH 2FO9A 4HFPB 2YMSB 1A0HB 1H8DH 4YESB 2Z3EA 5J4QA 1BB0B 1BTHH 5FPYA 4KP0A 1GDNA 1L1JA 4O03A 1P02A 4JZ1A 3BTKE 1EZSC 5EPNA 4FU8A 2H9TH 1PFXC 3MU5A 1WTGH 5IK2D 2HVXA 2WV9A 3GCTF 4X0WU 1EUFA 3E3TA 1FPHH 1P57B 1TONA 5DN6D 5IDKA 3SV7A 3E6PH 4X2XA 2ALVA 1BDAA 4D7FA 3GYLB 5GNDA 3UNQA 1O5AB 1O5CB 1QZ8A 8GCHG 2PWXA 4OM9A 3TNSA 1MD7A 2GV6A 2AFQB 1O33A 3A7XA 8LPRA 4WVPE 3M7QA 2Q6DA 4JYTA 2QCYA 3ZZ6A 2ZCHP 2XOKD 4WJG2 2A4RA 2KZ4A 5GCHG 7ESTE 1T8LA 1WUNH 5AFZH 1KDQB 1PPGE 1ZTJA 4X1SU 4Y0YE 5EJLA 4RN6A 5FCRA 1K1NA 1W11U 5BPEA 2IPQX 2D26C 2CHAC 2Y5FA 3MH5A 4IMQA 4OS1A 1RIWC 2KCOA 1Z6JH 4Q2KA 4U01A 2QF3A 1O2KA 1TRMA 1O37A 7LPRA 4D76A 1P3EA 4OS7A 1IQEA 3E16B 5HIZA 1HV7A 4BTIB 1O2RA 2AMPA 2NU0E 3KYGA 1P3CA 3URDA 1D3TB 4I86A 4WWYA 1RTLA 3LGUA 1F0TA 1G9IE 4R8TB 2BOHB 1GMDG 1A0LA 1O3CA 5FL7D 3SW2B 1GG6C 2VVUA 5ESTE 3V3MA 1QR3E 5EGMA 1ESBA 1WV7H 2KFWA 3Q3KA 3K2UA 3B23B 3IWMA 1O2UA 3AW0A 3SUDA 2SGFE 3P8NA 2FYQA 1GI1A 1P11E 2VB0A 4ESTE 4NA9H 3MU8A 2ZFRH 2J38A 2GGVB 1QRXA 2GCTB 1D3QB 4LZ4B 1ELBA 1TQ7B 1LVOA 2EI7A 3U9AH 1BMLA 1FN8A 1G30B 1GJBB 5T3HA 1LHGH 2KCPA 1SPJA 3FKSD 2PKAB 1AN1E 1GMHF 2GT8A 5T6DA 1QGFA 3SU5A 1GJ8B 2VIDA 1C5UA 1V2OT 1K1LA 2BDIA 4OS6A 1TGNA 5EW2H 3CNRA 4INKA 1A0JA 3AAUA 1C1SA 4NG9H 5LPEA 1ELFA 4NFEA 5G4BA 3TVJB 3A84A 1H9HE 1GBCA 2BHGA 3BG8A 1DY9A 1YKTA 4XE4A 1W0JD 4DG4A 2SGQE 1P10A 1EX3A 3U8RH 1IHTH 1IQGA 3RXQA 1WDIA 3UOPA 3GY2A 3UUZA 1GHVH 2GD4B 1NESE 3NCLA 1C1RA 4CR9A 3MO6A 1NFWA 4TPYA 2A45B 1L4ZA 3Q00A 2F4LA 1K22H 2BDHA 2ZNKH 2UUFB 3QUMP 1O3OA 1AHTH 1YY3A 2VWLA 3P70B 2V3OH 1THRH 3PMBB 1MABB 1K1JA 1O5GH 1G3CA 3L3TA 1H9LB 2Z9JA 4JZDH 3QWCH 2JETB 2QAAA 4A1XA 2BTCE 2NWNA 1HJAB 1NRRH 1O2PA 3OAAD 6ESTA 5A8YA 2LPRA 4JMYA 1O3IA 3MU4A 4IMZA 4Y79A 2OTVA 1FN6A 4ZAEA 1QJ6B 3SU6A 1P03A 1GMCG 2PHBA 3NK8A 2CGAA 3GY4A 2VNTA 1SL3A 5F8ZA 5K0HA 2IJOB 1B5GH 4MPUA 3VFEA 1TBQH 1DUAA 1FY1A 3LC3A 3M5LA 1EPTB 3MWIU 3ZZAA 3PO1B 2VWMA 1BMFD 1CGHA 2PV9B 3RMNH 5DJ7A 1YPHC 1SGCA 4K69A 3BIVH 4UFDH 2ZG0H 1GI8B 2BDBA 2P59A 1TX7A 2FS8A 3ZV9A 5AF9H 1JRSA 1XUHA 4X6PA 5A2MH 1AI8H 5DKMA 1J15A 2VVVA 4AOQA 3ZZBA 1GI5A 1Z8IB 3VG8A 1N8OB 4OS4A 3ZVDA 1LMWB 1RS0A 1JBUH 2PKSC 3A7WA 1ARBA 2GCHG 2BY6X 2L6OA 2Y5GA 3SGBE 2J9NA 3PLPA 1EAIA 1GPZA 4IS5A 1K0HA 4TT3D 4AN7A 2XC4A 2O8UA 5HGGA 8GCHF 2WUCA 1HB0B 1OYTH 1YLDA 1P2JA 1KXCA 