2UVDA

The crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
b'MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
publication title Crystal Structure of a 3-Oxoacyl-(Acylcarrier Protein) Reductase (Ba3989) from Bacillus Anthracis at 2.4-A Resolution.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 90
structure length 246
sequence length 246
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2uvdA00
3WICA 5ILOA 3I83A 4FCCA 4F45A 4BO7A 3EMKA 2HDHA 3H5RA 3OMLA 2X9NA 2LDXA 1IY8A 2YFQA 1ZW1A 2GNAA 1I2BA 2Y99A 2ZK7A 1XKQA 3HE3A 1DHRA 4AJEA 1JU9A 4NHEA 5TJ9A 1LLQA 4RGBA 3DAFA 4RLHA 1HDYA 2HRZA 3RFVA 4MO2A 4XKJA 2Q4EA 1O9BA 3ULKA 1I24A 1T2CA 3GA0A 4KDEA 4A0SA 1M66A 4CUJA 1DO8A 1ISIA 2RBEA 3NAQA 4OH1A 2A9FA 5JY6A 1ZJZA 5T64A 1K89A 1RYEA 4BNUA 4A7PA 4RLSA 3B70A 3UGKA 1PL6A 2DTDA 2QX7A 4QEDA 4XYMA 1P45A 1ADBA 4FQ8A 4OSOA 1P31A 1ZMOA 1FDUA 2NNLD 1PJLA 3GAFA 3QE3A 3GVIA 1VI2A 5JFOA 1E7RA 2QYTA 2ZJ1A 4WK6A 2GLXA 5A1TA 1I3LA 4YAEA 1AXEA 5BSEA 3PGJA 4WNIA 5IN5A 3S55A 2EERA 3X2FA 4D43A 4GKVA 3COSA 1TT5A 3EC7A 4OXYA 3VZSA 1DPGA 3C1TA 5L40A 3I9JA 1NX6A 2PD4A 4YAGA 3RCBA 4BOYA 4WLVA 3K5PA 3TJRA 3L6OO 3AI3A 1Y8QA 3TL3A 5CAEA 3GFGA 1ZSYA 1DIAA 1NR7A 2FRDA 2AA3A 1OC2A 3WGZA 1SOVA 2JFHA 4HKTA 2AXQA 4IGEA 4CLOA 3GEMA 1X7DA 2OBYA 1AHIA 1X1TA 4EJ6A 1KEUA 1A7AA 4W6ZA 4BB6A 4RO0A 2PGJA 5L51A 4RPLA 3GNSA 3ZI0A 2HLPA 2Q1TA 5DOVA 1U9JA 3E03A 2G17A 3VVBA 2ZTLA 4WGGA 3D4OA 3CZRA 2VHXA 2E6UX 4L0QA 3ZNNA 4WNCA 3VH1A 2YHIB 3IOYA 1O5IA 4OMUA 3KO8A 1ULUA 2X0NA 2CVOA 5DN9A 4D0RA 2YHUA 1RJWA 1T2FA 2X58A 1C1DB 3QWBA 2AHRA 3ZWNA 1NAHA 3W8DA 1GR0A 3V5NA 4MP3A 3ZV5A 4CM5A 1TLTA 3JQ8A 3U4DA 1BWSA 4GSKA 2NVBA 1I3KA 3GMSA 4WECA 3MJTA 2YQ5A 2FN7A 1B2LA 2Q2WA 3D64A 4AJOA 2NU7A 1EDOA 4JJIA 3ZW8A 3BIOA 3NV9A 3RUFA 4JN6B 1ARZA 5T6BA 1IE3A 3K73O 1M2WA 1W4ZA 1GV1A 3KEQA 1Z45A 3WFIA 4BO2A 1XG5A 2UDPA 3M2TA 3P7MA 4GL4A 3CUKA 3ENKA 5JAIA 4D44A 3D0OA 5IZCC 2X22A 1TT7A 4EYEA 4MVJI 3RC2A 1YRLA 4J7CA 5KJCA 3IQDB 5DBFA 3H9EO 1X0XA 2VT2A 4CM6A 1ZK2A 1KVUA 3RFXA 1P1FA 1XCBA 3C85A 5THKA 1FK8A 4QTZA 3GY0A 3OEYA 3OQ6A 4XEHA 1IZ9A 3MJSA 4XB2A 3W6ZA 1HETA 1DC4A 4GX1A 3WXBA 5JDCA 1MLDA 3HN7A 4UUPA 1MP0A 4PLPA 1BXGA 1N9GB 4E13A 3MWDB 3DBHB 3NTRA 4ZRMA 5EQDA 5AXDA 3ZHXA 5ENDA 4FN4A 1C1XB 1ZFNA 2P2SA 3JCZA 3FHLA 4GAEA 3PZBA 2HK9A 3SVTA 3ZW9A 2J5RA 5JDIC 3BMQA 1GQ2A 4FJ2A 