2UVDA

The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
b'MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
molecule tags Oxidoreductase
source organism Bacillus anthracis
publication title Crystal Structure of a 3-Oxoacyl-(Acylcarrier Protein) Reductase (Ba3989) from Bacillus Anthracis at 2.4-A Resolution.
pubmed doi rcsb
total genus 90
structure length 246
sequence length 246
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2uvdA00
2HK9A 3OF2A 3ZW9A 3NGLA 1YB4A 1DXYA 1MC4A 1EVIA 3VH1A 1QR6A 3WSWA 2QW8A 3F46A 4P38A 5G4LA 2B69A 1U3UA 2ZCVA 4E2ZA 3H2ZA 1YKFA 3PDJA 5IZ4A 4YA6A 5CDUA 2IZZA 3NT4A 4RPLA 3VPHA 9LDTA 1D1SA 4NBUA 5BSFA 1R37A 4BHTA 2X23A 4DLLA 1NVGA 4E4YA 3JQ8B 4OYRA 4FOOA 2AW5A 2OUIA 3H8VA 2QYSA 2IYOA 2O4UX 3CKYA 2J5QA 1BVUA 1NM5A 3AW9A 2C82A 4CM9D 1Z73A 2LDBA 1BW9A 1JA9A 2AG5A 3ZV4A 1B15A 2PV7A 2BFMA 5KVQA 1ZXLA 2UUOA 3PLNA 4N18A 5EERA 1LDGA 5L53A 3FSRA 2UAGA 2Q4BA 4CV2A 1Y6JA 3QWBA 3U4HA 2B5WA 3SJUA 4BO1A 1N2SA 3WG9A 2V6BA 4MIOA 4Z9YA 5HA5A 3ULKA 3JQAA 4BO5A 1U8XX 4IUYA 1KVTA 2J3IA 2BLLA 4IM7A 2VN8A 3QWHA 1K2WA 4BO2A 2C0CA 3NRCA 5A05A 3OQBA 3PHLA 1NAHA 3OJ0A 4I5DA 5A5FA 4RVFA 5L7TA 3OHSX 4QO7A 3RVDA 3R0IA 3SXPA 3JD4A 1TA4A 5GZ6A 2I67A 5TX7A 4FJ0A 1IHXA 3BMOA 2HU2A 1YH3A 4CLRB 5L51A 4K6CA 5A06A 3WYEA 3FF4A 2ZCUA 1CIVA 1U8FO 3AJRA 2V6MA 5ER6A 5KTKA 1DC3A 3DO5A 1R6DA 4ND1A 2VOEA 1FDTA 3O8QB 3WXBA 4B3JA 3GF4A 1A9ZA 1J49A 3FD8A 3X2EA 4CPDA 3QWFA 4ZICA 1GCUA 4TRJA 4B7XA 5A9TA 4M1QA 2Y1FA 4E5YA 3U09A 3MWEB 1ZK1A 3QVOA 2JD2A 2SCUA 5JAIA 1HYEA 3TFOA 2YHUA 3QV1A 4BV9A 2PR2A 4MVJD 4CMAA 4UEOA 1P0CA 3LC1O 4UEJA 1P3DA 1ZEJA 4F45A 3ZU3A 5IJZA 3QLJA 1N7GA 2X1HA 3LF2A 5HS6A 1OAAA 3LT1A 1ZMTA 5JY1A 2PTGA 3BTUA 5B1YA 1HSOA 3GEGA 1ENOA 4NI5A 3W8EA 2AEJA 5IN5A 1NNUA 4XX0A 4BGVA 2QQ5A 2G5CA 1XCBA 2Y1CA 3ZWPA 4XYMA 1ZK2A 3PVZA 1A9YA 1BMDA 1BVRA 1VE9A 2NWQA 4RCVA 1T1RA 2JAHA 1LU9A 2E6UX 1B26A 2FPPA 4I9NA 4JJIA 5JCXA 1UXKA 2H9IA 1P45A 3A28A 4BKUA 4YYZA 3ONEA 4LN1A 3KYCA 4YT5A 4PG6A 1DC4A 2W90A 3ZWNA 1WDMA 4XIYA 1ZK4A 4EZBA 1I2CA 4Y6RA 4BNXA 2CDCA 4YTEA 1R16A 3ONDA 3F1KA 3IJRA 2BGMA 3PJFA 4EUHA 3ASVA 1SCUA 1QV6A 2EKLA 4U5QA 4BQRA 2VYVA 2J3JA 3DBVO 1I2BA 3KM0A 2JHGA 3ABIA 3O4RA 4M8SA 3VH2A 4IINA 4OGWA 4JLWA 4R5MA 4W7IA 2GO1A 3UFXA 5JAZA 5TQVA 1K89A 4ROSA 1SB9A 3W1VA 3VDQA 3ZW8A 2DKNA 5ITWA 4E30A 1NTOA 5DCYA 2O2SA 1P1FA 5G4KA 3C1AA 2F00A 1S6YA 1T4BA 1D4FA 2Y0CA 1UR5A 3RBZA 4Q3BA 2PH3A 5T57A 3GVIA 3VPGA 4B3HA 4YBZA 2O50A 4WOJA 4WNIA 1PGQA 1EMDA 3BMCA 3KEOA 3ZHBA 4C4OA 4UEKA 4LMRA 4PLVA 2WYWA 4GVLA 3UICA 2P9GA 2X22A 3NV9A 4IS3A 5I7FA 5JNLA 2VCYA 1UXIA 4O1MA 5T64A 2HMVA 3ZU4A 2DPGA 1WXDA 1QV7A 3OFSA 5BNIA 2HMUA 1PGJA 4CMIB 5AQ1A 1H93A 2IEDA 4CR6A 4UUMA 1OC2A 5HM8A 4XJTA 3K6JA 1V8BA 4LVUA 4R16A 1R0SA 3PZRA 1G0OA 3OJEA 4DXHA 1EEHA 4R01A 3FBTA 3AY3A 1NYTA 2DQ4A 4NU5A 1VL0A 3RCBA 5BR7A 3S2EA 4E12A 3DR3A 1ZVMA 4YJHB 3RUEA 5EL0A 1B0AA 4UVIA 4CM3A 2Q1SA 3K9QO 1KEVA 1GYPA 1Q0LA 5ENDA 1T25A 3B20A 5C7IO 1IPEA 5U4QA 2OP0A 4B7UA 2FP4A 3IP1A 3VTZA 3DOCA 4K28A 4EI2A 1B8PA 5COAA 3IMFA 2JKVA 3CMCO 5ILOA 1EQ2A 4E33A 1YQGA 3I3OA 4CMBA 1I2ZA 4R1UA 3QP9A 5IDWA 1HKUA 1YB5A 4RVDA 1LDEA 4RVHA 2HK8A 4MINA 1RJWA 4XB1A 1ISFA 4JP3A 5KIAA 1HDYA 1MFZA 1PS8A 5A04A 3VVCA 2IXAA 4ESOA 2O48X 3PJDA 1ULUA 5ICSA 1IB6A 3MOIA 3PEFA 3PHJA 1MC5A 1SMKA 1PGPA 4LMPA 4A0SA 5BSGA 2O3JA 2WYUA 3NT5A 3K8ZA 4Y8VA 1YOVA 1E3WB 2RBEA 3E6AA 3VH3A 4AJIA 3KSUA 1F8FA 4PN3A 5L3ZA 3E18A 5A5EA 4FD3A 4TQGA 2Y93A 2YDXA 4BKOA 2D2IA 2HUNA 2GLXA 1W6UA 3V2GA 3UAGA 5JW6A 3FR8A 5FI3A 1KS9A 3I9KA 4CLHA 3JV7A 4J4TA 4YJFA 2XXBA 1TI7A 4WGGA 3I9MA 1HE5A 1F12A 4CLDA 3STHA 5KCZA 3HADA 1B14A 1JAYA 5ES3A 4CMCA 4NPCA 1ONOA 1E3SA 4CLEA 2YW9A 4YQYA 3ROQA 5ICMA 1ZXBA 3ZH2A 1PR9A 1RPNA 3GDGA 4PG8A 4UVGA 1ORRA 1QORA 3JQBA 1LSSA 4BV8A 1DFGA 4GMGA 1M66A 1U4SA 3GPDG 5L4LA 3DBRA 3E9MA 3WYCA 4DBVO 3KUXA 1C0LA 3K96A 3V1TC 1OFGA 4JIGA 5FI5A 3TOZA 4YB8A 2I3GA 4ND3A 3GVXA 4AJ4A 1DPGA 3H6KA 2ZTLA 3JQ7B 5EQFA 2X6TA 4ZRNA 1QRRA 1L7DA 2BELA 2ZK7A 2VWGA 3GH3A 4GWKA 4IMPA 1MV8A 3AOEA 3WIDA 1LX6A 3PK0A 4AJJA 4FFPA 4B7CA 4X54A 3AU8A 4GPD1 2Q50A 4NDNE 3DMYA 3E5RA 1BXKA 1NXQA 1FMCA 3DQPA 3RIHA 2JL1A 1E7QA 3E48A 3IS3A 4YPOA 2PKQP 2EV9A 1H0KA 1I30A 1WZIA 4TZKA 4MO2A 4HY3A 2Z1MA 2NM0A 2DBQA 2GZ3A 5C7LO 2CDBA 2BF7A 3TRIA 3WGOA 1CEQA 3WOHA 5JMPA 1ZEMA 3OIDA 4MVJI 3PWZA 3PI7A 4IJVA 3OJLA 3CZRA 4PZEA 3PIIA 4EYEA 1LQTA 1Q1NA 4PCVA 1GUYA 4WEOA 3AY7A 2OZPA 4RLSA 4PG5A 2BHLA 3IOYA 1IHYA 2HO5A 1SAYA 5KJEA 4CLXA 4DIOA 2AA3A 4O63O 4E0BA 5MDHA 3IAHA 5A9RA 1WPQA 5I9MA 2ZB3A 1IOLA 2Y1DA 1OMOA 1UZLA 1DHTA 1E6EA 3RSHA 1X1EA 1I3LA 1PJCA 2OOSA 1X13A 1C1XA 1E7SA 3QW2A 2EGGA 5CG2A 1Y8RB 1UP6A 2PLAA 1YL7A 4BKQA 3ITDA 3WSVA 4DMMA 3GZ4A 1NQTA 3EVNA 4MIEA 5L40A 1JKFA 5EIOA 4YR9A 3H9EO 2AQHA 2GSDA 1NQ5A 3I5MA 4JQCA 1Y5MA 2O7SA 1M75A 1TT5A 2BGLA 1PS9A 2V7PA 5A3JA 4WCFA 5TC4A 4E32A 1RYEA 2A94A 4M87A 2YY7A 1O9BA 3I52A 1GYRA 1H6AA 3D4PA 3NDRA 5TS3A 3QVSA 4S1VA 1TEHA 1IULA 2CD9A 2CNBA 2Y0EA 2DAPA 3RUDA 3EYWA 4O6VA 3EGOA 4FFLA 3VHRA 3IL2A 3ENKA 2H5LA 