1KIGH 4LZ1H 1C2GA 1MKWH 3SNDA 4DW2U 1C5OH 2KM0A 3CS0A 3M7TA 2QA9E 3U28C 2RCEA 3LT3A 2AS9A 3FP6E 3RC6A 3JZ1B 4DGJA 2R2MB 3EGKH 4XBBA 4AGKA 1QJ1B 2VIWA 2C8WB 2Z9LA 1DUEA 5GWZA 1GJ4H 1NRPH 1DE7H 1MH0A 4CBNA 2B8OH 5A8ZA 2ZPRA 3UPEA 3KQDA 4B75A 4NSYA 5FX6A 2PUXB 4ABGA 3SQEE 4NIXA 4FUEA 1YPEH 3SHAH 1O3BA 3U98H 3GCHB 1ANEA 4ACBA 2ZTZA 2D1JA 1BUIA 1XKBC 1AE8H 3BSQA 1ZMJA 2BDGA 2UUKB 2BY8X 2ZKSA 4P00A 3NWUA 2J92A 2GMTB 1QNJA 1CE5A 1QB6A 3LGVA 1VCPA 3LGIA 3ESTA 1QBNA 3E1XB 1MKWK 4J2YB 4Q7ZA 4BNRA 3GICB 1GJDB 5JPMH 3RXTA 1AGJA 4AFSA 2C8ZB 1Y3WA 4GHQA 4YT6H 1CA0B 3E0NB 1UK4A 1W10U 1FV9A 2QXGA 2VJ1A 4WH8A 4HTCH 2P16A 3C27B 1UO6A 1ETSH 4Z0KA 1QBOA 1O2XA 2TGDA 1NY22 1C5WB 1DWBH 1QA7A 3Q77A 1N6XA 1TMUH 2OQUA 5F6MA 3KEEA 4Q80A 2WPIS 1UVPA 3CP7A 1CT4E 1LPKB 4JK5A 3BEUA 4B6EA 1KXDA 4CH2B 3TU7H 1MD8A 1HLTH 1SSXA 2ZP0H 3RXMA 4TYDA 1GDUA 1KLJH 1SQOA 5DGJA 4X1PU 4DURA 2DE9A 1ZLRA 1Z6EA 3RUOA 3LOXA 1FJSA 2OC8A 3CS7A 4XRNA 1C4Y2 4MLFB 3EE0B 1ZGVA 2UWPA 1O31A 1Y8TA 1BMAA 3MNCA 1TB6H 3BTFE 4BANB 3RXBA 4B73A 1C2FA 5C1YA 4ASHA 2ZFTA 1FAXA 1GDQA 3LC5A 2GKVE 5CE1A 1GHAG 4O9VA 1GI2A 2ANYA 4E7RG 1ZPCA 3T27A 1BZXE 1CT0E 1TGBA 2OLGA 2H9EH 1V2ST 2A4QA 2F9UA 3Q3YA 2OXSA 1TRYA 1V3XA 4FUGA 2FTLE 1GBEA 3N7EA 1LO6A 3HPTB 1E36B 3GCTG 4YOJA 2ZIQH 4NFFA 5HKKD 3SI4H 3DT0H 1JMOH 3GY8A 1LPGB 4U30A 2ZDLA 2P94A 1FI8A 1SGTA 2G55A 4QT8C 4AFZA 5CDFE 4MNYA 5DP4A 1YPKH 4BXSA 1QRZA 1TWXB 3SUEA 3PMHB 3NPSA 4X6OA 1SHYA 3U8OH 1OP2A 1PPCE 4KKDA 1C1QA 1GHXH 1K2I1 3IG6B 1XKAC 5L2ZH 2J98B 1O3PB 2FX6A 1C2DA 4CR5A 1KSNA 1TNHA 1A5HA 3A8BA 1S85A 4DOQA 3EQ0H 4YT7H 3MHWU 2HPPH 2W6JD 5EU8A 1MZDA 1ZJDA 2V0BA 1JOUB 1C5XB 1RFNA 1LVMA 5ESBA 1SOTA 3OY6U 5KGOA 2BD7A 1AZ8A 1ZSKA 1AY6H 1C1MA 2KCAA 4YTAA 4BOHA 1AVWA 1BTWA 1EAWA 1OWDA 1T8NA 2HRVA 3U69H 3RC4A 3QZRA 3RLWH 1HPGA 1ZMNA 4F4OC 2ZGCA 3F1SB 1AFQB 1S6LA 1XUGA 2J4IA 2R9PA 4UD9H 2AMQA 1SI5H 2K0QA 1V2RT 2BD9A 4MPVA 2LNCA 4ZHAA 4X8TH 1TNGA 3T2NA 1T4VH 1PQ8A 2GCHF 1BIOA 1S6FA 2ALPA 2W6ID 1Z71A 1SGQE 4FU7A 4X8SH 1C1NA 2RFKC 3SJ8A 1O0DH 2F9BH 2XNDD 3C1KA 1Y3YA 3RXLA 3E0PB 2GDDA 3PMJA 1V2MT 5A09A 2V35A 1F5RA 4YLUA 1IQJA 1NBMD 3EYDA 2J5UA 2ZFPH 5EQQA 2WV5A 5GJ4B 5EJZA 3BTME 2O9QA 1VCWA 3SJKA 2BD2A 2O8WA 2XCFA 3FVFB 1F0UA 1C2JA 4J1YA 1EP6A 3H5CB 3SU3A 1Z8GA 2P95A 1CGJE 4DIIH 5GDSH 1MZAA 1O3KA 3UB0A 1AVXA 