2UVDA

The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
publication title Crystal Structure of a 3-Oxoacyl-(Acylcarrier Protein) Reductase (Ba3989) from Bacillus Anthracis at 2.4-A Resolution.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 90
structure length 246
sequence length 246
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2uvdA00
1IE3A 2VHXA 3NGXA 2FZWA 4UUPA 3ZU3A 4OXYA 3OIFA 4WCFB 1G1AA 2W4QA 4CLHA 2NVUA 1GYQA 2ZQYA 4OSPA 4MVJM 1WP4A 4IMPA 2AHRA 3KLPX 1E3WB 4D0RA 1MB4A 1Q2XA 2P9EA 4BNJA 5EJ2A 4ONEA 2EGGA 4A0SA 4ZQGA 3WNQA 5EPOA 1ZK1A 3K30A 1HE3A 4G5HA 4U0KA 2JAPA 4ALLA 4IIUA 2FSSA 4GWKA 1OZAA 4UEOA 3G49A 1YBVA 1LLDA 4QO7A 2PD4A 4DRYA 3DWFA 3NKLA 3NAQA 2JFFA 4KTTE 4R68A 5CG2A 1WDMA 2RH4A 5FWNA 1ORRA 1HSOA 3TPCA 1EK5A 4IUYA 1E92A 4S3MA 1E1LA 1N1GA 4W6ZA 4JROA 3BIOA 4NI5A 3ROPA 4AJNA 2I3AA 5AOVA 2Y05A 1EE9A 2IDZA 5JNLA 1ZCJA 3DAGA 3JD0A 2AG8A 2CDCA 2Z95A 4XIYA 4MKRA 1LC3A 5L53A 1NFQA 3MJCA 4YAKA 1P44A 4O59O 3AU9A 1Z7EA 4ZQFA 4R1UA 4NHEA 1VC2A 3Q0EA 1N92A 3C85A 3LT1A 4R51A 3WTCA 8LDHA 3MOIA 3OEWA 3WNVA 4YQZA 3E9NA 4NNJA 3WJAA 4BNIA 3JD3A 4BB5A 3I4CA 4BIIA 2D3TA 1DLIA 2J5QA 3NDJA 4J1NA 5ITWA 1TEHA 1QYCA 3NDIA 3ZV6A 1EEHA 4MVJE 3G17A 3PK0A 4ID9A 1V0JA 1Y8RA 4IJWA 2IZ1A 3L4SO 2V6MA 2FPIA 2ZTMA 2D1YA 3BHJA 3OJOA 1P1KA 4MDHA 4MVJF 1WDKA 1ONOA 2NV6A 3I3OA 2YDXA 3JQAA 4TROA 3P7MA 4XYGA 4E2ZA 1MFZA 3DOOA 3WGZA 1NXQA 5KNLA 4LRTB 2ZJ1A 3X2EA 4N18A 5IFLA 3NDRA 3NUGA 2BI7A 3MZ0A 4DREA 3FNEA 1MFPA 3RUFA 1R37A 1GUZA 1WMBA 1M75A 1G0NA 3WX0A 3IQDB 1ISHA 3MOGA 4D3SA 1I2ZA 2PZMA 4WKGA 1PTJA 4MOWA 2Y0DA 3QE3A 4FJ2A 4WLUA 3BHMA 5COAA 3K9QO 1PS0A 2GD1O 2VHVA 2O7SA 1BW9A 3KM0A 1ZFNA 3I6IA 1C0IA 2YQ4A 4E32A 2ZB3A 3NT5A 4MJLA 4LSMA 3DBHB 2HU2A 4CL3A 1E7RA 2GF2A 4JP3A 4M89A 3GHYA 1DPGA 4IDGA 3AUTA 4CUZA 4BMSA 1E3IA 2P91A 1XELA 3LSYA 3Q2KA 2WWRA 1ADCA 1P31A 2X23A 4BO0A 3IP1A 5B12A 2NLOA 3VZQA 1TA4A 1FDTA 2HK8A 4J4HA 2C54A 3L6EA 4PCVA 4B4VA 3CEAA 1XU9A 3DAPA 3GEMA 4QT0A 4BGUA 5J23A 1ISIA 1PZHA 3GNQA 3BMCA 1UXHA 4CQLA 3C1AA 5THQA 3JYNA 3OJLA 4YJHB 4DPMA 4YWJA 1ZSNA 4LCEA 3C1OA 2Q46A 3RUEA 1KEVA 2I9PA 5AVOA 3VDRA 5G0UA 3MJVA 3HJAA 4BNXA 3AFNA 3JD1A 5A04A 1W4ZA 3UCEA 1DIRA 1KS9A 3L77A 3T4XA 2ZTUA 1VL6A 3KETA 4GSLA 3L4BC 1XR3A 1Y8QA 2E49A 1UAYA 1XQ6A 3WYEA 4HP8A 3K2EA 3JQCA 3VPXA 4BV8A 4TRJA 1DC4A 3I9KA 2P5YA 3PYLA 4YBZA 4J6FA 4MVJG 3RUIA 3WGHA 2WJPA 3C7AA 1BSVA 1QV6A 2BLLA 1FDUA 4PZCA 3ZWCA 4TRRA 1BWSA 5FYDA 2PTGA 3D7LA 4FIZA 2TMDA 1PJBA 1PS8A 3H3JA 1C1XB 3ZWMA 1E5QA 3ETEA 2HMUA 3KYDB 1QLHA 2G5CA 4GKVA 2O4CA 4YT5A 1BVUA 1UAGA 1UP4A 1JA9A 1ZSVA 3WMXA 1KY5A 5KIAA 4ND3A 4EJ0A 2NADA 4FOSA 1K0UA 1GCUA 2GDZA 2XAAA 2PA3A 4CM5A 4Z6KA 4MP3A 2BD0A 1RKXA 2FY8A 1YE3A 1UP7A 4OAQA 5JDCA 1WNTA 3GVHA 4XYEA 2AEFA 1AHIA 1C0LA 2VT2A 3JQGA 2IE0A 1DJNA 2QX7A 5AYVA 3B20A 2BHLA 3GZNB 2F00A 3H9EO 1PGNA 1DC3A 3S2EA 1TVEA 4XA8A 1E3EA 1BXGA 2IEBA 3BTSA 3LQFA 4KUGA 1U8XX 2YYYA 1NQAO 3OECA 3DMTA 4ND4A 4BGVA 3ANMA 3M2PA 1VPDA 2QYTA 3AM3A 3FCOA 2C59A 3L6DA 3QWFA 1P74A 3D5TA 2HMSA 3JQDA 1LLUA 1NFFA 4J16A 3DBVO 4Y67A 1MC5A 1GV0A 1PX0A 4DLLA 4WASA 3VHRA 5B37A 3A28A 3OBBA 1WPQA 1OAAA 2VUSA 3K8ZA 4CM8A 2FHSA 3WQQA 3RC1A 3UGKA 4A5OA 4NPCA 3A9WA 1GCOA 4I1IA 3FBGA 1NWCA 4XYBA 1E6UA 1MXHA 1LA2A 2GZ3A 4YJDA 2QZZA 4J91A 1DC6A 1LQUA 2PKQP 4AJ4A 4BO8A 5L7TA 3UKOA 3K73O 2O7QA 3BMQB 2GO1A 5JAQA 2ZATA 2VWPA 4PG6A 3G79A 3OMLA 4L76A 2C2XA 6LDHA 4EYEA 5JYEA 4L4RA 4P8RA 4A73A 1H9BA 3IJPA 3AY7A 5G0WA 2BRUA 1QR6A 3K92A 4PLZA 4AJHA 3IL2A 1YS4A 3INGA 1ONNA 1IHYA 2BGMA 2FOIA 4KWIA 3GGPA 4G65A 5GY7A 1C1DA 2POQX 4DVJA 2CDBA 2H1SA 1ULUA 2GYYA 2RIRA 1DFIA 2YV2A 4II3A 3QRWA 1ENZA 1KVSA 3BMOA 3DB2A 5JY1A 3L9WA 1EQUA 3QVWA 5DCWA 1WXDA 3GF4A 2YY7A 4PLWA 2JAHA 4R01A 4BO7A 4RPGA 1D1TA 2O3RA 1DDOA 3AU8A 4HFMA 3FTPA 1IB6A 2NWQA 4CQMD 2OXIA 1HDGO 1NYTA 3SVTA 3S2GA 4CR6A 4E5MA 4E5YA 4YCAA 2PKQO 5MGBA 3O4RA 2R2GA 2CVOA 3PWZA 2HMVA 1V35A 2JD2A 1IL0A 1R4MB 2Y68A 1YO6A 2Q1TA 5FI3A 3ORFA 1HDYA 5L7YA 4PZEA 3VPFA 4XD2A 1IULA 4BHTA 2O2YA 5ENVA 3RQSA 1UP6A 2FR0A 3HFSA 5TJ9A 1I01A 3RC7A 3IOYA 1PJ3A 5JE8A 1TI7A 2CSUA 3HDHA 1DC5A 1GYRA 3PHIA 4UEKA 3T4EA 3OJ0A 4DC1A 4KDEA 3HQ4O 2RAFA 3AJRA 3QJ5A 1HXHA 3JQAB 1PQWA 4RCVA 1PZFA 1HDXA 1I3MA 3FNFA 4Z3DA 3SC6A 1NNUA 4R5HA 3U09A 3RKUA 1EK6A 5DOZA 1MG5A 3Q3CA 3ZWNA 5JCXA 1HF3A 4XB2A 2X7HA 1O95A 2DM6A 3D3EA 3D3WA 1HLDA 2G82A 1VM6A 4YAIA 4B4WA 5KWEA 3C7DB 4BO5A 1LSOA 1P77A 5DBFA 3DFZA 3JQBA 1PJTA 1PIWA 4DMLA 2X5JO 1BW9B 1E6WA 2DAPA 5ER6A 4BO1A 1BDBA 3INTA 4TQGA 3WFJA 2AEMA 2J3IA 1K3TA 3GMDA 4XJSA 4PG4A 2Q2QA 1XIVA 3GUCA 4DMMA 4Q3CA 1ZK2A 4LISA 1PSDA 4WCFA 3TZHA 4J7XA 2OOSA 3QP9A 4OKIA 2B5WA 2E4AA 3OM9A 3ULKA 3CE6A 1E3JA 2XPCA 1U28A 3PFWO 1HL3A 1I3KA 1E3WA 1ULSA 4Q3AA 3BYZA 3ZU5A 4W7IA 1SMKA 3C7CB 4HBGA 2BELA 1VJ1A 4XJTA 3MWEB 5HWSA 5BSGA 1D3AA 1UXKA 4ND5A 4LVUA 1K6JA 4WGGA 2NSDA 3PHHA 4CQLB 2EKLA 4L4SA 1LDBA 1ZMTA 1E7QA 4E2XA 1I2BA 5CFZA 4U7WA 3LF1A 3TJRA 4IMRA 1LDGA 3UAGA 5JDCC 2XOXA 5CEEA 4YPOA 1IYZA 1YQXA 1PL8A 4HUJA 1DB3A 4IDCA 2QQ5A 1T1SA 4HFJA 