2NUAA 4GLLA 1GR0A 1X0XA 3GG2A 3WBFA 1E1KA 5G2OA 3SJ7A 4FPXA 4LCJA 4Q3NA 3GOHA 5C7OO 3DAPA 1PZGA 4R69A 3OIFA 5DBGA 1NWCA 3QE3A 2EWMA 4A73A 3AUTA 3U4IA 3UCEA 3W6ZA 3IJPA 3DONA 3RI3A 4HXYA 4N5NA 5FF9A 3NEPX 1E3WA 1FF9A 4GX2A 3F4LA 5JSFA 1NR1A 4YAKA 5F21A 1VPDA 5JO9A 3GUCA 2Y1OA 3F5SA 1EE9A 2C20A 3I9JA 3NTOA 3DBRB 3JQGB 4C7KA 3N7UA 3JQBC 3OA2A 4A26A 3MJVA 1GEEA 3PIDA 3KTDA 2FN7A 3ICCA 4XYGA 1M6HA 3V2UA 1GUFA 3RUHA 1U4OA 1BDMA 3FPLA 4NNJA 4QFDA 1DDOA 1UP7A 3X2FA 1ONPA 1JQBA 4Z3DA 1ZSYA 3C7AA 4JP2A 1A5ZA 1ULSA 4LSMA 3D1LA 5BSEA 2V6FA 3GUYA 3TZQA 5AYVA 3O8QA 2X8LA 2DPHA 1MXHA 1N92A 2IRWA 3I9NA 4RQUA 3BTVA 4N5LA 1PWZA 1Z6ZA 3BZUA 3OP4A 4CMJA 1JDJA 2NQTA 1CYDA 1JU9A 1Y81A 4OMUA 2PKRA 1W4ZA 3OSUA 4MKZA 4R9SA 4E21A 4PGFA 1DC5A 1E3EA 1T2AA 1YBAA 4RJTA 1JN0A 2GD1O 1HDZA 1K0UA 4ZQHA 2O2YA 3OM9A 2HK7A 1ENPA 3V1UA 1MP0A 2C7VA 4IIUA 2VRCA 3R3SA 1PIWA 1P1RA 5JE8A 5IZCC 4YDRA 4BO6A 2FR8A 5LC1A 3GT0A 4CMIA 2Y67A 3B1JA 4IMRA 3JQFA 4JXKA 3Q3CA 2YFHA 1ONNA 3TFQA 3MEQA 2AHRA 4LVCA 4O0LA 2CF6A 4LISA 3HDYA 1PJBA 1NASA 1O6ZA 1MXFA 1WP4A 1MX3A 2X9NA 4IXTA 5THQA 3AI3A 4MP6A 3PHIA 2JFGA 3JQCA 4JJGA 5I8WA 5A02A 1R4MB 4Y6PA 5ITVA 5JY6A 2FY8A 4AL4A 4D3FA 3ZWXA 3OMLA 4ZGWA 3SLKA 4NH4A 3OETA 4AG3A 3O03A 2HRBA 5ADHA 4GX0A 4WLFA 5EJ2A 4NG5A 5KOIA 1DC6A 3AUUA 1ZJZA 2OBNA 1T24A 1YJ8A 1DIBA 1H2HA 1YDEA 4E5MA 5CFZA 3ZWOA 2VHWA 1M67A 2CUKA 3ZWYA 4J49A 1HT0A 4P4NA 8ADHA 2CVQA 2ZQYA 3EZYA 1JLLA 3KXDA 2O3TA 3KVOA 4Y98A 3VH4A 4YAIA 4KUHA 3E9QA 2WDZA 1LRJA 2UV8A 4PFJA 1YVEI 4B4WA 4LK3A 1AHIA 4YJFB 2NSDA 4J90A 1E5LA 5GMOA 1EUZA 3OA0A 3P19A 2BI8A 5DDIP 2HCTA 2VYVD 4DYVA 1YONA 4OSOA 3DZHA 2FMUA 4FSHA 1W73A 4CL3A 4CR7A 5TT1A 1ADCA 2DTDA 4CV0A 3RBXA 3UH1A 1WDKA 3OBBA 1P1HA 3RKUA 3OECA 1GFSA 3EVTA 4IS2A 1SB8A 1YOVB 3UOGA 4CMGA 3GC6A 4YACA 3ZV3A 2PD4A 4BO9A 5H81A 3SX2A 3RJ9A 1F06A 1ID1A 3GFBA 4HFNA 4YQZA 3VKVA 3BMNB 1EE2A 3H9UA 3JD0A 4W6ZA 5LDGA 4Q3AA 5T67A 4BB5A 4UUNA 1NPDA 3OEYA 2DTEA 4RF5A 3MTJA 3QY9A 4II3A 4FFMA 3W8DA 1XG5A 3JQAD 2CF5A 3GVHA 3F6YA 1QYWA 3IKVA 3JQEA 1E7WA 1P31A 3ZGYA 5TRTA 3S2IA 2O3SA 2PD3A 1PX0A 2YV1A 1F17A 2Q1WA 2GGSA 2CSUA 2CDAA 4GSLA 5BQFA 2HRZA 2QIOA 3BYZA 2VQ3A 5A9SA 2WTBA 3PQFA 1EUDA 1SPXA 4WASA 4BO8A 3COSA 2W2LA 3D3EA 3C1TA 1C1XB 4Z9FA 2YDYA 1XSEA 4IGFA 2ZJ0A 3WIEA 4RL6A 3PJGA 1RYDA 4DC1A 4N5MA 5I7VA 2EF1A 1PU2A 3F3SA 1DRVA 3H3JA 3KYCB 4CM8A 4CV3A 4H7PA 1WMAA 2FPIA 4XJSA 1RM5A 1KEUA 2R00A 4ZA2A 5DBIA 4NK5A 4I5EA 1ENZA 4L76A 5JXWA 3JQ9A 2A4KA 3BMOB 1LC0A 3D5TA 1XYGA 4NMHA 1O95A 4RVGA 4ILKA 4O59O 4E13A 5CDTA 1U5AA 1SZJG 3FHLA 4NBTA 1LLUA 1VSUA 3HB4X 1E3JA 1C1DA 1ADBA 1KVSA 1ZW1A 5B4VA 2NTNA 3KYDB 4J91A 1LJ8A 1V3VA 4L9RA 3VVBA 1I24A 1GV0A 1XA0A 4OXKA 4PIVA 2CZCA 5TJ9A 3OEWA 5C3MA 3B1KA 1LDMA 3GFGA 1UXHA 3GG9A 1MFPA 3ZV5A 4ZJUA 3ZV6A 1Q0QA 4CM4B 1KVQA 5TGDA 1PZFA 1E7RA 1HF3A 1J5PA 2E4AA 1TVEA 1D1TA 1E92A 3QSGA 3PHHA 2YQ5A 2R00C 4U0KA 1HDRA 1XLTA 2GN8A 2NVBA 4Z9XA 2FSSA 5I7SA 1FJHA 1WVGA 1F0YA 1P74A 2ZYDA 4W99A 3RJ5A 2NU7A 4IIVA 5DN9A 1EVZA 4MIYA 4CMKA 3NUGA 1HDOA 2VWQA 4FN4A 3WBBA 4EJMA 3FNHA 2D3TA 4BVAA 2RAFA 3NJ8A 2D8AA 2I5PO 4ALIA 5TLSA 4L75A 4Z6KA 8LDHA 1Q0HA 1N9GA 4IBOA 3AM5A 2HJRA 4NR0A 4B3IA 3RU7A 3P5SA 4I9UA 4R9RA 4F6CA 4IPTA 3N74A 4PG4A 5JAMA 1NAIA 1JWAB 3LT2A 3P2OA 2PY6A 5HBRA 1I3NA 2ZATA 4WJZA 3LLVA 1ZKMA 1Z45A 3OJOA 3AUSA 2O3QA 4EGFA 3C1OA 1UZNA 1PEDA 2BFPA 1Y8QB 2UUPA 3GEMA 3NAQA 4CQMA 1MLDA 4ID9A 4Z0HO 1GQQA 3WYBA 1L7EA 1QG6A 4DREA 4IXWA 3R3JA 3HDHA 1YB1A 4J1TA 3ZU2A 1KY4A 3U4DA 3PFFA 1MG5A 2Q49A 1Q7CA 1LSOA 3G1UA 3DHNA 2ZQZA 4J9VA 3ZHYA 4YWJA 4IJWA 1OI7A 3DMTC 2IEBA 1QLHA 2Q2VA 4MVJH 1XELA 3GHYA 4YT8A 2Q1UA 3UUWA 1J4AA 1I0ZA 3H2SA 1HETA 4A10A 3BAZA 1Q7BA 2J6IA 2GN9A 3MCVA 5K6AA 1N8KA 1CQJA 4D3SA 2NU8A 2GN6A 3WGYA 4B4OA 4F3YA 3ORFA 5DNAA 3DBLB 1E6WA 2FRDA 1UAGA 3HWRA 3H9GA 4NBVA 4K9DA 4ZU3A 3O9ZA 1I8TA 3BHIA 3MJCA 4K26A 2O3UA 1U3VA 4G2NA 4TKLA 4D41A 3QHAA 1U1IA 1YWGO 1YRLA 2NQ8A 5IAAA 5K9ZA 2O4CA 1R0LA 2C29D 3VPXA 1LSUA 2Y05A 5DULA 2WM3A 1Y9AA 5BNFA 1E6UA 1ARZA 2VUSA 3Q2IA 3T4EA 1K6IA 2OHXA 4BNVA 1T26A 1ISMA 2PWZA 4UVHA 3U62A 4L0QA 1XWFA 3JYLA 1V9LA 2NLOA 4I9HA 4QSMA 3ZWVA 3DOOA 1XIVA 1P9LA 3QIVA 5G0WA 3S55A 3PYXA 5DT9A 1YJQA 3PRJA 3TJRA 1C14A 4K1LA 4YVFA 4KWHA 4UUOA 4TKMA 3HB5X 1FDWA 1R15A 4HFJA 4Q3CA 3ZNPA 1NP3A 4YJGA 5DP2A 4Z0PA 3RC1A 3GVCA 4MVJA 5KVCA 1NR7A 1HLDA 2JFFA 2PGLA 3Q9UA 2RH8A 1IE3A 2EIHA 3Q1LA 4S3MA 4BNMA 1VJ1A 1Z75A 1PS0A 3EAGA 3GAZA 1GPDG 3GN1A 4FGWA 1O89A 2JJYA 1LRLA 4B4VA 1Y7TA 1E3IA 3IIEA 4HBGA 3DZKA 4BL5A 4NJMA 4OH1A 3GGGA 2POQX 2C59A 4J2HA 2C5AA 4I08A 2H1SA 3GVPA 3HFSA 2UDPA 2OORA 1QMGA 2Z95A 3JQ6A 4J4BA 4LCEA 3KLPX 4NZ9A 1P1JA 1VJ0A 1I01A 1DEHA 2P9CA 2WEKA 1NHWA 3RD5A 1CF2O 1PL6A 4DIFA 2OL4A 3Q6IA 4R1TA 4PLFA 1JW9B 4IQ0A 4CQMD 4D44A 3NX4A 4JBGA 3NDIA 4ALKA 1LBEA 1BGVA 4BNYA 1B16A 2IYPA 4IY1A 1U9JA 4PLGA 3AUAA 4XA8A 1QP8A 2VHYA 4YJDA 2WD8A 2BD0A 1GZ3A 4QX6A 3U5TA 1K6JA 2JHFA 1Z7BA 3E8XA 3PHGA 3QWAA 3VZQA 4F46A 5U9CA 3TF5A 5F1PA 3ROPA 3TZ6A 4RDIA 5CG1A 2H63A 5KWEA 4R4JA 4NJMB 4C7JA 2HQ1A 4TMFA 2D5AA 4PLYA 2YV3A 