3OSYA 4GVUA 2WSSD 1AUJA 4JZEH 3OEHD 1DPOA 3ZZ7A 1QHRB 1PPFE 4AYYB 2WPMS 3OTJE 4IN2A 2GJGA 1XXFA 3RXVA 2FMJA 1GI3A 3V12A 3QLPH 4CRDA 3BG4B 1KXAA 2TPIZ 2WV4A 3TH3H 5C20A 2QF0A 5I25A 3GCOA 1QFKH 4Y8ZA 1LHCH 4NCYA 4RSPA 1GL1A 2UWLA 1YP9A 1UMAH 1A4WH 4HG6A 3UOUA 4GUXA 2SGAA 1NPMA 4M9FA 4I33A 1Y5BT 2P8OC 1OKXA 1NROH 1QL8A 2ZGHA 2SFAA 5FXLA 4AG2A 1SB1H 1YPMH 1CHOF 1Y3VA 3BEFB 2FZZA 2XTTB 1H1BA 1A5IA 3A7ZA 2AMDA 1VGCC 3ENSB 3ZZDA 1P2NA 3RXAA 1S82A 2A5IA 2IN2A 3BIUH 2PSYA 1SGDE 1J17T 3K6ZA 1HAVB 3TH4H 4MTBA 5I46H 2BY7X 2BD4A 3FO8D 3ZIAD 3KNXA 1H4WA 1W0ZU 1V2WT 2GP9B 4H6TA 3QZQA 3S9AA 3IITA 4TPIZ 5JB9S 2HLCA 3S7HB 1V2LT 3AASA 3SI3H 4VGCB 2QV1A 1EOLA 2PGQB 5C0UA 1FDPA 1JRTA 2BVXH 4A7IB 1HYLA 1HUTH 1PPEE 1AKSB 1AWFH 1D9IA 4I31A 4ASUD 1E37B 2B5TB 2GX4A 2ULLA 3OEED 2ZDKA 2ZZUH 4Q7YA 4ZKOU 5PTPA 4AZ2B 3SORA 2EY4C 1OXGA 3MI4A 3PV2A 3ZVCA 1O3FA 1EZXC 2A4OA 1GHZA 2ZHDA 1GBDA 1O5BB 3HK6B 1EZQA 3RDZA 2OP9A 4IGDA 1O3JA 3I78A 3ATIA 4X8VH 1GL0E 1LKBA 1SQAA 1C2IA 4KELA 1GVZA 2EA3A 2G5VA 2ZI2H 1O2QA 1P0SH 2BVRH 1C5RA 5C3NA 2CHAB 2BZ6H 1RIWB 2KAIB 1K1PA 1LHDH 4Y8YA 2JDID 5H4IB 3S0NA 2AERH 1JIRA 2R2WU 5CHAC 1T7CA 1F0RA 1GHBG 1QIXB 2Y5HA 5IYTA 3QDZB 2VWOA 4ABAA 1FX0B 1YCPH 2ZHQH 1HIAB 3GYMA 1D3PB 1RJXB 3M7UA 3U8TH 4BAHB 3DD2H 1PQ5A 2BVSH 2ZWLH 5EXNA 1ZRBA 2RDLA 4LXBH 1MBQA 5B6OA 2AEIH 3ZVGA 2H5CA 1ZHRA 1W0YH 2QE7D 2KCYA 1WSSH 2Y7ZA 4D7GA 2QC2A 1GG6B 1MTSA 2ZFQH 1GBLA 2ZQ1A 3ZZ8A 1MMJN 3SO3A 1ELTA 4XFQA 5C94A 4UEHH 1EB1H 3V13A 2V3HH 5HM9A 1N6YA 2STBE 2BX4A 3N7DA 1LQEA 1NO9H 1XMNB 5A0AE 1NN6A 1J16A 1FIZA 3TNTA 4CHAB 1SFIA 4I8HA 1W13U 1C5MD 1NM6A 4FUHA 5JBBS 3ZZ4A 1E1QD 3BTEE 2W7SA 4ZXXH 1UTKA 5EJ1A 3STIA 2OBQA 2P3TB 4CRCA 3S9CA 1YCPK 1DT2A 1YWUA 5HXFA 1LVBA 3KGPA 4ISHH 2PW8H 2B0FA 2BLQA 5EXLA 1YLCA 1TYNA 3A83A 2OBOA 1XVOA 1ORFA 1S0QA 2FLRH 3A85A 1OWKA 1TPSA 4NZQA 1V2PT 2Q6GA 3RXPA 4ABHA 2A5AA 2R3UA 1ZR0A 2C4FH 2F9VA 4CREA 1MTVA 1ZOMA 1G3BA 4XBCA 2OUAA 1FXYA 3MH6A 4H42U 4ABJA 1JIMA 2Z9GA 1AU8A 1LDTT 4Q7XA 2PTNA 1TGTA 1PQ7A 2FOFA 3AAVA 2V3MA 1HDTH 1GJ6A 3SN8A 1S81A 2I6SA 4RKOB 5DO4H 2VWNA 3F2HA 2CN0H 4TSFD 1ZPZA 1ACBE 3A7TA 3SV2H 3LGTA 3RXEA 1QCPA 3KHVA 4E06H 1B0FA 1YGCH 3HGNA 1WQSA 4K1SA 1O3AA 4OS5A 4Y6DA 4GSOA 2WPLS 1IQIA 2ZU2A 4K5ZA 2DUCA 1SGFA 1AWHB 3B8JA 4FUJA 1O3DA 3S7KB 1F5KU 2F9OA 1XVMA 2J2UA 4ZROA 