1XSEA 2HMWA 4BL5A 5JC1A 4MP6A 1E7MA 5A9SB 3WYBA 4LRSB 3EW7A 3QVTA 8ADHA 2PGJA 3I1JA 3DMTC 3TFQA 3U49A 2Q2VA 4BNMA 3JQ6A 1KVQA 4A7PA 3IIEA 2JCXA 2Y67A 4NBWA 1W6UA 3RASA 1P0FA 1LRJA 1SZJG 2ZCUA 2WTBA 4RVGA 4CLOA 2W2LD 1YB5A 1VL0A 4BMNA 3GUYA 4NFHA 3DO5A 3ZV3A 3U5TA 4G81A 5EIOA 1S7CA 1P1RA 4RPJA 3ROMA 3PIDA 4Y6SA 4CQMB 4IDFA 1GYPA 4UVGA 4RF2A 1Z73A 3E03A 1GQYA 3ZHYA 3F5QA 4ALJA 4E4YA 3OIDA 4HV4A 1ZMOA 3WR5A 4AL4A 4ILKA 4NDNE 4FS3A 2FSVA 4XR4A 4Y6RA 4EUEA 3JQGB 1UDAA 2J3KA 2Z1MA 3EUWA 3EVNA 1R66A 2JFHA 4CMBA 1R0SA 4QFCA 5IZ4A 4D3FA 5JXWA 2GN4A 3D1LA 1IOLA 1JLLA 1BXGB 3AY3A 3NX4A 1LRLA 1J5PA 4RF4A 1VI2A 4CJXA 3ANLA 3CSDA 3LT4A 3UFXA 1Y1PA 2FMUA 1GAEO 3C24A 2J3HA 2A92A 3INRA 4FD3A 3VH3A 1E1KA 3WMWA 2VYVD 2FPPA 3DONA 4XGIA 2VTDA 3DDNA 5CDUA 2VUUA 3TZCA 1R15A 2HK7A 3EZYA 4NBTA 3DBHA 4O63O 4CV1A 2B83A 4UVHA 2FR8A 1H94A 4H15A 1D7OA 3A1NA 3PJEA 3ST7A 3W4KA 5DP2A 4I5DA 2ZTVA 3M1LA 4J1QA 3WG9A 2VOEA 3HSKA 2X0IA 1JKFA 2PH3A 3M1AA 4E31A 2Y93A 4IDBA 4XGKA 3DAFA 5DNAA 4J2HA 1A71A 1H6AA 1O94A 4BNWA 3FF4A 4LK3A 1N7HA 1FXSA 3PEFA 2AQHA 4DIOA 4ZQBA 1ZZEA 4KWHA 1NVTA 1GEEA 2B69A 3RFVA 3WSWA 3Q2IA 1OMOA 3JV7A 5ILOA 2HCTA 2YUTA 3WGOA 1PJSA 5CDSA 4HNHA 3KVOA 4J7CA 1KOLA 1T2EA 1BG6A 1YBAA 2PZJA 1I0ZA 3DZIA 4II2A 4U6QA 4FW8A 1ISMA 2PWZA 5BNIA 1T4BA 1RWBA 5CP8A 4BNYA 4HNGA 1HDCA 2PK3A 1ZVMA 3UVEA 3WQRA 5KJCA 4ZHSA 3BMOB 1ZXBA 1V8BA 4GVXA 1LU9A 3H4VA 4BKPA 1ZK4A 1U4OA 3EC7A 3COSA 3GFBA 4XQGA 2Q50A 3QA9A 4GL4A 2JJYA 5EINA 3UICA 4TKLA 2NU8A 2RH8A 4GX2A 1CRWG 1JKIA 3I9MA 1ZXLA 4DLAA 5ITVA 4PVCA 3PI7A 4YA6A 3Q9NA 1BVRA 3JQBC 4GQAA 3RAJA 5HS4A 3PQFA 2AQKA 3VPHA 3F5SA 3VZRA 1C1XA 2UAGA 2DT5A 5ES3A 2IEDA 2VTEA 4C7JA 3KYDA 3B70A 1A9ZA 3E5RA 1XYGA 4B3IA 1M66A 2WMDA 4INAA 5DF1A 3ZW8A 1KETA 3PYMA 2PV7A 1PJLA 1QORA 4JIGA 4RORA 3IMFA 1WMAA 1YB4A 4H3VA 3KSDO 2G76A 1E5LA 3GMSA 3OQBA 4XR9A 3WWZA 5I7SA 3DZFA 4RQUA 1TXGA 3E48A 1PWXA 2X8LA 5L4SA 3H65A 3OEYA 4Z0TA 2CVZA 2NUAA 2QRLA 3GDFA 1JWBB 2WYVA 2X86A 1NQ5A 3ZNQA 4HFNA 2E82A 4ITUA 1QLJA 3L4BA 4J3FA 5EQFA 2CY0A 1BTOA 2UUOA 3JYOA 4BUCA 3GZNA 2VZ8A 3GA0A 3D3WB 2P68A 3Q6IA 4BKQA 1DRWA 1H6BA 4OMUA 3TDKA 2GLXA 4BMVA 4GMGA 1EFLA 3RFXA 1HWYA 1WZEA 5JPIA 4QUKA 4RO0A 3RROA 1GPJA 3DC2A 3PHGA 3NV9A 4NBUA 2X6TA 2DKNA 1EVJA 5L4NA 4ALIA 5T8KA 3U0BA 3GDOA 3MJSA 1N9GB 3O38A 4WLNA 4RVSA 1UZLA 2I6TA 2BFAA 1S6YA 3GEGA 4W82A 4YDRA 4JP2A 3WDSA 4IGFA 4EW6A 1R16A 1XQ1A 4WEOA 1K6IA 4Z0HO 1ONPA 4M86A 4NH4A 1H5QA 3CKYA 3BMQA 2NTNA 4XRRA 3C1TA 4K26A 4MKZA 3ZWOA 5KKCA 1PJCA 1B3RA 5KCZA 5T57A 1C0PA 4RZIA 5T64A 3SEFA 3UXYA 1ZEMA 4CR7A 4YR9A 4DL9A 5IDQA 2X58A 3OA0A 5EQDA 1UXJA 4RVHA 3SJUA 2H9IA 3HNPA 1LQTA 1ENPA 1NPDA 3PRJA 5KVQA 4WLFA 4IS3A 4D45A 1I5RA 3RC2A 1HYEA 1GEGA 4OXNA 4I08A 4DYVA 5ADHA 5IDWA 4WNCA 3U4CA 1RJWA 1Z45A 3WLEA 1T2DA 1Y5RA 1SCUA 2BKAA 4UUNA 1BRMA 4WE3A 5T6BA 3WLFA 3IUSA 2BF7A 3K2BA 4AJEA 2NM0A 1NHGA 2ZTLA 1X0VA 4PLGA 5BR7A 1QMGA 4CLOB 2A35A 2EV9A 3HG7A 4AICA 4MP8A 4R1SA 3AWDA 1MA0A 3KXDA 4LSWA 3JD2A 5B4VA 2D2IA 1HYHA 4DA9A 4UVDA 2LDXA 1ML3A 1J49A 1NAHA 1DJQA 1LDEA 1EUZA 2FZEA 3ZNOA 1R4MA 4MIOA 1PL7A 1GL3A 2Q45A 1FF9A 2B4RO 5G0SA 3PHJA 2NQTA 1O8CA 3ZGYA 4DWVA 3OFSA 5JY6A 2LDBA 3E18A 4E12A 3WSVA 2EJWA 2OL4A 4Z3KA 3GY0A 5A9TA 3R6DA 1JAYA 1NHWA 4RLSA 1DIGA 3ICCA 3CMMA 2A94A 3JYQA 3DBRB 5K9ZA 3RU9A 2WSBA 1KERA 4MINA 1OFGA 1P1JA 3QHAA 4B8ZA 3ZH2A 3P2OA 1R12A 1B3BA 2NVBA 2PLAA 4ZRMA 4UAGA 5CDYA 3F6YA 4JX8A 4D46A 1GFSA 3PDUA 3ADPA 2O3QA 4XQ9A 3D4OA 4FFRA 4RV9A 4FJ0A 5A06A 1MUUA 1DIBA 2DBZA 3DZKA 3PJGA 5FF9A 1JQBA 4AJOA 1IZ0A 3N7UA 5LCXA 4NIMA 2FWMX 1ZEJA 2Q4EA 5I8WA 2QG4A 4AJ2A 3F3SA 3ZV4A 1PJQA 3C3XA 3GNSA 4ROSA 5B4TA 1M6HA 3PWKA 2J6IA 2HO5A 5CPBA 5JDIA 1RYEA 3HDQA 4TKMA 1YOVB 3KB6A 1JWAB 3H7AA 5T67A 1DAOA 5TJHA 2C5EA 1NX6A 5FI5A 3ZNNA 2HQ1A 3U3XA 5COQA 1YRLA 2PZLA 5U1PA 4XYMA 2C20A 3EY4A 4MVJH 1QYVA 2CNBA 4M8SA 3OJFA 4FQ8A 4Q3DA 3JQ9C 4WLVA 1HE5A 1U2DA 1X14A 1B16A 1I3NA 5JW6A 4FFNA 3ZZNA 3KHUA 3DL2A 1KY4A 3VZSA 3QLJA 4DXHA 1IZ9A 4BNHA 1JTVA 3I9NA 4RPKA 5THKA 2EKPA 4OYRA 2YW9A 4CMJA 2DPGA 5A02A 2EEZA 3HUDA 3RFTA 3VOSA 4TWRA 4ZD6A 4ZICA 2Y99A 3PZRA 4PLCA 4EITA 1GR0A 2CUKA 2V6GA 1RM3A 3GDGA 3O9ZA 4NZ9A 2X9VA 4GAEA 3QY9A 2Y66A 4YXFA 2PH5A 3R1IA 3HFGA 1BMDA 4IQ0A 2VNAA 3ZWAA 4ALKA 1ZBQA 3JD4A 2CF5A 3PZBA 4U8GA 4KUEA 5A9SA 1PQUA 4NG5A 4DQXA 1AN9A 2WYWA 4JQCA 2EWMA 4HY3A 2A9FA 1KC1A 1N8KA 3WBBA 4Q39A 4DYDA 2EP5A 3QVXA 1HLPA 5L3ZA 1ENYA 1EVZA 3AM5A 4URFA 5C3MA 1GUYA 4UEJA 4AVYA 1E7SA 1F12A 3KV3O 3NT4A 5CPFA 5T8KC 3W1VA 2NU7A 1OBFO 4Z9XA 3B6ZA 1EFKA 4E5PA 3UCXA 2J8ZA 3NT2A 4TVBA 4CQMA 3H2SA 1HZZA 4PGFA 4KQWA 2P9CA 4CM1A 3JQFC 5IZCA 3PJFA 4FCCA 4PLTA 3G1UA 4R9SA 1BDMA 5IG2A 4DQUA 4YAJA 3IKTA 4IQGA 4ZQEA 3UF0A 1W0CA 5L51A 3ICPA 5B1YA 4A2CA 5K0ZA 2VRCA 2NNLD 4YRAA 4O5OA 3RCBA 3KZVA 4LMPA 4I8XA 1YONA 4O1MA 3F1LA 4YTEA 1CETA 3GC6A 4LN1A 3RSHA 1WLYA 2GASA 1E3LA 2QZ9A 3NTRA 3V5NA 1CERA 1XWFA 4PLYA 5I9NA 3KBOA 4FR5A 3FD8A 2DPHA 1HE2A 4UVIA 5H81A 3RUCA 1R0KA 1PJ2A 4KDFA 3DTTA 1R6DA 3RBVA 2EHDA 4GVLA 5JSFA 3PIIA 4PFJA 5BT9A 4BO9A 4JJIA 