4QFCA 4BNNA 2O3QA 1FDVA 1ENPA 5K6AC 3VC7A 4LMRA 1ZIDA 3H9JA 5G0UA 1GCOA 1H0KA 5AXBA 3SLGA 1VKNA 1DBVO 3DC2A 4L9RA 1LDNA 3BHIA 4KQXA 4ZQGA 4QO8A 3CE6A 3N58A 3AY3A 4ALIA 3F9IA 4O0LA 5IFLA 1UDCA 3OA0A 3PFWO 3AOEA 1PGPA 3KVOA 2X7HA 2GRAA 1CYDA 2BGMA 3FWNA 3GN1A 5L3ZA 2H5LA 4PLZA 2WD8A 2PK3A 4N7RA 2GF2A 4I5EA 1WAMA 4PFJA 5J23A 1R4NB 1Z6ZA 3KSUA 3C7CB 1GTMA 4HFJA 2JAPA 2WYVA 4YRDA 2EJWA 2VRCD 2BFMA 3JV7A 4OSPA 5TIIA 2I67A 4B7CA 4RJTA 2X8LA 5IJZA 1ONPA 1H6CA 1SO8A 2QW8A 4YJFB 1NXQA 3HFSA 1E1MA 3O8QB 4EITA 3D4NA 5BSFA 1PJQA 4MIOA 1RM5A 4NH4A 4R54A 5DP1A 3LF2A 1QYDA 3IMFA 3U4IA 3ZWYA 5IDXA 2OXIA 1YDWA 1VL6A 4CM8A 5H82A 1LNQA 5L95A 1C0IA 4DTIA 3UXYA 3G79A 4LCJA 1HDXA 4N5NA 3RJ5A 2J3IA 4J2OA 3HZZA 3V1TC 3NX4A 5F5LA 1HYHA 4W9NA 1EVZA 3SBOA 4F3YA 2GZ2A 4Q9NA 4DPLA 5KIAA 5KJ1A 1E5QA 4E12A 2GERA 2Q50A 1UXGA 3G3EA 3CSDA 5KKCA 4YT8A 4QUKA 2IYOA 2Q1WA 3BMOA 5CEEA 2C20A 2GN6A 1QYVA 4UAGA 4CQLA 4PG5A 1E3JA 3I23A 2WMDA 5I9LA 3FN4A 4BNGA 1NHGA 3DXFA 4CLHA 3E9MA 2GUGA 3HWRA 3H5NA 2A4KA 1NFQA 2FP4A 4IUYA 3GAZA 3ZV3A 4CV2A 2CY0A 4Z0TA 5K9ZA 4L8VA 4YTEA 1NHWA 4OQZA 4NR0A 1PZFA 5ES3A 3IUSA 3DBVO 3L4BC 4YWJA 1Z7EA 3TZCA 4YR9A 5JO0A 1WPQA 3NEPX 5JW6A 1XELA 5G0SA 4EZBA 2WTBA 4PVDA 3C3XA 4YJHB 2X86A 4CM3A 3PLRA 4CMKA 4OJNA 4CMJA 3TOZA 4UEOA 4XD2A 1J4AA 1XDWA 1B8PA 3AFNA 3NT2A 4UULA 3VHRA 4IS3A 1UXKA 2Y1OA 4WEQA 1U4OA 4CL3A 3WDSA 4FIZA 3JQGA 1SEVA 4YCAA 2C7GA 3AU8A 2VT3A 3INGA 2IODA 3D7LA 3L6DA 4J1SA 4NK5A 4J7XA 2IZ1A 4LSWA 5ITVA 2JKVA 4BNLA 3K2EA 4XR9A 3WGGA 5C37A 1G1AA 5LDHA 1ONOA 3I1JA 4BKQA 3D3WB 2OHXA 1OAAA 1Y6JA 3CXRA 4D46A 4Y9DA 4AJPA 4DLBA 4BO3A 3GDFA 1B14A 3C1AA 4XJSA 3W8EA 5HTOA 4IPTA 2FSVA 4WEOA 1GYQA 3DFUA 3ST7A 4FPXA 5THQA 1M75A 3F46A 1JKJA 2X0JA 3JD2A 2B83A 3GR6A 1E3WA 4M89A 1SCUA 3QVSA 4AG3A 4TWRA 1Q7GA 2X0IA 1I3NA 2Y67A 4CQMB 4E3ZA 4K6CA 1T1RA 4LRTB 4G81A 4XGIA 1H2HA 3GRPA 4BO5A 3V8BA 3UOGA 4JGBA 4NJMB 4XYBA 4GGOA 4FFOA 1LRLA 3KB6A 1YOVA 1VL0A 3NKLA 4JX8A 4UUOA 4IZIA 1P0FA 1A72A 4HUJA 4TQGA 2C29D 4Z0HO 4ZVVA 3WTCA 1HE3A 4E32A 1E7MA 4PLVA 4ALMA 3GH3A 3F47A 3A4VA 3IS3A 2V65A 5U1PA 4U5QA 1IZ0A 4BNIA 3T4XA 3IDSA 3VDQA 1NPTO 1NQOA 4ROSA 2X6TA 2AMFA 3UF0A 1C3VA 4L73A 3VPFA 4PLHA 1DJNA 1XWFA 4DMLA 2FR0A 2DFVA 3OF2A 1HF3A 2BFAA 2X9VA 2P4QA 2HAEA 2HMWA 3M1AA 1BSVA 4PLCA 1XHLA 3QRWA 1E1KA 3DL2A 1HDGO 2VHWA 3GK3A 2QQ5A 4ZU3A 5G4LA 1BXZA 1K0UA 