4XQGA 2GR9A 7MDHA 5KKCA 1A7KA 2Z5LA 3HSKA 1JKJA 4G5HA 5GZ1A 5IDXA 1ZZEA 4RPKA 5J23A 4AJ1A 2RHCA 5T5QA 3FNGA 3OICA 1LEHA 3L4BA 3UKOA 3KYBA 1YBVA 1AXGA 3L6EA 4UULA 2G17A 4BGUA 1U5CA 5JMWA 5CPBA 3AOGA 4YCAA 2PNFA 3GLQA 2YUTA 5JLAA 1B3RA 1XR3A 1I5RA 1ZMOA 4FBGA 1NFQA 4CM7A 4GKVA 1QYXA 4NFSA 3WWYA 3WICA 3OH8A 5IXSA 1Z82A 2BFAA 2NTJA 3IP3A 4IZHA 4R1NA 3GZNB 4U0JA 4MP8A 1A72A 1UXGA 2C2YA 3CIFA 3QVTA 4H3VA 5AXDA 3RWBA 3JQFC 5CDGA 1PJLA 3FBGA 4R3WA 2EERA 3FNEA 2P91A 3D3WB 4TRRA 5AXCA 4WOKA 3WR5A 4ITUA 5JAQA 1UUFA 2VRCD 3CTMA 4WCFC 5F1KA 2VZ8A 1DFIA 1CJCA 5I9NA 1HLPA 4WEQA 3MJ4A 4E6PA 3NTQA 2RIRA 4W4TA 3ZNNA 3DBHB 2HMWA 4QO8A 3U49A 4HUJA 2QZ9A 3VKUA 3TN7A 4ALJA 4BO7A 4DC0A 4EBFA 4QXMA 4HV4A 2I3AA 3DFUA 2DM6A 4DQVA 4D45A 3A4VA 4E5NA 3MJTA 1GZ4A 4Y6SA 4IJKA 4B8WA 1VLLA 1DOHA 1GQYA 3I4FA 1NWHA 3MOGA 3WMWA 2EEZA 3PTZA 6ADHA 2C07A 2ZB8A 1V3UA 3L9WA 4XGKA 5HS4A 1I3MA 1AE1A 3BMQB 3FPCA 1GCOA 4J0FA 3INTA 1VJTA 5T8KA 3LDHA 4AJEA 3PXXA 3K73O 2GUGA 2I99A 1ENYA 3HG7A 2DTXA 3DZGA 4OM8A 2OP1A 3K2BA 3NKLA 3PZBA 1Y8QA 2QZZA 4MPDA 5DZSA 4CQMB 1Z7EA 3C7CB 2P5YA 3BHJA 2DU8A 1LI4A 1HDXA 4WNCA 2BH9A 2C2XA 2OO5A 3GMDA 3D5QA 4RGBA 5AOVA 2X58A 1ISIA 4ND4A 3GNTA 4RF3A 4EDFA 1CRWG 3EZLA 2TMDA 2YFQA 3HDQA 4Z0TA 2B0JA 4D46A 5CAEA 1I10A 1NPYA 5FEUA 5L4SA 3SVTA 3ONFA 3EDMA 1LDNA 4NHEA 2C7GA 3DFZA 2FR1A 4HKTA 3PGJA 3AM3A 3PWSA 2X9VA 2ZYGA 4MP3A 2VNSA 1YBMA 4MOWA 3DHYA 3ADPA 4E2WA 4YT2A 5EINA 4YT4A 1E1MA 3TPCA 4XQCA 4BOYA 3DMTA 1BXZA 1YXMA 2JAPA 4GKBA 1EFLA 4AJOA 3Q9NA 3WGTA 2NVUA 1E77A 4JK3A 2VT3A 3F4BA 4OXNA 3WB9A 1G1AA 4LSWA 1PJQA 3KZVA 2NADA 2DUUA 3DC2A 3H5NA 4KTTE 1AHHA 3VPSA 3EC7A 4DL9A 4IDAA 4E5PA 5AXAA 3VTFA 3L6OO 4BMSA 1PJSA 1G0NA 1E3LA 3IKTA 4FC6A 2QX7A 4G65A 3TNLA 5TNXA 4FFRA 4YAEA 2FOIA 4XCVA 1PQUA 4Q9NA 1PJTA 5KJ1A 2GZ1A 4E31A 1MUUA 3R6DA 4OL9A 1GU7A 4GLOA 1WMBA 1ZFNA 4KUGA 3GDOA 5F5LA 3CPSA 2X5KO 1EFKA 4XYBA 1SC6A 3RBVA 3CH6A 2JFHA 3E9NA 1PJ3A 4M86A 2GDZA 2G82A 4P22A 2G0TA 1R4NA 3E82A 4MVJF 4ZD6A 3D4NA 2E37A 3GA0A 4R51A 4M89A 5EESA 3ZWBA 1CETA 4QFCA 3JD2A 3O26A 3MJEA 3IDSA 1B8VA 2EHDA 1AGNA 1XHLA 3JD3A 5HRUA 3JYQA 1G6KA 4GL4A 3ENNA 4IJUA 3ADOA 1ZCJA 1DIAA 5K6AC 4PLHA 3RUAA 1J6UA 5FFFA 1ZO8A 2QRJA 2H6EA 2FR0A 4XIJA 1P1IA 1NVTA 2BGKA 2Y1EA 2VTDA 1A71A 1NFFA 3JQ8A 4PZCA 4PVDA 5KJFA 1QYVA 3LK7A 4KDEA 2NU6A 2X0NA 3FN4A 3G1TA 1X7GA 3L9XA 3WTCA 5C5IA 5K0ZA 2JD0A 1M2WA 1SEVA 2DLDA 3I9OA 1DB3A 3RU9A 1KY5A 3V5NA 4ND5A 1GV1A 3DL2A 1FDVA 1PWXA 4W82A 3HN7A 1Y9EA 4FW8A 4TZTA 1NX6A 2VT2A 3TL2A 5ENVA 4D79A 4J7CA 5JC8A 2HLPA 2Q2WA 2WJPA 4XD2A 1OBFO 3QVWA 3E5MA 1NVMB 3WGIA 1H6BA 3DAFA 4M55A 2YJZA 4E2XA 4XEHA 2PGDA 4RF4A 5KVVA 4PLZA 5AVOA 4CM9A 4J9UE 2BRUA 1U2DA 3KLMX 5DCWA 1BDBA 3KYDA 4PZDA 3ITKA 3ZWMA 3SC6A 3WS7A 4B8ZA 1EQUA 2GN4A 3EMKA 4IQ8A 1YL5A 4DBZA 1GQ2A 1N9GB 4XGNA 1N1EA 1DIGA 1T4DA 1TT5B 1QYDA 4BNGA 1KIFA 4RZHA 5JPIA 5JDCA 3A14A 3WGZA 3JD1A 4GWGA 4KZPA 4AJKA 4DLBA 4DPMA 4F6LA 2PGJA 3S2FA 6LDHA 3OJFA 4BQPA 4L4XA 2XOXA 1ADGA 4YRBA 1EVJA 2NVWA 4BMVA 3LSYA 1LLDA 2E49A 3PQDA 3KRTA 5EQDA 3VOSA 4UVDA 1LLQA 2X7HA 3L0DA 3JYPA 5TJHA 1PL8A 4P8RA 1VKNA 3AI2A 3W6UA 2X5OA 2JCXA 2W98A 2Y99A 1YL6A 3S1LA 3WNVA 3IUPA 1LDBA 4GBJA 1DHRA 1PR3A 2OGUA 1M76A 3I9LA 4R3NA 1L1FA 3WFIA 5JO0A 1YE3A 3L4SO 1QSGA 1O0SA 3GGPA 3E1KA 4BGIA 4TWRA 2B4RO 3DZBA 2Y66A 3K30A 3QRWA 3U0BA 4ZHSA 4HNHA 4BGEA 2VHXA 4RO0A 4HFMA 4DLAA 4RORA 1ZUD1 2ZYAA 4OHUA 2DT5A 5BSHA 3CEAA 1B8UA 4GX1A 5JDIA 2CY0A 3BMNA 4KQXA 2G1UA 3E03A 3JQ9C 2B4QA 2DVMA 3VZSA 1C0PA 1TLTA 2YZ7A 4NIMA 3JYNA 4WK6A 4QUKA 5CEEA 5IZCA 3AM4A 4I5FA 4JN6B 4PRLA 2YHIB 2I66A 4DQUA 4BNZA 1WZEA 2D59A 5DF1A 4RPJA 1WWKA 4YRAA 1E7YA 3TSCA 5MGBA 4OKIA 4XQ9A 1BXGA 1BRMA 4QT0A 3V1YA 1PQWA 3NT2A 4JROA 3AU9A 1O8CA 4U7WA 5JYEA 4O5OA 3KB6A 3TQHA 4KTVE 3WQSB 4B79A 1ZBQA 4XB2A 1R4MA 4MVJG 4EEXA 1PL7A 4J3FA 3LQFA 3DB2A 1TT7A 5A3VA 4KWIA 4CM5A 1Q2XA 1KVRA 4D7AA 1FK8A 5CP8A 1V6AA 1DJQA 1GYQA 2WD7B 3HQ4O 3GAFA 1ZK3A 3RFXA 4D43A 4PLPA 3DAGA 1F8GA 5A03A 1H6DA 4J2OA 4OOFA 3UHAA 4DPLA 4N54A 1NHGA 2V65A 5T8KC 3SEFA 3RUIA 4WKGA 3HFGA 3LC7O 2TMGA 1V0JA 1F14A 2DUWA 2HMSA 3PDUA 4W9NC 1VL8A 2FHSA 3GN2A 1U3TA 5L7YA 3ROMA 4E3ZA 3K5PA 3Q2KA 4PLWA 4JBIA 2Q46A 4JBHA 1QLJA 5IN4A 1KERA 5F1OA 3LZ6A 5TT0A 1UZMA 2IDZA 2P9EA 3F47A 1NFRA 4W7HA 1H2BA 3ANLA 3F5QA 4BNHA 1DLJA 4AJ2A 3ZN2A 1DIHA 4FR5A 3GNQA 1H6CA 4OIMA 5HWSA 2EXXA 1X1TA 2B5VA 4BO0A 4NK4A 1W0CA 4FOSA 2W8ZA 1JKIA 1NBOA 3AY6A 3GK3A 1GPJA 3H9JA 3D0OA 3M1LA 4WCFB 5T6BA 1PGOA 1I3KA 2ET6A 4CR8A 2O23A 4TRMA 1WW8A 4CMEC 4AFNA 1FDSA 2J5KA 5TSDA 5L4NA 2AE2A 3G0OA 2AEFA 2I6TA 1IPFA 1RWBA 4PVCA 1V3TA 5F5NA 3DOJA 2AEMA 1VI2A 3H3FA 4CUZA 4M49A 2X0JA 4Y9DA 2NV6A 5IFLA 2DBRA 3WGHA 1I32A 3DHEA 3JQDA 2ZTVA 4RPHA 2PFGA 1E1NA 1O94A 1RM3A 4LGVA 2GF2A 4Y67A 1PQPA 2W2KB 1TXGA 4NBRA 2AMFA 1EK5A 4D42A 3WNQA 3G3EA 2QRLA 4MVJE 4XQEA 5JCJA 1OOEA 4AJPA 3HJAA 3SBOA 1E1LA 3ANNA 1M6WA 2GYYA 2UVDA 2B4TO 4TVOA 1X7DA 4U6QA 2GPTA 5HTOA 3HUDA 2EJVA 4J16A 1UDBA 1H94A 3H65A 1EBUA 4YAJA 4ALMA 1HDGO 1LUAA 1P0FA 1IYZA 4KMSA 4OSPA 5H82A 3W8FA 4WLOA 3KEQA 