1BOQA 2HALA 3GY6A 4GLYA 4Q63A 4SGBE 3FFGA 4U32A 4TWWA 3PRBA 3F0PA 1OWJA 2I6QA 4AC9A 4K1EA 3T25A 2ZEBA 1O32A 1KTSB 4K8BA 1DY8A 2HOBA 1MQ5A 4YM9A 1RTKA 4HI3A 1N1LA 5C5NA 5CMXH 1YPHE 3HGPA 1NC6A 1ANBA 5DP7A 1KY9A 3OE7D 2G8TA 1O5DH 1DDJA 1UVOA 1MTUA 5T1VA 1TOMH 1ZPBA 3TH2H 4DIHH 3PTNA 2H5DA 1SVPA 1TQ0B 1ANCA 1EKBB 3RU4E 1VR1H 1UW7A 1THPB 1HAPH 1OS8A 3VB4A 3A87A 1GI4A 1UK3A 3NRLA 1GBAA 1GBJA 3UREA 1YPLH 1NBME 2ZHFH 1PYTD 1V2TT 3SYJA 3Q76A 3ZYDA 1WAYB 1OPHB 1ZTLA 2OC7A 2EQNA 3GY5A 4KTUA 5L30H 2PKSB 2WPKS 3KF2A 3VB5A 1UTQA 2FP7B 4OGXA 2SGPE 1A61H 4ZKNU 1K1MA 3M37A 4I8JA 2Z3CA 4B2CA 6GCHG 1E1RD 1DWCH 1ZJKA 3ATKA 2BX3A 4MG3A 2F43B 1TNLA 3MTYA 5DPAA 1A3EH 1UHBB 4RT1A 2ZFFH 1CBWB 1PQAA 2A7HA 2FYRA 2G00A 3RXRA 5E0GA 3TGIE 2CF9H 3M35A 4ISOA 4NWLA 4A92A 2FLBH 2FM2A 1GWAA 1LCYA 2Z9KA 2JETC 4Y76A 5C5OA 1V2QT 1O2JA 4D8NA 2ZU3A 1XUKA 3EDXB 4WF8A 2FEQH 2FX4A 4Q4LA 1SQTA 1A3BH 2Y6TA 3F9GA 4M7GA 3UY9A 2RA0A 4CRBA 1D6WA 1GHBF 1AQ7A 5FBIA 1EASA 1KDQA 1TAWA 1S84A 1AE5A 3V7TA 3BTQE 3DSGA 2DE8A 4A1VA 7GCHG 1GI9B 5GIBA 1Q31A 3PROA 4CRFA 1IQFA 8ESTE 1PPHE 2XBWA 3NUMA 5LGOA 2OK5A 3W94A 4XBDA 2VBCA 3ATMA 2XC0A 5EOKA 1MTWA 1Q3XA 4XOJA 3STJA 3RXHA 2R3YA 2FI4E 3LONA 4INHA 2FTMA 4I32A 2YMSD 2BQ7B 3KCGH 1BTUA 2AGIX 1MQ6A 1HGTH 2QXHA 1P2IA 3QK1A 5L2YH 3PLKA 3OFND 2VIOA 4Y71A 2BLWA 3MNSA 4TWYA 1FY3A 1CQQA 1SGNE 3T62A 1M9UA 3WWBA 4UONA 2FI5E 2BQWB 1ABIH 2BB4A 3FP7E 3FANA 2O8TA 4FUCA 1XUJA 4Y8XA 1LHEH 1DFPA 1GCTB 1C2HA 2WYGA 1BA8B 3DCLA 2F9PA 1BTZA 3ZVAA 4ACAA 5FHTA 2W3KA 2ODQA 2K1QA 1AB9C 1CHOG 5T6GA 1IQHA 1C5ZB 2F3CE 3UNRA 3GOVB 3D65E 2PKAA 1GJAB 1YYY1 3GY3A 1B0EA 1O3HA 2W26A 2Q1JA 3SGAE 2AGEX 1SLXB 2W5EA 1BRCE 3KN2A 4UFEH 1UVTH 1H8HD 1GBHA 3MQKC 1UTJA 5B6LA 2F91A 4X1QU 4WH6A 2FOGA 3BN9A 3DSPA 1O2MA 1AMHA 1HCGA 1TGSZ 1O3GA 3LJOA 1TRNA 2HNTC 3MNBA 4JZFH 4XSKU 5TCAA 3SZNA 1BCUH 2FOHA 2GMTC 4BAMB 1LQDB 1O2HA 4I8LA 3UQVA 4I7YH 2WPJS 4CRAA 4BTTB 1SKYE 2PFEA 3HKJB 1IQKA 5EQSA 3PLBA 1HFDA 4FU9A 2BZAA 3LDXH 5C67A 2BM2A 1C2KA 1C5YB 1ARCA 3M3VA 1DLKB 1C5NH 4JYVH 2BXTH 2SNVA 3A86A 1O34A 3PM3A 3I77A 4H6SB 4A6LA 1P12E 1P2QA 1P9SA 1GJ5H 3L6PA 3M36A 3MU0A 1HAGE 4B2AA 1DX5M 1W2KH 4HGCA 9LPRA 1RTFB 2ZTXA 3BF6H 3SV6A 1F92A 4ISLA 3URCA 3FZZA 2XBVA 2LELA 3P95A 5FCKA 3DA9B 1KXEA 2C3SA 1YC0A 3OYPA 3UR6A 3GDSA 1GBMA 2ZHEH 2HWLB 1TIOA 