3RASA 2JCYA 4RV9A 2J3JA 3IKVA 1EE9A 3CZMA 1EQUA 1HKUA 1ZNQO 4O6VA 2YV2A 3WNVA 2O2YA 1UXJA 4E5KA 1E5LA 3UW3A 5IXYA 3NT4A 1HLDA 5CHEA 3PGXA 4PG7A 2PZJA 3BMCB 3HNPA 4GI2A 3ON5A 3K2BA 3GN2A 3RUAA 4R5HA 4BNKA 3NDJA 1AGNA 4MVJM 1C14A 2X23A 4JBIA 1YE3A 1B7GO 1P1IA 2DC1A 3KYCA 4JJGA 4I5FA 4O5OA 3STHA 3MOIA 1PZEA 2PZMA 4G5HA 4P38A 1N2SA 3RROA 2NVUA 3D5QA 4CMHA 3FNHA 2AE2A 2B36A 1GCUA 1G6KA 5B4VA 2UUPA 3ZU5A 2GGSA 1SB8A 4EGFA 4MVJP 1S6YA 1YJ8A 3O9ZA 3WYCA 3OSUA 1RKXA 1GPJA 1YQXA 2POQX 2DPGA 1N7HA 4ND4A 4NJOA 5ADHA 1YBMA 1MV8A 4R01A 2ZB7A 1E0DA 2OORA 5JXWA 4WLEA 4U6SA 2YQ4A 3VDRA 3KM0A 1ONNA 1GZ3A 4TZTA 1XQ1A 1SOWA 5L4NA 3VTFA 1EDZA 5AOVA 2EG9A 4M86A 3WGQA 2Y1CA 3JYOA 3PLNA 4MINA 3E18A 4XA8A 1JQBA 3UH1A 3IP3A 3PJDA 5BT9A 2NUAA 3EK2A 3IUPA 1LSJA 4Y67A 2BMAA 1YBVA 3RI3A 3QP9A 3ZH2A 5JS6A 1QMGA 4BKRA 3WMWA 1QP8A 2NWQA 3F4LA 5AXCA 4CM8B 4DYVA 3EAGA 2B0JA 1LI4A 5F21A 5A06A 4NBUA 3DZHA 2J5KA 2XXBA 2TMDA 3AJRA 3H65A 1KERA 4RF5A 4TSKA 3PEFA 5TJHA 2Z1NA 3GDOA 3BHMA 2ZB3A 5JBIA 3TN7A 1BW9A 2WE7A 3JQ9C 3VH3A 1TI7A 3RAJA 3FSRA 4JIGA 1VRWA 4FJ1A 4I9HA 3AUTA 3GGGA 2O7QA 1D1TA 4FD3A 4GKBA 4GSLA 3DBLA 4BVAA 4MIEA 2C0CA 1NPDA 2LDBA 4DXHA 1K2WA 3DAGA 5EINA 1YB5A 3GUCA 2I66A 3CINA 5F1PA 1YVEI 3ITKA 8LDHA 5TLSA 2A94A 3ZV6A 2AQKA 3QIVA 2BGLA 1R0SA 2FSSA 2RH4A 3EDMA 3PRJA 3V2UA 4ZHSA 3ICCA 4XIYA 3UCFA 4AJLA 4DQUA 2I65A 3VZPA 3S2GA 1B3BA 2UAGA 5DDIP 1TT5B 4J1NA 1E3IA 5JE8A 3T4EA 3FF4A 3QSGA 2FMUA 4Q3EA 2JCXA 3PQDA 4RF4A 3NTQA 3ANNA 1JAYA 2JAHA 2VWGA 4D3SA 5B12A 3FNEA 3GLQA 3ORFA 1R12A 1U2GA 4XZ3A 2FWMX 4WOKA 4XRRA 2OBNA 1SAYA 3I9OA 5CP8A 5TSDA 5AVOA 1LLUA 4R3NA 2Y0CA 3P19A 5JCJA 1T26A 4BKUA 1UDBA 3M1LA 2V6GA 2OL4A 1G0OA 4XR4A 4E30A 1WNTA 2F00A 3GHHA 3IC5A 1I32A 1Y8RB 1T24A 3JQDA 2NQ8A 3ASVA 3RUCA 4IY1A 5F3RA 4NBWA 1WDMA 3AOGA 3K92A 4MPDA 2XAAA 4AJKA 2X5OA 1MB4A 2C54A 1C0LA 4LRSB 3JQAA 4M55A 3I6QA 2X9GA 2XXJA 4DL9A 5JAQA 1KVQA 3WG9A 1L7DA 4KUEA 1WLYA 5A5EA 4AJJA 1UZLA 4HXYA 5ICMA 1N1GA 5HBRA 2VOEA 5EN4A 4OKNA 3QLJA 2EW8A 3W8FA 4XX0A 1U5CA 2X5KO 1TXGA 3JQ8B 2P68A 1Q0QA 1AUPA 1DIGA 2QHXA 1PU2A 1AHHA 3QVTA 3FI9A 4JLWA 4G2NA 1PIWA 8ADHA 4AICA 2PKRA 3PHLA 2B4TO 1J49A 3AFMA 1OI7A 3JQ7A 4XQ9A 4BO6A 2YZ7A 2AW5A 3RFTA 4BL5A 4RF2A 1H9AA 2Y66A 3CTMA 3RC7A 3ZWOA 4GWGA 4CV1A 3OJEA 3JYPA 4A03A 4BNTA 1NM5A 2FR1A 1EBFA 3VZQA 4B3HA 1H9BA 3WR5A 4XQGA 2W2LA 1A9YA 1IOLA 