3CXRA 1T2CA 1X0VA 2IZ0A 4HWKA 2RH4A 4FFNA 1HZZA 3GQVA 3WJ7A 1KETA 4HNGA 2X9GA 2PKQO 2OFPA 4CV1A 2VNAA 3FWNA 3NYWA 4DYDA 2Y0DA 3JQ7A 4FC7A 3ZNOA 4XRGA 1PSDA 4DPKA 1DRUA 2D5CA 1UJMA 1XKQA 4QECA 4FJ2A 4XWYA 4J0EA 4A03A 4CUJA 4FDAA 3BIOA 5CPFA 3TZHA 5CEJA 2GZ2A 4BNFA 5CDSA 5FWNA 4TVBA 4BS9A 4GVXA 1CDOA 4GX5A 4E2YA 4Q3DA 4XYLA 1PJ4A 4A27A 1D8AA 2WYVA 1GDHA 2VTEA 3IC5A 4OJNA 4GI2A 3JQGA 3I1JA 1DBVO 5KKAA 1UXJA 1GZ6A 4RZIA 2Q3EA 3MTGA 4GSKA 4KP7A 1HSZA 1MB4A 4IDGA 3G79A 4JGBA 1Y8RA 2AQKA 1GADO 4CLOA 5JFOA 1R66A 1X15A 4IDBA 1VSVA 1E0DA 1XEAA 1BHSA 5IG2A 4GQAA 1FDUA 2XF8A 2W2KA 4GAEA 1Y1PA 1E5QA 1EBFA 2EJWA 1NPTO 1VKOA 4WUVA 4CM4A 3INGA 4NJOA 4WPGA 2NVUB 2IE0A 4KQWA 4J1QA 3U9LA 4ZRMA 1UP4A 1RKXA 2IXBA 3FTNA 4ZVVA 1I36A 5DBFA 3QVXA 5I7EA 1BTOA 4DWVA 3GMSA 3DZJA 2C54A 1C1DB 4GH5A 5G0TA 2D4AA 3WQQA 3AFNA 4IZIA 4J43A 3VPFA 2HSDA 1A4IA 1AUPA 2AE1A 1ML3A 4ZN6A 5CDYA 3EUWA 1ZJYA 1SNYA 1N5DA 1DRWA 3PPIA 1DAPA 5THKA 3PQEA 1IY8A 3EK2A 4JNKA 1I33A 2QHXA 1TB4A 3WGQA 1S7CA 1C3VA 2J8ZA 3JSAA 3RASA 3GGOA 9LDBA 4L8VA 4CM8B 4E5KA 2F1KA 3PP8A 3NDJA 4HADA 3TL3A 1H9AA 1YDWA 5B12A 1YQDA 2HMTA 3UW3A 4NFYA 4EUEA 3RC9A 1CERA 4I5GA 3I23A 4UREA 3EW7A 4OXYA 4KDFA 2EP5A 4RQTA 3AWDA 1YQXA 1P33A 1KEWA 2VZ0A 2W4QA 4D0RA 3DTTA 4XR9A 3VZPA 4Z3KA 4MDHA 3NTRA 2HKIA 1HDCA 1LSJA 4IDFA 1T2FA 4CQLB 4CLRA 3GR6A 4GMFA 2AQIA 2D1YA 2QYTA 4P4GA 4DUPA 3QQPA 3HZZA 4BKPA 3DWFA 2WSBA 4U6SA 2GASA 1HTBA 1MA0A 1H9BA 1VL6A 3KSDO 2W2LD 1XU7A 4OOEA 5DCUA 3F1LA 3D7LA 4PRKA 1SOVA 1FXSA 3OQ1A 2VOJA 3GPIA 3FRJA 2E48A 4R1SA 4CQLA 4OO3A 4BUCA 5G0UA 3CINA 2VHVA 2ZB7A 4CJXA 5CHEA 4J1SA 4OKNA 2I65A 1B2LA 3GDFA 5JCJD 1R12A 2FWMX 2VZ9A 3TOXA 5L95A 1BG6A 1NQOA 4MJLA 3ZHXA 1QXSA 2OXIA 4G81A 2LDXA 5F3RA 4A7PA 2EKPA 5G4KB 1T1SA 1LQUA 4UVEA 3GZNA 3HE3A 3QWIA 2ZKLA 2V6GA 4LRTB 4AJNA 3QJ5A 3O38A 4CM1A 2HJSA 2R6JA 1ZSNA 3IQDB 3M2PA 3WJAA 4DRYA 2JCYA 2ZIZA 2PZLA 2DC1A 3PFWO 1CQIA 5ER9A 4NFHA 5LDHA 3UGKA 2NU9A 4PG7A 3H5RA 5G0SA 5KJ6A 4EW6A 4RPGA 5JDCC 1U2GA 2B35A 5EN4A 4H16A 4ZQEA 1SBYA 4R41A 3UF0A 1ZK0A 3T7CA 5IDQA 1Y5RA 4A2CA 5C37A 3EY4A 2X4GA 3MWDB 1K5HA 4AJHA 2PH5A 1GEGA 4QEDA 1YO6A 1VC2A 3HHPA 1B7GO 1MG0A 3L6DA 1VM6A 4DIBA 3DZIA 3VC7A 3U4CA 1HE2A 3AK4A 2GNAA 4R5HA 2PA3A 1OC4A 4J1NA 2Y1GA 5L45A 2A92A 4MKXA 3WQRA 1HRDA 1H5QA 2QRKA 4WE3A 1DIRA 1IUKA 2BI7A 3A06A 4BNIA 1JTVA 5B4TA 1UAYA 3BHMA 2X86A 1WDLA 3A9WA 4XDYA 1LA2A 4QQRA 5JS6A 5JDIC 3B1FA 1KVUA 1BSVA 1V35A 3NGXA 2WD7A 3RUFA 3FI9A 3ETEA 1EVYA 4CM6A 5L7WA 1A27A 3KO8A 3BXXA 1LXCA 2GERA 2GRAA 4MVJP 1KBZA 4D0SA 1EDZA 5IF3A 1KC3A 1PGNA 4RVSA 4M54A 2X5JO 4BNWA 1EZ4A 3BMCB 5COBA 4DMLA 1K3TA 2DFDA 2NTVA 4ZQFA 2B36A 1ZIDA 3N58A 1K6XA 3GEDA 2P2SA 2I9PA 1HWYA 2VUUA 1A4UA 2P4HX 3ZCXA 1T2EA 1Z74A 2FZWA 3P2YA 3WGGA 3CSDA 3UN1A 3I6QA 2VHZA 2WE8A 3PLRA 3LT4A 4YJHA 2J3KA 2J3HA 2X0RA 4XR4A 5ILGA 4AICA 5I9LA 3TWOA 2YHIA 3CMMA 1OZAA 2B37A 1ZH8A 3FCOA 4EUFA 2ZTMA 2CVOA 4EITA 3TDKA 1P77A 4ZQBA 1C0KA 1LRKA 4XRRA 4L73A 4XDZA 4YEDA 4KOAA 5TIIA 1GUZA 2BFOA 3KOUA 1D7OA 5I8ZA 1WLYA 3ZU5A 3HDJA 3OQ6A 2AQ8A 4PLTA 5CEFA 3LLSA 1UDCA 5GZ3A 1T2DA 3LVFO 4PLCA 4WLEA 3W4JA 3JQAB 2RCYA 1CWUA 1DSSG 1UDAA 3ETGA 2AXQA 3SC4A 5B4UA 1IZ0A 3KHUA 1ISHA 3U3XA 4FS3A 3RFVA 5LCXA 1HE4A 5L9AA 3UVEA 3GHHA 2BMAA 4DVJA 3ZI0A 3MJSA 4BNLA 5JBIA 3ST7A 2ZTUA 4ONEA 1R4NB 4BNJA 1X14A 2YV2A 3VZRA 4HFRA 2YYYA 3C24A 4ND2A 3GNSA 1BW9B 3P7MA 4CLOB 2X0IA 2WE7A 1E7MA 3L77A 1EUCA 3FNFA 1HZJA 4RF2A 4AVYA 2JCVA 3UCXA 1U7HA 4UAGA 4U8GA 4CUKA 3M2TA 2OMEA 4YAGA 2Y68A 1XQ6A 4IGEA 4JX8A 3MZ0A 4EEZA 3C85A 4J7UA 3ZWAA 4L4RA 3WFJA 2IZ1A 3ROKA 2Q2QA 4GGPA 3DDNA 1XQ1A 1GAEO 3H9QA 3HNPA 3C3XA 2EG9A 3BA1A 3INRA 4D3DA 3IUSA 1XGKA 2ZJ1A 2A35A 4II2A 1QYCA 3GY0A 4WLUA 1HL3A 5IDYA 3ZWCA 1EDOA 1UH5A 5BNTA 1LC3A 3DZFA 4XZ3A 5TF4A 2FSVA 4BIIA 3H4VA 3NJ4A 3D4OA 4TSKA 2PZJA 4Q39A 3JYOA 4TRNA 4FFOA 1RM0A 4URFA 2A9FA 3LYLA 4KUEA 1U7TA 1R0KA 2RHRA 4ALLA 2GCGA 4RDHA 1PZHA 3ON5A 3PYMA 4CMHA 2P4QA 3GRPA 3Q0EA 3I6IA 1N7HA 4AJLA 1J0XO 1DO8A 3BTSA 4J7XA 4Q3EA 5AXBA 2VUTA 3RUCA 1B3BA 3DBHA 3B6ZA 1N1GA 4IDEA 4R68A 1HYGA 4GGOA 4P4LA 5IXYA 4OAQA 2VYNA 2NACA 3V2HA 1ZSVA 3M6IA 4INAA 4EJ0A 2VRBA 3VDRA 1WNTA 5JYDA 1EK6A 4FJ1A 3SLGA 4BKRA 1YGYA 2J5RA 5U1PA 4J4HA 2O3RA 1LDYA 3KV3O 3K31A 3T4XA 4RVUA 4YRDA 5KNLA 4MKRA 2HAEA 2FZEA 4FB5A 1GL3A 1XU9A 2EP7A 3F9IA 2YQ4A 3JCZA 2R2GA 3ETDA 4RV9A 3S8MA 3AOEC 5H83A 3OIGA 1ISGA 2P68A 2UYYA 4I8XA 2I76A 1ISJA 1KOLA 2Q1TA 3I83A 4BB6A 4R54A 5COQA 3BTOA 3D64A 3FWZA 1IZ9A 1ADFA 3JTMA 3FR7A 3WMXA 5A4DA 2Q45A 1IL0A 2DBZA 4IDCA 1PTJA 5DOVA 5BT9A 3V8BA 4FIZA 5G0VA 1KYQA 4N7RA 4ALNA 3ZDFA 1SO8A 1C0IA 1W8DA 4BNTA 2QG4A 2IODA 1SOWA 3GRKA 2G76A 3G49A 1PJ2A 2VWPA 3EHEA 3R1IA 2NNLD 1VRWA 3H7AA 5A9SB 1P1KA 3BMQA 4DA9A 3ZHZA 1DLIA 3CE6A 1NQAO 3D3WA 3HN2A 4BMNA 3KETA 4L74A 3QA9A 2PZKA 1LLCA 3ASUA 2VWHA 2EKQA 4EJ6A 1XDWA 4XKJA 3S2GA 4OQYA 2WMDA 4B4UA 4WECA 1A7AA 5DOZA 4CODB 1GTMA 3H5AA 2OBYA 3WTBA 4BO3A 3RQSA 1MGOA 1U3WA 3CUKA 4XYEA 4JCOA 3UCFA 3ZZNA 3ICPA 1RM4A 4WLVA 4BO4A 3L4BC 1AN9A 4LW8A 4BNNA 2Z1NA 1DFHA 3WLFA 5DP1A 2P5UA 4FGSA 