2UVDA

The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a 3-Oxoacyl-(Acylcarrier Protein) Reductase (Ba3989) from Bacillus Anthracis at 2.4-A Resolution.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
total genus 90
structure length 246
sequence length 246
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2uvdA00
4NR0A 3GAZA 3RC7A 3FF4A 1CYDA 4AJ2A 1BVRA 3ZH2A 1VI2A 1E3SA 1U2DA 1XELA 3OJOA 4NJMA 5DOZA 2VTDA 3ZW9A 4NMHA 3QP9A 1KYQA 3PQFA 1L7DA 1UXGA 1OC4A 4HY3A 5ER9A 1YJQA 1NHWA 2IYOA 5DNAA 2VUTA 4E5KA 5DT9A 2NTVA 4Q3BA 3PVZA 1XIVA 4ONEA 2DKNA 4DQVA 1GZ4A 4YJFB 3GHHA 4FGSA 1H94A 2UYYA 3S1LA 5ES3A 3HHPA 2BMAA 2FR0A 2UVDA 1CERA 1I2CA 3K2EA 5ADHA 4ALNA 4ZU3A 1PGQA 3JQ8B 3BMQB 4ZRMA 3LU1A 3M1LA 5CG1A 1GU7A 1G0OA 4UVIA 1HWYA 1KY5A 4FPXA 3K8ZA 2BGLA 1P1RA 4W6ZA 2X0JA 4BNVA 2D59A 2IZZA 4GBJA 1SPXA 4KDEA 1E6WA 1C1XA 3KSDO 3KVOA 3WMXA 5KVQA 1A7KA 1B0AA 5A9RA 2Y1CA 3DBVO 3GZNA 4LK3A 2WJPA 4OXYA 2TMGA 4WOJA 4AG3A 4MVJM 4KWHA 4MVJE 2WD7B 4FCCA 3HFGA 4MJLA 3TF5A 2JFGA 3VH3A 2Y1EA 3NEPX 3GGOA 3NTRA 3O8QB 4NHEA 5FYDA 5JAQA 3VH1A 1RM3A 4DIFA 4JROA 4WLOA 4OH1A 2X9GA 4A7PA 3K30A 5F1KA 4YJFA 1UDAA 4YAIA 4BQPA 3ORFA 5A05A 2D5AA 2IRWA 3JSAA 4LSWA 3OF2A 1I3KA 2X9VA 1YL5A 5ITVA 4P4NA 4JJGA 4D7AA 2PTGA 1LQUA 4CJXA 2EW2A 3Q1LA 4J1QA 4RQTA 1N9GB 4A27A 1H9AA 2CVOA 2X0RA 3G79A 3I6IA 2VCYA 1HL3A 3ZN2A 1O5IA 4R5HA 3L07A 3DTTA 3GNQA 1NTOA 3H5NA 2AE2A 2B36A 1MV8A 2FRDA 5TNXA 2FPPA 3PWZA 1IZ0A 1F0YA 4BHTA 4DPMA 3V8BA 2V6MA 1N2SA 5F5NA 1MFZA 1SB8A 3KSZO 2PGDA 3H5AA 1Z7EA 2IXBA 3GN2A 4BMNA 2NQTA 4MPDA 7ADHA 3RUIA 1SC6A 3ZDFA 4CM1A 5IDWA 3KYDA 3PGXA 3I3OA 3DBLA 3R3JA 2OMEA 3OM9A 3A9WA 1LDBA 1EVIA 2F00A 3LF1A 3ZV4A 4HFMA 2EW8A 3DZJA 2B4QA 3AUSA 4E13A 2YDYA 1PTJA 4RVFA 4CMGA 4Z9FA 2O48X 4A73A 1BVUA 4BB5A 4GI2A 1LJ8A 4PFJA 4GQAA 5B4VA 2W2LD 1UAYA 4IS3A 3AFMA 3WYBA 4ND2A 1BXKA 3F1LA 4CUKA 1YJ8A 2Y1OA 3JQFA 2D8AA 1BWSA 3PHLA 1B14A 2BHLA 2PLAA 5BSEA 1PL6A 2AXQA 4MVJI 1VM6A 5CPFA 5T6BA 3MJVA 5IN4A 2G1UA 2HKIA 4INAA 2WM3A 4RF4A 3SJ7A 4BNTA 3TFOA 1PGNA 1N5DA 4CMHA 3H9EO 1S6YA 3PRJA 2R6JA 3UGKA 2DBZA 3W8FA 4KP7A 1UUFA 2EIHA 4BKQA 2HCTA 3L4BA 1PWXA 5FI5A 4HX5A 2O3QA 4HXYA 4CLDA 5L7TA 1Q0HA 3UF0A 4ALLA 1FXSA 3QWFA 2O3JA 4D44A 4BGEA 2GN9A 1VC2A 2Y68A 5T67A 1NNUA 3AY3A 2ZTUA 1ZEMA 4K9DA 4Z0HO 1NHGA 2OORA 4J9VA 1LTHR 4NFYA 1T25A 3WGTA 4J4HA 3D7LA 1EQUA 1T1SA 1YOVB 3ABIA 1OOEA 4CPDA 3KLPX 5DCYA 1HLDA 4XR9A 4YT4A 3L0DA 2HMUA 3F4BA 1J4AA 1P1KA 1Y1PA 1O89A 2PKQO 3ZWXA 4R41A 5KJ6A 1C0IA 3OFSA 3PYMA 4NK5A 4ZQFA 3H65A 4IDGA 4CMEC 3G0OA 1NQAO 4MOWA 4BNJA 2ZTVA 2ZB7A 1I0ZA 1K6IA 3KEQA 3SXPA 5KTKA 3VZRA 3Q9NA 3M2PA 1MXFA 3GZNB 3NDIA 1U3TA 4IDEA 3PFWO 1PS8A 1E3EA 3DTYA 1LC0A 3E9MA 4E0BA 3V1TC 1DC6A 1U5AA 3F6YA 1ADBA 4R9SA 2DC1A 2Q50A 4IJUA 1KEWA 3VHRA 2ZB3A 4CQMA 5CDTA 1NYTA 1FMCA 1E5LA 3GVCA 3L6EA 4L9RA 2VYVD 4JN6B 4NBWA 1GFSA 1P1HA 1T1RA 4DYDA 3I52A 4XRGA 4W7IA 4JJIA 4ZQGA 3DZHA 3GN1A 4CR7A 1Y5MA 3CKYA 2DPHA 2VTEA 1TB4A 2FPIA 4JP2A 3QRWA 3PIIA 1W73A 1AHIA 3GFGA 3DL2A 2NLOA 1W4ZA 3PZBA 3DEYX 3TZCA 1ENOA 3C1TA 4OMUA 4UVGA 1GV0A 3WQQA 3ZU5A 3GF4A 3ONFA 3CPSA 3JD0A 4NBTA 4BO0A 1GL3A 3DZBA 1LI4A 4J90A 2E82A 1QLHA 1P74A 3HB5X 3IMFA 1H6BA 2TMDA 2ZJ0A 5JYEA 3NKLA 4GAEA 4YB8A 1XLTA 2CDAA 4PZCA 3U5TA 3L9XA 3UVEA 1DSSG 4BO2A 1BMDA 1MB4A 4UVEA 1E6EA 4A03A 3ZHYA 1MA0A 4PLWA 2PGLA 3FNGA 3LT4A 4KUGA 3RAJA 1B8VA 3TZQA 5I9LA 3KBOA 4AJLA 2EGHA 4YACA 1DHTA 3AOEA 2HJRA 4WLNA 1ZK3A 4QFDA 1SEPA 5A02A 4LMRA 5CDSA 3ZWNA 1E77A 4FC6A 2ZB4A 4OO3A 3NT2A 3QW2A 1H93A 2DM6A 4DLAA 2OO5A 3RU7A 2J5RA 3PLNA 4BL5A 4CLRB 2VZ9A 4GX1A 1JKFA 2HRZA 2EJVA 4CM7A 3O38A 1NVMB 3ETGA 3OMLA 3Q2KA 1WMBA 1V8BA 4WLVA 5EQDA 2Y0DA 1O0SA 4BMVA 3TOXA 2VOJA 1LDGA 1U1IA 2LDBA 2WD8A 4R68A 1MGOA 2ILTA 2BFPA 4HNHA 2X0NA 1PJLA 4OAQA 2E37A 1V35A 1LRLA 2AEFA 5DBFA 5CDUA 4O6VA 4XR4A 3WQRA 2QX7A 3N58A 3PYLA 3I9OA 4CM4B 5TJ9A 3U4DA 1LLQA 3EY4A 5JMPA 2YW9A 1GQ2A 1R12A 2QW8A 3EZYA 4G2NA 2HK8A 2GN6A 4XYGA 3ZWPA 3IL2A 4G81A 3W8EA 5KKCA 2OGUA 1XYGA 4NFHA 9LDTA 3O4RA 1TT7A 4B79A 4IDBA 3TOZA 2Z5LA 5LDGA 5JDIC 4J7XA 3TZ6A 5I9NA 1CETA 4AJ1A 1ENPA 1K6JA 3AUAA 1EBFA 1F8FA 4L76A 5CG2A 2J3HA 2FPGA 1NAHA 3PP8A 1A9YA 4NNJA 3QVSA 3WG9A 5AXDA 2JFFA 1ZK2A 2VNAA 3CTMA 3KYDB 4I5FA 2UV8A 1LSUA 1ZW1A 4E30A 4P4LA 3EVNA 4PLHA 4XWYA 2RH8A 3H2SA 3IAHA 3JD4A 4R16A 2GERA 3DDNA 2OP0A 3JQCA 3WXBA 5L4SA 2O3SA 1UXKA 1HKUA 5EESA 1ZUD1 3E18A 4W9NC 4YEDA 4EZBA 3GVHA 3M6IA 4OSOA 5KJFA 1CJCA 1BDBA 2PZMA 1V3TA 2Q4EA 3V1YA 3RJ5A 1MXHA 1C14A 2H6EA 1X1EA 4XJSA 3RU9A 2RBEA 2DT5A 1MFPA 1FK8A 3B6ZA 5AQ1A 1EVZA 4LN1A 3FPCA 2JL1A 1Z73A 4CMIA 4FS3A 1EDOA 4XQEA 1YO6A 5THKA 3WFJA 1HEUA 5HWSA 3LLSA 3OBBA 2A9FA 4CQLB 1SZJG 4CM5A 2DBVO 1XEAA 4YPOA 4ROSA 1AXGA 2BKAA 4BNLA 2Z1MA 1W6UA 4L73A 4Y9DA 3K6JA 2VHYA 3EZLA 1GCOA 3C85A 3ZV6A 2ZCUA 4ALMA 2I3GA 4K1LA 2WD7A 3JQGA 3RWBA 4JK3A 3GVPA 1LLCA 1LU9A 4NG5A 5EIOA 5CEFA 1R4MB 1GUYA 1NWHA 3BA1A 3DXFA 1PZHA 2PK3A 3D5QA 2C7GA 1QKIA 4PCVA 3UW3A 4RDIA 1EQ2A 5A5EA 1OFGA 4PLTA 2FP4A 4RQUA 3Q11A 4IIUA 5K9ZA 3PI7A 1KS9A 3WLFA 