3IP1A 1GUFA 3RU7A 3ZZNA 1M6HA 1TVEA 3NGLA 4XJTA 3F4BA 4E4YA 1WVGA 3C24A 4BUCA 1J5PA 3Q0EA 3QVOA 2DM6A 4MP8A 4GX2A 4BNJA 1WDLA 2DPHA 1DEHA 1HE4A 5CEFA 1LC0A 3C8MA 1YWGO 1Z7BA 3D5TA 4PLFA 4KDFA 4CLRA 1BXGB 4Z6KA 1R15A 4BIIA 4S3MA 4YEDA 5JSFA 1ADGA 4J4TA 4DIOA 1NNUA 3HJAA 3ONEA 4RVUA 4FC6A 2PFGA 3VOSA 4D41A 5B4UA 4K6FA 4IXWA 4JBHA 4EJMA 2NLOA 5KNLA 4LSMA 3DMYA 3DOJA 1KYQA 3BMQB 3DFZA 3Q2IA 4A5OA 4DQVA 1OOEA 4FOOA 1WP4A 4IDDA 5DT9A 2ZB8A 3WQQA 1D8AA 4AJIA 2Y1EA 3Q1LA 1E1LA 1LXCA 5DULA 4BQRA 3MJEA 3V2HA 3LC1O 2I76A 3PYLA 1X14A 4TRRA 4Y6RA 3DWFA 3IL2A 1KS9A 2O4CA 1VC2A 3CPSA 3LK7A 3PHHA 4B79A 2EKQA 5BNFA 3PWKA 1BHSA 4EUFA 3P2YA 2CMDA 4ILKA 1IL0A 1DRUA 4K26A 2VYND 1CIVA 3A28A 1SZJG 2Y1DA 1YO6A 3JQBA 4I5GA 2D59A 3VKVA 3S8MA 4EEZA 3M2PA 2YDYA 3QVXA 3QQPA 4HFRA 2PZKA 5DNAA 1ZBQA 1LDBA 1ZO8A 4IQ8A 1B15A 3DR3A 3I5MA 1A71A 3DTYA 1P77A 1YJQA 1EEHA 1ID1A 1K3TA 1YKFA 3RUDA 1NQTA 2HO5A 5I7FA 3LT0A 5TF4A 1U7TA 1Y9AA 1OFGA 2J8ZA 2JD2A 1ZK4A 4OKIA 1U8XX 1DIBA 3ANLA 3O03A 3PIIA 3ABIA 2NTJA 2V6FA 5LC1A 4BV9A 3PIDA 3DZJA 2V6MA 1T2DA 4XWYA 3P5SA 3NTOA 5HWSA 3FTPA 3RQSA 1BDBA 3INTA 4K1LA 4MKRA 1CQJA 3LYLA 2H6EA 4TKLA 2DVMA 4E33A 1Y1PA 2NM0A 3I9MA 4NFYA 3ETGA 1P3DA 1DRWA 3PJGA 5IAAA 2R00A 1PGOA 2SCUA 4CMEA 4CV0A 2IE0A 5KCZA 3FPCA 1O0SA 2O3UA 1Z75A 1CEQA 2UUOA 3BMOB 4D79A 3PVZA 1J6UA 3ROQA 3R3JA 5FI3A 4CQLB 4R41A 4MKXA 1HLPA 3AI1A 1ZMTA 4M1QA 4I5DA 1KVTA 1LC3A 1Y5RA 2H63A 3OM9A 1EK6A 4FFPA 4ZQHA 3KUXA 3DZKA 2AG8A 2ILTA 3FNGA 4TKMA 1ISGA 3FRJA 4WUVA 3WYBA 2A35A 3GMDA 2GPTA 5EL0A 4IIVA 3KLPX 1LLCA 3NJ8A 4IBOA 4JP3A 4PVCA 3ICPA 1LRJA 1RM3A 1ZSNA 3VH4A 4DC1A 3WQSB 4J6FA 1UXIA 2VRBA 2Y68A 4PZEA 5L4SA 1NQAO 5GMOA 1W73A 1E7SA 4FBGA 3G1TA 1DHTA 1DSSG 1LQUA 2BI8A 4F46A 3KRTA 3HN2A 1CETA 5JY1A 4E5PA 5A3VA 4BNFA 1BRMA 3EVNA 4H16A 4IZHA 4KUHA 5FYDA 4O63O 4Z9FA 5JYEA 5T8KC 1T4DA 3IJRA 4CQMA 2PR2A 1KEPA 4KTVE 5CEJA 3K31A 1HDZA 2JD1A 3GF4A 3NDIA 1VLLA 1TEHA 3AU9A 4CR8A 3JQGB 1QR6A 1E1NA 5A05A 2X4GA 5KVQA 4IDBA 5JAZA 1CF2O 2CUKA 2P9EA 2QG4A 2PH3A 2VWHA 1QSGA 1DAPA 5JNLA 4ALJA 4JROA 3DAPA 2B4QA 3B1FA 3OA2A 5KOIA 1N1EA 2VWQA 3V1YA 4AVYA 2NU9A 1EVYA 4ESOA 3JQFC 3TPCA 3JD4A 4DBZA 2NACA 4XGNA 1DAOA 4A27A 5A9TA 4IDGA 1P1RA 1PJ4A 4L76A 2VNAA 2NQTA 3OETA 1FDTA 1GUZA 2C2XA 4OXNA 4YJGB 5TC4A 1DC6A 4CLXA 1VM6A 2OUIA 4RVHA 4DGSA 4DC0A 3ZWBA 4IQ0A 1N5DA 4BKOA 3H2SA 4DPKA 