4WCDA 3LT0A 1LNQA 1HXHA 2HDHA 3W4IA 3FTPA 1AXEA 4TROA 3ANMA 2PK3A 3WX0A 2JD1A 1DAOA 3L07A 4QTZA 4BNUA 1GY8A 3LC2O 4WLNA 1BXGB 3A1NA 2XXJA 1KC1A 2D0IA 1YS4A 1KEPA 4J6FA 2WWRA 3LF1A 4MVJM 1WAMA 1X7HA 2VYND 3WLEA 3TZKA 1O5IA 1BWSA 3DXFA 3KBOA 4IDDA 4LRSB 1GD1O 4K6FA 3RAJA 3C8MA 3PJEA 5KVSA 4FQ8A 1JWBB 5B37A 2Q4EA 3WDSA 2EW2A 2XAAA 1HYHA 4RLHA 4NU6A 5EPOA 1PZEA 2DBVO 4CMEA 3RC7A 2ILTA 3WWZA 1P44A 2DFVA 1HEUA 3LU1A 4BNKA 3C7DB 3AFMA 2PZMA 3CZMA 4ZQGA 5FYDA 4UUPA 3PYLA 4OQZA 3I4CA 3TZCA 3T7EA 2BKAA 3ZNQA 7ADHA 5KJCA 4H15A 5EMHA 1JAXA 1SEPA 4I1IA 2C5EA 4XGIA 1D3AA 2EGHA 3M1AA 2FPGA 4FCCA 3DTYA 3ZWWA 1Q7GA 2CVZA 4NQZA 4HX5A 5GY7A 2ZB4A 3DBLA 2AG8A 3VAZA 4IQGA 3RFTA 1DJNA 5A1TA 4NBWA 2E82A 1JVSA 3K92A 3DEYX 4YJGB 4DTIA 2B83A 3PWKA 4HP8A 4DGSA 4L4SA 2EW8A 2CMDA 2XPCA 2CFCA 2PD6A 4W9NA 1JVBA 2O7QA 4JJFA 3RC2A 3PGXA 3RROA 4DQXA 1QKIA 3RKRA 1ZNQO 3Q11A 2Q99A 4A5OA 1LTHR 4CL8A 3KSZO 3K2EA 1U28A 3G17A 3UXYA 5JC1A 1HE3A 3B70A 4YXFA 3W4KA 3AI1A
chains in the Genus database with same CATH superfamily
4CF3A 2R25B 2N47A 1SQ0A 3QUSA 2IV7A 4WGFA 1ZD9A 3TLXA 2B82A 4D8YA 1MAAA 2X4IA 4KI7A 2WJ6A 3OPMA 1QR6A 4YGXB 1GG8A 1PTJC 2QW8A 2YOHA 3HKCA 1TO1E 2ZIFA 4P38A 1X9GA 1G42A 4K0RA 3NC1C 1GZ7A 2JFNA 2ZBDA 4E2ZA 1I0LA 1JQKA 4AUNA 3WO0A 1C3OB 3SNHA 3PDJA 4KXQA 2ON6A 4FK8A 2IZZA 4YA6A 5CDUA 3NT4A 1C81A 1EDBA 4I4NA 1M34E 5L6MB 5C5EA 3AB3A 4FWIB 1J9GA 4QFBA 1A5TA 2H1CA 3SEQA 3WL6A 3KL4A 5CD9A 4WK2B 2DPMA 4ETMA 5K0BA 4KO4S 1TCAA 1YZKA 3ISJA 4DCNA 2R6DA 3OD1A 3NHFA 5D5PA 2FRVA 1M6NA 2QX4A 4NS1A 4NENA 5FWXB 1ZA2A 3MTDA 4IIJB 1BVUA 4LY6A 1JE0A 3GROA 1MJ5A 1NC1A 2CN1A 2C82A 2H8GA 2NO9A 2VL7A 3AW9A 4GOKA 4CM9D 1NG1A 1RZUA 3HXOA 1B15A 5BMVF 1FSSA 1OGIA 4QHSA 3DTVA 3BF8A 3PLNA 3QM1A 3FDIA 4N18A 1CT9A 2BDTA 4IF6A 4JZKA 2Z3ZA 3WMRA 1AGPA 4N8EA 4DQDA 4A3SA 1E2NA 1Y6JA 2X4DA 3TXXA 5DNCA 2FJPA 4Q0MA 1NW4A 1OKKD 3F7OA 4ENUA 1DV1A 2QM7A 5AW5A 5JHGB 4BO1A 3WG9A 1K5PA 1WB5A 4MIOA 4Z9YA 5KWIA 1BEZA 1IATA 5HCNA 4QD3A 2BFDA 5FLXA 3LOPA 2CB9A 4NCJA 2BC9A 4IUYA 4KRYA 1KVTA 2NTYC 1MRNA 3RYFA 3ZBQA 4XSVA 3I04M 2J3IA 3KG2A 3I0ZA 3VPCA 4KFRA 4ETWA 4ZQCB 3R76A 1DMRA 1NONA 3QWHA 4HPWA 4N3GA 4OBBA 2C3MA 2PSJA 4EHHA 3D8SA 3A4MA 4BO2A 4R8RA 3DAYA 3SDZA 3OJ0A 4I5DA 4EO9A 1E64A 2WG0A 1CRZA 4GNKA 3BFPA 4RVFA 5AW8A 5L7TA 3RVDA 5IBCA 1JECA 3ZBPA 2G9QA 1MO2A 1TA4A 2CNWD 2ZW9A 5TX7A 4AAYA 5FOSA 4BDTA 4EGQA 1IHXA 5E9QA 3WLRA 1HGXA 3A8TA 2QLBA 1LLFA 1IVYA 3U60B 1H0SA 2F55A 1G21B 3QNUA 2YVQA 2FFHA 4X3CA 5EP1A 3ZKAA 1W59A 4G1EB 1TOAA 3PGKA 2EWVA 4BQQA 2ZYUX 4K9NA 5ANRB 4OI2A 1NF3A 1ZNZA 1IU9A 5AW7A 2QMHA 4G5RA 5KYUB 4B3JA 2BZGA 5AVUA 4EGJA 1E5VA 3FD8A 4ZICA 1KEEA 1UT6A 1GCUA 1OLXA 2A0FA 2IK8A 4CCAA 2EJCA 4E5YA 2WICA 2P2YA 4MO9A 4JJ6A 5I6DA 2SCUA 4J75A 3OT5A 1WUYA 3GLGE 2BR5A 2EL9A 4WKNA 2F8TA 2PR2A 1QPZA 2QS9A 5FBKA 4CMAA 1N0UA 1D1PA 1E2FA 2OLEA 1I1HA 1O8BA 2PT6A 3LC1O 3O1LA 3OIYA 4ESEA 3BD7A 3FDZB 4OREX 3CLUC 1JZSA 3HBJA 3TCXB 2WWWA 2EX0A 3A04A 2KI5A 4FX2A 5IJZA 3VFDA 2YJ4A 5HS6A 1JSXA 4C4PA 4BJHB 2BR3A 3OVMA 1JAIA 1G3UA 1SU4A 5HGJA 5JY1A 2PTGA 1RC8A 3I2HA 4BEVA 1ENOA 1DWUA 3FYUA 16PKA 5C8DA 1T3HA 1NNUA 1IEXA 2JCBA 3C0KA 2FX2A 2C9BA 3E1SA 4G0VA 2E55A 2Y1CA 2DETA 3K09C 4E3WA 3K6SA 5HKLA 3PVZA 1QTQA 5ALPA 1KH3A 1BVRA 1WY5A 3EMDA 3ZYZA 3PRKE 1T1RA 2JAHA 5EJIA 1AGRA 2VYCA 1ZHOA 1B26A 2FPPA 3FG9A 4HTFB 4FHEA 1UPTA 5LUBA 2G9NA 4MQEA 4DIKA 3P9KA 4QDOA 4TKUA 5BV0A 1UXKA 1BH6A 1P45A 4BKUA 1FXWF 3P96A 4LN1A 4L9WA 3OOWA 4YT5A 4PG6A 3L7MA 5IVHA 5CVTA 5AJHA 1K3UB 3NVKI 2XITA 3ZWNA 1HMPA 5JFGA 2NNWB 1ZK4A 3C97A 2JIOA 4UTVA 3WK8A 4DS3A 5EC8A 4MJ3A 3E8MA 1I2CA 3VNBA 4I1YA 3NCTA 1GITA 5BYBA 1KDYA 4B3XA 4E09A 3FMVA 1R16A 2BEVA 2R1TA 3W7VA 4DDHA 1CFZA 3IJRA 3D2AA 1GAJA 5FNVB 2BGMA 2J3EA 2QVYX 3DEIA 4H3SA 2JDID 4IEFB 4EUHA 3P0HA 1SCUA 1DBRA 1QV6A 2CNDA 4IMJB 3I73A 5TF0A 1W96A 2P75A 1YIAA 3OZIA 4BV3A 3DBVO 3EBLA 3A11A 4QU0A 1QU2A 5FUVA 1WXHA 3EVDA 3ZDDA 5CK5A 1QOQB 4M22A 2O52A 2VNJA 5JI2E 3AUYA 3ZDRA 4ZOLF 2X6QA 3UFXA 1QCZA 1IDOA 2QD2A 3SM9A 5BWNA 2B6HA 2P2LA 3WGNA 2FZLA 3W1VA 5B30A 1XCLA 3BK2A 3H0CA 5ITWA 2JW5A 4P4UA 4J07A 4KCGA 2RGEA 4K2AA 4HB4A 4WN9B 5G4KA 5UKDA 2F00A 2J9XB 3PNMA 1QQBA 2Y0CA 1PYOA 3BFVA 2XV1A 4JJKA 4Q3BA 3R7BA 2A4MA 1LZLA 3GVIA 1Z5NA 2WIGA 1SD2A 4GXRA 4X66B 3KWLA 2VJMB 5FPQA 3ORSA 1C4KA 3ZE8A 4D9FA 2X0KA 4YRPA 3ZVKA 2BGTA 1TZ2A 2W6OA 1Y4UA 4G09A 1MABB 2R6R1 2VCYA 4IDPA 5JNLA 1WSBA 1OYYA 1YBHA 3W7BA 1UXIA 3A1TA 4FHDA 4RGBA 3KZKA 2IHNA 4RSHA 1OVGA 3AVTA 2DPGA 1WXDA 3HL4A 1QV7A 3OFSA 1PGJA 4EOGA 4L6AA 3U4QA 4CEIB 4CR6A 3E22A 2W22A 1OC2A 3FF1A 5HM8A 5DX1A 5GM1A 5EE0A 5IC5A 4C4RA 5KYYA 4YRMA 3K6JA 3L4JA 3H2YA 3PUKA 4LVUA 4R16A 5IXJA 2FPLA 1G5RA 4JBYA 1ZGHA 1FMFA 4AF8A 2HLDA 4OFWA 1KAOA 1NYTA 4NU5A 4PBSA 1T5BA 1WF6A 2BE9A 4QPJC 5B1IA 5DMHA 3HNRA 4YJHB 3RUEA 1OX6A 1F7UA 3UGTA 3A10A 5E2IA 1FSZA 4UHCA 2GXSA 2IWRA 5FUBA 4CIAA 1P2FA 4GEKA 3HP7A 3RYCB 3K9QO 3C3EA 4IJMA 3RVNA 3OSZA 1JJBA 2C78A 3A7EA 4B4DA 4E08A 4EMUA 3B20A 3UAXA 5CW1A 1NRJB 2FQQA 3CEPB 3KTOA 1G3MA 4HG2A 5ALKA 4CGZA 1EIWA 5K0TA 2EQAA 2X8AA 