3ZI0A 4D45A 4E5NA 3L6OO 3R1IA 2Y1FA 3B20A 4CV0A 2HMTA 1J49A 1VRWA 5I7EA 4M54A 4W9NA 4BNIA 5F21A 3N7UA 1WPQA 3D4OA 4D0SA 2Q3EA 1VJTA 5K6AA 3JTMA 3RFVA 5JS6A 1HDYA 1QORA 1S7CA 4MVJF 4XQCA 1XDWA 3INGA 4FW8A 3KM0A 3BMCB 5A4DA 1K5HA 4TZTA 4DUPA 1I5RA 1SAYA 4OL9A 5LCXA 1Z74A 3ONDA 1BDMA 4Y6PA 4CLOB 2W2KB 2CDCA 3UN1A 4CL8A 3S2FA 1GR0A 4Y8VA 1K2WA 1X15A 1FF9A 4BV8A 4F46A 3PHIA 2G76A 4E3ZA 2WEKA 1GYRA 3L6DA 3G1UA 2QQ5A 4MIEA 3O8QA 2AMFA 1JTVA 1SEVA 3QHAA 3WGGA 3F3SA 3UH1A 1MG5A 2B0JA 4XIYA 3WNQA 1BHSA 3SX2A 1LDYA 1MG0A 3OJEA 3HE3A 1B16A 1YWGO 4B4WA 1DEHA 3KO8A 4I5GA 1Y8RB 4GH5A 4DMLA 4YAJA 5A1TA 1ZK1A 2PWZA 2VUSA 2NU9A 3EGOA 4YJGA 4I9HA 3VH2A 1AGNA 1C1DB 3ZWBA 3D3WA 1ZMOA 1B26A 4R1SA 1TT5A 2ZTMA 4HNGA 3B70A 2Y1DA 4D3FA 2C07A 1XA0A 3WBFA 3W6ZA 5ITWA 4YAKA 4S1VA 1HZZA 3HFSA 1K6XA 3HSKA 3I5MA 3X2FA 5T8KC 2IE0A 3WWYA 5IAAA 5A04A 3OECA 1D7OA 3PXXA 4DPLA 2I99A 3ADPA 1ZK4A 5BNIA 5IFLA 1DC4A 2Y0CA 3I1JA 4M8SA 2V7PA 4EI2A 3NAQA 3IJPA 1M2WA 3RUEA 4XRRA 3ANMA 4NBUA 2OBYA 2H9IA 4NQZA 4GLOA 2F1KA 4Q3DA 4CUJA 2PKRA 3K92A 1XHLA 3C3XA 3HWRA 4UEKA 4B3JA 5JC1A 1JN0A 5CAEA 4GL4A 4RF3A 4E2WA 1QRRA 5TT1A 4DPKA 1QMGA 5CDYA 5A03A 1HDZA 1PWZA 3C24A 1BRMA 4EBFA 1UZNA 4DRYA 1IUKA 4LVCA 5L7YA 2I67A 2ZYGA 1YRLA 3GDFA 1SBYA 3VVCA 3BYZA 2J8ZA 4OSPA 3JYQA 3I4FA 4FQ8A 1WVGA 1RJWA 3JQEA 4BS9A 4B4UA 4CL3A 4RCVA 3SBOA 4JIGA 1YQGA 3IJRA 1ZJZA 1DLIA 3E1KA 1IOLA 1YL7A 3CZMA 3MJTA 3WNVA 4N5NA 4YYZA 4OOFA 3NT4A 1M67A 1HT0A 3S2IA 4FOSA 1NR7A 1ZXBA 5FF9A 4E4YA 2PKQP 2YHIA 3D5TA 5JDCA 4GSLA 1QV7A 1HE5A 1C0LA 4XYEA 3EK2A 3TSCA 2AQ8A 3E9QA 4GSKA 3BTSA 1YQXA 2JAPA 2BGMA 2JAHA 1I24A 3AFNA 3UOGA 5GY7A 4AJNA 2QRJA 4TRJA 5JPIA 4EEZA 3QY9A 2QYSA 1WDMA 1DFIA 3VTFA 5JCJD 3FN4A 1KVTA 3I4CA 3PYXA 4J91A 3BAZA 3I9JA 3KOUA 2DQ4A 1VL8A 3BMOB 1M75A 1D4FA 4Z3DA 4AJOA 3VAZA 3ADOA 3M2TA 4BO8A 4FIZA 5DDIP 3ZWAA 3KB6A 1VE9A 2NU7A 3C1AA 1U9JA 3FTPA 4R9RA 3F4LA 2ZB8A 4FOOA 2QHXA 1T24A 1TLTA 1P1JA 2HK9A 4Q3EA 4RPLA 1R66A 4EGFA 4J43A 4CV2A 2YZ7A 1WLYA 4ND4A 2WSBA 5KVVA 1O94A 2SCUA 2Q49A 3GGPA 3I23A 5TGDA 3ONEA 2C54A 2HDHA 3AY7A 3E5MA 2QZZA 3T7CA 3RBXA 3HNPA 2DTEA 4JX8A 5C3MA 1XR3A 4WLUA 1GEGA 2CD9A 4E2XA 1NQ5A 3SLKA 4PRKA 3FSRA 2BELA 1Y81A 1NASA 3RQSA 1YB1A 3PWKA 1FDSA 5G2OA 3H2ZA 1ZK0A 3DR3A 1YDWA 4JGBA 1NR1A 3DBRB 8ADHA 5IXYA 4DQUA 2HJSA 1HLPA 4II2A 2VYVA 4BNFA 3WSVA 2GPTA 4FR5A 4CM8B 1C1DA 2XF8A 4EJ0A 1HDXA 1PJSA 3GRPA 1B8UA 2B4RO 2GGSA 3MCVA 3B1JA 1L1FA 2WMDA 4AL4A 2PZLA 4HWKA 3KTDA 4GMFA 4NPCA 3H9JA 3GQVA 4M49A 1E0DA 3T4EA 2WDZA 1ONOA 2GO1A 2DAPA 4Y98A 4IZIA 2P9CA 4J1TA 4HFJA 1ISJA 1B15A 4HBGA 1LEHA 1WAMA 4D46A 1GQQA 2C0CA 1PGOA 4QT0A 4CMJA 1NWCA 5JNLA 4WECA 5I8ZA 3TJRA 1U8XX 4C7JA 4CV3A 2CNBA 2E4AA 5F5LA 4WCFA 2NVUB 1ONPA 2IZ1A 4YCAA 1UDBA 4UVDA 5JLAA 4AJ4A 2PH5A 4WLEA 3W4IA 2B69A 3OH8A 3COSA 1UP7A 2NACA 3TFQA 2B5VA 2BI8A 4Q3AA 3K96A 4MIYA 1JWBB 1ENYA 2ZKLA 3D3EA 1DFHA 2P9EA 1PJ4A 4RDHA 3DONA 2PY6A 2YYYA 1E1MA 2O23A 2ZQZA 1U4OA 1A71A 1DHRA 4RZIA 2X5JO 3VPSA 1NPDA 2ZQYA 4OXKA 4NDNE 2JCXA 3PDUA 1F12A 3DBLB 2VHVA 2Q46A 1I33A 4MVJD 5TC4A 1DLJA 1J6UA 3LT2A 1HF3A 1KEPA 4JXKA 3OSUA 2X86A 5TT0A 4IIVA 3SEFA 3WJ7A 3WTCA 3S8MA 4K6CA 5I9MA 2YHUA 3PEFA 3QWHA 2VWPA 4H16A 5T8KA 4YT2A 4KOAA 3RUHA 1XQ6A 1U7TA 2JD0A 2VT3A 4KZPA 4LRTB 4ESOA 3OP4A 4IMRA 1YXMA 1KERA 4QEDA 3V5NA 5G4LA 3BTUA 1E1LA 1ZH8A 4O1MA 4B8WA 4YQZA 2B35A 2JFHA 1EMDA 3O03A 5G4KB 4Q3NA 3VH4A 4GKBA 2OHXA 3OHSX 4WEQA 2DFVA 1WDLA 4KDFA 3ZV3A 1N8KA 1IY8A 5H81A 4BB6A 4C7KA 3JQ7B 2C29D 2VHXA 3K5PA 3G17A 4HV4A 3LYLA 4HKTA 1HDOA 4PLGA 5TX7A 5ILOA 3ZWMA 5AXBA 1ULSA 3HDYA 3MOGA 4J1SA 1YGYA 2CF6A 2RH4A 3DHNA 4ZD6A 1A9ZA 2AEJA 2HU2A 4HFNA 5FFFA 4ZQEA 1ORRA 1YDEA 4BNZA 1BXZA 1ZJYA 2X1HA 3LSYA 3S2GA 3S55A 3KETA 4BO7A 2EKQA 5C7IO 2WYVA 3SC6A 4W99A 3STHA 1FDUA 2HK7A 4PG7A 4JCOA 4F3YA 4KMSA 3GGGA 3TZKA 1XU9A 4MVJH 1U28A 1UZMA 4NBVA 4OIMA 4O5OA 3PTZA 1NAIA 1Y8QB 2J3IA 4MVJA 5JW6A 3ZNNA 4IGEA 5EMHA 3GH3A 1YKFA 3IC5A 3VZSA 2ZYDA 1ADGA 4LRSB 4CLXA 1JWAB 3KHUA 3MTGA 4XB1A 4DVJA 1Z45A 2O3RA 3GEGA 3JQBA 3AK4A 3PHHA 2GLXA 2DBRA 1Y5RA 1P3DA 4E2YA 2FR1A 3OEWA 5IZCC 4L74A 5DCWA 4TRRA 4ZN6A 1HE3A 3EUWA 4HFRA 2H5LA 5F1OA 1C3VA 4D41A 2PH3A 2VYND 4EW6A 4YDRA 2Q1WA 4F45A 4IUYA 4O59O 1Y9EA 5FI3A 4CLEA 1EK6A 2FOIA 5B4UA 3NUGA 1ISHA 4QTZA 4CMCA 2X7HA 2WYWA 1YS4A 3F5SA 4JJFA 3IKTA 1SNYA 1DRUA 3GVXA 1QSGA 2Q1SA 2VUUA 3R0IA 4O63O 5L4LA 1OC2A 4IDCA 4XCVA 1M76A 2NVBA 3Q2IA 4N7RA 3CSDA 3AM3A 5CP8A 3ZU3A 4MIOA 4IDAA 1GTMA 3FD8A 1RM4A 4W4TA 3W1VA 4DREA 3GAFA 3DBHB 5TS3A 1F17A 3NT5A 4DL9A 1V9LA 3NTQA 3WIEA 1I2BA 4E32A 3JQBC 4MVJP 4NIMA 2Z1NA 5A3JA 4QO7A 4GX5A 3W8DA 4L8VA 3ZWVA 2QIOA 4MVJG 5H82A 4ZGWA 2HMWA 2RHCA 3MJEA 2O2YA 1IE3A 2EKPA 1VLLA 5JDIA 1Y9AA 3I9KA 2P9GA 5JFOA 1CRWG 1H6CA 3GVIA 2VZ8A 2VYNA 4IJKA 3JQ9C 4IINA 2NWQA 1L7EA 2NVWA 2RHRA 2EGGA 1XG5A 1WZIA 4GWKA 4MDHA 2CY0A 1MLDA 3A28A 2YJZA 2IDZA 2Q2VA 3Q0EA 5A06A 4HP8A 3VDQA 4Z0TA 3PJFA 2JD1A 1JKJA 4U7WA 3DZGA 5IF3A 1P45A 3GNSA 3E03A 3GFBA 3H7AA 5B37A 4FFNA 1PQWA 5KCZA 1RM0A 2GYYA 3GNTA 4BNHA 2D0IA 4BNNA 2WWRA 