1IAUA 2AIQA 5DK1A 4AFQA 2C93B 3ZYEA 2SGEE 1GGDC 3SU4A 1J8AA 1HXFH 3WW7A 1TOCB 3LKWA 1H8IH 1AO5A 4K60A 1ELVA 3V0XA 3D23A 7KMEH 1EPTA 2P93A 4GPGA 1HAYB 4O3UA 1C4U2 3QX5H 4BAQB 1TNIA 3F9EA 3KYFA 4DVAU 2QY0B 3A88A 2JH5D 2PSXA 2IOTA 2ZC9H 2FOMB 3QTOH 3BEIB 3F9FA 1IQNA 2QGRA 2GZ8A 1SLVB 6GCHF 1GJ9B 1MKXH 1SGIB 2FESH 9ESTA 1ESTA 1TE0A 4E05H 1KXFA 5EODA 3SJOA 1HJ9A 3M5NA 1O38A 1C5TA 1UK2A 1GCDA 1SBWA 1FY8E 1C1PA 5DP9A 1V2VT 2Y7XA 1ELDE 1FLEE 3TITA 1FMGA 2FI3E 2GV7A 5A0BA 3TJOA 3A8DA 1ELCA 1ABJH 1D6RA 4GHTA 1NFUA 4MVNA 4OS2A 3A81A 3RXOA 3MNXA 5L6NH 1PPZA 1VJ9U 2QF4A 1C2LA 3F2FA 1FIWA 3SJ9A 1GI0A 1YPJH 2WUBA 1OP8A 1L1NA 3A82A 3LU9B 1SGEE 3QGNB 1W8BH 2D8WA 1C1VH 3H7TA 7GCHF 2FOCA 1V2JT 1O5FH 2EI8A 2ANKH 1DWDH 1CHGA 1ANDA 3ELAH 6LPRA 1EOJA 1FZZA 1SLWB 2TBSA 1OWEA 3SBKA 1Q2WA 2B9LA 1SGRE 1TNKA 1XX9A 1GBFA 2BDCA 4JYUH 2BDAA 4YZUA 4WXIA 2KR7A 2SGDE 2YNBA 3BTTE 1OP0A 1MTNB 3NZIA 3DSOA 3T5FH 2NU2E 4AX9H 2EEKA 3SV8A 5TCCA 1XM1A 4MPXA 1V2NT 3ZZCA 4FUIA 2TRMA 3TK6A 3K6YA 3RC5A 4B76A 3NKKA 2PGBB 1BITA 1DITH 2A7JA 2BD5A 1T31A 1O2YA 4I8KA 1CSOE 2BD3A 1P06A 2VGCC 2VIQA 3TGJE 4JK6A 4K2YA 3DFJA 4NWKA 3RXUA 4HZHA 2OCVB 1KLIH 2G4TA 3VGCC 3LPRA 1CA8B 1QB9A 3AK5A 1TABE 1P04A 1ZZZA 4ABBA 1SMFE 1HBTH 2A4GA 4FVDA 5HIYA 1AD8H 3MU1A 1OOKB 1NU7B 4WMFA 4FETA 1GI7B 1K21H 4TY6A 4B2BA 1O36A 5T6FA 1AIXH 2QYIA 2Z3DA
chains in the Genus database with same CATH topology
2XBXA 1INCA 1PYTC 2ZA5A 3P8GA 1E35B 2H1UA 1ZHPA 4MNVA 1LHFH 2XW9A 2Z6BD 1WOFA 4JZIA 2FIRH 5FX5A 1Z1IA 3BG4C 1MUEB 2G51A 4ABFA 1JXPA 4TY7A 3CENA 2OC1A 4DJZB 2JKHA 1P9UA 1V2UT 3E8LA 1GVLA 4ZHLU 1KLTA 5LH8A 3ODFA 1K1IA 1WQVH 2W7UA 2G52A 4IC5A 1J9CH 2P3UB 1K28D 2Q6FA 3NXPA 5FPSA 1C5SA 1DLEA 2WYJA 3O8DA 5LPFA 1SOZA 1QY6A 1SR5C 5CHAB 2J95A 1WBGB 4YO9A 2XC5A 5JBCS 2UUYA 3L33A 5JYIA 1ELAA 4X2WA 1QURH 4PROA 1Z8RA 5K7RA 3HATH 2A7CA 2QXJA 1F0SA 1QTFA 5F8XA 5GXPA 2Y82A 2J94A 1EJAA 2BD8A 2IPHA 3N7OA 4VGCC 6CHAC 1H9IE 1O30A 2XYAA 1CO7E 1DANH 3GDVA 1UTMA 3RMLH 1O2WA 3EAJA 2Y80A 5ABWA 1ELGA 1NTPA 1C9TA 3K65B 2VIVA 1VJAU 1AVGH 2SNWA 1ETTH 5DP8A 1ZTKA 5DP3A 3SU1A 2ZDVH 1NRSH 2F9NA 2FXRA 1OYQA 2BOKA 1THSH 1L1GA 1BJVA 5C2ZA 1GJCB 2XNIA 2ZTYA 3AW1A 3SOSA 3U1IB 1FUJA 4RKJB 1O5EH 2FOBA 1AZZA 2O8MA 4LOYH 1O3LA 1V6DA 3MYWA 1GI6A 1O2ZA 3TIUA 1VITG 4KGAA 1DM4B 2A32A 2OD3B 1O2IA 