3VTZA 3DOCA 4K28A 3HEMA 4EI2A 4QJBA 3AL3A 1U2ZA 4I55B 2CLFB 4N5HX 1FUYB 3ZX5A 1XZLA 1ZGCA 5ISMA 2VYFA 1I2ZA 2LCIA 4OGKA 1FSFA 5IDWA 1HKUA 4MKHA 4AYXA 3BB3A 4H7HA 1VDMA 1G1MA 2JA2A 2JLRA 4RVHA 2FSPA 1GPWB 1QWSA 2HK8A 4LYGA 4M4SA 4MINA 5CLJA 5JAOA 2JLYA 2V7GA 1ISFA 4GZLA 4MW9A 1HDYA 1PS8A 3HLTA 2DUMA 3B5IA 4K46A 4ZXFA 3T7JA 4TV9B 1EFTA 1QFZA 1TM4E 2B94A 3JY6A 4JT9A 4UXJA 5LBIA 3VJLA 1ULUA 1HYBA 2YXDA 1G3QA 1IB6A 2I2WA 2BKUA 3FSGD 3KQYA 3GUUA 4A0SA 2WYUA 4EPTA 1D4AA 3K8ZA 2GK3A 4Y8VA 1XTIA 1WOYA 1YASA 2OYRA 4FYMA 1YCGA 3LKBA 4DSUA 1EX6A 4OY3A 3W2IA 2RBEA 4F4DA 3E6AA 3DQZA 4HX9A 4UOEA 4NNOA 2VCHA 3KSUA 5KKNB 4YFVA 3LWDA 1OI4A 2AYXA 3NHUA 1DWOA 4FD3A 3P20A 2Y93A 2XTAA 4FZJA 1VE3A 4EQ6B 1E0JA 4Y2GA 4ZYYA 4ZTZB 2VP6A 2YX1A 1OIXA 1RWKA 1MOZA 3DW1X 4RGVA 5LKAA 1KS9A 5J4VA 4FWBA 1HFJA 4J2TA 1GUDA 4Q6WA 1FPQA 3HR8A 4CT5A 3I9KA 2E4UA 1PW7A 3L40A 4EPXA 4DKJA 4ZZ0A 2Q41A 4HN9A 1XRMA 2OXCA 2IPNA 1TI7A 2B25A 4FFSA 4WGGA 5FBWB 3T3PB 4CKCB 2O6HA 4EW2A 1I5EA 2WIFA 1E98A 1OBHA 3JPYA 1B14A 2CZQA 1Z33A 4CMCA 2VG8A 2OZEA 1Y7IA 2HQOA 3D1VA 5JISA 2CUZA 2QUZA 2VHUA 2YW9A 3AETB 3BF7A 5EJGA 4BV2A 2UXBB 1RPNA 3A1CA 1TUBB 4UVGA 1ORRA 1QORA 2F7SA 2J33A 4UBLA 4LF7B 3MCZA 3OE5A 3ZBTA 4GMGA 1KHHA 1AIPA 3FVWA 1M66A 1PK8A 1VPLA 4NV1A 3GPDG 5JYBA 2IKSA 2CL0X 4DBVO 4MWGA 5JQGA 5EEHA 1OFGA 4JIGA 2PMWB 3D1JA 3LUCA 5HDQA 4ND3A 4QXAA 3EWNA 1DPGA 3HO6A 3OTHA 2AN3A 4WZAE 3H6KA 1UBKS 4BAGA 4QGSA 1JFRA 4QU5A 1CV2A 1U2SA 1U3DA 1XCPA 4KOEC 4B44A 1NJ5A 3GH3A 4GWKA 3PTAA 4LWZA 3NHYA 3LTNC 4IMPA 1MV8A 3PK0A 4JEUA 2HF8A 4PSUA 2EOAA 4X54A 4BJ3A 5HHTA 3ROEA 1NA5A 1RFLA 2Q50A 2YMQA 1DELA 1BXKA 3AB8A 2XQIA 3DMYA 3QVLA 4N39A 2AZXA 2ZJAA 3MTEA 1XRSB 1IM2A 4JITA 4TZKA 3L79A 4JA2A 4MQUA 5EY5B 3RYTC 3DPIA 4JLKA 4Q24A 2NM0A 5C7LO 3UWOA 3UC5A 3V4SA 4NE9A 2JJ2A 4DLRA 1RHQA 4OIFA 1SA0B 3RWMB 4RMGA 4EG1A 1A8QA 1SHZA 5ALDA 5KIAA 3PWZA 2LXNA 3E53A 4CBVA 1R1DA 5C7YA 4NCAA 3OJLA 3G6WA 4H6XA 1T3SA 3HWSA 2NVOA 1GUYA 1W49A 3AY7A 4LOHA 3LPNA 4MUAA 4ZHQF 4UJ5A 5H80A 1IHYA 2X9LA 1SAYA 4PPFA 5CLQA 5KJEA 4C4ZA 2AA3A 5CFRA 3L1VA 4O63O 2H7VA 5IKEA 2I34A 3P9QA 1SC1A 5MDHA 4GFDA 3E4CA 2H51A 2J09A 3N2GB 3OE1A 5AVSA 4IZOA 1KJIA 3SZ3A 1W0JD 3F8SA 3W3AH 4IX9A 5DASA 4S0XA 5EUCA 1X13A 1P80A 3PNKA 3RSOA 3EQ7A 3MSXA 4I1RA 5GV8A 1U81A 2ZR8A 3GYBA 3IVCA 4QHTA 3UHPA 3I39X 5AUPB 4MRVA 2DQYA 5JCOC 1Y8RB 2ZRBA 1HTWA 4UKDA 3BCHA 1CUBA 3WSVA 1NLFA 4HCJA 4HEA6 3GZ4A 1RWOA 4YHBA 4DMMA 2NYUA 5JXIA 3EVNA 1ZLXA 1GA1A 4RX1A 4ZT5A 1BCRB 4YR9A 1KMHB 2WNIA 4MXDA 1BZYA 1VPTA 1HMYA 2GSDA 1NQ5A 2EEPA 2QNRA 5FTJA 2VQSA 4J3NA 1M75A 1JHAA 3GRZA 4P3NA 5LZ2A 1AOXA 4RYLA 2V7PA 1DTWB 4LFAB 5BOVA 2GXQA 1R0YA 3ONWA 4BB9A 3H5OA 4Y30A 2WAYA 1YHNA 2IPAB 2JEZA 3T5CA 2OXFA 2QB5A 2YY7A 4MV5A 4TYQA 5FR2A 2F3QA 3TUJC 3U3RA 4HZIA 2H2HA 4YMVA 3QKIA 4FU0A 2CFSA 2CD9A 4PX3A 2AXPA 2Y0EA 4YIHA 2DAPA 4K9RA 4M1TA 1T0JB 5EP2A 5IH3A 3RUDA 3G6KA 4O6VA 1A77A 1OW3B 3VHRA 3IEXA 3IHLA 2O0JA 2YWXA 4FVTA 3ENKA 3T99A 3IT0A 3WA7A 1X0XA 4W9MC 1SUPA 4I6EA 2M32A 3GGSA 4ZP1A 1TKRA 4O2BB 3GWZA 4RACA 5C7OO 1MTZA 3JATB 1SN7A 5GM2A 2IF2A 5SYMA 1YI8A 2LV8A 2ZT6A 3BIWA 3ECSA 3OIFA 3QOWA 4KIWA 2EWMA 1VYTA 3L3BA 4K9KA 3AUTA 4V0KA 4IIDA 4RJIA 3TTXA 3L46A 1V4VA 2G9RA 4CIYA 1RLUA 3NEPX 3RS8A 4GX2A 2VPQA 7REQB 2ZE7A 3KPYA 4MYCA 4O4HF 4PZZA 5H16A 2GUWA 5JSFA 3KFVA 4QT4A 4Q7JB 5A0FA 2C96A 4JJAA 2RONA 5JNTA 3U6KA 2GOYA 3ZD6A 3DBRB 3O8NA 3THXA 4C7KA 3KTAB 3QLVC 4RLFA 5FXMA 3MJVA 3PIDA 5CB4F 2YWJA 3ZHSA 4DLKA 1RBZA 1W36D 5HRAA 2VPZA 4XYGA 2I7DA 5IYZF 4MGKR 3RUHA 1U4OA 4Q05A 2YNMC 3N8DA 4RE6A 4KXYA 1TQ6A 3D6HA 1JQBA 1TEVA 1ZSYA 4TT3D 2D1SA 5CB8A 4QXQA 3RIEA 1QJCA 2CLKB 1B76A 4PZ0A 2LCQA 1PUIA 3UMGA 4JVSB 3FUXA 1D0VA 1T5LA 2B8JA 2FP4B 3K9WA 3TLGA 5BSEA 1D07A 2O2HA 5EJEA 3DLAA 5AYVA 3RSCA 3O8QA 2EVWX 3KUKA 2QRMA 3QVKA 1P2TA 3RU3A 4D4HA 2X5NA 1XTTA 4LJ8A 2NQTA 5CGQB 3A1DA 1Y81A 3BGOS 4OMUA 2PKRA 1NR5A 2H1VA 2ZYTX 2JGJA 1E2KA 3B6JA 2BFFA 1DC5A 2QD1A 3CY6A 5LB2A 5CXUA 1ZI6A 3MD9A 4EARA 1YBAA 2BGUA 3OPVA 1L8LA 3A6KA 4MPTA 2DPYA 1I4LD 5BYJA 3VKHA 3F78A 3CLUD 4JEMA 1XAIA 4DW8A 1DU4A 3T4UA 2F4VB 1UQTA 1H1LB 2I1QA 4WAUA 4EG8A 4UTPA 1JXMA 1MP0A 3PC8A 1LI7A 1P1RA 2C7QA 3FZGA 4N41A 3GT0A 2W43A 1QIDA 2XLBA 3O2SB 3PFBA 3JQFA 4IMRA 4LDZA 1IBRA 3Q3CA 1ONNA 3TFQA 5MHTA 2HGZA 3RRJA 1Q0PA 4HYTA 4BKMA 1KNXA 1NASA 1WP4A 1MXFA 1SK9A 1TA9A 3AY0A 3H75A 4XIGS 3WWEA 4E12A 5F35A 3PHIA 2JFGA 2YH2A 4JJGA 5I8WA 1FDOA 2YINC 4P2GA 1W25A 4BPBA 4Y6PA 4HNUA 3DF7A 1NXOA 5JY6A 1V1MB 3BG5A 3MW8A 2JK0A 2RHJA 3ZWXA 2WBLC 1ZESA 4D3YA 1AV6A 3OMLA 1BC5A 4WERA 3UAYA 3DWGA 3O03A 1FDIA 2HRBA 2OHVA 3OG9A 2UYQA 5ADHA 3T3OA 4HB0A 4G1BA 1QVAA 4OG2A 4LWQA 4URVR 3N8IA 1TCBA 2O9JA 1OV6A 1DIBA 1PR6A 1RRMA 4MEJA 4OB8A 5BN4A 1YDEA 4OM7A 5ITZB 2PSDA 5H8WA 5JI3E 2OFWA 5CFZA 3ZWOA 1U2QA 2JAOA 4B3DA 3W6PA 3ZWYA 4C2AA 1G55A 1HOTA 2XRMA 4TVBA 3RV3A 2BEWB 3HUUA 5AKGA 1QNLA 2CL7X 2CVQA 4LDJA 3R23A 2ZQYA 4LFCB 3TZLA 1G8JA 4WDRA 5JR3A 3NNDA 5FLEX 1JLLA 3THWB 4B3MB 4CEHB 1FZQA 2B4KA 3BBLA 3KVOA 4Y98A 4UXHA 4H7FA 3USES 1XTJA 2V7WA 1IHPA 3GIWA 