1YB5A 1U5CA 2VWQA 2DUUA 3OQ6A 3KZVA 3RC9A 1ID1A 4OJNA 1N7GA 1UJMA 4I08A 1DIRA 3BIOA 3SC4A 1AXEA 1CF2O 3IOYA 3OIGA 3OA2A 3TPCA 2POQX 4NZ9A 2JCVA 3U09A 1PL8A 4DBZA 3FNHA 4ND1A 3OEYA 1I36A 3T4XA 1EDZA 3DZIA 1KOLA 4Z0PA 3ZNQA 2GZ2A 1BXGB 4XGIA 4BGVA 3RJ9A 2X8LA 5IDYA 4E2ZA 1O9BA 1WWKA 3GT0A 5JCJA 3SLGA 1IZ9A 1VKOA 3C1OA 1YOVA 1JLLA 3EVTA 3WYEA 1LSOA 3FBTA 2O3TA 5B1YA 1X7GA 2OUIA 3JD1A 3VPFA 1HYHA 1K3TA 2V6GA 4ITUA 1UXJA 1DC3A 2GN8A 4IPTA 4K26A 1ZO8A 3AOEC 4CMKA 3TDKA 3MTJA 1GQYA 5GZ1A 1M6WA 3UCFA 2GR9A 3BHMA 4JBIA 3RI3A 2O50A 2VWHA 2FMUA 1R6DA 3ITDA 3QV1A 4I5EA 2OXIA 2P4HX 1WW8A 2V6BA 4G5HA 3H9UA 4WGGA 3WIDA 1KEUA 1MC4A 2HLPA 1ISFA 2X6TA 5C7OO 3PJDA 1ZMTA 1PJBA 2Y93A 1XU7A 4ZQBA 1E7SA 4OXNA 4YJGB 2VRCA 3EW7A 4TKMA 4ZRNA 3C7CB 9LDBA 3X2EA 1PGPA 3RBVA 4FDAA 3GHYA 3JQAD 1UXIA 2HAEA 2FZEA 2DTXA 1T2EA 2EG9A 4ND5A 4CM9D 1OZAA 4DLLA 4I9UA 4KUHA 4PZDA 1DAPA 2JHGA 2Y67A 3PGJA 3GA0A 3DOCA 4BO4A 2FSVA 1XQ1A 4RVHA 2A35A 2Y05A 4H15A 3W4KA 4OQZA 1HZJA 4QSMA 2YV1A 3H3JA 1LRKA 1HDCA 4TRMA 2V65A 4LCJA 4BNGA 1R4NB 4K28A 1JVBA 1SOWA 1PR9A 1QYXA 3MJ4A 5J23A 3PLRA 5IG2A 1P77A 3NRCA 4R4JA 3RUCA 2B83A 1MUUA 4BV9A 5C7LO 3AUUA 3ZNOA 4BGIA 4B8ZA 3VZQA 1NVTA 4BQRA 4Z6KA 1IB6A 1YONA 4PLCA 1GV1A 1YE3A 5LDHA 1R0SA 4CQMD 1R37A 1KVUA 2WE8A 3HZZA 4J9UE 4XD2A 1AE1A 1RYEA 2OOSA 3RUAA 3DOOA 1JW9B 1M66A 2OL4A 1U3UA 4DBVO 4WUVA 4ALKA 4Q9NA 1C1XB 1GUZA 1XKQA 1CEQA 1U3VA 2E49A 1FJHA 1HDGO 4XX0A 4TQGA 2DUWA 3ZHZA 2FZWA 3ZWOA 1NFQA 1ZBQA 5DOVA 5IDXA 4LVUA 1F8GA 1LLDA 2RAFA 3NJ8A 2NV6A 4BNKA 1JAXA 4KUEA 2YV3A 2UUPA 3CUKA 3HDJA 3KXDA 3T7EA 1GUFA 1H6DA 2HQ1A 1X1TA 4MINA 4R1NA 3RVDA 1Q1NA 2QYTA 3F1KA 2D4AA 4FD3A 4PGFA 4AJHA 5L45A 4WNCA 3UAGA 1DDOA 1RM5A 3U49A 4F6LA 4RPHA 2O3UA 3OICA 4IGFA 1VSVA 4J4TA 3PHGA 2G0TA 4M87A 5C5IA 3L4SO 5A9TA 4F6CA 1GDHA 2J6IA 1GPDG 1VJ0A 4XZ3A 4RVGA 1UR5A 2YFHA 2OZPA 2VRBA 2CFCA 4B7UA 5U4QA 5BNTA 1A5ZA 4TWRA 4IJVA 2PR2A 4ALJA 1DAOA 2CF5A 1DIAA 3NGLA 4WEOA 2BI7A 4XEHA 3U4HA 1N1EA 3ZV5A 3D64A 4WOKA 1DBVO 4I8XA 2Q4BA 4UEJA 3ZWCA 5JO0A 1GPJA 1E3WA 4R3NA 3GZ4A 1ZNQO 4CLHA 2C2XA 2W4QA 3A1NA 1T2CA 1IPFA 4EITA 2W2KA 5T5QA 1QP8A 2D1YA 3F47A 4A0SA 5A5FA 2AHRA 1T4DA 2Q2WA 4J6FA 4OKIA 3Q3CA 4UUPA 3FPLA 3D4PA 3TRIA 1JU9A 3DB2A 3RUDA 4L0QA 3JQFC 3RKRA 4BNYA 4FN4A 3CZRA 5EJ2A 1DB3A 4L75A 1RPNA 3VKVA 5KJEA 2G82A 3UXYA 2OFPA 5KJ1A 1KETA 1HDRA 2EKLA 1UH5A 1PQPA 3RFXA 1ZCJA 3JCZA 3FNFA 3VVBA 2DFDA 2QZ9A 3ENKA 4D79A 3P2OA 4IXTA 5EL0A 3WOHA 5JAMA 1LRJA 2BF7A 1LDNA 1CDOA 1ISIA 1LXCA 3TL3A 1JKIA 3HDQA 3NDJA 5HS6A 1ZSNA 1JQBA 1P33A 1XSEA 3K31A 2R00C 3LLVA 3WLEA 4WCDA 6ADHA 4J2OA 2DU8A 3JQDA 1NQTA 2NTJA 3ZHBA 4RVSA 2VRCD 3LT1A 4LISA 3BMNB 3A4VA 1ADCA 1VL0A 2CMDA 4UEOA 3LT0A 5IZ4A 2CVZA 1DIGA 3JQ7A 4ID9A 4JLWA 1DFGA 1E7WA 3RSHA 4BOYA 4J0FA 3P2YA 1HE2A 3WGQA 3WTBA 3EDMA 4WK6A 4B3IA 5L4NA 1N9GA 1PR3A 4NBRA 1TT5B 4M1QA 2C82A 3VTZA 5COQA 3GPIA 2OP1A 4PVDA 5FEUA 2I76A 1KVQA 3ENNA 4ZVVA 1P0FA 3ROPA 4ZHSA 4PG5A 5ILGA 3AU8A 3ASUA 4OKNA 4AJJA 4TRNA 1BTOA 3FR7A 1I3MA 3D1LA 3DBHA 3JD2A 2C20A 1U2GA 5BSHA 3D3WB 4FBGA 4BNUA 5I7SA 1N92A 1EUDA 2GZ3A 3UCXA 3QSGA 4B4VA 1V0JA 2PD6A 3CXRA 3UCEA 4PG8A 5KKAA 3TQHA 5KNLA 3OETA 1EZ4A 1VSUA 2GASA 2ZATA 1DIBA 3GDOA 4PN3A 4RGBA 4CUZA 1CIVA 4NU6A 3U4CA 1W0CA 4RPGA 3RC2A 1P44A 5JMWA 3EYWA 5COAA 5IZCA 4IQ0A 1NQOA 4J3FA 4PLFA 1P0CA 4XQ9A 1PEDA 4QFCA 2RCYA 1NBOA 1ZFNA 3DFZA 3GC6A 1GY8A 2AA3A 3HN7A 4QUKA 2NM0A 1YBAA 4EEXA 1F06A 4RVDA 3JQ8A 1DPGA 4CM4A 3G3EA 3K73O 2D5CA 1U8FO 3I83A 1R16A 2NVUA 1HRDA 1PJ3A 3EHEA 4WCFB 4DIBA 3E6AA 2BD0A 5AOVA 2O2SA 1Q0LA 5ENDA 5CDGA 1JAYA 1ZIDA 4YWJA 1H5QA 5EN4A 1GZ3A 4DWVA 1CQIA 2ZJ1A 4L4RA 4R5MA 1ENZA 3MOIA 5G0TA 2YQ5A 3ROMA 1SCUA 1V3UA 3TWOA 4BNMA 4E33A 1AUPA 4XKJA 3BMOA 3QJ5A 3E9NA 3LK7A 2HO5A 4LW8A 5JYDA 1Y8RA 1YBVA 3KRTA 6LDHA 3HQ4O 3WGYA 5TRTA 3ANNA 1R15A 1X7HA 5I7VA 1E92A 5K0ZA 2CUKA 4EJ6A 1DRVA 3PIDA 4YVFA 4BVAA 5G0SA 1DJNA 1TVEA 4P38A 2CZCA 1OAAA 2JJYA 4AJKA 1UDCA 5KVSA 4RPKA 4RLSA 4WNIA 2C7VA 3BXXA 3VC7A 3WFIA 4Z9XA 1UZLA 4IXWA 3G49A 4JBGA 4R01A 4GWGA 5COBA 4GGOA 4XGKA 4BO5A 3C8MA 4U5QA 1IYZA 3K9QO 3UFXA 1OBFO 1EE2A 3BTOA 3NV9A 1GADO 2Q99A 4E6PA 1EFKA 2IEDA 3V2HA 2X5KO 5CFZA 3E82A 3H9GA 5CEEA 1U3WA 1D8AA 4L4SA 1YBMA 3BMNA 5DF1A 3H3FA 3JYNA 1PS9A 2EEZA 2AW5A 2NQ8A 2I65A 4D3DA 4YQYA 4BMSA 1RWBA 1E7RA 3GG9A 3SVTA 2Y0EA 3WDSA 1BW9A 3DMTA 2P68A 4HUJA 5JE8A 3F5QA 2W8ZA 4LSMA 1BGVA 3OQ1A 5F3RA 1MC5A 3KYCB 3RASA 3AW9A 4D42A 1UXHA 5EINA 2O7QA 4KQWA 1KBZA 1QYWA 4HADA 1NFRA 4RPJA 5DBIA 4KQXA 1Q0QA 5AXCA 1W8DA 3DZFA 2VWGA 1IHXA 3LQFA 3DAPA 1Q7CA 1QXSA 3AY6A 3JYOA 1A72A 2G17A 3KYCA 1H2HA 3JQGB 4ILKA 1GZ6A 4IQ8A 3PQDA 4YBZA 2OBNA 4CM9A 5AXAA 5TQVA 4J4BA 1C0PA 4XQGA 1IULA 2BLLA 3IIEA 3LZ6A 1ISMA 3DZKA 4YAGA 4JNKA 5BT9A 4U0KA 4II3A 2B37A 1NVGA 1PQUA 3MJCA 5TJHA 1EEHA 4P22A 5BQFA 4XIJA 3I6QA 3SJUA 3WGHA 5ICMA 4E31A 3VZPA 5IXSA 4EUFA 3B1KA 4LMPA 4UUMA 2JHFA 3QVOA 1E1NA 1YB4A 4DGSA 3IKVA 5GZ6A 4J49A 4R69A 3IUPA 1QYDA 3U9LA 5B12A 1QYCA 1E3LA 3B1FA 3GY0A 4IBOA 1E3JA 5JO9A 1HSZA 1PS0A 1NX6A 3FHLA 3HUDA 4DXHA 