7ADHA 5HRUA 3AUAA 1PS0A 3GT0A 1AXGA 3GG9A 4HP8A 4PG8A 2I5PO 4KTTE 1I3MA 4NFHA 1FDWA 4JK3A 3CH6A 3D3EA 1GEEA 3N7UA 1B16A 3RVDA 2AE1A 5JMPA 4MVJE 2HU2A 3I9NA 2O2SA 4LK3A 1A5ZA 1JA9A 4HV4A 1KC3A 1KBZA 2DBVO 2HK8A 3FNFA 4Q3AA 4RPHA 1X13A 1A9ZA 4RPKA 2JFGA 4R1SA 3DZIA 1E3LA 1QKIA 1YH3A 2GYYA 3DMTC 5KVSA 1ISHA 4NQZA 1UH5A 2ZQYA 1LUAA 1PZHA 2OOSA 1B26A 1QYCA 2GCGA 3PYXA 5JYDA 4Y6SA 3A14A 2EKPA 3A06A 4YT5A 4IJVA 3AM4A 3TOXA 2O7SA 5IZCA 2NTVA 2YHIA 1EK5A 1ULSA 1R4MA 1PJ2A 5TGDA 3FTNA 2DBRA 3OBBA 1JKIA 1PJSA 2P9GA 2VUTA 3WGTA 3WLEA 1W8DA 4R1TA 4BGEA 4BO4A 5C7LO 5IDQA 1DLIA 1NPYA 3OEWA 3GVHA 1C1DA 1MG5A 2OGUA 1IYZA 1ZXLA 4LW8A 4JNKA 3PYMA 1NR1A 1Q2XA 3I9KA 3ONDA 4U7WA 3KYBA 5JO9A 3SXPA 4YPOA 2Q1SA 3F1LA 4W4TA 3AUUA 1IHXA 3WIDA 1M67A 5BQFA 2ZCUA 3G17A 5COAA 3CKYA 2Q49A 4AFNA 2FPGA 4ZD6A 2WD7B 1RYDA 3DBRB 4DQXA 2X1HA 5JDIA 4HWKA 1JWBB 1N7GA 2W2KB 4FFLA 4GX0A 5K6AA 4KZPA 1GAEO 4FJ0A 4DWVA 1DXYA 4K9DA 4AJHA 3TFQA 4RVSA 2HMUA 4F6LA 2Y05A 3KSZO 2RHRA 3AWDA 4D0SA 1JKFA 2ZYGA 5DF1A 3HDHA 2WM3A 4L4SA 3DZFA 3WB9A 3E6AA 3GG2A 2NADA 3GUYA 4U0JA 1U28A 1R6DA 2BD0A 4MP6A 1NTOA 4WCDA 5TQVA 3JTMA 1DIHA 4WLUA 5CDUA 1GYPA 1GQYA 4B3JA 2IXBA 5B1YA 3BZUA 4D3DA 1NVMB 4PGFA 1P9LA 3LQFA 1PTJA 2EW2A 3VH2A 5COQA 4WOJA 1PEDA 4ND5A 3CMCO 2J3HA 4NU6A 4MVJD 3I3OA 3ZU2A 1UXHA 1N9GA 3JYQA 1EBUA 4R3WA 3DBHA 3GVXA 3JYLA 2CVZA 5L53A 1C1XA 1Q7BA 3W6UA 2O3RA 1VJTA 1W0CA 1RPNA 2PV7A 4J1QA 4A10A 1TA4A 3LDHA 4EI2A 1NQ5A 3H7AA 4W7IA 1A4IA 4YA6A 1H2BA 2DT5A 1F14A 3JD3A 3WGYA 5A5FA 1BVUA 3ASUA 2NVWA 1FMCA 2ZQZA 1ORRA 3C7DB 4EUHA 3LSYA 2OZPA 4B4OA 7MDHA 1HSOA 3RD5A 1I2CA 2JD0A 4CM4B 1GEGA 4H7PA 1MC4A 3S2EA 1ZJYA 3ZHYA 4HNHA 4Y98A 2EKLA 2I9PA 3OH8A 3KXDA 3W1VA 1CQIA 1V0JA 4OXKA 3PJEA 5A9SB 3RBVA 1F17A 4CM9A 1BW9B 4I9NA 2FR8A 3LT2A 4ZJUA 4R4JA 3L9XA 4RQTA 3AI2A 4BV8A 3E82A 1HYGA 4DVJA 1PWXA 1R4NA 1NAIA 5KWEA 3DBLB 3ZNPA 4FR5A 4RDHA 5K0ZA 2QYSA 3I4FA 4IIUA 3JQAD 2QZZA 4IS2A 4NG5A 4UUMA 4OIMA 2BF7A 3H6KA 4CLDA 2DLDA 4NPCA 4E0BA 3O26A 1GV0A 2I6TA 4BO9A 1JTVA 3MOGA 3BYZA 4IXTA 4Z9YA 3ZNOA 3O8QA 5IF3A 1LLDA 5TS3A 1L7EA 3OIGA 5I8WA 1NFRA 2A92A 5H81A 1XIVA 3ETEA 1O89A 3OQ1A 4UVHA 3PWZA 3BTVA 2JFFA 5DCWA 1XLTA 3RUEA 1GD1O 4B4VA 1XA0A 3DOCA 3L4BA 4A73A 1U3VA 3ADOA 4RVDA 3U49A 4RF3A 3TZKA 3RUIA 4DYDA 3MWEB 3ETDA 4UUNA 1U3WA 2AQHA 4NU5A 1CWUA 5I9MA 1R66A 2B5VA 2QRLA 4MVJH 5C5IA 1ZK3A 