5EMJA 5HK8A 2R6AA 3R5JA 2O5EA 2UV8A 2BFCA 2JA1A 4IO1A 3BWBA 2VPTA 4L15A 4HDNA 1WRBA 1SCAA 2EFGA 1X8KA 3GFTA 1WSDA 1K92A 5FJJA 4HH1A 4HAIA 1EUZA 4JUBA 3MRSA 5DDIP 2VYVD 3G2IA 4ID3A 1L7NA 4BFTA 4OSOA 4A0HA 3LPAA 3RWOA 2H8KA 2XRFA 3HGQA 2DUNA 5TT1A 1N2XA 1NUPA 1QOPB 3I58A 3JRWA 3EBPA 4MV0A 2WF8A 5FA5A 5GIOE 5D51S 2B98A 3IIKA 4XOIA 821PA 1X9IA 1O4WA 3UH1A 5E6RB 1PG5A 3OECA 3NHPA 3LCCA 5KWJA 1XNQB 3EVTA 4EW1A 4EQZA 4DR2B 1WUTA 3UOGA 2GBPA 4R7GA 4BO9A 2NYVA 1SOAA 5H81A 1W2GA 3RJ9A 1WCYA 1TZCA 3KAPA 3GFBA 2OD9A 4HFNA 4YQZA 5BN5B 2A5YB 2OOKA 4ZOQI 1YS7A 5AM3A 4LQDA 3H9UA 3JD0A 2A0XA 2G83A 4BFZA 4MTLA 1MT0A 4Q3AA 5T67A 1JBEA 1ZR4A 4G5XA 4DLXA 3W8DA 3MTJA 3VSEA 4E03A 4YIKA 4YLYA 3JQAD 1T6ZA 1PN3A 4MULA 3F6YA 3JQEA 1BYIA 1R0ZA 1TU3A 2GCEA 4X41A 1MQ9A 1VJGA 1LK7A 3PFNA 3K1AA 4ZOAA 1KO5A 5IASA 3STUA 2IH4A 1KMHA 1K97A 1G4AE 4GSLA 3C7KA 2HRZA 4ZWNA 3TLAA 3UB4A 5KEIA 2VQ3A 3LT5A 4ZYWA 1H8ED 1TGYA 1EUDA 4EO7A 3TRDA 2VK2A 2WINI 2WHQA 3X44A 5IT9A 4BO8A 3COSA 3G5LA 2BONA 1KR5A 4Z9FA 3H5TA 3B12A 4X1YA 5CIQA 4L5BA 2B1GA 3WIEA 3PJGA 1RYDA 1C9JA 3ZDAA 5I7VA 2EF1A 1PU2A 3F3SA 1DRVA 1ORVA 2B5OA 2ZSAA 1IOZA 1W88A 3DBIA 3PD1A 4M37A 3SQDA 2PSEA 4CV3A 1J2RA 1AQLA 3H2JA 1WCIB 1RM5A 5GONF 2IUFA 1EWVA 3V4FA 4EG6A 4I5EA 1ENZA 4QYMA 1FVOA 3PC7A 1XI2A 5LZ4A 2GETA 4BFSA 2FZVA 3BMOB 1Z5WA 1LC0A 3EG5A 4Y0VA 4UE3S 5EA2A 4LGCA 3R7DA 4GOOD 1XXHE 3EXEA 2BSAA 4DCTA 1QRTA 4KPEC 4LG1A 5CDTA 4WOBA 1YRWA 421PA 5EE3A 3I04A 2ZUWA 1LLUA 4NBTA 4U2DA 1FTQA 1ADBA 1OYWA 1WNFA 5TY0A 3JZMA 4AW9A 3KYDB 1XD2A 1UAAA 4TLCA 1Y7HA 4J91A 4L9RA 3RVPA 4BMCA 4J03A 1YK1A 2XNDA 3IRVA 4DWJA 3OEWA 1AS0A 3FROA 1NZDA 1QO7A 5C3MA 5EZYA 3RS4A 3GFGA 3TTTA 3TD6A 1UXHA 1C3JA 3ED5A 3OKCA 4KHZA 3ZV5A 2REXB 4RJKA 1M2EA 5LZ8A 3O0TA 3SXJA 3KKKA 1KVQA 1PZFA 1E7RA 5ALGA 4P98A 4QGHA 2E4AA 1OXUA 1JQEA 1E92A 5HJ2A 3GLKA 5LLDA 2WV9A 4LJ6A 1D2MA 3KYJB 3PHHA 2H85A 4U0KA 1HDRA 1XLTA 3TZEA 2NVBA 3S0JA 1S7GA 1UT5A 1M2OB 3KXLA 4R9VA 5D6NA 2XBMA 1F0YA 1P74A 4W99A 3T3DA 5DN9A 4L50A 3GFQA 2JCSA 2PX0A 3NBYC 1Z6YA 3PT5A 4EJMA 3B9BA 3NHLA 2D3TA 1CLUA 1KE1A 3UQYS 2W6NA 1E2UA 3D7MA 5HYVA 1B74A 1A2BA 1DAMA 4LF4B 1F4LA 1ESZA 4AMGA 1QHFA 2WOOA 5TLSA 3A6PC 1XZ8A 2QP4A 4FLMA 1N9GA 3MS4A 2XYVA 4BVFA 2PMCA 1ADJA 2ORIA 2Q3LA 4I9UA 5CVCA 4DE5A 3MUOA 4WRRA 4CWAA 3L8HA 4PG4A 3RSSA 4D80A 4DM4A 4OHRA 3P2OA 1WKCA 3LT2A 4Q3KA 2VTKA 4XVQA 1G5HA 3IBGA 1KHTA 4XDGA 3D0KA 3B1WA 2B3DA 2QN2A 3DMFA 2VUHB 3HPRA 3OJOA 4ZZIA 3AUSA 1SHJA 3N2NA 5TMBA 1ZJ4A 2O3QA 1U2TA 3EA5A 5JCZA 4TGLA 5I51A 5K3FA 1Y8QB 2ZI4A 1KQOA 3NAQA 3SBXA 5ICGA 4YQFA 1MLDA 2LW7A 3KFXA 4ID9A 5EXDA 1GQQA 1NRIA 1L7EA 4LOAA 4F1JA 1YDFA 4IXWA 8ATCA 3R3JA 1K68A 3HDHA 1CS4C 4BBPA 1PV4A 1E2IA 3ZU2A 2PGXA 4BJ5A 3ID6C 2C83A 4J9VA 5GQSA 3MPOA 2RKBA 3ZDXB 4F96A 1F51E 2HTEA 3ZK8A 4M0UA 1JFVA 1M5RA 5H3HA 2IEBA 1QLHA 2HBYA 2HA6A 1PNRA 3CG4A 1AZLA 1TZKA 1NXXA 3FI0A 3GRFA 3HFRA 4LYAA 5CHYA 2O59A 2ZUDA 1UOOA 1J24A 4DLWA 5CA1B 5LZ5A 2J6IA 1DBIA 1FA9A 1GVHA 3GT4A 4X63A 5I7OA 1GCIA 3PXCX 5K6AA 4RKRA 1N8KA 1CQJA 3ZS9A 3RT7A 1YZLA 4JLPA 2DPLA 2VJKA 4X3PA 4KWTA 3WGYA 1WUHS 2H9YA 3AF2A 4X65B 4YRJA 1YMQA 2DHDA 3HBNA 4H60A 1EAYA 1UAGA 4HAWA 3HB0A 1VTKA 4B85A 4OHYA 4G97A 2GJ8A 4Q01A 4P35A 2HRDA 1ESCA 3KKPA 1JALA 3TI9A 3W5JA 4CTOA 1DXOA 2C7OA 2VDPB 5CT4A 3AQ4A 4TKLA 5ALWA 4EFLA 1DJPA 1JHQA 1GPLA 1P0PA 4QC2A 1NLUA 5IAAA 2XNCA 3RRZA 2O4CA 3PCXA 4LCBA 1M1YE 1ZUHA 3B3JA 3G9UA 1RNLA 2ZIWB 5KBYA 3J7AC 1UBLS 2BJHA 2VUSA 3GU3A 4WY5A 1K6IA 3DE4X 1M6YA 4GXQA 1CB7A 2OHXA 2H0QA 1NJGA 2A9JA 2GZDA 2ZU0C 4FGZA 4N3CA 4OP1A 2ZJBA 3BCUA 4PONA 4QSHA 4Y2JA 4YP5A 4YRCA 1WD7A 5E6SB 4BTVA 4UVHA 3U62A 4EHNA 4GPBA 4MR9A 1G5TA 3PV0A 3JYLA 5HMMA 2D54A 2Q6VA 2NZXA 4IOLA 3RREA 4ZV7A 1T6XA 1MX9A 1M1NB 3PFCA 3WLJA 4QHYA 2TSYB 3G85A 5LNK6 4OXXA 2Q3BA 1K0FA 4BEWA 4ERXA 5E38A 3DXYA 4G0ZA 4BWVA 5HCUA 2RD2A 1M0EA 4UUOA 3QLEA 4GRIA 1I4TD 3HB5X 4CFZA 1S4MA 2VDKB 3TSYA 3JYHA 1QOZA 1VJRA 3FHJA 4JHXA 1Z08A 4K03A 3GVCA 3TE6A 2I1VB 4RIFA 5AUQA 2FFQA 3U44B 2RH8A 3K0KA 1IE3A 4BXOB 4L5CA 4C6TA 2X3UA 3LOQA 4BNMA 2QLMA 3KQTA 1UKVY 4DR5B 1PS0A 2GM4A 4D2IA 3EGDB 5JALA 4B4VA 1Y7TA 5CBKA 3DZKA 5LA6A 4B3SB 4LSZA 2WYOA 2POQX 3GGGA 3RH0A 3IBCA 2C5AA 4D6YA 2H1SA 3TSWA 3A6FA 1JDPA 1XQWA 4HWOA 2F43A 4E5UA 1GPBA 3W5DA 1DI0A 2CVFA 2OORA 2JVJA 2Z08A 4J4BA 4MAMA 3HVIA 4AROA 4CCYA 1DEHA 4NEGA 1NHWA 5DFAA 3O73A 3CHYA 4DIFA 4JR2A 1TW2A 1JB1A 2I0FA 2I54A 1E94E 4PLFA 3A3OA 3D8UA 1O6BA 5K09A 2H0RA 4D44A 3IBTA 3V7UA 1N2CA 3TQTA 3HY6A 3K32A 4ALKA 1GOTA 1LBEA 1BGVA 3FETA 5FFMA 1G20E 4FDTA 2ZOSA 5C35A 3KEFA 1ZL2A 1GGNA 4IY1A 4YJDA 1M2NA 2OE2A 2VHYA 1QS0A 4WQMA 3MYYA 2IYYA 2BD0A 2WD8A 3SHOA 2HWKA 3G8BA 1QWOA 1GZ3A 3P26A 5HG0A 1IMOA 2JFYA 3AR7A 4PU0A 1V6SA 3TIIA 2WZBA 1MKYA 2JHFA 5JROA 1Z7BA 4F46A 1Z39A 4G84A 2HV8A 4FNAA 5F1PA 3ROPA 2CJWA 2YNMA 1V7ZA 1SELA 3K0AA 2H63A 3CX8A 4R4JA 1A9XB 1L8QA 2D5AA 2DHRA 4JQZA 2GR9A 1KQPA 1WXEA 4PLYA 3DEHA 2GZAA 4WBXC 3R5FA 3SHTA 4S1OA 3P9SA 3R4VA 4MV6A 5IDXA 5J23A 4HYEA 6NULA 3CNQS 1Y9JA 4RHCA 4CT0A 4PS0A 3OICA 4R8LA 4M46A 4L0DA 1LEHA 3UKOA 