1NM5A 5I7FA 4XDZA 1D1TA 1V6AA 3EC7A 4TMFA 1I10A 5G0WA 3UKOA 4PLYA 2W2LA 5G4KA 4E12A 1UP4A 3GLQA 2J3KA 1TA4A 3DAFA 1ZSYA 3MWEB 4U6QA 1BXGA 2C5AA 1B2LA 1QR6A 3CH6A 4H7PA 4P8RA 3U62A 2W90A 4GX2A 2AQIA 1T2DA 2BRUA 1GD1O 3WQSB 3JQAA 4RF2A 5U9CA 3R3SA 3O9ZA 2X9NA 1HTBA 2GZ1A 2IEBA 1T2FA 4TROA 3GEDA 4N18A 1QV6A 5KWEA 4PVCA 5JCXA 3DFUA 3VPGA 1DXYA 4UUNA 4BKUA 2PZJA 3DAGA 1PJ2A 2NNLD 3HJAA 4BGUA 5IN5A 1LX6A 1VKNA 1WP4A 5JY1A 2XOXA 2PNFA 1LUAA 1X13A 1ZVMA 3ROQA 1Y7TA 3PHJA 5DBGA 4XYBA 2VQ3A 3ST7A 4ZQHA 5MGBA 1U4SA 4GX0A 3ROKA 4CM6A 2Q1TA 1KC3A 3OJFA 3VPHA 2P91A 3HN2A 1A4UA 4LCEA 1KY4A 2PFGA 1AHHA 1CQJA 2X22A 4YRBA 1RKXA 5F1PA 3IDSA 1B3RA 2C5EA 3KLMX 1EFLA 3D0OA 4YXFA 4BO1A 1E3IA 1XGKA 1WDKA 4IJWA 4X54A 4M86A 2HSDA 4CMEA 2EHDA 1Y8QA 3ULKA 1DRWA 4RVUA 4CM3A 4A2CA 4MKRA 1QYVA 3H4VA 4UUOA 1TXGA 5HBRA 4TVBA 3GEMA 1IHYA 2WYUA 3BZUA 4GVLA 2O4CA 3UUWA 1ML3A 2VN8A 4FFRA 4WKGA 3HADA 1GEEA 1I8TA 3WMWA 2EP5A 4NFSA 3OA0A 3C7DB 1Z75A 1LDEA 1KVRA 4YR9A 5L40A 1O6ZA 1R4NA 4TKLA 2QRKA 1N7HA 1Q7GA 4J7CA 4RORA 1LBEA 4BNWA 4BIIA 4GGPA 1I01A 2YHIB 2Y99A 4FFOA 3L77A 4AJEA 3QE3A 5JAZA 4BUCA 2NSDA 1OI7A 3I9MA 2AE1A 2ZTLA 3E8XA 3IUSA 4ZJUA 3DWFA 2NTNA 3WYCA 4OGWA 2O4UX 1ULUA 1OMOA 1I2ZA 1QLJA 5TSDA 3QLJA 4FFMA 4UVHA 1WNTA 4NK4A 3AI3A 4S3MA 3TN7A 3I9LA 5L3ZA 4ZA2A 3QA9A 1GAEO 3AI1A 3GG2A 1SMKA 4BO9A 4K6FA 2PD3A 4IMPA 3GMDA 4MKZA 5U1PA 1LLUA 3ZHXA 4I5DA 2Q2QA 3CINA 3C7AA 4IZHA 4KTVE 5HS4A 2GNAA 3UHAA 3RD5A 3WB9A 3BHIA 2IYPA 4J7UA 1FDTA 3O26A 4WLFA 2BH9A 1CWUA 5KIAA 2PGJA 3LC7O 3LF2A 2X5OA 3FWZA 2YDXA 3AWDA 4YAEA 1ADFA 4DMMA 1M6HA 1V3VA 3QIVA 2DVMA 2V6FA 3ZZNA 3GK3A 1E6UA 1XCBA 5AVOA 4EUEA 3ETEA 2NU8A 5BR7A 3OQBA 1A27A 2PA3A 4D3SA 1U7HA 3P5SA 2FY8A 3IP1A 1I3NA 1O8CA 3OJLA 1ONNA 2B5WA 3H8VA 3QVXA 3MWDB 3V1UA 4GMGA 3RROA 4UAGA 1Z7BA 1EVYA 1EK5A 1R0LA 5JDCC 2AQKA 3WR5A 2ZYAA 4UULA 3AOGA 3GDGA 3U3XA 2DLDA 1VJ1A 2YQ4A 4MKXA 2IXAA 4B7CA 1DO8A 2I9PA 1B7GO 4FFPA 1NXQA 4IM7A 3QWBA 1PJQA 3INRA 4N5LA 4WE3A 3P19A 5FWNA 3INTA 4BO6A 4D43A 3WICA 4CLRA 4D0RA 5IJZA 1JA9A 1DIHA 4BKPA 3DO5A 3JQAB 5KJCA 2HMVA 4RLHA 1ZZEA 2HMSA 3DMTC 3FBGA 1X7DA 1I30A 2UAGA 4I1IA 4M55A 4IQGA 3JQ6A 3S2EA 1BSVA 4RV9A 1P1IA 1JVSA 1ZEJA 4Y6RA 5HA5A 1JDJA 1T2AA 3W4JA 1G1AA 4EDFA 3DBRA 1EBUA 3ZW8A 2UDPA 4R54A 3BMCA 3TZHA 3NDRA 3EMKA 3WSWA 3AI2A 3WX0A 3RIHA 4YT5A 4IDDA 1P1FA 3ZWWA 2A4KA 3NTOA 1EE9A 4PIVA 5L53A 4QQRA 4Q3CA 4R51A 1D1SA 2QG4A 3OJ0A 4FFLA 1PSDA 1SO8A 3U0BA 2Y1GA 3JYLA 5THQA 1G0NA 3WGIA 4R1TA 5T64A 2H63A 2GD1O 4KTTE 3CMCO 4Q39A 3V2UA 2FWMX 2VNSA 4Y67A 1DJQA 2GCGA 2D3TA 4YRDA 2I66A 2XXJA 3L4BC 2X58A 5A9SB 5L51A 3PK0A 1E7MA 4DC0A 2G5CA 1YQDA 3ITKA 4BKOA 1KEVA 2BFOA 2GN4A 1NFFA 1DOHA 4XJTA 3CEAA 4U6SA 2GRAA 5B4TA 5EERA 2ZK7A 3QWIA 3TNLA 1UAGA 3DMYA 4R3WA 1PZEA 4A5OA 3BMQA 1AN9A 4EJMA 1LQTA 4CQMB 3GUCA 1PX0A 4WCFC 2P2SA 1SB9A 2NADA 2ZIZA 1GYPA 1BW9B 2GSDA 3MEQA 3PWSA 3WGOA 1NPTO 4FJ0A 3UICA 1LSJA 5I8WA 4DA9A 1HYGA 5ER6A 2NU6A 3PPIA 4RO0A 4DQXA 4U8GA 4AJPA 1K89A 3DOJA 3PZRA 3PJEA 2JD2A 5DZSA 4B7XA 4E5MA 3FCOA 3VPXA 1NP3A 4LGVA 5DCUA 1EUCA 3KYBA 3AU9A 3IQDB 3LVFO 1PJCA 4OHUA 2AEMA 4P4GA 1GCUA 3F46A 1QG6A 3Q6IA 2A92A 3BTVA 3ZWYA 4I9NA 4AFNA 1LSSA 4RZHA 3JD3A 2O7SA 1RYDA 3QVWA 4OQYA 3RFTA 2WE7A 2BFAA 3LC2O 3ON5A 4DC1A 1J0XO 3CE6A 2AQHA 4MP8A 2R00A 4XB2A 2P4QA 1E7YA 5HM8A 3H6KA 2I3AA 1BG6A 1K0UA 4NI5A 3CIFA 4JBHA 4RF5A 5KOIA 2XXBA 2NUAA 4IDFA 3AUTA 3FWNA 4GPD1 1YL6A 1MX3A 1A4IA 4CMBA 2IZ0A 2YUTA 4JP3A 4MP3A 4N5MA 3H5RA 4NJOA 5KVCA 2CSUA 2JKVA 3GOHA 1X14A 1PU2A 2FHSA 1PZGA 1R4MA 2X0IA 1H6AA 2E48A 1KVSA 2PV7A 1H0KA 3U4IA 3FRJA 3RBZA 3NYWA 3ZU4A 4CQLA 4W82A 5H83A 4A26A 3ASVA 4FJ2A 1T4BA 1PZFA 1MP0A 2AG8A 1PJTA 3DHYA 4FGWA 4PLPA 5G0UA 3ICCA 3ZCXA 2EF1A 4B3HA 4YRAA 4CMIB 1PIWA 3QWAA 3L9WA 3EAGA 3VDRA 3HB4X 4CMAA 5ENVA 5GZ3A 2H1SA 2J5QA 5EQFA 4WASA 3LDHA 1VL6A 3IS3A 3OIFA 4C4OA 2C2YA 3RKUA 4PZEA 5CPBA 3H9QA 4BKRA 1EVJA 2R2GA 3DQPA 3MZ0A 4YTEA 4J16A 2QRLA 4OYRA 5JXWA 3P7MA 1WZEA 3E48A 1I32A 4YJHA 1P31A 4GLLA 1ZSVA 1X0XA 2B4TO 2J3JA 4XYMA 4AVYA 5L95A 3OIDA 5L9AA 3LC1O 4AICA 3HDHA 4A10A 1IL0A 5HRUA 1LC3A 4E5PA 1TEHA 5LC1A 1D3AA 3BHJA 4MP6A 4U0JA 3PJGA 2D2IA 4J2HA 2AG5A 4MO2A 4PLVA 5DP1A 1ZXLA 2CDBA 1WMAA 4QO8A 4E21A 1H9BA 3KV3O 1NPYA 4FC7A 3VKUA 1TI7A 4TSKA 4DYVA 1KIFA 2YV2A 4XGNA 4PG4A 1HETA 1ISGA 4CLOA 3ZNPA 1H2BA 5TIIA 2YFQA 2VHWA 3FI9A 1HYEA 4WJZA 1Z6ZA 4NH4A 2EXXA 2EV9A 3GPDG 3NX4A 5BSGA 3KUXA 4CR8A 3GR6A 4O0LA 5CHEA 5ICSA 4YJDA 3TL2A 5JY6A 4TVOA 4BO3A 3VOSA 5TLSA 3IP3A 1HXHA 1XWFA 4XYLA 2Z95A 5TF4A 1C0KA 5AYVA 4UREA 1LA2A 4E5YA 4KWIA 4CR6A 3GRKA 1Z82A 4GVXA 4G65A 4J1NA 4W7HA 3DHEA 3ZU2A 3R6DA 3PFFA 4NU5A 3I9NA 1WXDA 4PG6A 5JC8A 3AM5A 3N74A 1DC5A 3WS7A 5A3VA 1A7AA 3JV7A 3K2BA 8LDHA 1G6KA 4R1UA 3E5RA 2VOEA 1EUZA 1J5PA 2W98A 2I6TA 1PGJA 4OOEA 3PQEA 3RC1A 4RL6A 5A9SA 5JSFA 2E6UX 4YT8A 1R0KA 2EERA 3DC2A 3HG7A 2BGKA 2J5KA 3WWZA 1HSOA 1GYQA 1T26A 3CMMA 4N54A 2PZKA 2WTBA 2C59A 4XA8A 4ZICA 4RJTA 1PL7A 5IDQA 2X4GA 3JQ9A 2EP7A 4QX6A 1P9LA 2EJWA 4QECA 2ET6A 5BSFA 5EPOA 2GDZA 2PD4A 2Q1UA 5DULA 