1LX6A 1ENOA 3JYPA 5EN4A 1I24A 3H6KA 1X1TA 1HYGA 4CLXA 2VUTA 3S2IA 2GZ1A 2IYOA 5JAMA 3QSGA 5A3JA 1A4IA 2ET6A 3GGGA 3NEPX 3CXRA 3SX2A 1KC3A 3BAZA 2BFOA 1E7WA 5C7LO 1SC6A 4AFNA 3JQ8A 3EDMA 1P1FA 4E3ZA 5CHEA 5F5NA 5L9AA 1EQ2A 1NVGA 2X9NA 3ZHXA 3ZW9A 5JO9A 4TZKA 4E5KA 2PFGA 3E9MA 1A7KA 2OP1A 4WECA 4C4OA 4CUKA 2FN7A 3V1TC 1E0DA 4CR8A 2VWGA 2DTDA 5KKAA 4YYZA 1ZO8A 4R41A 3TSCA 3PQEA 3A06A 3FWZA 3JSAA 5F1PA 1MC4A 4K9DA 3GPDG 4Q3EA 1HRDA 3ETGA 1TT5A 3BTVA 4P4LA 3GR6A 1DIHA 3KEQA 1U5AA 3ZDFA 1SEVA 3QV1A 2ZB8A 3LT0A 2EW8A 3OETA 2DUWA 4GX0A 4MVJD 4CV2A 3QWIA 2Y1OA 3GRKA 1NASA 3WTBA 5F1OA 5JDIC 4OIMA 4E5NA 4K6CA 1YH3A 2IYPA 5U9CA 1BXZA 1SEPA 2PY6A 3N58A 5I7EA 3FNGA 4H7PA 4E0BA 4MVJP 3QVSA 4YVFA 5A9RA 1QV7A 2VRCD 5TC4A 4FB5A 5CG1A 1EVIA 5L95A 2C29D 1LJ8A 2W2LA 2VRBA 4AJKA 1E6EA 2D8AA 2Z1NA 2WEKA 3A4VA 3AOGA 3W8FA 4U5QA 2GUGA 4RGBA 5TLSA 4WNIA 1WZIA 1EUDA 5G0VA 3B1JA 3WQSB 3ENNA 1NWHA 1VSVA 2OFPA 4NJMB 4QSMA 5DCYA 5EESA 4L74A 2CVQA 1WVGA 3RBZA 5TT1A 2J3JA 1F14A 3L9XA 1OC2A 5HRUA 3ZHZA 3IJRA 1SOWA 2VWHA 1KIFA 2PD6A 2CDAA 2YJZA 1XGKA 1UDBA 4TMFA 3OQ1A 3ABIA 3AFMA 4RDIA 3A14A 5IDYA 1R4NB 2VHWA 3FR7A 4G2NA 4KZPA 3X2FA 1MXFA 1N9GA 1ZIDA 3ANNA 4QO8A 5K6AA 2P9GA 2DBRA 1Z74A 4LVCA 3F9IA 4XWYA 4IJUA 1U5CA 9LDTA 4KTVE 4B3HA 2W2KB 2FR1A 2VNSA 3HB4X 4I9UA 5B4UA 1PZEA 2VYVA 4F46A 2HSDA 2Q4BA 1Y9AA 3ZN2A 2C5AA 4BV9A 2UYYA 4PZDA 2O3UA 1HDZA 2EGHA 3QVOA 4NK5A 4JGBA 2AA3A 1ZJYA 1LSSA 2PD3A 4QFDA 4TRMA 1ZUD1 5TF4A 2AEJA 1Y6JA 1GDHA 5KVSA 1PWZA 5JYDA 3WICA 5IZCC 5I7FA 3UCFA 5IN4A 3EAGA 2GR9A 1HKUA 3ONEA 4JBIA 4QTZA 1LXCA 4J2OA 1V6AA 2HRBA 5T5QA 4ALMA 1I2CA 2JFGA 2OGUA 3TOZA 4AJJA 2B0JA 1E77A 1Z6ZA 3DTYA 1ZNQO 2EKQA 5IXYA 1CWUA 2UV8A 4CM9D 2DFVA 2Z5LA 4F6LA 3AK4A 4DBVO 5FFFA 3WIDA 1JVBA 3SJ7A 3HWRA 3TNLA 2HDHA 2D4AA 1SO8A 1L7DA 1GQQA 3GLQA 3O8QA 4UVEA 4W99A 4JBGA 4LCJA 4PRLA 3CIFA 2WYUA 1QYDA 4YEDA 1NAIA 2OHXA 3O26A 1GD1O 1DFHA 4OL9A 3WS7A 2C0CA 3L07A 1DRVA 3H5NA 4PG7A 3KOUA 1WW8A 3PDJA 3V2UA 5HTOA 3IC5A 2ZB4A 3M2TA 2XXBA 3DR3A 1YGYA 2JD0A 4QEDA 1XKQA 2QW8A 1MG0A 5CAEA 5L7WA 4L8VA 4J1SA 3GOHA 4F6CA 1QYWA 4NFYA 4RJTA 3E9QA 2NU6A 2ZB7A 4CM6A 3DZHA 2EW2A 1UUFA 3UOGA 4DPKA 3FR8A 1RYDA 3DBRA 1EBFA 1A5ZA 3O03A 5ICSA 1YL7A 1GV1A 5A5FA 1SBYA 3VPGA 4OSOA 4YT4A 2I67A 1B14A 2GN6A 2BMAA 4YT2A 1DO8A 2HK9A 4IXWA 3U62A 1DRUA 3SC4A 4J49A 1GU7A 4YRDA 3I9LA 3FPCA 4A10A 1LSJA 3BMNB 4GGPA 4RVDA 1DBVO 3GG9A 2QRKA 3IS3A 1L1FA 3VKVA 5AXAA 3BTOA 1Y81A 1A72A 2Y0EA 4M87A 5C37A 4K6FA 3RVDA 5I9MA 1DAPA 2ILTA 2RHRA 3OSUA 4OXKA 3V1YA 1XLTA 3GH3A 2RCYA 1GZ3A 1M67A 1YOVA 1N1EA 4D44A 4BGIA 3OJEA 5AXBA 5IXSA 4ZGWA 5DDIP 3ZU4A 4KUHA 2D59A 3WJ7A 3FN4A 4CM7A 3AUSA 4CODB 3I4FA 1QRRA 2NVWA 1X0XA 1GADO 1ARZA 1VJTA 1HDOA 3E6AA 3R0IA 1PGOA 1Z82A 2O3TA 2QHXA 3S1LA 1P1IA 4EZBA 1YVEI 3L6OO 3MJEA 1O9BA 3FSRA 1KBZA 3JQ8B 3VH1A 3LC2O 5BNFA 5GZ1A 3OICA 2X22A 4RF3A 2DTXA 2NU9A 2PGLA 5JAIA 3H9JA 2XXJA 4L73A 4UULA 4OKNA 1PL6A 2YHIA 1V3TA 4J7UA 4A27A 4XB1A 1H9AA 4RPHA 3DHYA 3PYXA 1RM0A 1EZ4A 4L4XA 2W90A 3NJ4A 4I9NA 3GG2A 4M55A 1FDVA 1TT5B 2WD7B 1UH5A 2GSDA 5ICMA 4JLWA 4ALNA 4J9VA 2YZ7A 4BNLA 4GBJA 4JCOA 4DUPA 5IDXA 3ZWXA 3H5RA 1Q7BA 4FFLA 3JQ9A 3HDJA 3NRCA 4GWGA 4P22A 3JCZA 2DLDA 1O89A 1Q0HA 2FP4A 3OHSX 5JCJD 1DSSG 1L7EA 3TZ6A 3OH8A 5K6AC 4OJNA 3DBLB 1XEAA 1U3VA 2VYND 4N5LA 1ZK0A 1XCBA 2R6JA 4CMEC 2UUPA 5HM8A 4WOKA 1AXEA 1K2WA 3RC9A 2Q1SA 4FDAA 3ONDA 1EVYA 3KRTA 2DQ4A 4FFOA 3H5AA 5A1TA 4DPLA 2O4UX 2E48A 2QIOA 3EK2A 3HB5X 3TQHA 4D41A 2R00A 2W98A 4CMGA 5KTKA 1QG6A 3I9OA 1KEWA 4FC7A 1WAMA 1YQGA 3K96A 4FFMA 4K28A 3ASVA 4E6PA 4JXKA 1HSZA 1XG5A 5HBRA 3WOHA 3U9LA 4NMHA 1Y5MA 2HLPA 6ADHA 4XDYA 4E30A 4WLOA 3UHAA 3E82A 2C7GA 5F3RA 4OM8A 1VKOA 4IS2A 5DP1A 2I65A 2B4QA 2AE1A 5KJFA 2X1HA 4Q3BA 4BNVA 5KJEA 4E13A 5KVVA 4XDZA 5EERA 4EUFA 2AG5A 5LDGA 2Q2WA 2E37A 1TLTA 3GAFA 5DN9A 3AI2A 4YJGB 5G2OA 1JAXA 3R3JA 1B8PA 3EZLA 3DOCA 5DZSA 1JW9B 1UR5A 4BNZA 1PGJA 1O5IA 1YBMA 4Y8VA 4ESOA 4XYLA 3DMYA 2AMFA 3FI9A 3H8VA 4S1VA 4PLVA 2X0RA 3B1FA 1I3LA 1A4UA 1ZKMA 3JQFA 2G0TA 3Q1LA 2PKRA 4PG5A 7MDHA 1PU2A 1HZJA 1NPYA 1T24A 3ASUA 3GQVA 5AXDA 3V2HA 4DLBA 4R54A 4W4TA 3QWBA 2AE2A 4IY1A 1EDOA 4IDDA 1FJHA 2AXQA 2CFCA 3AUUA 4D42A 2OP0A 3G3EA 3TZKA 5TIIA 4LW8A 1NR1A 4WPGA 1FMCA 1WDLA 4JBHA 4GH5A 2O50A 2C2YA 5IJZA 2GGSA 4Z9FA 3RUAA 4YAEA 3GRPA 4OOEA 3JQEA 4AJPA 4D43A 5JMWA 3LDHA 3LU1A 4GLLA 3BA1A 1P33A 4CUJA 3P5SA 3SXPA 3W8EA 2WE8A 3ZI0A 3VC7A 4FFPA 2QRJA 5TNXA 2ZYAA 5JMPA 4BKUA 5TRTA 1QYXA 3JQ7B 1EMDA 3UH1A 1YJ8A 3QWAA 1Q1NA 1HEUA 3NGLA 3HADA 2Y1DA 3EHEA 4JN6B 1XDWA 5EL0A 3WGGA 4YRBA 1KYQA 3AUAA 3O8QB 3EYWA 4KMSA 1WWKA 4L75A 2QYSA 3K6JA 3FBTA 4RL6A 1SAYA 3CZRA 1IPEA 4HX5A 2ZIZA 4XEHA 1LI4A 5C7OO 1PGQA 2I99A 4BKOA 3P2YA 5L4LA 1I36A 1IY8A 3CUKA 4M54A 4ND2A 2UDPA 1Q0LA 1LUAA 3TL3A 4ZN6A 2E6UX 3GNTA 1K89A 2YQ5A 2F1KA 1ISJA 1KEPA 4CMKA 5F21A 4CLRB 3EGOA 4HFRA 4PVDA 5KVCA 4XX0A 1X7GA 2TMGA 4XGNA 4I9HA 4MVJI 2EJVA 2W8ZA 1P1HA 3KEOA 4PLPA 3WBFA 2OORA 1NQTA 4BNNA 2B4TO 2GPTA 1YL5A 2Q3EA 3ZHBA 3H3FA 5TT0A 1O0SA 4E2WA 1J6UA 1QSGA 1T25A 