1T0BA 1T5DX 1YBVA 4LQ4A 3K7EA 4LRUA 1TIKA 5F64A 3NQ41 1O94C 4KQJA 5JMWA 4LI3X 1WUIS 3EGEA 5LU9A 3AOGA 1H8HA 4MQ4A 2H5JA 1CHDA 5LP6C 3IVMA 4LWOA 3B6KA 1XR3A 1EFVB 5DX0A 4PGAA 4CKEA 1NFQA 2YUIA 4AC9A 4B3GA 1QYXA 4I6JA 3OH8A 5IXSA 5T7BA 2PKEA 2PRZA 2QUKA 1RVV1 2AK3A 3GZNB 2NIPA 4U0JA 4CYMA 3CIFA 1MVLA 2ID9A 2R44A 4NZZA 5LYJA 2Q07A 3JQFC 1DWPA 3PX7A 2M9MA 4GD3Q 4RHYA 5CDGA 1PJLA 2W6QA 1W5AA 1DO2A 1XWWA 1ZD1A 4R3WA 1N0WA 2AWNA 4WZBA 5C8ZA 3FDZA 1YBFA 3D3WB 3A9TA 2ENUA 1YFLA 3LFHA 5CLFA 1WB4A 3BDIA 2H3HA 3VMFA 4LZOA 3MD0A 5LP1A 4X8LA 1NJ1A 2QTRA 3Q0IA 3I2KA 3TOCA 4DIEA 2FN4A 3V1MA 4E6PA 4W4TA 2XKKA 1M8FA 3K9BA 4DC0A 3TN7A 4C4SA 4F38A 2HSWA 4MRSA 1ZAYA 4QXMA 2C0PA 2ZPTX 1WTCA 4Z4QA 1EK1A 2OAGA 4RXTA 5AQEA 4HV4A 4C22A 2IJGX 1ZCAA 3WA6A 2EIXA 3U3ZA 4JJ7A 3AZQA 1PV2A 1FFHA 2IYEA 1F2TB 5KC8A 5FA6A 5KNDD 2XMBA 1XTUA 1MO4A 1U0RA 2IPXA 3H99A 1NWHA 2GTHA 3T9DA 1H2XA 4DSZA 2O8CB 3PNVA 1RYBA 3WMWA 5I7UA 1FFDA 2IHBA 3AEUB 5C1BA 2C07A 2F43B 2ZB8A 3GRAA 5HS4A 4TXMA 4J0FA 4CTMA 4QQKA 1FW6A 3B7GA 1XD9A 3EXHA 4MMXB 4AJEA 1SURA 4D9NA 3L1UA 3AKCA 3OWOA 3DULA 2ZR7A 4OQPA 3FHOA 3OI7A 4TUYB 3P0EA 4ROTA 2GUGA 1ISPA 2RKOA 4L4ZA 1OF1A 3GJ6A 3PZBA 3IHKA 4NOJA 1Y8QA 4QOEA 3ZIAA 1AKTA 3IUYA 4YCNA 3QFRA 5F2NA 4O4LF 3L92A 1Z5VA 1JIVA 2BH9A 2VP5A 5FCDA 4YXWA 1UANA 5AOVA 1WABA 3T3EA 3AERA 4G5QA 1TK3A 2WJ4A 4EDFA 3U5ZB 1CRWG 5ARCA 2BUAA 3AHDA 4D46A 4OJMX 5CAEA 1P0IA 1I10A 2E3JA 1QHHB 1K4KA 2RBGA 3HMKA 5CVUA 1CQIB 1AHNA 5MN5A 4TS9A 3LOUA 4FSDA 2VS1A 4ETIA 3R7WA 2PUVA 3MQFA 1U0JA 1ZDMA 2FR1A 1H2AS 1SY7A 2Q8QA 1QDLB 3DDZX 2ZYGA 3BXPA 4LX0A 1NT2A 4LY3A 4MP3A 1J5XA 4WV3A 5EWLB 1KI3A 5LZ9A 1YBMA 3USCS 4YT2A 1PT8A 3N2YA 4OU5A 3VOTA 3MLEA 2O07A 5EINA 2JLSA 4TYWA 1E1MA 5AM2A 4XM2A 2NAFA 3TPCA 2C58A 3E15A 4GPTA 2BZ1A 3V8NA 4Z7QB 1BXZA 2HIGA 4MH0R 3DO8A 1THTA 1O97D 3T3MB 5K20A 1F38A 1EFLA 3D6UA 4QODA 5TPWB 3THOA 4UOQA 4AJOA 5MF6A 4O08A 4HUQB 4QBKA 3Q9NA 3OJXA 4PR3A 4EPVA 4HQKA 2ZT5A 4RVNA 1WL8A 4JK3A 4PGMA 3PLAE 1FLNA 5C80A 2QF7A 1XVAA 3F4BA 3L7NA 4OXNA 4Q1AA 5DV9A 2GD6A 3GPBA 5NULA 2NADA 1Q1GA 1U1EA 2X76A 2G5PA 5FL7A 4DRZA 4F9TA 3I32A 2FLVA 3KJQA 2QD4A 5FKJA 2OCLA 3G2NA 1EQAA 1N6KA 1YAHA 1Y1RA 4WCVA 4X20B 4KIGA 5HKKD 5E4JA 1JZTA 3TLKA 4QPPA 4AG5A 2WKSA 1Q1EA 1RAFA 3RPEA 4AO8A 1Q0ZA 3R41A 5DGCA 5AXAA 3X2SA 4AMBA 5AD1A 5CA1A 2R8OA 3EN0A 4LNAA 3DLCA 3QVGA 3PIRA 3KOOA 2Q1XA 4QUAA 3IBFA 4Y7DA 4C0BA 2IXGA 1G0NA 3IKTA 4KSCA 1D5CA 4RSMA 1OSNA 2ZM5A 5TNXA 2PMFA 1W34A 4YAEA 3OUZA 4BGDA 4DAOA 2ZS7A 3LDFA 4XCVA 3RYHA 4Q9NA 1PJTA 3BJRA 5IS2A 4E31A 1MUUA 4OL9A 3WLNA 2G40A 1X7ZB 5HF6A 5IYZB 1PYDA 1ZFNA 1CVIA 1JSCA 4M8NE 5AKZA 4WBNA 2AVNA 3UGQA 1KKUA 1TJNA 5CFLA 3HP1A 2AOTA 2QTGA 3SKVA 1FX1A 1IG3A 2FX5A 3JQQA 4HLUC 1Y3HA 4PO8A 5CFMA 3E9NA 4X1YB 4M86A 1UZAA 2OGSA 4OLAA 2X8JB 4MYDA 3PRHA 4C2BA 4GDMA 1F4PA 1SKYB 4TSFA 2GWRA 5AI8A 4DUZB 3MG9A 4M89A 4MPRA 4MSUA 4Y1GA 3RHFA 5G40A 3VR3D 1TTHA 5A4FS 1RWXA 3EXAA 3AXSA 3QGMA 4QFCA 3E5HA 1U7UA 1AGNA 1WVMA 1N7JA 1XHLA 3JD3A 3D3KA 4JVNA 3JYQA 4RSRA 5CK4A 1O4VA 1YAJA 2GRJA 5ES4B 1W2WB 2ZBRA 2QQGA 3RIMA 4GL4A 1RFGE 1Y3CE 1LV8A 1ZCJA 4B75A 3LA8A 1G5FA 1EXDA 1X1RA 2YWCA 4GI7A 5FFFA 1EFHA 2OZKA 2GFHA 2NXJA 4LJSA 4XIJA 2Y1EA 2NV2B 3FYSA 4KFTA 4AX8A 2PLWA 5EKUA 1FRZA 4AUKA 3DKIA 3VA7A 2J0QA 2FGJA 4PSAA 5EZ6B 1QYVA 3WOVA 4I2VA 2PL1A 4PZAA 1Y9DA 3A4TA 3G1TA 2AN1A 3K9LA 3HUEA 5EVCA 4AZ3B 3WTCA 3KWFA 1TM1E 5EIFA 4YRRA 4C0KA 1ISRA 3L7OA 5EE9A 3W2FA 2OSBA 1DB3A 4CDMA 1KY5A 1GV1A 3CLRC 4J1TC 1FW8A 1PWXA 2UZ1A 3DFMA 4MWCA 4TZTA 3S1SA 2V8BA 3ZXIA 4AXBA 1SULA 2WJPA 3PBKA 2ZI9A 1KDPA 1P5JA 1NVMB 1UDWA 1H6BA 3UA3A 3DAFA 4EX7A 2PGDA 4RF4A 4RD2A 5KVVA 4K88A 4CM9A 4J9UE 1U2DA 1VSQA 3GEBA 3KLMX 5EG5A 1Q6ZA 3L8ZA 3KYDA 1GU0A 2HJWA 2PRSA 3VPBA 1Q50A 1QM5A 3ZWMA 1AKRA 2PWPA 3D2LA 3DE3X 3FUWA 1JU3A 2F62A 3RE1A 4DDVA 4B34A 4NXMB 1EI9A 1MAVA 4IQ8A 1TRKA 5AW1A 2GHTA 1DEKA 4HN2A 5CXSA 5HSGA 1PFVA 2R4QA 4RY9A 1DIGA 1Z2EA 1O95C 5KYXA 2GHRA 1QYDA 1KIFA 5JDCA 3DEAA 3AHGA 1Q0TA 3WGZA 1C2YA 1JIQA 3JD1A 3MWYW 3V34A 2R96A 3U17A 4TTQA 2HMYB 1A8HA 1JEDA 2FU5C 3ILHA 5F52A 2QY6A 4FWTA 3OJFA 4BQPA 1ADGA 3W2TA 2ZI5A 5AM0A 4GOJA 1EVJA 4KXNA 3PF8A 3RLFA 2COKA 1LLDA 3KRTA 4TWAA 6REQB 2C9DA 1JKMA 4FD2A 2IDKA 5IKMA 5EIXA 3L0DA 1G8GA 4IHKA 3F74A 1L4LA 1C7FA 1F2UA 3HBAA 2W58A 2YOFA 5DKFA 3T61A 1PL8A 4C05A 4QTXA 1HK7A 1GA4A 2WJ3A 1WR8A 1Q0RA 2BEUB 4RWZA 4FGJA 2X0FA 3W6UA 4AF7A 1PR5A 1S2GA 3PS9A 4ZHQB 1YL6A 3EOAI 1J33A 1WULS 2XX3A 2QD5A 1P9WA 1T9GR 5EIBD 2Q6IA 1UBOS 2OGUA 4MYRA 5BWOA 3RSFA 1Z2PX 5LD2B 4O1IA 4NCKA 3GGCA 3DNMA 1PF7E 3L4SO 3COJA 1VBKA 1D2CA 1O0SA 3GGPA 3EIHA 3ENQA 1M8GA 3DZBA 3K30A 3QRWA 4GXNA 5D6OA 1IJFA 3T9EA 1RWWA 3WRYA 5LMZA 3IR6A 1JXQA 4HFMA 5HX7A 4DLAA 2C3YA 2ZYAA 1RAHA 2M1XA 3CEAA 2IZ5A 5EIAA 4AZSA 2L18A 2Y1XA 3MYRA 5CUQA 2G1UA 3E03A 3GRYA 1AKMA 3JQ9C 4FGUA 4M1MA 2JGLA 1TLTA 1H1LA 3DM9B 1DX6A 3DTVD 3R74A 4X97A 2PQ6A 4RABA 1EYZA 1MT3A 2KE5A 1COZA 1ORWA 1Z88A 4B6QA 3M9WA 4JLSA 3FFXA 1J8MF 3DUFB 5FWDA 4D4JA 1O87A 1U31A 1WZEA 3G8YA 1AS2A 2JI9A 3R6LA 3CLSD 4YRAA 1WWKA 4RPCA 2RIPA