4RVFA 1C0KA 2Y0EA 3X2EA 3LVFO 2O48X 3MCVA 1B3RA 1DLJA 4Q3BA 3HADA 4B7UA 1JVSA 4AJ4A 4XDZA 5U4QA 3GHYA 1I0ZA 1O6ZA 1Z82A 2R6JA 3INRA 4WCFB 1HE5A 1IPFA 1GY8A 3DHYA 3UKOA 3RBZA 2DTXA 3RUHA 3JQAB 3GPDG 2DBZA 1DIRA 4I08A 2E49A 2VCYA 1A4UA 2Q46A 4FSHA 3QV1A 4R1NA 4YVFA 4D42A 4R69A 4EUEA 4B3IA 5JPIA 2W4QA 2O3SA 3GGPA 3PWSA 4LGVA 4NZ9A 3I52A 3I6IA 2PGLA 1CDOA 1MA0A 4P4GA 1E7QA 2C7VA 3DQPA 1K6JA 4I8XA 3ZWCA 4CMIB 3RBXA 3VTZA 1A27A 1KIFA 1PQPA 4Q3NA 3GOHA 5T5QA 1LA2A 1XQ6A 2DKNA 2GASA 5FEUA 3UFXA 5L4LA 1Q7CA 2PH5A 3TL2A 5JCXA 2VHYA 3KV3O 1S7CA 2YDXA 3O38A 1BGVA 1PJ3A 4CODB 1LDGA 5DCUA 5CDSA 5HS4A 4BNMA 2YUTA 4LMPA 1KC1A 4ALNA 3ZWMA 4N18A 1LTHR 3H5AA 1LQTA 3FPLA 4FFNA 2GR9A 3TWOA 1GUYA 4WCFC 1PR9A 4YRBA 2ZCVA 3ONFA 2I3AA 2D4AA 3P2OA 4J4HA 4CJXA 5GZ3A 4M49A 4E6PA 1I33A 2G5CA 1QYXA 1ML3A 5LDGA 4J9VA 4BO0A 2VWPA 4KOAA 1E92A 1PWZA 4UEKA 3EZYA 2QRJA 2WE8A 5CDYA 1PQWA 4J43A 4J1TA 1HDCA 4ID9A 4IDCA 3JQ6A 2Y1GA 1P33A 1GADO 2VYVA 2YY7A 1M6WA 4D45A 2C2YA 5G0TA 2J6IA 2Q4BA 1DB3A 5A03A 3BMNA 2VUSA 3PQEA 3RC9A 3VAZA 4LCEA 4W7HA 5KVCA 1LJ8A 3QJ5A 3BHJA 3PHGA 2YYYA 2B4RO 3ZNQA 2BGKA 4NJMA 1CJCA 3EYWA 4CUZA 4IGFA 2GZ3A 2HKIA 3GEGA 1HDRA 1NWHA 4DUPA 2UVDA 1AN9A 1AE1A 1GL3A 1PGNA 2XOXA 4IJWA 1LSUA 1QG6A 4IDEA 3V2GA 1ZKMA 2GO1A 3JD0A 2NU8A 2ZTUA 3KBOA 1D1SA 2IRWA 3OJLA 2D0IA 2Q45A 4NDNE 1PJCA 4LISA 2O4UX 4EJ0A 2JHFA 1EUZA 1D4FA 3IAHA 2VTDA 4GMGA 1Y8QB 2JHGA 4CPDA 4UVIA 5G0VA 3U09A 1FF9A 3O4RA 1BXKA 1R0LA 3BA1A 5L7YA 4NIMA 4J2HA 1A7KA 4RVGA 1XGKA 4CLOB 3VPXA 4BNWA 4GBJA 4WLFA 3OIDA 1YGYA 2BLLA 3E48A 4BNHA 2ZB4A 5F5NA 2G1UA 2WDZA 4CMCA 3DEYX 2G82A 4TRMA 2DTEA 1V3VA 4ALLA 3IIEA 4FGSA 4GVLA 3ITDA 1H6DA 3BMCA 1WWKA 3EY4A 4PCVA 4QFDA 1PS8A 3GZNA 3MTJA 2NTNA 1XYGA 3NDRA 4E2XA 1LRKA 2IXAA 3L4SO 4J0EA 2Y0DA 4QXMA 3ANMA 4GVXA 3S2IA 3C1OA 1HRDA 2RCYA 4P4NA 5G2OA 6LDHA 4YAKA 4HFNA 3RJ9A 2H9IA 5IXSA 2G76A 2Q1UA 3OJFA 4J16A 4MVJF 3PDUA 3K96A 1U3UA 3PDJA 1MGOA 3TF5A 1Y5MA 3TSCA 2W90A 1V6AA 2CDBA 2D1YA 2BELA 2JL1A 3I9LA 4KUGA 4XCVA 9LDBA 1G0NA 1JVBA 2GN4A 3NJ4A 3PK0A 4PRLA 2XPCA 4TVBA 1QORA 3TDKA 2ZTMA 4R9SA 1DC5A 4GQAA 2IZZA 1RWBA 2CDCA 3PTZA 1HTBA 3B1JA 1IB6A 3Q3CA 4QO7A 3TFOA 1Q0LA 3LZ6A 5EERA 2ZYDA 5ENVA 2PD6A 3JQ9A 3Q9NA 4OM8A 2NU6A 3GQVA 1ISJA 3Q11A 4GWKA 1D3AA 1XU9A 3MJVA 1ZK1A 5MGBA 2ZIZA 3UHAA 2ZATA 5A3JA 1UAGA 1U8FO 3ZHBA 5ER6A 5A9RA 1UAYA 3EUWA 4XGKA 