3KLMX 4ZRNA 3PGXA 4R1NA 4NJMA 3F47A 4YQYA 3KSZO 4A26A 2IZ0A 2DUUA 4R69A 4YJFB 1SB9A 5COBA 4R3WA 4J0FA 2JCVA 4IBOA 1SB8A 4B4UA 4NR0A 3F46A 4TVOA 2OZPA 1C3VA 4IIVA 2RBEA 1ADFA 4M1QA 1IUKA 2G17A 3K31A 5KOIA 3LT2A 4WJZA 1R4NA 1RM5A 3EMKA 5H83A 1CF2O 2AQ8A 2P4QA 3IDSA 5DBIA 4E33A 1GZ4A 3Q9UA 3PTZA 4UUOA 5ILGA 4WK6A 4IDEA 1F06A 1U7TA 3E1KA 2A4KA 2EIHA 2VT3A 3H9GA 1HTBA 4MKXA 2W2KA 1E7YA 4YB8A 3WFIA 1UZNA 1ADBA 1J0XO 1GQ2A 1M76A 4D79A 3ZNPA 5I8ZA 3KYCB 3PLNA 1U8FO 4Q9NA 2EERA 1B26A 4E21A 1Z7BA 4DQVA 1CIVA 5KJ1A 4R5MA 1LDMA 1E3SA 1OI7A 1ZJZA 3HHPA 1FDWA 1E1NA 2BFPA 2EP7A 2GZ2A 1ZK3A 4L9RA 3VDQA 4OOFA 4B7UA 1EDZA 1YKFA 5JO0A 2R00C 1LDYA 3T7EA 4IQ8A 2YHIB 3OIGA 1TB4A 1D8AA 5ER9A 1BHSA 1NP3A 4CMIB 3WGTA 1H6CA 5I9LA 4HWKA 4B7CA 2AQIA 3VH2A 2ZKLA 1RPNA 2RHCA 3JTMA 1U7HA 2DBVO 4BNTA 1YDWA 2G1UA 2Y1EA 2J5RA 5LDHA 1ISFA 1VSUA 3QIVA 2GN9A 2HRZA 3GHHA 4BS9A 4YAGA 1H2HA 4BO6A 3H2ZA 4RZHA 3U4DA 3SLGA 3GFGA 1NTOA 1SOVA 4NU5A 1CDOA 2VN8A 1MV8A 3DZBA 4QECA 2GERA 3S2FA 1H2BA 3PQDA 2HJRA 3VPSA 3OQ6A 1MX3A 2I66A 3ROQA 3AOEC 4MVJA 4FGSA 1HETA 3HN7A 3FTNA 1ADGA 2P2SA 3I52A 2NQ8A 2Y0CA 3QW2A 1T2FA 1DXYA 1OOEA 1VRWA 2X9GA 3U4IA 4OGWA 1I10A 4CL8A 4I5FA 1VL8A 2D0IA 5DOVA 3IKVA 3WYCA 4BVAA 5C7IO 3PVZA 4A03A 4NU6A 2V6FA 2PNFA 3VKUA 2CMDA 4QQRA 2B37A 3JQAD 2NTJA 2JKVA 4KOAA 3WGYA 2IZZA 4NJOA 3MEQA 4LGVA 4OQZA 3BMNA 4P4NA 2VOJA 1MGOA 1F0YA 3VTFA 1P45A 5BSFA 3W8DA 4ZA2A 3JYLA 4FJ1A 3RJ5A 3G0OA 4XKJA 5G4LA 3CPSA 4AJ1A 4JJFA 1YXMA 4KP7A 2V7PA 1NM5A 4WCDA 4D7AA 1ID1A 3W4JA 4UREA 5F5LA 4XCVA 1X7HA 2FPGA 2C7VA 2B36A 3DHNA 1NR7A 2WE7A 3ITKA 3Q11A 3V8BA 3WGQA 2VHZA 4B7XA 2P5UA 4OH1A 5AXCA 1IPFA 4CM4B 1U1IA 3GN2A 3RD5A 1UDCA 5JAZA 3S55A 1DFGA 4NBVA 4PIVA 5GMOA 4OO3A 1NPTO 5A05A 3WIEA 2UVDA 3K5PA 1UXGA 4R16A 2DVMA 2GN8A 3KUXA 1U3WA 4FOOA 5MDHA 5BQFA 3AI3A 2PR2A 3DFUA 4M49A 3I23A 2D5AA 4IXTA 5CDGA 4BNUA 2NVUB 4F3YA 3DHEA 3ITDA 1GTMA 2Y1GA 3H9QA 4N54A 3IAHA 4WUVA 1AHHA 3B1KA 4IJVA 5I7VA 4DGSA 5L40A 2HKIA 4R4JA 3ZWVA 3STHA 1YDEA 3DXFA 1TT7A 2BH9A 4RVFA 5AQ1A 1GY8A 3PHLA 3D64A 4NFSA 1DLJA 3MJTA 3ZU2A 5A3VA 2OO5A 1B7GO 1V3VA 2O48X 4J1TA 2JD1A 4FN4A 3NYWA 4DBZA 4EEXA 4B4OA 2YHUA 3D0OA 2YV3A 1T1RA 1N5DA 3UN1A 5DULA 2VZ0A 1X15A 3HZZA 4EJMA 1MP0A 3RKRA 3PP8A 1YQDA 2WD7A 1PGPA 1AXGA 1EBUA 3F4BA 4XQEA 2I5PO 4EBFA 1GZ6A 2YFQA 3CINA 4MIEA 1O6ZA 1Q7GA 1ISGA 3UW3A 3W4IA 4CM9A 2ZK7A 3GVXA 4B3JA 4N5MA 3VZPA 1JVSA 4Z9YA 3OA2A 1H0KA 5TSDA 4DIFA 2CD9A 4NK4A 3GVPA 3DBLA 1DHRA 4LMRA 4KQXA 4PRKA 2CZCA 4Y9DA 3IUPA 5DT9A 1VJ0A 3WGIA 4QXMA 4X54A 1Z75A 1T2AA 2B35A 5DBGA 1R0LA 4W9NA 3UUWA 3PWSA 3FWNA 3HE3A 1I33A 4GLOA 4IPTA 4XRGA 5JFOA 1EE2A 2GCGA 4FSHA 2OUIA 3AM4A 3KO8A 5C5IA 1YB1A 1B2LA 4XQCA 4R9RA 3I9JA 4DC0A 2OBNA 2Y1CA 3MWDB 3RUDA 1KVTA 3RJ9A 2BI8A 3MCVA 2DC1A 1XHLA 2BFMA 4RPLA 4ZVVA 1Y8RB 2YFHA 3CH6A 1H93A 3BTUA 4I5GA 1YWGO 1D1SA 4Y98A 4BO2A 1N7GA 2GNAA 5G4KA 3NTOA 1PZGA 3PJDA 1D4FA 3AW9A 1HT0A 7ADHA 4W7HA 2D5CA 3LZ6A 4O6VA 3OF2A 4RVUA 2Q49A 3BHIA 4BQPA 1A27A 1W73A 2FRDA 4N7RA 4CMHA 1XU7A 1Q7CA 3LC1O 4YJGA 1KVRA 4GMFA 5FEUA 3GVIA 3ENKA 4CMEA 1NBOA 1F17A 1SNYA 4HKTA 4Q3NA 4EJ6A 2VQ3A 1A9YA 4FGWA 2JCYA 4BO4A 2I76A 1LC0A 3M6IA 1JDJA 3V2GA 3GPIA 5BSHA 5JS6A 4TZTA 4B79A 4R1TA 1X1EA 4BNKA 3WWYA 1LLQA 2EF1A 1UZMA 4CM3A 3ZCXA 1ZW1A 1DIAA 1U3TA 2IXAA 1PJ4A 4BKRA 2VCYA 4Z0PA 2Q1UA 2H6EA 1QP8A 1AUPA 3IP3A 4EI2A 4ZJUA 2DBQA 1LTHR 3MTGA 1C14A 5TGDA 3ZWYA 1I8TA 4RQTA 3BXXA 4CPDA 3E5MA 4HXYA 2Y1FA 3PFFA 2ZYDA 3MJ4A 3RWBA 3CTMA 1LSUA 1LDNA 4IJKA 3JQ7A 2YV1A 5G0TA 4PG8A 3D5QA 2HMTA 4MPDA 4RLHA 3BMCB 2NACA 1Y9EA 3H9UA 4JNKA 3TN7A 4BNGA 4J0EA 1U3UA 2PGDA 4IZIA 3F4LA 3CMCO 1X13A 2C82A 4B8WA 1DEHA 1H6DA 1NVMB 4WOJA 2VZ9A 3RBXA 3RIHA 1Y8QB 2H5LA 4GSKA 2B5VA 2BGKA 4J9UE 3GVCA 3I6QA 1F8FA 2Q99A 2DFDA 4ND1A 1Y7TA 4XIJA 1A7AA 3WB9A 1EUCA 4L0QA 4BO3A 4C7KA 3HN2A 1VLLA 4GI2A 4PLFA 2EXXA 3BZUA 5CDTA 1UXIA 1P3DA 4CLRA 5GZ6A 1NFRA 4H16A 2JL1A 3U4HA 3D4PA 3QQPA 1B15A 1LLCA 5JCJA 4WLEA 3RUHA 2HUNA 1BGVA 1QKIA 3I5MA 3TWOA 4J4TA 4R3NA 2VYNA 3C8MA 3LYLA 4FC6A 5IN5A 3S8MA 4PN3A 4P38A 4U0JA 5LC1A 4CMCA 3TZQA 3TF5A 1KEUA 1YJQA 5F1KA 1V3UA 3TFOA 1T26A 3N74A 1RM4A 1BXKA 5ENDA 2DTEA 2OMEA 3ZWPA 4PLHA 5JLAA 3TOXA 1U9JA 2IODA 3GEDA 4GKBA 4MO2A 4CLDA 4YJFA 3VAZA 2HJSA 4BOYA 1GPDG 3R3SA 2PZKA 1I30A 1T2CA 3GAZA 2AW5A 2O3JA 3ADOA 4GPD1 4AJIA 4EEZA 3NTQA 1YL6A 5KJ6A 5BSEA 3AI1A 1B8UA 1G6KA 3DZGA 2SCUA 5DCUA 1K5HA 4IGEA 1P0CA 2O23A 1VE9A 2DU8A 1FK8A 4EGFA 3I83A 4JJGA 1LBEA 1K6XA 3ZWBA 1DHTA 3LLSA 3L0DA 3KYBA 4FBGA 3FNHA 1SPXA 3ROKA 3D4NA 4FPXA 4TRNA 4TSKA 3SBOA 3KYCA 5EMHA 5IF3A 3ZWWA 2JHGA 3PGJA 3LK7A 1U4SA 1LEHA 4CM8B 3VTZA 1X7DA 4EUHA 9LDBA 1CQJA 3OP4A 3W6UA 3LLVA 3QWHA 2X0NA 4NBRA 4IZHA 4J43A 5TX7A 2VHYA 4W9NC 3W6ZA 1XA0A 1T4DA 4QX6A 3ONFA 2EG9A 5IAAA 3LVFO 1V9LA 2WDZA 2P4HX 4BB6A 2IRWA 5TS3A 4DTIA 3RU7A 2O2SA 1QXSA 3NJ8A 4O0LA 2GRAA 4YACA 3TL2A 1CJCA 2Q1WA 4CMIA 5HS6A 3TRIA 2IXBA 4IINA 3V1UA 4U6SA 4D0SA 2X5KO 4GX1A 3DEYX 4BGEA 5BNTA 1G0OA 2I3GA 1UJMA 1F8GA 1M6WA 1PR9A 1Q0QA 3T7CA 1E1MA 1HE4A 4YJHA 1IHXA 2ZYGA 1C1DB 