3D4NA 3KEOA 4IY1A 2BFMA 1ZKMA 3FNEA 2FR8A 3Q9UA 1IPEA 4CM8A 2HUNA 3RUFA 2IODA 1E5QA 1LNQA 4ND3A 4H3VA 5DN9A 7MDHA 2GUGA 2FSSA 3PDJA 2Y66A 2ZCVA 5BNFA 2Q45A 1KC1A 4Z3KA 2YY7A 1Q2XA 1E7QA 4CV1A 2EWMA 1E3WB 2LDXA 3GUYA 5DP2A 2DBQA 2HRBA 4QXMA 3QVTA 4IS2A 4NJMB 2VT2A 3W6UA 5L7WA 4JQCA 5G0VA 2X23A 5CEJA 4AJIA 1B3BA 5JBIA 1N1GA 4DIOA 1X0VA 3JYPA 4L4XA 1YVEI 1LDMA 3FTNA 2RIRA 3V2GA 4GKVA 4M89A 4EUHA 4WPGA 2XPCA 3F9IA 5C37A 4YJHB 3KSUA 3WGZA 3A14A 3ETDA 1B8PA 5MDHA 1HE4A 2P5UA 3NGXA 2P5YA 2VHZA 5HTOA 1Y6JA 1YH3A 4DTIA 4XDYA 2I5PO 2DPGA 4J0EA 1SOVA 4EYEA 1FDWA 4PRLA 5GMOA 2A94A 3AM4A 3G1TA 3AJRA 2JCYA 4BNXA 1ARZA 2CVQA 4YA6A 3WJAA 5K6AC 4FJ1A 2GF2A 3FR8A 2VZ0A 3NJ4A 3RCBA 4TZKA 1E1KA 4OM8A 1F14A 4Z9YA 2XAAA 3ZGYA 3WBBA 1I3LA 4FSHA 2UUOA 4B4OA 4PLZA 4Y6SA 3ANLA 2FN7A 4ALIA 3M1AA 5JAIA 3ICPA 4URFA 4FB5A 4DLBA 5T57A 1O95A 1VPDA 3GMSA 3QQPA 1UP6A 3MJSA 2DTDA 1Q7BA 4CODB 1FDVA 3A06A
chains in the Genus database with same CATH superfamily
1JIIA 3RSOA 4KX5A 3DM5A 1BVRA 3E2MA 3EFOB 4KKVA 4L8YA 1XELA 2GPBA 3OEHA 5DOZA 3ZHSA 3D7MA 4DJ5X 4NMHA 3QP9A 3V1KA 1KYQA 2EFJA 3TOVA 3WY9A 5ENZA 5EWJA 4XD7A 1OC4A 2C0QA 2P9QA 2RAUA 1KDOA 2IYOA 2VUTA 3SOPA 2NTVA 4Q3BA 5K2MA 3ZWKA 5KNBA 2V9ZA 1XIVA 3B9BA 2Z3WA 4RVOA 4DQVA 1MIHA 1GZ4A 1Z6QA 2PZGA 4MQ5A 3RYHB 3MMNA 1TZ2A 5GONB 1L8LA 3MFYA 2PX0A 2BFDB 4P3KA 3GJ3A 4PRYA 4D96A 5CLLA 4WZBB 2VTBA 1ZM7A 1J56A 5H1YA 4QG3A 1DAGA 2A30A 2QVZX 4JT4A 4Z4FA 4BRWA 2BJWA 3RYIA 2J4DA 3QELA 4CNBA 2OK7A 3HKCA 5CG1A 4XPIB 2OQIA 1XRLA 4N0PA 3DCNA 4PXSA 3W2GA 2BGLA 1LQ2A 3FBWA 1GAQA 3HUEA 5TPZD 2IZZA 3SQOA 2F1HA 4XWKA 4U7PB 3QUBA 1E6WA 3KR2A 3KSDO 3KVOA 4RELA 3WMXA 3ICEA 1GPBA 2CXSA 4TTSA 3C14C 4XAQA 2Y1CA 2PCJA 3DBVO 2HV8A 4FMCF 1DV1A 2AJTA 4AG3A 1UMBB 1VQ1A 2EZTA 2XB2A 4DA7A 2X6QA 1M1YE 6NULA 2QLTA 4LV5B 3HXLA 3E27A 5SZHB 2ZWOA 4NHEA 5FYDA 4FWBA 1GARA 1RM3A 3A05A 5LA6A 2QDKA 4PSAA 1EP3B 2LUOA 4OH1A 5DRYA 2X9GA 4A7PA 4BQOA 4U2BA 3AJDA 1HMPA 5F1KA 5FHRA 1LK5A 4HDMB 2HUPA 3HYSA 4LXYA 3AXTA 2OO3A 3OKPA 4MWOA 1V6CA 1M73E 2IRWA 3TLKA 3TM5A 4TYWA 2X9VA 4O8ZA 4C89A 5A5VA 1J2TA 1W85B 2PTGA 3PXBA 3MILA 3G23A 1RXVA 1M33A 3KKEA 4BRSA 1JFVA 2EW2A 2KX7A 2JZCA 2P69A 3MCAA 2OCKA 5AUQA 4PS0A 4CL2A 2CVOA 1DEXA 3AXSA 4PYOA 1BGXT 3GNQA 4WY5A 2B36A 3DE4X 4QDUA 4L9SA 4ZC1A 1P8AA 1R5BA 2ZRLA 4DPMA 1F0YA 4LXGA 4F4FA 5EJGA 3K8YA 2FEAA 2V6MA 5E7MA 5F5NA 3U4QB 4P0PB 5IK2D 2FEOA 4HRVA 4PC6A 5B3JA 1P7YA 1TLFA 3OVMA 5CD9A 2ID9A 4QBFA 3SXJA 2ZAYA 3FFTA 1Z7EA 2D3WA 3QXHA 2XVMA 4URVR 3ED5A 5DPMA 5K3SA 1TZJA 1WSBA 5TR9A 5JSKA 1RLJA 4BQNA 4HN2A 5HCNA 5IAKA 1EX6A 2IY7A 5E6SA 1M34B 4D8VA 4X65B 4ERNA 3ZQUA 1D8TA 3DBLA 4P08A 1E1CB 1KMHA 3O95A 3Q8MA 5H3HA 3AO0B 3LF1A 4IYJA 2VR1A 2B4QA 4E13A 1RQRA 1AZTA 1V48A 2YDYA 3HYRA 4QLAA 4YP5A 1GLVA 1EFHA 4RVFA 4A73A 3WLRA 3HXPA 1RPJA 4BB5A 4GI2A 4AD8A 2EOAA 5CAEB 4CUKA 3RS5A 1AB5A 3N8IA 4W5NA 3ECSA 1UM9A 1XD2B 4DSZA 4NZYA 2FUEA 3D2LA 5GJWC 5K8LA 3DOHA 2PA0A 4LHSA 1JR3D 4D82A 4JVSB 5EMKA 2D8AA 1I1OA 3PHLA 1P2UA 2PLAA 4C06A 3G5LA 3K53A 5DGXA 4IFEA 5FR1A 2AXQA 1EVKA 4MVJI 2PUCA 1K7CA 1L8AA 2MSLA 4G8BA 5E0KB 4TV9B 1NQXA 3U44A 3BL5A 4F7WA 5ALYA 4HG2A 5I7UA 3OC6A 2FUCA 2HKIA 5DNDA 2AR7A 4C2BA 4F12A 1OR8A 3KSMA 3DYBA 1EK0A 3AZPA 1PGNA 1FFCA 1N5DA 2FPLA 3W9BA 2P78A 3H9EO 3X43A 1S6YA 3W7AA 1E8MA 2R6JA 3C87A 5JS8A 4C20A 2O7VA 2DBZA 1IWPB 2GLTA 1UUFA 3E3LA 4ENPA 5C7IO 1WX1A 2HCTA 1PWXA 1UL1X 5FI5A 4AG6A 2SKEA 4HXYA 3P0FA 5SZIA 4MAAA 4U6NA 3E3OA 1CU1A 4QPPA 1XRJA 3EMBA 1Z4IA 3WYFA 5KQPA 5ALWA 2A67A 1DG3A 1H69A 3N39C 2JZOA 4RMNA 1Y1SA 3VR4H 1J2UA 4ZWNA 2X9LA 1RRMA 1T36B 3AY3A 3H16A 2CMFA 2ISSD 1D6SA 1AUVA 4K9DA 2NZWA 1T3SA 3FOWA 4REQA 4IEEA 2OORA 4PGMA 2XIJA 4J9VA 1LTHR 1S4QA 2J31A 3JU3A 2IUTA 3D7LA 4BPBA 4QOSA 4WBNB 2OKCA 4M9XA 2E5WA 3GX1A 4LE1A 1YOVB 3UXMA 2XT6A 3ABIA 1T34A 3OAAD 4WQMA 5HDBB 4XLTA 4RQBA 4YT4A 1EUCB 3F98A 1P1KA 3MHPA 3QPDA 1L5YA 1NMQA 3D8BA 4OGFA 2JCSA 1WCWA 4P53A 4M0EA 3RO7A 4AAYA 4C21A 2ERCA 2OPBA 1C0IA 2PFSA 4LOJA 1MC8A 3OFSA 3PYMA 4WX2B 1X1QA 5B57C 4NXNB 3W2FA 1WF3A 3F2VA 1BROA 5JROA 5C9ZA 2ZTVA 3CV3A 1YS1X 3KEQA 3BB1A 3NBYC 4COOA 2KS6A 2RGAA 3M2PA 3KSAC 3QHQA 1XPUA 5IAJA 3TTYA 1U3TA 3P2KA 3PFWO 1NATA 5FD8A 3K1TA 1MHTA 1UBOS 1KR5A 1G3UA 3K7EA 3V1TC 3BSWA 1W87A 2QIPA 3F6YA 3G2QA 2CYAA 3AERB 3UHPA 3HJGA 4QEZA 2HF2A 3PNBA 3VHRA 4MRAA 2ZB3A 3WLPA 4CQMA 5CDTA 1FMCA 1E5LA 3GVCA 4E88A 5K8CA 4ZT6A 2PO7A 3KKMA 4GKJB 3MUEA 4OJMX 2Z5VA 4KW7A 3KDSE 4W7IA 3I76A 2JGDB 2O2CA 4TYPA 2IYRA 4CCWA 5FOQA 2C8LA 2H17A 2Z2KA 3CKYA 4L5CA 3QMWA 4JP2A 3ANYB 2HRDA 1W73A 3H04A 3X2SA 3CF6R 4ZJZA 5ALOA 1YRWA 3QKUA 1ID8A 1CY6A 1VIAA 2GTIA 4CG2A 1FFAA 4TMWA 1SOMA 1ENOA 2PSEA 3C1TA 4TSFD 4EZEA 2YXLA 1NJ5A 1GL6A 3CUYA 3P32A 4IOMA 5ARDA 3ONFA 4HLCA 3WQQA 3CPSA 1CCWA 2L69A 4F71A 3CVYA 4BO0A 3E1SA 2HR1A 1GL3A 2WUGA 2FEPA 1RJGA 5CTJA 3PC7A 3EA4A 4JI3B 3F8WA 4B34A 3IMFA 4XUDA 3F6CA 3FCAA 4N39A 5C80A 7MHTA 1IC6A 3FWPA 3G2LA 2R86A 2A9JA 5DMXA 4NESA 2QRVB 3L1UA 1QGOA 1DSSG 3L8MA 4BO2A 2FZLA 1MA0A 1KFBB 2PGLA 4QTUB 2VJCA 3RAJA 1GRNA 1B8VA 