4FXGH 1HAZB 5HMAA 1TMBH 4B1TA 1HAIH 1O35A 5F8TA 1L2EA 1RRKA 5DG6A 3BTHE 1E38B 1SC8U 4H4FA 5E0JA 1XXDA 2ZO3H 2EC9H 2ZQ2A 2QXIA 1LKAA 2GTBA 2BY9X 1HNEE 1K9OE 1HRTH 1NFYA 1YM0A 3QTVH 2XBYA 3TPIZ 2GDEH 1TGCA 1LPZB 4GCHG 1KYNA 5TJXA 1S83A 3ITIA 3BTGE 1W12U 1GBKA 4BTUB 1BT7A 1NT1A 4K3JA 1WTHD 3KQBA 3A8CA 4O3TA 3T26A 2ZPSA 1FAKH 3W95A 5EQRA 1C5QA 3B9FH 5EG4A 1V2KT 1ZMLA 3P6ZB 3KQEA 4CHAC 3RLYH 1F5LA 3D62A 3RXGA 4WMEA 2WPHS 1J14A 1BHXF 3E90B 3FP8E 4NGAH 3UWIA 2H9HA 5AFYH 1UJ1A 5EXMA 1HAHH 1P05A 2C8XB 2M5TA 3ODDA 1G2MA 3GISB 1XUFA 3VXFH 3ZVFA 4AORA 4Z6AH 4D9RA 3TJVA 1C1WH 1IHSH 1GBBA 1GHWH 4ZKRU 2GCTC 2TIOA 3HK3B 3Q3XA 1LTOA 2GT7A 1SGYE 2ZDNA 1Z7KA 1QRWA 3VPKA 3R3GB 5EPYA 1HAVA 1TPAE 4BAOB 4WXVA 2YOLA 3MO9A 4CRGA 1RXPA 5SGAE 1UVSH 2ZGBH 1WCZA 1YF4A 5LPRA 2GVFA 3KQCA 1IQLA 4FUFA 4AGJA 4AYVB 2PUQH 5E2OA 1UTNA 1PJPA 3DHKH 1EJNA 2ZPQA 2BLVA 2OINA 4ZHMU 1P2MA 5JB8S 1ZSLA 1OWIA 4X1RU 2WINI 4ZUHA 5FBEA 2W3IA 2VIPA 2NU1E 1TPPA 2OC0A 2Y81A 1AKSA 1QQ4A 1ID5H 4NA8A 4B71A 2PR3A 4AG1A 1EAUA 3UQOA 2A1DB 2XRCA 1A1RA 1FPCH 2EI6A 1O39A 3RMMH 1GBTA 1MCTA 3SNBA 1ZGIA 1SG8B 3U1JB 1BHXB 1T32A 5EW1H 2B7DH 3A89A 1T8MA 1UTLM 2QN5T 2G81E 1A5GH 1GVKB 4YLQH 4ISNA 1EQ9A 3TJNA 1Y59T 1BTYA 2UWOA 1DSTA 4ISIH 2VH0A 3OU0A 3VB7A 4E7NA 3G01A 2VVCA 3SV9A 2HNTF 1HAOH 1QBVH 2ESTE 1VITH 5JDUB 3S9BA 1SGPE 1Y3UA 1ELEE 1O3NA 1C5PA 1O2VA 2FODA 2KAIA 1YPGH 3MH7A 1HJAC 3FZDA 1Y5AT 3T29A 3WY8A 1ETRH 2ZHWH 3ZZ9A 2P3FH 1AUTC 1E34B 1HIAA 3GY7A 4UFGH 3SQHE 1G3DA 3TK9A 3RXIA 2H6MA 1U6QA 1BTXA 1VCQA 4IC6A 1F2SE 1YBWA 1SGFG 1TBRH 1ZRKA 2VH6A 1Y5UT 3VB3A 5FAHA 1QL9A 4KTCA 1EPTC 1FQ3A 3OY5U 1HJ8A 4UFFH 3PO1C 4X1NU 1BJUA 1EATA 3DUXH 1SLUB 4KTSA 2TGTA 1DOJA 4F49A 3UFAA 1Z8JB 3UWJH 3LIWA 4UE7H 3EA7A 3TJUA 1QB1A 4D9QA 5E0HA 3A8AA 1CBWC 3HKIB 1G36A 1O3EA 4U2WA 4Y7AA 1C5LH 2A0QB 2YNAA 2BDYA 1C9PA 5DP5A 4ZKSU 5GCHF 1N8OC 1JWTA 1UTPA 2FWWA 1AB9B 3DFLA 1FONA 2CMYA 2HGTH 3VXEH 2ZECA 1VITF 4K8YA 3T28A 4A5TS 3S69A 1BMMH 1RD3B 1UCYH 1S5SA 2Z9IA 3SU2A 2TGAA 2OQ5A 3RXDA 3M3TA 3GDUA 2HNTE 2ODYB 1T8OA 3EA8A 1TALA 3ZVEA 3VEQB 3PWCA 4MDSA 4I8GA 3MOCA 3PWBA 4CBOA 1TLDA 4INLA 1BTPA 2A2QH 4O97A 1KTTB 1CU1A 1MAYA 4NIVA 1P01A 1W7XH 1IQMA 4NZLA 5E8EH 1EAXA 2ASUB 1CT2E 4GCHF 1LVYA 1O2LA 1GMDF 1TPOA 3P17H 2STAE 3O8RA 1GBIA 4MNWA 4R0IA 1Y3XA 4YOIA 3BV9B 2ILNA 3A7VA 