5A4DA 3ON5A 3GGOA 1N2SA 4K1LA 3GZ4A 1LRKA 1CQIA 1PR3A 4P4GA 1ZH8A 4J4BA 1J4AA 1U2GA 1W8DA 4GX5A 4OHUA 1I32A 5GZ3A 3PXXA 2X5OA 5CEJA 3WXBA 1FDSA 3ETDA 5TQVA 4AJLA 1HDRA 1NQOA 5JBIA 3E8XA 1P9LA 1JKJA 2OBYA 4J90A 4WEQA 4D3DA 1C0KA 5A03A 4IDAA 1ZSYA 4N5NA 1MLDA 2C07A 4E2YA 3MTJA 2O3SA 4MIYA 1CEQA 3VVBA 3FPLA 5L45A 3FRJA 3DOJA 3DQPA 1VKNA 1DOHA 3VVCA 4IM7A 3RI3A 1PS9A 4HADA 3LC7O 1AE1A 4WCFC 4BNFA 3SLKA 2YDYA 4EDFA 3GN1A 3KTDA 4NQZA 4RF5A 5G4KB 2VWQA 3G1TA 1B8VA 2X0JA 3EVTA 2BGLA 3VH4A 1PEDA 3GK3A 2XF8A 2CF6A 2ZCVA 3LF2A 1GUFA 2ZJ0A 2ZQZA 2NTVA 2X4GA 4XZ3A 5U4QA 4YT8A 2JHFA 1AGNA 4UUMA 1B0AA 5CEFA 3PLRA 1LNQA 2WD8A 1M2WA 1JU9A 3P19A 3FHLA 4CMAA 3GT0A 4CV0A 4Y6PA 2H63A 3KSUA 3AY6A 5HA5A 4BQRA 5H82A 4JK3A 1JN0A 3DZJA 4CV3A 2V6BA 3HDYA 4GGOA 4ZQHA 4I5EA 4RDHA 3F1KA 1PQPA 4CLEA 3AOEA 4DIBA 2J5KA 4CM4A 3PPIA 4AG3A 3ZV5A 1CYDA 5A5EA 5JC8A 4F45A 2V65A 4ZU3A 1OC4A 2WM3A 2HAEA 4OQYA 1KVUA 3CZMA
chains in the Genus database with same CATH superfamily
2V5VA 3K8OE 5CM8B 4ZQCB 2VHXA 4CQNA 3FCEA 4YMIA 2GCIA 3BC1A 3DR5A 4ZJZA 3ZU3A 1QHEA 1ZRMA 3QF7A 1QHXA 2FPLA 2W4QA 1V7PC 1Y6QA 1F0PA 1LVUA 1VHLA 3IEXA 4B6RA 3BDIA 4EMSA 2XCTB 2GOYA 2QX8A 4OSPA 3KOWA 3QU7A 1ODJA 1H0SA 3U1BA 5H9VA 2AHRA 3T7IA 1MB4A 2P9EA 4BNJA 1NUTA 5EJ2A 3RO7A 2B8WA 1R10A 2RH9B 3OEED 5H16A 5BW6B 5LXTA 1XTSA 3DM5A 4IX9A 5EPOA 1AA9A 1LVGA 2GWRA 2BM1A 2FSSA 2ZG6A 4J03A 5ALUA 3NOOA 4DV7B 4AWBA 2HJGA 2FPOA 4UEOA 3T4UA 3ERCA 4KQMA 1K3FA 2FN3A 3NAQA 3AUKA 4QVKA 1K7XB 4G5RA 1WTAA 3NWBA 2DBYA 1SBNE 1WDMA 3KPYA 3NM5A 4QA9A 4R7ZA 4BRZA 2DCUA 4RENA 4OREX 4EA8A 4GOLD 1ORRA 4YROA 3WKEA 3O0TA 4LOIA 3TD9A 1E1LA 5ALMA 4Z7NB 2AMJA 4W6ZA 3RTEA 5EJ6A 4JVNA 5F3WB 1R0WA 4FZVA 5KVAA 1OTXA 5KWJA 4U7TB 4LMBA 2GNPA 4GBGA 1QANA 5AOVA 2SKDA 1EE9A 3CPHA 4RJLA 3GO4A 5DWVA 3UA3A 3PUKA 4PHCA 5JNLA 4ZVPA 3JD0A 3MOSA 1EA5A 3O91A 2Z2IA 1UFQA 1Q16A 3IAFA 3EN0A 4FYPA 5L53A 4XXHA 5TR9A 3AU9A 1IQPA 1Z7EA 5J5AA 1G5IA 1XEWY 2C3PA 1TTTA 4TX1A 4F7DA 1CY0A 3PEEA 4R1UA 1KEKA 1NVKA 5CIYA 2XRFA 1MABA 1VC2A 2H8KA 1XQWA 4WBNF 3COZA 3N2GA 4DUYB 4WXPA 1RJ9B 4EPVA 1IDN1 1UBOS 4JBNA 4Z7OB 2NO6A 3MOIA 3OEWA 4DB2A 3G9UA 2W6ZA 5E2IA 4Q3OA 4BFCA 5IJWA 3E9NA 2YXNA 4NNJA 2IS1A 1DIOB 2C7OA 3BWMA 3WJAA 3MINA 3U81A 1W48A 3JD3A 4BB5A 4NH0A 4GW3A 1DLIA 4LWPA 2OG2A 1ML4A 1U7DA 3NDIA 3DGEC 3AILA 5LLDA 1D2RA 1EEHA 2IZOA 4U2KA 1BQEA 2VHQA 3PK0A 4DM3A 2BTQB 4IYJA 1V0JA 1XOIA 4IJWA 4LHZA 3NBQA 3AB7A 1T91A 3L3BA 3Q6MA 5SYAA 2G08A 4BN5A 3C4QA 3SQDA 5BMVA 3PXGA 3N2KB 2OE2A 4UASA 1UIMA 2WMOB 4HEHA 1M0EA 1P1KA 1VHTA 3K09A 4MDHA 3R5JA 1ONOA 2AK3A 2NV6A 4G0XA 4JFRA 4YDSA 4G4JA 1NF3A 2ZI9A 4WZ6A 2D5BA 4OBBA 3ZZTA 5KNLA 4MYUA 1FTQA 5ESXA 1KFJB 4N18A 5EZYF 2WJ6A 2EKBA 3NUGA 3HU5A 3P0IA 3ROZA 2BI7A 3MZ0A 1QHHB 2GM5A 3FNEA 3O2SB 1H1TA 4PGGA 5E6RA 3RUFA 1GUZA 1JHOA 1FOEB 1WMSA 1K0FA 2HIAA 5HMLA 1V11A 3WA6A 1R6VA 3BD6A 1BX3A 2E4WA 4P4UA 3IILA 1I2ZA 4YI5A 2PZMA 2XVZA 5CR9A 1D0IA 3A1DA 1PTJA 4MOWA 2Y0DA 4W1SA 1FLAA 3QE3A 4FJ2A 4WLUA 4X45A 1JECA 4EVRA 1XPUA 3OWOA 2ZRMA 5EWJA 5ALGA 2RGAA 4GP7A 4UVHA 1BW9A 2JK0A 3ILHA 1ZFNA 3BWBA 2A5YB 3EIXA 4N49A 3NT5A 3NBXX 4MJLA 1B00A 3DBHB 1VLHA 2H7YA 2QN7A 3C0KA 1R0RE 4Q7MB 2NSHA 4I4TF 2KX7A 4X60A 3MB5A 3ADCA 4M89A 4B8YA 1H2FA 4CHGA 3GHYA 5CNJA 3LUGA 1PSZA 3CUTA 4IDGA 5IC6A 3AUTA 2XJ4A 4KNWA 4BMSA 3E27A 4HDKA 2P0EA 1SXJB 3L7MA 5IULC 1XELA 2PBLA 5I7AA 1VBKA 3CEPB 4JJ4A 1ADCA 1WMDA 3D6AA 4K6GA 3KB2A 3GLHB 3WV5A 2PS1A 3K70C 2PZAA 3KTFA 2IEIA 5B12A 3FX2A 1FDTA 3X1KA 4QICA 2ILVA 2XA2A 5BXQC 4JC8A 1OXUA 2GEDA 5C5CA 1ZICA 1JP7A 1W94A 5IUNC 4EKYA 1TX4B 4KQIA 2KBEA 3K1ZA 5DSZA 5AFSA 4TS9A 3SZUA 1I7PA 2YZNA 4X8MA 2IDJA 5FEMA 4DPMA 1XTIA 2KJQA 3K20A 4MS4A 2PMFA 3N2NA 3HUTA 2J9FA 5G0UA 3JD1A 3ONNA 4H2DA 1ZMRA 5CX1B 5JS1A 5A4IS 3UCEA 3AM1A 1DIRA 4O33A 5IYZA 2DXIA 2ZTUA 1H66A 2E49A 1E99A 2QTWB 2A78A 4I46A 1XZBA 3WYEA 1Z2PX 4HP8A 1WBJB 3O5AA 2OCBA 1U8AA 3K0FB 1XQXA 2WF9A 1V1JA 4TRJA 3B9PA 5HQTA 1DC4A 3EEBA 2P5YA 3I9KA 4O2LA 1EFVB 1OD6A 4MVJG 4UAVA 5KYYB 3GLIE 3FPAA 1RXVA 4L8LA 3EGVA 3WRXC 1GPKA 2BLLA 3FYUB 4FMDF 3AR2A 2VJBA 1IEVA 3MS7A 1NF8A 5AK5A 4TRRA 2F3SA 4JYAB 5F64A 1RHMA 2WI8A 1RI3A 1AT1A 1FNBA 1F2UA 3AH8A 3EGXB 5LNK1 1FFSA 4IIEA 4UU8A 2HMUA 3OZCA 3FDXA 2P9ZA 5ALIA 3FVRA 1E8MA 3SSOA 3W3ZB 1UK9A 1OPRA 1SIBE 1ZUWA 3Q10A 2UYGA 4OPMA 3ROFA 1BGWA 1Z5PA 2JH8A 3WMXA 3HXOA 2HT6A 3ZHQA 1KQFA 1KY5A 2I87A 3NATA 3TLEA 4EHNA 2V5AA 3GD7A 4EJ0A 2G80A 2NADA 5IVHA 2V1UA 3EXG2 2PM8A 2PA3A 4CM5A 3IUEA 3B38A 4PPYA 5IH7A 1RKXA 2YVLA 1N33B 2OD7A 2JFUA 1NVWQ 3CV3A 5AVKA 1UP7A 1VMIA 4OAQA 1CT9A 5FUVA 3QKSB 5FFNA 2CGEA 3WLPA 1WNTA 1UOOA 1X1AA 3GVHA 4JP8A 4XYEA 3TSAA 1AA6A 1EVEA 1AHIA 1U2EA 1C0LA 3QXJA 4HNQA 5FBKA 1TCAA 2GTIA 3RIXA 1OB2A 2IYZA 2QL7A 4JBLA 4OQQA 5JIBA 4M7WA 3MPOA 3H9EO 1OSNA 2XTZA 1E1CB 4C4PA 2QTVB 3EZNA 4R2WA 4RZ3A 2J08A 4UXHA 4BGVA 4BLOA 4Z9AA 5CB8A 5FR2A 2ZS8A 2ZYVX 3AM3A 3L6BA 1IU9A 1VDMA 3FCOA 4RNDB 4WFIA 5LPNA 2NXJA 3MJRA 3TD6A 2JLXA 1BN6A 4AMUA 1LLUA 3CEMA 1G21A 1N9ZA 4JBWA 5EKDA 1GV0A 3IFSA 4KDRA 2VHJA 4KAFA 4E46A 4ZZ3A 