1SH7A 5JFGA 1XPJA 3EEQA 3MUOA 1Y1LA 5I9LA 4JYCA 2FMFA 1UJ5A 2EGHA 3DEZA 4H27A 3SSNA 4AJLA 1SQ5A 2NXJA 2DPYA 2QTBA 4HO1X 3SKYA 1WTAA 2P11A 3I61A 2HJRA 5SZKB 4FYHA 1YS2X 4NMMA 4DDTA 5CDSA 5ARBA 4YQFA 3FROA 3DKVA 5JJ5A 2ZYIA 2E3JA 3AHCA 4KZKA 3TRDA 2RHWA 4MW5A 1SUCA 1ZX1A 3QW2A 4PWZA 3M3HA 1MN6A 4PSDA 3NBFA 3KPWA 4R6WA 2GXQA 4CLRB 1YRHA 4GX1A 1JKFA 2HRZA 4YDSA 5LIPA 5DSZA 3DH0A 3O38A 4JVOA 3TSAA 1EZZA 2J87A 4DDHA 5KOHA 1V8BA 4Y7CA 1I7PA 3SC2B 4AO7A 2LWIA 1CY4A 5I9IA 5F77A 5EIFA 2VOJA 3UGQA 5T3YA 3ROZA 1BWQA 1Y7HA 2LDBA 1FYEA 2WHQA 3JSXA 2HJHA 1CYEA 2WY2D 2RC6A 1BN7A 1M8KA 1MGOA 2BFPA 2X0NA 3C98A 3L46A 4OAQA 3ZOZA 2E37A 2IC5A 2PMKA 2COKA 3OZUA 5HF6A 3WQRA 3B36A 3EODA 2BGGA 2V98A 3RVRA 3PYLA 2CHUA 3CGGA 1RJEA 1SBNE 5TJ9A 4CF6A 2WSIA 4JLUA 1NBME 4IYRA 3KOMA 3EY4A 2YW9A 1R12A 5HQ3B 2GN6A 1T9BA 3PR3A 2H4JA 1WZ2A 1JDBB 1T5IA 2R44A 1I7LA 1KTIA 3W8EA 1FE8A 3KWFA 2J4FA 4JJ7A 1XYGA 3TCNA 5KKCA 5KWSA 2WPDD 4P5EA 3ME5A 4QUDA 4U7FA 3TOZA 3QXCA 2Z5LA 5LDGA 1D7AA 4J7XA 4L08A 3CRW1 2F67A 3KOXA 1WMSA 2FN3A 2IF0A 2LPMA 3C6QA 4H2DA 4MW6A 4ZARA 5I9NA 1X1AA 3DGEC 5DNVA 3DCYA 4D0LB 5FQOA 4DQDA 3L7IA 4LIPD 2Z0MA 1MV5A 3R0XA 4OGKA 2DFPA 1OXTA 1NU6A 2ODWA 4HB2A 4EKIA 4V1CA 3KQMA 3PP8A 1A9YA 1PBNA 5LZ9A 4AY6A 2VNAA 3KYDB 3H5WA 3RYTC 5LR6A 1MQ9A 4OHKA 5EKTA 5I8PA 3DNFA 3SG0A 1KQFA 4O8CA 2AT1A 2ZT8A 4IHKA 4F3RA 4DJJA 2JLCA 3IAHA 4R16A 1DV2A 3I2KA 3O1IC 4Q01A 5DWDA 3GEEA 4E70A 5HVNA 4E3WA 1Y48E 3JQCA 3HSSA 3WXBA 1L9XA 1R8QA 1UODA 3SXUA 1PR6A 2WKWA 4BMZA 2J0VA 1JFRA 1HKUA 4QEKA 1KP2A 3ELWA 3TQQA 3C15C 1TJPB 4EZBA 1NW3A 3LRXA 3M6IA 4P4SB 2O2IA 2EEPA 3W5IA 3GMTA 1V3TA 1OWPA 2XQGA 2Y71A 3FFAA 2PT9A 4QVKA 4GR5A 2RKBA 4HNQA 4C0SA 2RBEA 3A4IA 1R8SA 1Y82A 4C1BA 1GNRA 4TPKA 4X20A 1KJNA 4LN1A 2I3BA 3PUZA 1RBMA 4X45A 3AR6A 2WMNB 5JAOA 3RVJA 5KYWB 1QIJA 4URWR 4XQEA 1TK3A 5HWSA 2AZXA 1ZH2A 1OZGA 3LLSA 1QDUA 4MICA 4ZO7A 1VCNA 1J9EA 3WLSA 4CF3A 4HDMA 1AXGA 2BKAA 2IHBA 4X8OA 2E4YA 1AV6A 2VSFA 2Z1MA 3IQWA 1PAUA 2N46A 2I8CA 1G5RA 1G6Q1 1BGWA 3ZV6A 3P96A 5EIEA 3EXAA 1K9VF 2I3GA 3KQTA 1PG2A 1WB5A 4JBNA 2I6UA 5C0OE 5LUAA 1N2JA 3EJ6A 3MBKA 4NG5A 3QBDA 4UFPA 2JNWA 3DYIA 4M37A 1KEEA 2H92A 2ZVDA 3DXFA 1S2MA 1IPHA 3BXGA 1YS9A 4PICA 4P36A 4YCJA 5LIRA 1VXRA 5C52B 3LTNC 1W9HA 3FZGA 4U7TB 2ALJA 2NPOA 1JZQA 3LBNA 5EIBC 4HVLA 3WK6A 4CGZA 1IMOA 2HXYA 3WLFA 4BVGA 2F3QA 4EFDA 1KA9H 1RS0A 1XEXA 4IIFA 4B40A 1E2NA 4DV7B 1A9PA 3TLGB 3B20A 4CV0A 5CT5A 3P9SA 2B61A 1E2PA 2E18A 1ZIXA 3CNOA 3A6HA 3PDHA 4BNIA 5F21A 2HHCA 3GDWA 3HYTA 3N7UA 1RXEA 3FUVA 2ZSEA 4S12A 2Q3EA 4W8HA 1QFZA 4WZBA 2QPAA 1U7ZA 4QUJA 4EKNB 1QORA 1OXMA 1X6VA 2WBLC 1O95D 3H84A 3INGA 5CB6A 3VNUA 3E7XA 5LWQA 2I2XB 4EG1A 2A2ZA 3J81k 3ILXA 3TCXB 4JSYA 4YO8A 2ORYA 3VU3A 1SAYA 2NZYA 5LCXA 3DM9B 2VK2A 3K5IA 3DHVA 3DMFA 3NOOA 2CDCA 2WSMA 3UN1A 2VP9A 5LZ2A 5EMJA 2WU0A 1FF9A 4BV8A 2NZ2A 3LV8A 1CD5A 1DKNA 1GYRA 1Y1KE 2HFKA 2WEKA 2O0LA 3GCWA 3L6DA 1RZ3A 1IQRA 2VQ6A 1JTVA 3O8QA 3QKRA 4NOKA 4QOIA 2NYVA 5DBHX 3F7NA 3K05A 4WKBA 3SX2A 4OB6A 2RHLA 3TDNA 2PGIA 2JB9A 2FQWA 3HE3A 5CA0B 3U13A 4F4HA 1YWGO 1DEHA 3BK7A 1Y8RB 2NT4A 1KK1A 1VYHA 4YAJA 2Y9MB 2VUSA 4Q1EA 4X1IA 1JFFA 1UT5A 2JFVA 2YZGA 2Z8ZA 4QOFA 1AGNA 2FCRA 2F3UA 1KKMA 2W4MA 3DHWC 5C1OA 1ZD5A 4GC5A 2C2KA 3VNBA 4R1SA 2P65A 2ZTMA 4QJBA 1EFRA 2C2GA 4FBLA 1CQIB 4JJKA 2V6JA 4PPGA 4U2FA 4TL6A 3RVQA 2BFCB 1JDSA 4GXRA 3W6ZA 1HFEL 3WBFA 1HZZA 3BD6A 3HFSA 2JEZA 4ZZ3A 1F5NA 3AFHA 4U3JA 2A9OA 3HKCB 1HNZB 3PFBA 1D7OA 3PXXA 1Q0UA 1C3XA 3CN7A 2I99A 3ZZMA 3P9KA 5CNIA 3VR6D 1HQKA 3STVA 4TL7A 5KI6A 5K1ZA 1DC4A 1JE0A 2B99A 2Y0CA 3FDZA 2C04A 2V7PA 4M8SA 4X95A 4EFMA 1URPA 3KX2A 1M2WA 2FH5B 4QWMA 2JLXA 4B3TB 3RSSA 4IP0A 3IV9A 1XZNA 1A3CA 5EJFA 4LVNA 1PJRA 2OXRA 2DJ5A 4GLOA 3VTKA 1R10A 5HRAA 1JJAA 2F1KA 4X60A 5K0SA 5BOSB 4CUJA 3DQQA 3PPYA 2PKRA 1EA5A 2N42A 2ZBEA 1BMQA 1L5WA 3AW8A 1JN0A 4GL4A 4E2WA 3EZFA 1O95C 3PNMA 3IAAA 3Q72A 4HH3C 1HDZA 1U1CA 3KL4A 4HXFB 1BRMA 2H48A 4EBFA 4Z5XA 2VL7A 4DRYA 5CB8A 1UEIA 4FMBB 1FW6A 1MHPA 2GJAA 4MQUA 1ZUNB 2WOOA 3L8FA 4REQB 1S3IA 3PGKA 4YUWA 3B6EA 5JRZA 2AMVA 1FP1D 3H2KA 4KH1A 3VOAA 1JEQA 2ODNA 2Q1YA 1IWOA 3JS5A 4MEBA 4C0KA 3JQEA 2CFTA 4EL5A 2P5SA 3U7HB 1QU3A 3W5SA 4JQOA 1V6SA 1PT6A 3AUXA 4CT0A 3ZJVA 3DW3X 4CBVA 3RARA 1IRXA 1GKKA 1ZJZA 4MKGA 3SKVA 1L4GA 5K7SA 3FUTA 4QPJC 5AO9A 13PKA 2C96A 1UJ6A 2FWJA 3HV2A 4N5NA 1VCOA 4QOHA 4TN5A 2CCJA 4RNDB 1M67A 5G3ZA 2WUEA 3S2IA 3DP9A 1ZXBA 1W75A 3AF2A 3AVYA 3AEXA 3ZZ1A 4GXQA 3V8PA 4B82A 2CLDX 1JSCA 1HE5A 4YALA 3U6KA 1N7IA 4ZAXA 1P9NA 2DSNA 4TKUB 2WHRA 4DZRA 2QJOA 5REQB 4LFBB 1CJSA 3PX2A 2IZ6A 2JAPA 2BGMA 1D6MA 2X76A 3CCCA 2GWHA 1G20A 4EO4A 1INLA 2G4LA 4PC3A 1OQAA 3MWFA 2BF4A 1D03A 1M2GA 1W19A 2QRJA 5JPIA 3HUFA 4M9ZA 2D5LA 5FLKA 2AJ8A 1YR9A 3FN4A 1GTG1 2UU9B 2WJZB 4KU4A 2IIPA 2NO9A 3PYXA 4J91A 5ICEA 5KUTA 3I9JA 2WD9A 3W3ZB 3KOUA 5BYBA 1Y1RA 4QKQA 3U7GA 3CGWA 4JELA 1M75A 4X6UA 1AA9A 3GLVA 1EFPA 2Q9CA 1WSDA 4R81A 1H05A 3R0JA 5A7FA 4BO8A 2CDNA 4FIZA 4G56A 3BWDD 5D51S 1QG2A 5F76A 2A1TR 2Z30A 1MDFA 3V8RA 4DR3B 1WHTA 4BX2A 1AA6A 