4XDEA 3MH4A 1W7GH 2VU8E 2ZU5A 3RXSA 4SGAE 5AVDA 3SU0A 2JH0D 4CH8B 4K1TA 1YCPM 1O2NA 3F9HA 1T4UH 3GCHC 4NA7A 3P8FA 1EZUC 2XWAA 1UCYK 1WYKA 2BMGB 1EXFA 5A0CA 3SNAA 3RXKA 4X2YA 1GHYH 3JZ2B 2CV3A 2A2XH 3LH1A 5C1UA 3RMOH 4JCNA 2QIQA 1EP5A 4MQAA 1GCTC 1CA0C 3SHCH 1OX1A 1IOEA 2RA3A 1NU9A 1TX8A 1SHHB 3ZV8A 2HPQH 3R0FA 1S6HA 1A7SA 1G3EA 4NIYA 1GGDB 1HAXB 5AHGH 5ETXA 2ZDAH 4YOGA 5HYOA 4AB8A 1NS3A 1MBMA 5DP6A 3H7OA 3RXFA 3MMGA 2ZGXH 4ABEA 3UTUH 4FUDA 3PV4A 1P09A 3UIRA 2RG3A 3OX7U 1C2EA 2ZU4A 2ZU1A 3UR9A 4THNH 3RM2H 1C1TA 4NSVA 1O2TA 4MPWA 3A7YA 3RU4T 2Z94A 3ZZ3A 3M61U 5A8XA 3F68H 1E0FD 3I29A 4ABDA 2XCNA 1MU8B 2ANWA 1D3DB 4GAWA 2TGPZ 1DXPA 3LH3A 2CJIA 1C1OA 2Z7FE 3BTDE 1DICA 2G5NA 1NRNH 2A5KA 5JBAS 5JBTA 2V6NA 4IBLH 1GJ7B 1BRBE 3GCNA 3BTWE 1VZQH 3D49H 4BXWA 2GZ7A 1UHBA 3FAOA 4AB9A 1UCYE 3SNCA 1X7AC 3PB1E 1BRAA 2CF8H 4WMDA 1GMCF 1NRQH 2J34A 5E2PA 1TFXA 2UUJB 3SUFA 2FPZA 1TA6A 2ANMH 1D4PB 1RGQA 5HM2A 2THFB 1FNIA 3RXCA 2BYAX 3SNEA 1ESAA 3M5MA 1F7ZA 1BBRH 4WY3A 4DY7B 1A46H 3O8CA 2AYWA 3AVZA 3RXJA 1SFQB 1C2MA 1K1OA 4Y7BA 1KXBA 4DCDA 1P2KA 3TGKE 4UDWH 1BQYA 3RM0H 1O3MA 3EA9A 5F03A 2JH6D 1UTOA 1HXEH 1QA0A 4X6NA 5FPTA 2C8YB 4ZXYH 3ATLA 2BQ6B 1A2CH 1TNJA 5J4SA 1DXWA 2BXUH 2GZ9A 3M5OA 3KL6A 1DSUA 4BAKB 1BMNH 1MKXK 1P2OA 2BY5X 2XWBI 3RU4D 4FVBA 2G4UA 3SGQE 1ZSJA 3PTBA 4ZH8A 1QJ7B 5C1XA 3M3SA 1C1UH 8KME2 3K9XB 3SUGA 4B74A 3MO3A 3O8BA 4X8UH 3PMAB 2VGCB 1QL7A 3UNSA 2CXVA 1AFQC 1BBRK 3P92A 4Y0ZE 1ZYOA 2P8OB 3VGCB 2VINA 2ZGJA 2C90B 3LGWA 1OWHA 2AIPA 1C4V2 1XUIA 4IN1A 4NIWA 4AFUA 1VGCB 1ZHMA 2R0LA 1W14U 2ZFSA 1BRUP 1P8VC 3TLOA 3SJIA 3LJJA 3ZVBA 1DS2E 1NFXA 2H2ZA 1GMHG 1DWEH 4MNXA 2BLOA 1G2LA 1UVUH 1EJMA 1O2SA 3QO6A 2FOAA 4ZMAH 3TK5A 1TBZH 2O8LA 3F6UH 5BRRE 4OGYA 5GPIB 3QGJA 2D2DA 2A31A 4FUBA 3KIDU 4X2VA 1W3CA 1L4DA 4DT7B 3MFJA 1NZQH 2ZCLP 2ZCKP 1MCVA 2AH4X 2FOEA 1FY5A 3P8OA 4X6MA 1MAXA 3A80A 1MTNC 1C5VA 1S0RA 1EB2A 2PLXA 3QN7A 1G37A 1O2GH 1QQUA 1O2OA 3VB6A 1MU6B 1AFEH 1WU1A 4IW4E 1CVWH 4A1TA 1TMTH 2ODPA 3E91A 3LGYA 3ZZ5A 2XXLA 2FS9A 2AGGX 4LK4A 2PTCE 2ZF0H 2ZDMA 1G32B 2R0KA 1BBRE 1L0ZA 2FDAA 2NU4E 1OSSA 2NU3E 4Y10E 1Z1JA 6CHAB 1CGIE 2F83A 1B7XB 3RP2A 1TX6A 4Y11E 1DVAH 4ABIA 1TA2A 3PYHA 3ATWA 1GHAF 1FY4A 1PPBH 2FO9A 4HFPB 1A0HB 1H8DH 4YESB 2Z3EA 5J4QA 1BB0B 1BTHH 5FPYA 4KP0A 1GDNA 1L1JA 4O03A 1P02A 4JZ1A 