2VSYA 4ZEXA 4R2HA 4GXNA 3OBBA 3PDIB 4FHEA 2YC4C 1Y48E 2VUSA 3OCXA 2BZGA 4NYIR 2X77A 5UKDA 5C2JB 3K8ZA 1KYVA 5KQRA 3AQ4A 3NIBA 2M1ZA 2VDRB 3H84A 3UGKA 4URWR 5EP2A 4UM5A 3FBGA 3WNZA 1NWCA 3VNBA 1VE3A 3KU4A 1E6UA 2OA0A 2ST1A 1YA6A 1I1OA 2F3QA 3Q2OA 1CB0A 2O6LA 2QZZA 2VCHA 2WIGA 1LQUA 3B7GA 4YFVA 1U0GA 5HCIA 1SVLA 4PQFA 4K9SA 1UDXA 1RYNA 1E96A 1Y6RA 1KK3A 3OD1A 3HHEA 1FTSA 3L7OA 4PG6A 3OMLA 2XCRB 5EJ8A 1XHEA 5JYEA 4EYEA 3KEMA 1VIDA 1PT6A 1Z0JA 1H9BA 3SFZA 2CNKA 3COWA 3RVNA 5HILA 3LOQA 4IWYA 1QR6A 2OAQ1 4RM2A 4G6ZA 4PXSA 4UE2A 3V3TA 4AJHA 1BAPA 3TW0A 4BX8A 1KRXA 4NU8X 2FOIA 1Y34E 5D8DA 2B99A 4FS8A 4G65A 1CIPA 1LVHA 1QGED 2JFNA 2ZE5A 1Z56C 4UDXX 4G0MA 3U80A 2RJ3A 3DC7A 3QY0A 1QHGA 1NRXA 3HA2A 4I3FA 5ALEA 4DVJA 2CDBA 1SD2A 2LVBA 3W90A 1DFIA 2ZBVA 3HFRA 3MLEA 3QF4A 4KCGA 3CKLA 4N0MA 4YMSA 2QR3A 2EBFX 3QVWA 4PANA 1PW5A 4MS1A 3GF4A 1SU7A 1MKYA 4X7RA 1EZ1A 3A31A 2B78A 1TPYA 1UMCA 2NPIA 5LDDC 2R6R1 4MWOA 3IAXA 3AEUA 2XY4A 2GD0A 4A8HA 5EUQB 5E1OA 4OHYA 1C9EA 2L42A 1L5YA 1D6MA 3JWGA 3S2GA 4CR6A 4Q34A 1VIYA 5BR8B 3O73A 5CFMA 2QV0A 3K6SA 2AR9A 3WI7A 1QE3A 1V5EA 3UOAB 3VR5A 2IZ5A 1P1BA 2CL6X 2CVOA 3H11B 2BBOA 3PWZA 4O2BF 4KOEC 1ZD1A 3FOCA 4BU0A 1IL0A 2INGX 1ONSA 1CNEA 2IT1A 2PXAA 2Y68A 4KQCA 4X44A 5L7YA 5LA6A 4PZEA 3VPFA 5THXA 2YWGA 3MT0A 3TTXA 5H1YA 3RQSA 3HFSA 5FI1B 4RULA 2NO0A 2RGEA 2A5DA 2DHCA 3QPUA 3IOYA 4HI0E 5EIHA 4BVJA 2X42A 3LBFA 1TI7A 2OGSA 1BMQA 4NZNA 4D56A 4EB3A 2W71A 3ANXA 1TCCA 4PPQA 4PZ0A 1DC5A 5HFNA 4OMDA 2HWXA 1XZKA 4Q3KA 1WMFA 3AJRA 2VO1A 2EJTA 5C51B 4RFLA 4P7FA 2A5LA 1U99A 5FUYA 3Q8MA 4IIHA 1I3MA 2BGRA 2JLZA 4N01A 3FNFA 4Z3DA 1Q1GA 3SC6A 3CZ9A 2R6GA 3U09A 2V8BA 4QEZA 1U0FA 5JATA 1Q1QA 1VYVA 1MG5A 5IEJA 4LHSA 3V97A 1HF3A 3SC2A 2XWJI 2DM6A 2LXNA 2XTMA 3IERA 2G82A 4KDCA 1PWEA 1T9GS 3CLKA 3SQOA 4LXGA 1O6BA 5KWEA 1S0UA 2IP4A 5KPJA 1VPVA 2HPVA 3T7RA 3SXJA 3ZW7A 5CDFE 1PIWA 2ZYHA 4QARA 1E6WA 2DAPA 2M98A 4MVCA 1WEKA 2NSLA 5AHWA 4TQGA 1ZN7A 4B48A 1OWOA 4B0PA 1KQGA 2Q2QA 4OGFA 3UJHA 2DFNA 3OZXA 3BVPA 2OTCA 2QAGA 3OIYA 1H0HA 4Q3CA 2GMWA 2H92A 4LV8B 2CDNA 1PSDA 4TLDA 3UY4A 3V1NA 1XDGA 3ORRA 4KJZA 4WKBA 4AZ3A 2O8FB 2E4AA 1KJZA 2EVWX 3EZ2A 3B1VA 3B52X 2OCAA 3B48A 4O2AB 3B6MA 1TC1A 1HL3A 1I3KA 2V3VA 2WU3A 3D7MA 3N8KA 3PNLA 4NPAA 4X61A 1BNCA 1SHUX 4W7IA 4F3RA 1T0IA 2CVHA 2E1RA 2BELA 2IWRA 3TTUA 4JHLA 1WSAA 2FFAA 1M5RA 3IURA 4XJTA 3HP1A 5JSKA 5F51A 1M2GA 4RX1A 2YOFA 4ND5A 1S2LA 2BF4A 3U7IA 3TOVA 1A82A 4WGGA 3WLHA 2AC4A 5AW2A 4LYHA 1WUYA 5KTTA 2EKLA 4K87A 3VMMA 1Z18A 4MAAA 1WNFA 1RRFA 1V8FA 4L4SA 3HKEB 1ZMTA 2CL7X 2Q27A 3DWEX 3QFFA 2JVKA 5B1HA 4BMXA 2WKQA 1R74A 3CGWA 2DPMA 3RR2A 4ZIRB 4P0QB 1UFOA 2O8VA 4QG7A 3MT8A 4U5XA 4DDMA 5M04A 1JHMA 1RWQA 2XOXA 3R3VA 1ZM7A 5JDCC 3O8BA 5ULLA 2JIBA 1PL8A 4J0QA 4HUJA 1DB3A 4IDCA 1OXTA 4HFJA 3A4NA 3HO1A 2XNHA 2PZFA 1UINA 1RW4A 4H7EA 1KF0A 2AG0A 4P35A 4TN5A 1A9XA 3GL9A 3WYBA 4LRSB 1QJ4A 1C7QA 3EW7A 4OATA 4LJAA 5LBTA 1SXPA 1E94E 3PRYA 3R7NA 2IGBA 3DMTC 2SICE 3R75A 2IUTA 3JXEA 3TFQA 2JJ1D 2Q7XA 1KH3A 3ENQA 4YAUA 3D0RA 3JQ6A 4Q4LA 2JEZA 2OGZA 1C30A 3KJEA 4DUGA 3IIEA 2JCXA 2RK6A 4NBWA 1N7IA 2ZS9A 2VF7A 4Q1FA 5CFLA 3BBLA 1SZJG 2ZCUA 1M3SA 2WTBA 4RVGA 3EW9A 4CLOA 1JR3D 4DV2B 2B21A 2BZSA 4RXUA 4B73A 2NU7B 4JUCA 4F38A 1VL0A 4OUDB 4NFHA 5AT1A 4PHFA 1E9CA 1FNSA 1GXSB 1FVXA 1XZQA 2VH5R 3DHVA 1FDOA 1WVIA 3DO5A 4LYEA 1BD4A 3OTGA 5JTTA 4S04A 2W22A 4HXFB 4LZNA 3WRWA 4Y6SA 4CQMB 3HVRA 2XQFA 2GH1A 3N1UA 3Q8WA 1D0SA 1H4SA 3CX3A 4PX9A 2V1XA 3CR8A 4YCMA 1Y3AA 1KK1A 1ZLXA 4N48A 4RW0A 2C4HA 4FS3A 1E3TA 3R7WA 2HPHA 4PCLA 1TTHA 5EIBD 3THXA 3KUUA 2J48A 3A04A 2D5IA 1F7UA 4WKOA 2FETA 3JQGB 1E2PA 2Z1MA 1BYUA 2JFHA 3O83A 4QFCA 2FWAA 2WYIA 2XOKD 2GN4A 5B2FA 3D1LA 3EUFA 1JLLA 3QG1A 1X8XA 3L18A 3G85A 4I1OA 3T9AA 2QNRA 2V7QD 3CUVA 5REQB 2Q3LA 4KQ2A 1VI5A 2A5GA 4GRAA 4D3ZA 3V32A 1X92A 1RI5A 3K16A 3RYTC 3ANLA 3QTBA 4CIVA 1DTEA 3DEKA 3OF3A 2FMUA 3PQCA 5AVZA 4YAOA 2C00A 4LF4B 3INRA 4I4LA 3VH3A 1OGJA 2H1FA 2I34A 3DDWA 1GKKA 4D4KA 5KYKA 2EJBA 4PFKA 4HDNA 1FFCA 5K8IA 3ESZA 2VUUA 1KSGA 2XDQA 4JI5B 1IBKB 3T95A 2PUTA 1DOAA 1KI3A 3K2QA 1EZZA 2QN2A 4UNSA 5DYYA 4DLNA 4L6IA 3TLCA 4FDMA 4QHSA 2GESA 3RS3A 4DR6B 1Z12A 5FLKA 1A9RA 3W3AA 3E1GA 2JGFA 3PJEA 3R0QA 2OK8A 2W2NA 4HQKA 1RJFA 4K9RA 5EWMA 2JRLA 5K3DA 3WG9A 3HSKA 3WO1A 5E6SA 3U5ZB 3M1AA 4E31A 1MRZA 1B23P 2Y93A 1TW3A 1YR2A 1X7WA 3HR7A 1R64A 4DZTA 2JPDA 1NQXA 3TNYA 3FKQA 3RJTA 4DIOA 4OGLA 3M81A 4IZOA 2OYRA 1EG7A 1GGEA 4KWHA 4UKDA 4C22A 1N3BA 3CWCA 3CKMA 4YUVA 3UWKA 4B09A 5KQGA 2PWYA 5CDSA 3PSHA 3OEEA 2QX6A 3I2HA 4U6QA 1YUNA 1I0ZA 2PZJA 2EQAA 2XUOA 4FW8A 5AM0A 1ILEA 1T4BA 3E2PA 3VDMA 1T9ZA 1R6UA 4FYYA 4NZZA 3V7WA 2ZBEA 3THWB 3EOBI 4Q66C 3ZQJA 1ZVMA 2J5XA 3WLMA 5I5EA 4AI6A 3RSQA 3OT1A 1QH8B 1F51E 1XZDA 2OC4A 4YJ2F 1V8BA 1LU9A 1WTCA 1WXHA 2Z9CA 3H4VA 4L3WA 5CYPA 1DZIA 2DCMA 3L1KA 1SA0A 1Z8HA 3CX7A 5LXTF 4BMYA 4UFPA 1X42A 1DCFA 3QA9A 4GL4A 2J9GA 5EINA 4D4JA 1WDTA 4TKLA 1U9ZA 1Y8ZA 4DY6A 5FUMA 3IO5A 2E9SA 1UBSB 4X1IB 2WK1A 1PV2A 4N8EA 3Q9NA 1BVRA 2BZ1A 2IJGX 2QRUA 3RAJA 1F5SA 2G25A 