3FTPA 1JIJA 4OQ4A 3J81A 5CVTA 1PD0A 1YB2A 4U3JB 1SCAA 4QD3A 4FOOA 2XMQA 2W2OA 4RPLA 3MLEA 1P4HA 4MWTA 4EGFA 3Q0IA 4DLVA 5KHOC 1O94A 2X15A 2ZYVX 4LC0A 3GGPA 3AESA 3FSEA 3EEOA 4D9GA 3IODA 4FTWA 2HSJA 3OIVA 1JIVA 2QZZA 3T7CA 1N3BA 4MDYA 3LCJA 1XYVA 4M98A 2HL6A 2DTEA 1Z25A 3I64A 4JX8A 3EIFA 3WIBA 2PSDA 1L4YA 3ZTTA 4UUAA 3UHFA 4RKQA 1GEGA 2CD9A 5FYQA 4HNRA 1M7BA 1NTRA 5FBHA 1UK9A 2CXPA 4K0RA 3OPVA 3FSRA 4IWYA 4RBNA 3TLMA 1XRNA 2WC1A 1V1RA 1YB1A 4YYEA 2HRRA 1T3HA 2BLNA 2YVKA 3A6EA 1H5UA 3B48A 3PG5A 1PZMA 2CL6X 5KYXA 3G2HA 1YDWA 4JGBA 4JVMA 3DBRB 4Y30A 3X1WA 4QQ8A 2W2PA 2YICA 3KFVA 4D6XA 2QQ0A 4UUQA 2RGGA 4MI9A 1HLPA 4BNFA 2CXRA 1FLNA 3OIUA 2W2XA 4U9IS 2BFEB 1K8ZB 1Q14A 4GMDA 4G0MA 1BFDA 2PL1A 2XAUA 4QZVA 3GRPA 4EUNA 1FUIA 2H29A 3IQFA 2GGSA 3KQPA 5EVCA 3FTCA 2FG7C 1U9IC 1YACA 2WMDA 3QPVA 1VPWA 4RKRA 1UCFA 1E2BA 4M7OA 4ZEXA 1L5LA 1YA4A 1ZHFA 3KTDA 4DMKA 5CLJA 3WZMA 2OESA 4ARBA 2C9BA 2ATVA 2C3YA 3IAS1 5EC8A 5JSZA 2A6PA 3QXSA 1W36B 2IBSA 4Z99A 4CFYA 2DAPA 5FXMA 2XDAA 4ZDKA 3B52X 4IZIA 4J1TA 5BN4B 3LUAA 1VLVA 4HBGA 1K6MA 1WAMA 1TGYA 1EFVA 1PRYA 1EB8A 1SXJD 3FWKA 3IEMA 1PGOA 4QT0A 3QU4A 4HMQA 3W05A 4C7JA 2OHVA 2I8AA 2NX2A 2RI0A 3SZOA 3QHPA 4FI3C 3GJZA 4N82A 4P3OA 4R8SA 4RXUA 5F5LA 5BYJA 3WLNA 2FZ4A 2IZ1A 3I72A 4UVDA 5JLAA 4D4MA 5BR8B 4MWDA 4WLEA 3B7WA 3EQZA 1VE6A 4G5OA 3C3BA 3W4IA 1H8HA 5AD1A 3L0BA 3SEAA 4I46A 4FEYA 2G5PA 3SS7X 2BI8A 1GGKA 2EZUA 2DFTA 2WZDA 4HLDA 2J9ZB 1A8HA 3HNOA 3T5MA 3BXZA 1EWRA 3F7MA 5THXA 1LW6E 2P6UA 4RDHA 4Q34A 5FBWB 3KJEA 2HW8A 1NKVA 3RS0A 1QX4A 2YYYA 1H4VB 2Z1DA 3HP7A 3QPAA 4YPVA 4J0QA 3M4NA 3CXUA 1A71A 3K2IA 3O4FA 1KXJA 1NF9A 4Q4CA 2X5JO 3HKDB 3VPSA 4ZXPA 4F4DA 3S81A 3I5UA 3ZVMA 3AY0A 5LJLA 4PR0A 1BS1A 1LI7A 3MRXA 5CNKA 5TC4A 4DUZB 4DSAA 3LT2A 5AK6A 5AKXA 4N12A 4EJFA 1KJ9A 4HX2A 4F9FA 4QRIA 4YREA 3VO1A 5CYGA 2VPZA 3OSUA 2BTOA 4UE2A 3Q8WA 4IIVA 1R0WA 3SEFA 1D07A 3WJ7A 2EIXA 1T35A 4FDLA 2Q2NA 1Q1ZA 5FI0B 1ULZA 4D6YA 5L3SA 2YHUA 5JS2A 2ZP1A 3PEFA 4Y18A 1AKWA 4UHBA 3QBJA 4YT2A 4R8MA 1ULBA 2W83A 4FS8A 3LNCA 4X8MA 3X1ZA 1N2ZA 1XQ6A 3IUEA 2VT3A 4NC9A 4QBKA 5M34A 2OCIA 2BFFA 2HV9A 1KERA 1OJLA 2YIDA 1UF9A 3BL8A 3GNLA 1W34A 3AF5A 4LFCB 2FDXA 2VLBA 3VKWA 1E1LA 4D80A 1YZGA 2ZWIA 1NP6A 2QTRA 2NXNA 4YQZA 4ZVNA 1Z22A 4INZA 3VAAA 1EMDA 1NI4A 4FFBA 3REQA 3O03A 1MVOA 4Q3NA 4F11A 3LH5A 1Y3BE 3OHSX 1WEKA 3O2SB 4X93A 4I66A 4KVGA 1Z35A 2QF7A 3FDIA 1N8KA 1IY8A 5E4JA 1Q50A 4BB6A 3JQ7B 3MXTA 1G7TA 2P79A 2VHXA 2VPQA 4ZQCB 3THYB 3LWBA 1BMFA 5FPPA 3JVEA 4TV9F 4RTKA 3KKZA 1WMDA 4PLGA 2WIFA 4RACA 5TX7A 5DNYB 2OXTA 4IV5A 3BDAA 2IYNA 5EP4A 5K0NA 1ULSA 3HDYA 5FWAA 3MOGA 3O47A 2AEJA 5EE5B 1DCFA 3EOBI 1X7WA 2ETXA 2W6MA 1ORRA 1PK8A 4DMCA 4S0ZA 1C4WA 1IK4A 5KC8A 2QRPA 5CFNA 2VAMA 3LSYA 4ASUD 2VJQA 1RYHA 3KC2A 3LDFA 4YRCA 2EATA 3A3NA 1H2FA 4M7PA 3SEZA 4JOBA 4ENRA 2DXIA 3T7TA 3R09A 3KT3A 4B43A 1XU9A 2ZIEA 3R77A 3AFGA 4NHOA 1E9CA 4UDXX 4DA0A 1XRPA 1V5EA 1ORIA 2PSSA 3FCUB 3HZHA 1NAIA 1VYTA 2WWXA 3HA7A 3NHYA 1UDWA 5AJVB 3RJZA 4MVJA 5DWQA 2EFYA 2YQZA 2HK6A 3ZNNA 4MUKA 1K8XB 4MZXA 3UPTA 3GH3A 3OU2A 1GXSB 2V4MA 5E6RA 5ESDA 1U7PA 5TPWA 2ETVA 3WL6A 3IC5A 1RAHA 5AI5A 4GRIA 1QRTA 1PZXA 2ZYDA 1ADGA 5DHFA 1NF3A 2D7DA 2QRMA 4ECAA 3H5TA 1GGJA 1W581 2C4WA 4DVJA 5HF5A 1E9VA 2AH5A 2O3RA 1FQWA 2ECQA 1O03A 1WQ3A 1TX4B 2GLXA 3JQBA 1Y5RA 3PHHA 2F1IA 4E2YA 3OEWA 5IZCC 3IT3A 2PEZA 4KIGA 3UT5A 5BT8A 3AEYA 4YHBA 1S9HA 3T8YA 3V2IA 4ZN6A 1YHZA 3AVTA 3V1LA 4C29A 3GAAA 1GDTA 4A16A 1F6BA 2VYND 2Q1WA 1OAOC 4F45A 4QDTA 5AI6A 1JR4A 1T3GA 3C3PA 2IXEA 1KXZA 2FOIA 3OF3A 5B4UA 4EP1A 5LQJA 2ZYHA 5LYYA 3UQZA 5ICCA 2GCPA 4MPRA 2O06A 5A4IS 4E51A 2Z8YM 1Y34E 1P5JA 1MCZA 3ZD7A 1T43A 4HXGA 1JEDA 2C03A 4WZBE 1QSGA 3R0IA 4O63O 2VZEA 3HU3A 3F9RA 4IDCA 4JOCA 4Q6WA 5L3QB 2DCMA 3CSDA 2WHPB 1XAJA 1M8JA 2RGRA 3FGPA 3ZU3A 4FYYA 4YDHB 4ZYYA 5SYNA 4WVFA 1MABA 1MX9A 2A0FA 4LDRA 4FLFA 4LCBA 4M6WA 4QFMA 4UBJA 2HLDD 3OOWA 4BC1A 3ZE7A 4DV0B 5FB3A 3FNBA 4MVJP 4NIMA 3PUJA 2VDJA 5D7NA 4QO7A 5JWRA 1CR1A 2Z9DA 1Z38A 2Z6AA 1Z5PA 1CUHA 1CZHA 1EPUA 1AK2A 5BMVF 4KGDA 4MVJG 4LZPA 2O2YA 1Z5NA 2Z6VA 1OFUX 2LRHA 1A76A 4TQAA 5CT9A 1IE3A 1NN5A 4EM6A 2NNWB 2V7TA 2GHQA 5G1NA 1N33B 5C4MA 3BVPA 1GZSA 1CRWG 1W1UA 2VYNA 2P9FA 2YWJA 1FPQA 4NL4H 2NWQA 3IPLA 1H9CA 2NVWA 3M5PA 3B38A 4MV5A 1XCJA 1XG5A 3NHZA 4GWKA 1WPXA 1O3YA 4MDHA 4Q19A 4TMTA 5TQ2B 2C4VA 3A28A 3NG1A 1EGAA 2DOKA 2OG2A 1THMA 2WSYB 2YY5A 3E5HA 3T12A 3L7MA 2WQ7A 3E03A 4KO8A 1PT9A 3I3SR 5KTOA 3SSAA 1SUSA 4ODIA 1Y80A 1XTKA 1RM0A 3M70A 4N7JA 2D00A 2F4NA 2BEVA 5IVPA 4MV4A 4QQNA 3IH5A 1CUXA 1YB5A 1D2HA 2OV8A 2G5TA 3KTAB 4WGFA 4AY5A 2XUHA 3QEMB 3Q8KA 1ID1A 1KRXA 1N7GA 4FZ3A 1W5SA 4FHZA 3NALA 3IEIA 2Z3ZA 1DIRA 1FLDA 1N2HA 2MHCA 2OAP1 1D2AA 2Q5HA 1JTEA 4G4JA 3TPCA 4AUEA 1T8UA 3KQLA 2WUFA 2Z4TA 4FQ7A 3RHSA 3RV3A 1A2QA 5F12A 3EGXA 3UJNA 2DP4E 3T4XA 4U00A 4OG2A 4TTVA 1QAMA 3IVXA 3CZ5A 1L4NA 2GZ2A 4TV8B 3ZNQA 4BGVA 1WOYA 5FTMA 1ZKDA 3RJ9A 3VVLA 2J9RA 3OHPA 1N4AA 1MTOA 2HSWA 1V1JA 2IY9A 1CQPA 4NAHA 2LR0A 5JCJA 1E63A 1VKOA 1N6PA 3VR5A 3C1OA 4J94A 1ABBA 3LD9A 3WYEA 