3E9NA 1QLJA 4Q3CA 1DFHA 5KJFA 4RZIA 3HHPA 4W99A 2F1KA 4IMPA 1E6UA 3KOUA 4U0KA 3WWYA 2FOIA 4HY3A 4Q39A 1JW9B 3OIFA 1OC4A 1V35A 5TRTA 2AEJA 3KYDA 2AEMA 4YBZA 4DIBA 3DDNA 3TNLA 4WJZA 1UZMA 4M87A 3WQRA 3LF1A 2RH8A 3SJUA 4B8WA 2QZ9A 2DUWA 3AK4A 2Z95A 4YB8A 5EJ2A 2CF6A 1QYWA 5KVVA 3H2ZA 2B5WA 4FFMA 4DMMA 1PGJA 3RSHA 4HX5A 3UCEA 1O95A 3WS7A 1LSOA 3PHJA 2DU8A 4DLAA 1GZ6A 3L6EA 3GRKA 1LSSA 4F6CA 3JSAA 2HMSA 3JQCA 4Z3KA 2FZEA 5B4TA 5GZ6A 3VVCA 3KTDA 4U6QA 5MDHA 2Q99A 3KEOA 3KZVA 4AJ1A 5JDCC 1T2EA 4CM7A 3FD8A 2CVQA 4OYRA 3M6IA 3WGOA 4BQPA 1ENYA 2FHSA 4B4UA 1KETA 1WDKA 1LDEA 4LVCA 1PS9A 1DC3A 1IHYA 4UREA 2VQ3A 5LCXA 1PJTA 3EHEA 4PG6A 3U4CA 1NWCA 1LEHA 5G4KA 5JMWA 3Q9UA 4YAIA 2NSDA 1GFSA 2Y93A 3MJ4A 4PLYA 2Q3EA 1B8UA 3WFJA 4BMVA 3V1UA 2UYYA 4X54A 1GPDG 3RU9A 3QW2A 1PGQA 3E8XA 4FDAA 4NBRA 4D7AA 3AOEC 3A9WA 3JYNA 1KY4A 1Y8RA 4D3FA 2DFDA 1UZNA 4OAQA 4CV3A 1EQ2A 2EGGA 2EHDA 1H6BA 4YT4A 4Y8VA 5KJEA 3NGXA 4E5NA 3QWHA 1EMDA 4O1MA 2D8AA 1KEWA 3QWAA 3VKUA 1R4MB 4NFSA 3SX2A 4BO1A 1ZEJA 3LLVA 1JDJA 3HSKA 3NT5A 4YDRA 5T57A 2CZCA 2GD1O 4PN3A 2EWMA 3ZWXA 2VN8A 4BHTA 1E6EA 3F5SA 2CF5A 3E5MA 4IJKA 4R51A 1KY5A 4JJFA 3SC4A 1OBFO 4BNXA 1YDEA 4IDAA 4XB1A 2B37A 1DFIA 3KETA 4R5MA 4ND2A 4E31A 3GNQA 3HQ4O 3TQHA 3OECA 1YBAA 2ZKLA 2CDAA 5EIOA 1GQQA 5GZ1A 4L74A 1H94A 5EMHA 3L07A 1ZZEA 4L4RA 4WASA 4BGVA 3U4HA 3EVTA 1Z74A 2QIOA 2DUUA 4P22A 4PLGA 4W9NC 2PKQP 2VHZA 4Z9XA 1PSDA 4KMSA 4ZA2A 4CM9D 4CMGA 3QY9A 1DFGA 3ENNA 4GH5A 1X7HA 3WNQA 2EGHA 5BNIA 2HQ1A 1L1FA 1E3EA 2HRBA 1QRRA 2EF1A 2OMEA 3DZGA 2JJYA 5DP2A 3GGOA 1YQGA 3PZRA 5DZSA 5U9CA 2PY6A 4HFMA 1NFFA 3CMMA 4JXKA 4YACA 1QV7A 3QVWA 1E7YA 2Q2VA 2YFHA 3GVPA 3FBTA 1V9LA 2AQ8A 2BHLA 2VNSA 5L7TA 4BGIA 5L45A 1NP3A 1SEPA 5HS6A 4QECA 2WSBA 3ROMA 5BNTA 5DBIA 3HB4X 4KQWA 4BO8A 2VOJA 1SMKA 1LBEA 4GX5A 3ZWAA 2EXXA 3WWZA 3K6JA 2O3JA 4ONEA 5TT1A 3H4VA 1P0CA 4RPJA 3ZWVA 3H9GA 3ZU4A 3JD1A 4IDFA 4JQCA 4QT0A 3FWZA 2HJRA 3PFFA 5FI5A 5C3MA 2OP0A 5I7EA 5I9NA 2HMVA 1E3WB 3ZHZA 4II3A 4DIFA 1DOHA 5CDGA 4BB5A 2VZ9A 3U9LA 3GPIA 1YL5A 2BI7A 3MZ0A 4GMFA 1P44A 6ADHA 2XF8A 3LC7O 5DBGA 3VPHA 5JAMA 3WGHA 1MG0A 3W4IA 4J7UA 1IULA 2P4HX 1YONA 1WMBA 1FXSA 1Q0HA 3DO5A 1MX3A 4IM7A 2CFCA 3UN1A 1YOVB 4YQYA 4O59O 1LX6A 3H9UA 1K6XA 1HXHA 4N5MA 5BR7A 5H83A 3TZ6A 1PL7A 3ZCXA 1MC5A 4XDYA 2YV3A 4ZQFA 3WBBA 2DAPA 5IDYA 3WOHA 4RQUA 4C7JA 5JC1A 1H93A 2IEDA 