3OOYA 1Z6QA 2JDID 4LV6A 1J5EB 3QEJA 4ZANA 3M3PA 3RADC 5GOTA 1RQGA 221PA 2X4DA 3RC3A 4DT1A 1ZMBA 2LKDA 2UAGA 1RPJA 3CRRA 3O4JA 3FZQA 3T5DA 1ZDMA 5DF1A 3C3PA 2OXTA 3ZW8A 5ABPA 4QDOA 4DV5B 5H7XA 1K7SN 1P29A 3KZMA 3DJYA 1TM5E 3OE7D 4OHOA 2ZPUA 1A7UA 2C5GA 2RAVA 1E9FA 3GMSA 2AYZA 4IP0A 3WWZA 1C7FA 1BX0A 1EK1A 4UXIA 5K0BA 3QBJA 3U1VA 4RQUA 3G2OA 2IELA 5CGQB 1MC8A 4GLFA 1PWXA 1CUAA 5L4SA 1QRUA 3UJBA 4X64B 1SN7A 3H65A 4Z0TA 4QVGA 1DEXA 1SC9A 3DYBA 3LPAA 3GDFA 1JWBB 2WYVA 2X86A 2UYOA 1MA3A 1ZI9A 4ITUA 2E82A 3W2EA 3QE9Y 3C70A 3L4BA 4FGUA 1DARA 3JYOA 3M83A 3BDVA 4BUCA 3GA0A 3GJSA 2YIVX 4QTUB 3WISA 4F1KA 1LV7A 1JPNA 3ED5A 4N4AA 1DRWA 1H6BA 2TMYA 4REQA 2B3DA 1YR1A 3RFXA 1KI6B 3CW9A 3DZ8A 5A3QA 4FZ5A 5KKNB 3A2MA 4B74A 4XWWA 3I6BA 5HF6A 3PGMA 4Q01A 5K2MA 2WT4A 3NV9A 4NBUA 2X6TA 4EABA 2BFCA 1Z4IA 2RH5A 1F2TB 3CR3C 2DOKA 5T8KA 2DLNA 1KA9H 1V2HE 2IXTA 4ZMRA 5C53B 1N9GB 3VHXB 2FN8A 2I6TA 1G20A 1H4VB 1YUMA 2C2HA 2HSWA 1M9NA 3P0HA 1EXVA 3R6WA 1U0HC 4W82A 1U80A 3MGGA 1SC4A 1FX1A 1R16A 3QA3E 3SNHA 4OHPA 1TUBA 2O0LA 1LFAA 1XQ1A 5ECYA 1TKCA 4IF4A 2QVBA 1K6IA 1FLDA 2Y1KA 5EMLA 5IBRA 2G9NA 3TLBA 4JI2B 2H7CA 1B0ZA 3L8CA 4IMIB 4NH4A 5AW4A 2F3UA 3Q7PA 3AZPA 4YV7A 1CEXA 3FCAA 4K26A 4MKZA 3RS7A 5KKCA 1UJ2A 1IMJA 5B58C 2V55B 1B3RA 3OQIB 1NQUA 4I1VA 3DYVA 1DG9A 2ALJA 4RZIA 3EYAA 3MRSA 2VYFA 4II7A 3UKDA 2EZTA 4EVIA 4IGKA 4YR9A 5F9HA 4E08A 4FN5A 1H3EA 4H18A 1UF9A 1YFKA 1MQ9A 4C3UA 5C1BA 4WZAB 3H5WA 4P2BA 2H65A 1MF7A 3HNPA 3A2NA 2B34A 4JYMA 1PD1A 1OLXB 2GJKA 1Y6FA 4PYOA 4WLFA 4P33A 4IS3A 1WZ2A 1JF8A 3EQ2A 1ACLA 4NENB 3THOA 3R3XA 1TPZA 4CNBA 1ECCA 4WNCA 4BECA 2C4VA 2LE0A 2NPOA 1Z4LA 1DKMA 2C7RA 3OHMA 3EVFA 2R25B 4PX3A 1E4YA 3FFWA 2P0YA 2BKAA 2VNHA 1BRMA 1YZKA 4L50A 2O1EA 1JUDA 4MA0A 3H16A 2VF2A 3JARA 4P2GA 3VTKA 1SQGA 4LNHA 3WIVA 4XVUA 3QXSA 4K03A 1QBKC 2DH6A 6NULA 3WYAA 1EVQA 5JUWA 3M82A 5KYXB 2XVAA 1UADA 1K8ZB 3A9VA 4OHVA 1T3ZA 4HSGA 1Z0FA 4RHTA 3AVQA 4ND8B 4ZI5A 2B9VA 4UVDA 1S96A 1ML3A 2IA5A 2LDXA 2XRMA 2DMRA 3RSOA 5JSUA 4M36A 1R4MA 3E23A 2HLDD 4MIOA 5DI3B 3ZKWB 4XVCA 1PL7A 1GL3A 1FF9A 2B4RO 1U8EA 2QJRA 3DVQX 3PHJA 4LXHA 1DWQA 1JLHA 1L3IA 5IYZF 5BUCA 1U63A 1NE7A 1MJGA 5BMVB 3GRFA 5CIWA 5A9TA 3WFZA 5CCDA 1IJKA 2NU6B 3TXYA 3M6LA 1UPAA 1G4AE 3KNZA 2CB0A 3K0AB 3FETA 2ZJAA 5KPDA 5K0JA 1O94C 3JYQA 4QPDA 5DM70 3DMGA 4DANA 1OFGA 3X1JA 2R1ZA 3QYJA 3ZH2A 1NSYA 4LDZA 5DGXA 4YRKA 2HU7A 1JA0A 3E05A 3LIIA 1E5TA 5GM2A 5LBUA 4ZRMA 1OU0A 1SJ9A 3O3CA 3TEMA 1GFSA 5ALHA 3ADPA 5DTJA 4EVSA 1XEXA 3DE3X 4FJ0A 5A06A 3HH8A 1DIBA 3DZKA 3GA5A 3N7UA 5LCXA 4NIMA 3HO6A 2FWMX 4MV6A 5E38A 1TU4A 4JMLA 3W2IA 5B1DA 5KO2A 3ZV4A 1PJQA 4RMGA 3IEKA 1MAAA 3KZ1E 4X66B 5FTLA 3WLNA 1PBTA 1L7PA 3BZBA 3LV8A 4HJXA 3THSA 1UKZA 3AYXB 4BGDA 4D9IA 1YA8A 4CF7A 2YJ6A 3KJZA 5DEOA 1U7OA 2XHZA 2IYTA 1HT3A 1W44A 3M6XA 3QYAA 4QU5A 4MRPA 5FI5A 2W70A 3WGYA 3VAYA 1Z0SA 1E5DA 3ZNNA 4HVLA 1G63A 2EBUA 4AB1A 3M6FA 3BB4A 1OPXA 5K05A 2VPYA 5U1PA 3U44B 1UOQA 1QYVA 2GK6A 4ZYUA 1VJCA 2HK6A 4FQ8A 4Q3DA 1IN5A 3ZK9A 2Q3DA 4WVLA 4WLVA 1HE5A 5CM2Z 3L8GA 1RWOA 3BGSA 3OM8A 2BFFB 1U9IA 5JD3A 3UUFA 2W8BB 2Z58A 3DXYA 4F2GA 5KS2A 2WVGA 4CYMA 1XCJA 4Y6LA 4HWPA 3VZSA 3HYNA 3MWEA 4DXHA 4ZODA 1QCYA 4M6WA 3QPBA 1JTVA 1C9JA 2ZFUA 3I9NA 4JC4A 4OYRA 4RPKA 1JIQA 2YW9A 4CMJA 4FP9A 2XZOA 1YFZA 3VOSA 2NU9B 4TWRA 2WJHA 4B7ZA 1GR0A 2R47A 4EY3A 4YV1A 3H9BA 2V6GA 1RM3A 3GDGA 1W9MA 5EIXA 2HF7A 2QLJA 1EHIA 2B82A 2CCGA 3QY9A 5JXHA 2WINI 1MO6A 2QKYA 3KR2A 5EKTA 3HFGA 2KE5A 4ZYXA 1CP2A 3JD4A 5IWCA 5A9SA 3PCTA 4U8GA 1V16A 4MWCA 1AN9A 4RPIA 2WAXA 3N75A 3ND7A 2A9FA 2AOTA 3QVJA 1Z0ZA 2X2EA 4P4SA 1T6YA 3JQQA 4WXRA 3WBBA 4AF7A 1WHSB 3L93A 4DYDA 5L3ZA 1HLPA 1KKLA 2NMVA 3AM5A 1GUYA 1Z22A 2VAPA 4UEJA 4ITRC 1U0RA 4K2HA 1U9CA 2PMDA 3GRUA 5CRIA 1MB2A 1OBFO 3B6ZA 2PXXA 2ES4A 3PPVA 3LBIA 2J8ZA 3UCXA 3NP9A 5FA6A 4E70A 3H2HA 3GFSA 4MW7A 3ETHA 1N6IA 1ULAA 1KO1A 2NO1A 1KJQA 1ZQ1A 3IQFA 4CM1A 4DLKA 2F6RA 3HV2A 3UWPA 2C1XA 2UYHA 2ZT5A 3CBGA 3C3WA 3PJFA 3OOHA 1Y7PA 4K6HA 4IHAA 1G8MA 1BDMA 2P3QA 2JFQA 2TYSB 2UVPA 3E15A 4RABA 3X1YA 3IKTA 1FUEA 3DVSX 4IQGA 4ZQEA 4DLZA 1BVYF 1KR5A 4OX9B 4ZCRA 3T1HB 1NQVA 3HUUA 3ICPA 3KFLA 5K0NA 4EB0A 4EKNB 2QMOA 3B6IA 1TA9A 4LDNA 1U7PA 4HPWA 5B1YA 1Q1BA 4A2CA 1K1EA 2ISQA 2V7UA 2W6QA 4RVNA 5J9FA 5BUQA 4EKIA 4E88A 4LY6A 2AWNA 3KZVA 2VCEA 1NMEA 1PJAA 5JVDB 4ZKEA 5IFKA 2YICA 5LIPA 4ZXPA 3GC6A 2J45A 3DCJA 3LECA 2ZJBA 2QZ9A 1L7QA 1A69A 2P2GA 5LA6F 3V4VB 2YQZA 2XECA 4DV1B 3IR7A 1P4AA 3O92A 2PKYX 1TD9A 3TR5A 5I9NA 3SHTA 4BXOA 2CCKA 4NCXA 1BE0A 3DE7X 4MUHA 4R8MA 3RUCA 4O3FA 4ZOCA 4REMA 3LO8A 3RW9A 4LRYA 3HVJA 2BE9A 2JLYA 3AERB 1HPLA 1YACA 1ID8A 3UENA 2EHDA 3OKCA 1TQDA 3LVBA 1JT2A 2XUFA 4GD3Q 3VR6H 4DWJA 1U2ZA 3AESA 4RANA 1SG6A 2WM2A 5J1TB 1FIUA 4BO9A 1AQUA 1JQ5A 3EPPA 3HRKA 2OG1A 1I4EB 1KZYC 5FTNA 4EK9A 1WABA 4DEVA 4EX6A 3PDCA 1NBWB 1X9HA 2FCAA 2QD1A 4KO3S 4O8ZA 4ETWA 3O8RA 1ODKA 3ZHUA 3GJ7A 1NBMD 5DYTA 5E7MA 4EW3A 1J2JA 1KC3A 1KPHA 1B2RA 2PX8A 2BFOA 3HYCA 4ND6A 1DEAA 3AEQB 4AKTA 2CSXA 2W9XA 4GI1A 5C7LO 3NEAA 4AFNA 2IS2A 1W0KD 3JQ8A 3ABSB 