3VV2A 3OE1A 2OV3A 2JLUA 1JAHA 2O3TA 5B1YA 1W5AA 3VPFA 2UVPB 1XMOB 4KYUA 5E1BA 5CT4A 2O5EA 3I8SA 1YR1A 5BVHA 2ZSFA 3R9XA 1KJJA 5I3CA 3F96A 1Z2EA 2B9VA 2GN8A 4IPTA 3H9BA 3AOEC 4G97A 1D0IA 5AK0A 2IEAA 5BWNA 3TDKA 1J23A 1XZAA 1VBNA 1F1JA 3I04A 4ZTZB 2AI1A 5J2TA 2ZT7A 2YWEA 1M6WA 4NZPA 3EPPA 1DBIA 1N2BA 3EVEA 4EELA 2NV0A 3NRBA 4JBIA 2Q3LA 3K2QA 1P2DA 1NSFA 2ZTHA 1X7XB 3D4LA 3QV1A 1R6UA 1R6DA 5KYTA 1XMQB 1SVMA 1GSIA 4MPJA 4GD3Q 4PEVA 4CHGA 1KEUA 1UOEA 4LDAA 1E2HA 4Y6RA 5ESXA 5F98A 4CIXA 2OGZA 2H0RA 5HUHA 1ZMTA 2Z4SA 4QHSA 1Z16A 3ODPA 4MR8A 1Q83A 5HXAA 1FVHA 1XU7A 2IHZA 3ABQB 2D7JA 4KYIB 5EUBA 2VJNA 4P7JA 4OXNA 4OJQA 3TW4A 4YJGB 1FUYB 3V46A 2VRCA 2GKSA 4N6OA 1H2YA 3HJCA 4FLEA 5CM8B 3A0UA 2XRYA 3C7CB 3O6VA 3X2EA 1U02A 5FOVA 3WQHA 3AGPA 2DTXA 1T2EA 2EG9A 2FW9A 3GLHE 4IMIB 5FBVB 1OZAA 1I7QB 1WBDA 1TVCA 4ISBA 4I9UA 1XTTA 2FV8A 3ELDA 4KUHA 3IX7A 4IJMA 3H8JA 3PTLA 2OT3B 2WILA 1XQ1A 3P4YA 4RVHA 1CEXA 3WDLA 4H15A 1N0UA 1T2VA 2GAIA 1N77A 4KC0A 1AKQA 1HZJA 2VZLA 2WWFA 2FFQA 3H3JA 3PFGA 4QSMA 2RAPA 4EA8A 2FDRA 1YULA 3C8DA 5IJ9A 2DQZA 4X0EA 3UAXA 4ZP1A 4JJZA 2Q8QA 3IBTA 1W94A 3EGCA 3FVRA 4G2TA 3Q6MA 1MZVA 4EK9A 3MJ4A 4G37A 2I1LA 4M60A 4RK1A 2VHUA 5FO0A 1OFIA 4C5BA 5IG2A 1P77A 3NRCA 3O94A 4G0UA 4R4JA 3QLUC 3KAPA 1FFXA 2V55B 3AUUA 5C7LO 3SK0A 3O75A 1JHXA 1E1QD 1NLZA 1NVTA 3O0DA 3Q5EA 1J7JA 5DB4A 5LMUB 1G21B 2UUAB 1YE3A 1TUGA 3K9HA 1YT5A 5LU9A 4KQ6A 1DAFA 3O82A 1PK9A 1XK6A 4WXHA 4LX8A 2ZI6A 4JUBA 4DCNA 1R37A 1T4CB 1TU0A 1AO3A 2WE8A 4JWKA 4R0MA 1KL7A 3HJTA 2NIPA 1EESA 1Q3HA 4QUAA 2HQOA 1BJTA 3ENVA 2FUKA 2H52A 1COWD 1G42A 4JU9A 4R8VA 4FYJA 4JVNA 1W46A 4HNAA 4WZZA 1CEEA 4JA2A 4JHLA 1QBGA 1ZRMA 1GPH1 1T0HB 4IR7A 4WUVA 3WKCA 2B2XA 2PMFA 4Q9NA 3FSGD 1GUZA 3GJYA 1XKQA 2ZE5A 3LXRA 4OJTA 4R2LA 3GCXA 1FJHA 1HDGO 2VEDA 3G9UA 4XX0A 4TQGA 4YRQA 3EZ7A 4O29A 2B8NA 3ETCA 3IUQA 5DOVA 1QFXA 4QG7A 1F8GA 1Y89A 4AX4A 3K0BA 4WH0A 1JLSA 2XT9A 4KUEA 4XW2A 4JENA 5DLEA 3RTCA 1Q1BA 2UUPA 3JARB 3KXDA 5IJXA 3CBGA 1GUFA 1R9NA 5DHTA 1Q7TA 4TYMA 5L45A 4NZZA 1G7SA 2EFEB 4Q7KA 2BH2A 3UAGA 2XUOA 3UGTA 3PKZA 2VNKA 3SDZA 5ERGB 1VSVA 4YRBA 4OX9B 4M87A 1M5RA 3QH4A 2ZVJA 3L4SO 2ATIA 1DJOA 3OTIA 1GPDG 4FW9A 3G8AA 4BE9A 4Z4IA 2J46A 4UTXA 3LXUX 2FZGA 2YFHA 1OB5A 4NENB 3NIGB 1WABA 1JQAA 3R4VA 3NVDA 3GL9A 4CG1A 1V8ZA 2PUEA 1WB6A 4B7UA 4F2DA 3LIIA 3M5CA 1NOKA 1DE0A 2ZIGA 4IHJB 2LKCA 4TWRA 5ITWA 2Y8EA 1WL8A 4GKAA 2Q5OA 2ZITA 4PZ9A 3WYNA 4ALJA 1DAOA 2CF5A 1ZIYA 2H1IA 1DIAA 4WEOA 1KDZA 4XIFA 3ZHTA 5ADUS 4B48A 1C7IA 2J3EA 2OZEA 4Z9BA 2Q4BA 4G8JA 4UEJA 1A7JA 5D00A 2IUFA 4P33A 2XX3A 1GPJA 1X92A 3LWNA 5IBPA 3RPEA 1WR8A 5K4GA 3GZ4A 2O8BB 1W59A 4LECA 2C2XA 2Y2VA 3IT0A 1T2CA 1IPFA 3UWSA 2Q2OA 2V8OA 3F47A 5KX5F 1CJTC 1WO8A 1PG0A 2PXAA 3ND5A 4IJQA 4K87A 1EHYA 4LJ8A 4QXPA 5ECYA 4YMTA 4DR1B 2ZXUA 3THWB 1RU3A 3B6JA 3AR9A 2RK6A 2G0NA 4UMDA 1ECJA 4OKIA 5K99A 1A9OA 3CVUA 5ELMA 3VR3D 2QZ4A 2CHGA 4C7VA 2PRIA 3Q3CA 1CP3A 1XD9A 1Z12A 2ZRHA 4BX0A 3E84A 1CZLA 1M2JA 3FPLA 1JU9A 3DB2A 3HLKA 1T5SA 2HA2A 4JBXA 4JL8A 2NSJA 4C0JA 2WF9A 4Y9SA 1UBMS 3JQFC 1GZDA 3EASA 1XVVA 5AVKA 1BU5A 1R6BX 2O0JA 3EZNA 5FLYA 5KDDA 1DB3A 4LJAA 4P1ZA 4FM9A 3P2MA 2NYUA 4L75A 3W0LB 1L4HA 3SZRA 5K03A 4KR3A 3L1KA 2LCFA 4O08A 1GA6A 1KZ1A 1CBUA 1KETA 1VL1A 2EKLA 1JHDA 2OHJA 5IRCD 1AGYA 2HHAA 1KAQA 2FPKA 3R4CA 3P2OA 3K9BA 2SKDA 2XJ9A 3WOHA 3X1KA 2VF5X 2H1HA 2BF7A 2I33A 4B6JA 1LXCA 2GF9A 3TL3A 3T5PA 2QPOA 3M9LA 4QXQA 3D6NB 3LQQA 3L8EA 4Z54A 1RBZA 4YC7A 3UEOA 5I4IA 5JD4A 1LV7A 2QOEA 4BN0A 2QROA 4MUBA 1BYIA 3QLEA 1P80A 1XZEA 3AR3A 5FPTA 4ZVQA 3RDPA 5FJJA 3DE0X 2NTJA 3NO4A 3I1FA 2YXDA 1YMQA 5FULA 4OQLA 1GNPA 1NC3A 4EMSA 3BMNB 1RCTE 2QN7A 3OZ7A 3OLVA 4NYMQ 2QD1A 1LZLA 2CLMB 2H51A 3LT0A 5IZ4A 2CVZA 2MJLA 5CFPA 4BMOB 3BE8A 4U02A 1Y3CE 1Y8AA 1QC5A 4L8LA 1DFGA 3EWNA 4BAGA 4BOYA 2R25B 3RTEA 3T7KA 1RWQA 3OPQA 3PXCX 1HE2A 2R11A 2IIVA 3D6HA 3EDMA 3FDZB 1EFVB 4HEQA 4WK6A 3WTBA 5BQXA 1D5WA 2FEMA 5L4NA 4LI0A 1L1RA 1P19A 4KE6A 3T4PA 3M1YA 5LFAA 3G6KA 3LY8A 2UVPA 3M6VA 5FEUA 2I76A 1I4TD 1ZIPA 2YZNA 4ZHSA 2FMXA 5CB0A 3AU8A 1KI6B 3FH0A 4OKNA 4DT1B 3PNKA 2GM3A 1FRZA 2WG2A 3FE2A 4TTQA 5CB4A 5H9VA 1KYWA 1YCHA 1ZGJA 3JD2A 4N6GA 1TM2A 2TS1A 5BSHA 4FBGA 5DYTA 3ZCSA 3A25A 2CJPA 5CW1A 2ZLBA 4DIEA 1ZD2P 4Y0AA 2BC9A 2R96A 4R71A 1AUOA 1JQ3A 3KVYA 1BDJA 4ARSA 2C2ZA 5B1SA 2PD6A 2GFQA 4RANA 3AIKA 5FQNA 4S05A 4PG8A 3I1YA 5DHRA 4M0CA 1KF0A 5KNLA 4DM7A 4KQJA 1VSUA 4LQDA 1DIBA 2QL5A 5A4FS 3WL5A 5ALIA 4CUZA 5AUNB 5CURA 1N8NA 2PXHA 1V11A 2HA3A 4NU6A 3JALB 3U17A 4Y1RB 3EG9A 3SJZA 1Y63A 4RPGA 5CFMA 2WSSD 1JJIA 2OQRA 1SIOA 1NUAA 1MOQA 3K0FA 4KE8A 1Q11A 3HMQA 5COAA 1PEDA 1Q2UA 1P29A 3SWWA 4XFJA 3DFZA 2AA3A 3KOWA 1KARA 2AVDA 4RHCA 1XCGB 2O05A 3B78A 3BZBA 2XBLA 4Y2QA 4ZT4A 4RDCA 2ZBGA 1G8PA 2ZWMA 3VM6A 1Q0TA 3AJ8A 4NYIQ 3G3EA 4BU1A 3V8MA 1SUFA 1U8FO 3LKBA 2JGAA 2I55A 1R16A 2NVUA 4WCFB 4K0KB 2HQBA 2PLWA 3E6AA 3ZJUA 4H0CA 2QMEA 2O2SA 3WWOA 3DXZA 5T6MA 1FB5A 3EDOA 5ENDA 3SC2A 1JAYA 3HUUA 4YWJA 5DGHA 1H5QA 1X77A 4QYIA 4DWVA 1CQIA 2IJGX 4EHNA 2ZYTX 3W5JA 5AW8A 3LP8A 5KNDA