3BTKE 1EZSC 5EPNA 4FU8A 2H9TH 1PFXC 3MU5A 1WTGH 2HVXA 3GCTF 4X0WU 1EUFA 3E3TA 1FPHH 1P57B 1TONA 5IDKA 3SV7A 3E6PH 4X2XA 2ALVA 1BDAA 4D7FA 3GYLB 3UNQA 1O5AB 1O5CB 8GCHG 2PWXA 3TNSA 1MD7A 2GV6A 2AFQB 1O33A 3A7XA 8LPRA 4WVPE 3M7QA 2Q6DA 4JYTA 2QCYA 3ZZ6A 2ZCHP 4WJG2 2A4RA 5GCHG 7ESTE 1T8LA 1WUNH 5AFZH 1KDQB 1PPGE 1ZTJA 4X1SU 4Y0YE 4RN6A 5FCRA 1K1NA 1W11U 5BPEA 4IMQA 2D26C 2CHAC 2Y5FA 3MH5A 4OS1A 1RIWC 4Q2KA 1Z6JH 4U01A 2QF3A 1O2KA 1TRMA 1O37A 7LPRA 4D76A 1P3EA 4OS7A 1IQEA 3E16B 1HV7A 4BTIB 1O2RA 2AMPA 2NU0E 1P3CA 3URDA 1D3TB 4WWYA 1RTLA 3LGUA 1F0TA 1G9IE 4R8TB 2BOHB 1GMDG 1A0LA 1O3CA 3SW2B 1GG6C 2VVUA 5ESTE 3V3MA 1QR3E 5EGMA 1ESBA 1WV7H 3Q3KA 3K2UA 3B23B 3IWMA 1O2UA 3AW0A 3SUDA 2SGFE 3P8NA 2FYQA 1GI1A 1P11E 2VB0A 4ESTE 4NA9H 3MU8A 2ZFRH 2J38A 2GGVB 1QRXA 2GCTB 1D3QB 4LZ4B 1ELBA 1TQ7B 1LVOA 2EI7A 3U9AH 1BMLA 1FN8A 1G30B 1GJBB 5T3HA 1LHGH 1SPJA 2PKAB 1AN1E 1GMHF 2GT8A 5T6DA 1QGFA 3SU5A 1GJ8B 2VIDA 1C5UA 1V2OT 1K1LA 2BDIA 4OS6A 1TGNA 5EW2H 4INKA 1A0JA 3AAUA 1C1SA 4NG9H 5LPEA 1ELFA 4NFEA 5G4BA 3TVJB 3A84A 1H9HE 1GBCA 2BHGA 3BG8A 1DY9A 1YKTA 4XE4A 4DG4A 2SGQE 1P10A 1EX3A 3U8RH 1IHTH 1IQGA 3RXQA 3UOPA 3GY2A 3UUZA 1GHVH 2GD4B 1NESE 3NCLA 1C1RA 4CR9A 3MO6A 1NFWA 4TPYA 2A45B 1L4ZA 3Q00A 1K22H 2BDHA 2ZNKH 2UUFB 3QUMP 1O3OA 1AHTH 2VWLA 3P70B 2V3OH 1THRH 3PMBB 1K1JA 1O5GH 1G3CA 3L3TA 1H9LB 2Z9JA 4JZDH 3QWCH 2JETB 2QAAA 4A1XA 2BTCE 2NWNA 1HJAB 1NRRH 1O2PA 6ESTA 5A8YA 2LPRA 4JMYA 1O3IA 3MU4A 4IMZA 4Y79A 2OTVA 1FN6A 4ZAEA 1QJ6B 3SU6A 1P03A 1GMCG 2PHBA 3NK8A 2CGAA 3GY4A 2VNTA 1SL3A 5F8ZA 5K0HA 2IJOB 1B5GH 4MPUA 3VFEA 1TBQH 1DUAA 1FY1A 3LC3A 3M5LA 1EPTB 3MWIU 3ZZAA 3PO1B 2VWMA 1CGHA 2PV9B 3RMNH 5DJ7A 1YPHC 1SGCA 4K69A 3BIVH 4UFDH 2ZG0H 1GI8B 2BDBA 2P59A 1TX7A 2FS8A 3ZV9A 5AF9H 1JRSA 1XUHA 4X6PA 5A2MH 1AI8H 5DKMA 1J15A 2VVVA 4AOQA 3ZZBA 1GI5A 1Z8IB 1N8OB 4OS4A 3ZVDA 1LMWB 1RS0A 1JBUH 2PKSC 3A7WA 1ARBA 2GCHG 2BY6X 2Y5GA 3SGBE 2J9NA 3PLPA 1EAIA 1GPZA 4IS5A 4AN7A 2XC4A 2O8UA 5HGGA 8GCHF 2WUCA 1HB0B 1OYTH 1YLDA 1P2JA 1KXCA 1KIGH 4LZ1H 1C2GA 1MKWH 3SNDA 4DW2U 1C5OH 3CS0A 3M7TA 2QA9E 2RCEA 3LT3A 2AS9A 3FP6E 3RC6A 3JZ1B 4DGJA 2R2MB 3EGKH 4XBBA 4AGKA 1QJ1B 2VIWA 2C8WB 2Z9LA 1DUEA 5GWZA 1GJ4H 1NRPH 1DE7H 1MH0A 4CBNA 2B8OH 5A8ZA 2ZPRA 3UPEA 3KQDA 4B75A 4NSYA 5FX6A 2PUXB 4ABGA 3SQEE 4NIXA 4FUEA 1YPEH 3SHAH