1WPRA 1P1FA 2L2QA 1PFWA 5CHEA 1QWOA 4EFMA 4AO6A 3F8WA 1EQ2A 2YHAA 4F7WA 2F59A 1JEYA 1WU8A 4DR5B 3QUCA 2PFGA 3BFPA 2FH5B 2DFPA 1W8IA 4ZREA 4UJ3A 3Q3IA 2OP1A 1JXOA 2CLDX 3LY7A 4OXRA 4B9AA 3V1TC 2I2DA 1VHDA 4LJLA 1QU2A 1ST2A 2EKZA 3O8OB 3REFA 4F12A 2G0AA 3NWPA 1L5QA 4RHUA 5A0TA 4D99A 3KKPA 1Z5VA 5F1PA 1MC4A 4KK3A 1VHJA 3TDMA 2K2WA 4LOAA 1YCHA 2GETA 3GPDG 4YRPA 3RRMA 1U3FA 4HJRA 2Q3MA 4WZAE 3GR6A 5K4HA 1U5AA 1BU8A 2W6ID 4KNVA 1L4UA 1OJLA 2EW8A 2DUWA 2N9UA 1FNNA 4IRUB 4CGZA 1V1RB 3QWIA 3GRKA 1NASA 3PGVA 4OIMA 3KJQA 4GZ6A 1TYZA 4ENUA 2O19A 4V0KA 3GMIA 2OCKA 3DNPA 3R9XA 1L4EA 1I1HA 2JJ1A 3DPUA 2PAAA 1E2QA 2WUFA 5I7EA 4RELA 2A9RA 3MWYW 4BIMA 4D4GA 4E0BA 1Z6XA 4UBLA 5EGSA 5LP6A 1MO5A 2I3DA 4X1YA 3QUSA 1ZG3A 3QVSA 5AHKA 2QL6A 1YNSA 2P67A 4TM7A 4HNSA 1HKHA 4EY8A 4XX0B 4I0WB 1JR3A 2VP4A 5CG1A 5L95A 4D5GA 3FPGA 1UDRA 2VRBA 2ZAYA 2Z1NA 5EYPA 2WEKA 1AXRA 1MVNA 2X0KA 3AOGA 4U5QA 2ZSJA 4HO1X 2NZ8A 1EUDA 3Q88A 3B1JA 1AQIA 1FP4A 1G3MA 5G0VA 3ENNA 3RNLA 1NWHA 1SKBA 3U1TA 3UAXA 1Q44A 4OIFA 1G8KA 4AKSA 4KMMA 2DUJA 2CXPA 5C8YB 5HIIA 4UTOA 1C4OA 1F14A 2F9LA 2VHEA 1OC2A 2HB6A 1X2EA 4F4JA 1L5WA 3IJRA 1QQAA 2F43B 1SOWA 2LR0A 2OV8A 3ELDA 3JALA 3L7JA 3NIDB 1DAEA 2JGDA 2PD6A 2CDAA 4R2JA 1XVAA 2J9ZB 4ZHQB 1UDBA 1EWRA 2X8AA 5TQ2B 4YRLA 5LQUA 2XOKA 2H31A 1YDGA 2XGOA 4Q15A 3OQ1A 1V5IA 2MSWA 2XCQA 1IOZA 4NKRA 3AFMA 3CLTD 4C6TB 4DA4A 5IDYA 3BE5A 1NUAA 4KZPA 2V7QA 3CPEA 5IKMA 1F6DA 2WC1A 3BGOS 1POWA 2EC5A 2WQ6A 3G9TA 1HT2E 1THGA 1ZIDA 4JSRA 3OFKA 1UQUA 4A8JB 2WG1A 3GJTA 4M76B 4ZEWA 4A92A 1F4LA 3P45A 5D5HA 1G7RA 1H2XA 2WJJA 4EKDA 2W2KB 2BJVA 2FR1A 1MT0A 1CS0B 2ZYUX 4Q93A 1GPH1 4UFOA 3V4RA 2UZIR 4BEVA 3MELA 4F84A 2QRVB 4JIMA 4RCZA 2RHBA 4MW6A 2OSVA 2UYYA 1FYEA 1QU3A 4N3GA 3HBNA 2O3UA 1K4MA 3HEMA 4OQLA 3VR4H 5AW0A 2EGHA 3QVOA 2F4VB 4JGBA 2B6HA 1LSSA 5CLLA 2ZM6B 4YV0A 2PD3A 5KYWB 1NVEA 1PFYA 1ZJ4A 2O52A 1XAJA 4L02A 3ZXXA 2Z6QA 4Z3OA 2AEJA 2FZVA 2AI2A 5KVSA 4G5SA 3UO8B 5FQNA 5JYDA 1HQYE 5EXXA 3DZDA 5F4ZA 4K46A 3HCAA 3EAGA 1QO0D 4JBIA 3ONEA 1LPSA 1XCGB 4J2OA 1XRMA 4IEIA 4IH4A 3I37X 4ALMA 1KOJA 1PUXA 1PKXA 4UPDA 1IUNA 5F7XA 1YKSA 1EP3B 1U8TA 1E77A 3G8YA 4CF6A 3B60A 1BU5A 1ZNQO 2EKQA 4ZAVA 4A1OA 4X94A 3OHPA 1CWUA 4CM9D 3CRQA 3NNSA 3RF7A 4F6LA 4KO1S 5FFFA 4P3NA 1RQRA 3WIDA 3LL4A 2CC2A 1DQSA 1CUYA 2JJQA 1JVBA 2ECKA 2FDXA 5K4GA 3JY6A 4WI1A 3NH9A 5KNBH 1B6RA 4RZ2A 3GLVA 3O8QA 4H60A 5BN5A 3U9TA 1UDWA 4GOND 1YJBA 1QYDA 2IV7A 3SU8A 4WXYB 4CF4A 1NAIA 4LHEA 4CCYA 4EBBA 1YR9A 4K3UA 4YHHB 3O26A 1GD1O 5AVSA 1UJBA 1WU7A 3WS7A 4ETMA 2QTCA 3IRVA 2Q0QA 1E1RD 1SQ5A 4GMDA 3PDJA 3V2UA 1E9BA 3MAAC 4QTXA 3T1QA 4WZBA 3IC5A 3ZHTA 2H5EA 1AS2A 4ARCA 5J2TA 2XXBA 4F5YA 2JD0A 4QEDA 1YQEA 5CNMA 3VC1A 7REQA 2JDIA 2M6RA 2O0JA 1X70A 3O2NA 5L7WA 4PRZA 1C5KA 1E9SA 4J1SA 3SFVA 2H2HA 4MWTA 1HURA 3VYVA 1RQXA 5C1PA 3JAMA 2ISSD 3HUEA 2O1SA 2PNJA 3FYCA 5K0CA 1UUFA 2OB1A 3UOGA 3FR8A 2G83A 3DBRA 2PZGA 3NTVA 5KWIA 3T7SA 5BN4A 1P0IA 3WK9A 3PL5A 3FCSB 1TZCA 5A5FA 3VPGA 2PGIA 3WYNA 3OE7A 4O4IA 4Y1RA 5BRNA 2O2EA 3WL5A 1FU4A 3X1WA 4LIPD 1DO8A 4LXXA 1J9GA 3JR7A 4J49A 1GU7A 2DR3A 3FPCA 1LSJA 3HRHA 1DBVO 1GGMA 2V54A 5AXAA 1G18A 1CUSA 2P1DA 3TSYA 4C5CA 3VSAA 3BCRA 4GLBA 2H1OA 2N1MA 3ONWA 3VPCA 2GJ4A 2KLBA 5C37A 4OB7A 2HRCA 1PD0A 2QXYA 5P8WA 1O5OA 2B98A 2ILTA 2RHRA 3OSUA 1XLTA 3GH3A 4NR0A 1GZ3A 3QSYA 1XTVA 1ZWLA 1YOVA 3MMXA 5IABA 2FPGB 2P9TA 4BGIA 4CU5A 5IXSA 3BB1A 2JGNA 1GL7A 4XSGA 1Q3KA 1K8RA 2ZUWA 3WJ7A 4YGXB 4JGIA 5EXDA 1W5TA 5GONB 5ADUS 3ZR4B 2YY6A 1UM9B 2VVTA 2I54A 3O8NA 2I6XA 5AUOB 5CH3A 1C50A 1Z34A 1CQPA 2AIRA 2Q9BA 2WWTA 2AZ4A 1T1EA 2JLSA 2WVJA 2JI7A 1L7NA 3C8DA 1ZHHA 2ZRJA 1N6NA 1SC3A 2GB4A 3DE5X 3TIXB 4AG5A 3GEIA 5DFAA 3RVKA 4Y2HA 5IKEA 2EJCA 4PINA 3I4FA 2BHSA 1QRRA 1TQ4A 1RD4A 2QTZA 2VXBA 3GJQA 3AKCA 3CR7A 3H8SA 4IX1A 4UE6A 2IYEA 2I4TA 8OHMA 3H6GA 4TL8A 2O7RA 4NXMB 1P1IA 4ZK2A 4D6PA 3QX9A 5JNTA 1VIAA 4MYRA 3FSEA 4V24A 3IMGA 1UBCA 3W1WA 5J4LA 3AMVA 1WE2A 4DV3B 1EFTA 4MB0A 5TXGA 4Q1EA 1OHHD 3D3JA 3VNSA 2X22A 3DTVD 3QMMA 1YZTA 2A5FA 1C2TA 2DTXA 3LUDA 2Q4OA 4R2IA 4UZFA 4ZOAA 5DVZA 3GDHA 1C7JA 3NUZA 1ICIA 2V7WA 3PNMA 1IM2A 4LQ4A 3N7TA 3FJYA 2WLTA 1X87A 3G5TA 4PSDA 4G1VA 4DA8A 4URXR 5JEEA 1V3TA 4UOZA 4XDHA 3BORA 4J0JA 2QORA 3SJBA 1QVWA 4JOCA 4XB1A 4RPHA 5IX8A 3LZCA 1GTRA 4E03A 1AKQA 1W29A 2W90A 3K6SB 4I9NA 5DLPA 1RKUA 3AR5A 4DSZA 1TT5B 4KZKA 4EY5A 2H1LA 4MS3A 1YRQA 4J9VA 2VYQA 4U8HA 2X7JA 4D26A 2Q0XA 3EXHB 4F4HA 4BNLA 4GBJA 4JCOA 1XRPA 1Y89A 1O5TA 2IOFK 2WZBA 2YL2A 2FSUA 3C5CA 3H1BA 2LIPA 3QEMB 4MUEA 4NMLA 4YV2A 3I3SR 1V41E 2G63A 4OP2A 4MV9A 3V8EA 3NRCA 1QX4A 1T5BA 3DLHA 2CNLA 1O89A 1NLUA 3VR4D 1MQAA 5AM5A 3CB2A 4AD8A 4I99A 1L7EA 3HBAA 1GWNA 2XBUA 2OO7A 3OH8A 4G0YA 4MAFA 1UJ5A 4B34A 4EARA 5K6AC 1LFDB 2VYND 3HCEA 2JLRA 1ZK0A 2R6JA 5HM8A 4FHGA 1RYFA 3J80A 3PQ6A 4WOKA 4ETIA 1LK0A 2P40A 3N5KA 5EEHA 4CL2A 3RVOA 4LTMA 1THZA 4ML3A 4NCKA 1EVYA 1WF6A 3KRTA 3EIFA 3A6FA 4WGFA 4UXJA 3WKCA 3V8VA 1TMGE 5JARA 5CK4A 3BJEA 1CUIA 1CR4A 4KX5A 1OYVA 5KTKA 1XPJA 4JUAA 2HLDA 3VU1A 1QB8A 5BV7A 4FC7A 3DBIA 1YQGA 5IHXA