5I7SA 4WLNA 5IZ4A 2V7PA 3BTUA 1EUDA 4U8GA 1VKOA 3GVCA 4YRAA 1DDOA 1K5HA 3HUDA 1LU9A 4JCOA 4TMFA 1X0VA 2WYUA 2Z5LA 5AYVA 4DA9A 1Y7TA 2Z1MA 2P5YA 4OO3A 2E4AA 1P1HA 2X5JO 5EQFA 5COBA 5C7OO 3PPIA 1ZCJA 4LN1A 4S1VA 1ISFA 3IKTA 5BSHA 3B20A 3UVEA 4YYZA 1ZK0A 3DTTA 1SC6A 1WW8A 2VUUA 2HK7A 5DOZA 1MUUA 5IN4A 1U4SA 1ZH8A 4OGWA 1SNYA 3UICA 1XSEA 3PP8A 5B37A 2PZLA 3R1IA 1BTOA 1WZIA 5T8KA 3D1LA 1P1JA 3KYCB 3OP4A 3PHIA 1E6WA 4EEXA 2WYWA 3NUGA 2NVUB 3MTGA 4AJ2A 2RIRA 5ICSA 1Z73A 4J0FA 4RCVA 2PD3A 5EPOA 4ITUA 4ALKA 2GDZA 3WBFA 2UV8A 4JP2A 2HUNA 5FFFA 1F12A 1YS4A 2VYNA 4CM1A 4PZDA 1B8VA 2VYVD 5CG1A 3WX0A 3FR7A 2EEZA 1ENZA 3PI7A 2BH9A 2OO5A 4CMBA 3DONA 4BNYA 4H3VA 1XEAA 4Y6PA 3LLSA 2HCTA 3E9QA 3N74A 3C7AA 3G49A 3WYEA 5C7IO 2D5CA 3F6YA 3WGIA 3HDYA 2EIHA 3JQFA 5FF9A 3UCXA 4CLEA 4JBGA 3DHNA 4TVOA 2NV6A 4RORA 3PXXA 4NK4A 1YB1A 4NMHA 1KVSA 5KKAA 5AXAA 3F3SA 4LVUA 1BVRA 3G0OA 2V6BA 1LDYA 2BRUA 2OFPA 5T67A 1ZEMA 3EW7A 3OJ0A 1WXDA 4ZICA 4MIYA 2GSDA 3A1NA 1BG6A 4INAA 2O3TA 2W98A 2I99A 4YT2A 3H9QA 5KTKA 1EE2A 4UVEA 4E2ZA 5CFZA 1UP4A 2GN9A 5JCJD 1PX0A 5A02A 2FZWA 4GLOA 4MJLA 3WSVA 1F8GA 3DMTA 3QHAA 4UVGA 4BS9A 1I01A 4N54A 3U5TA 4C4OA 2GN8A 4J49A 4XQEA 4II2A 4ZQEA 4H15A 3GFBA 4PLTA 1OZAA 1O94A 4DLLA 4E2WA 4OOEA 4L4XA 1U2DA 1UP7A 1IPEA 3WJ7A 4WPGA 3WSWA 1T2AA 4YJGA 1U3TA 3DB2A 2C82A 4XQCA 4P4LA 3BTSA 3DZBA 3I4CA 4ZQBA 3BMNB 2EV9A 4KP7A 4PG4A 5ER9A 2WJPA 2YW9A 1JWAB 1TB4A 3GEDA 2YV1A 3ZN2A 2W8ZA 3Q2KA 4QX6A 3WMXA 1CERA 5L9AA 3MJCA 2B35A 4YJFA 3BXXA 2PTGA 3LU1A 1VSVA 2HSDA 3WJAA 5A04A 4FFRA 2HJSA 1U1IA 1UR5A 2AG5A 4NBVA 4ND3A 3SC6A 5IDWA 1NASA 4R1UA 1E3SA 9LDTA 2CD9A 3AM5A 2BKAA 2P5UA 4FS3A 3OFSA 3ZDFA 2CSUA 1NBOA 1V3TA 4IINA 1Y9EA 1KOLA 3S1LA 4B4WA 4I1IA 4EW6A 4BKPA 1I2ZA 1PZGA 2ET6A 3H3FA 2ZTVA 3HG7A 1ZSVA 4W82A 2PLAA 3U62A 5F1OA 1W6UA 2W2LD 4XYGA 3VPGA 1RM0A 4DRYA 3CEAA 3B1KA 3UUWA 2E82A 1MXHA 4GGPA 1H6AA 3TZQA 2WWRA 3QWIA 1VSUA 3GC6A 3GDGA 3ADPA 4XYLA 1I5RA 2JCVA 2O23A 2J5QA 3E1KA 3ROPA 2GZ1A 4RZHA 3GZNB 1SBYA 1NVGA 4K28A 4IJUA 1PJBA 1T25A 4BNVA 1DJQA 1R0KA 2IEBA 1I10A 4B8ZA 5I7VA 2VRCA 1U7HA 5GY7A 2B69A 1YXMA 2H1SA 5F1KA 5TT0A 1HL3A 4GLLA 4FB5A 1NVTA 1Y81A 1HSZA 5EESA 2WD7A 1ENOA 1Q1NA 3AY6A 3DBRA 4WE3A 2BFOA 2W2KA 1BDMA 2E48A 5BSGA 2ZYAA 1MXFA 1OMOA 1YL6A 3WLFA 2D3TA 5A4DA 4OHUA 1IUKA 4A26A 2WEKA 2R2GA 4YJHA 1DRVA 4L75A 1CRWG 4TRJA 2EP5A 4EDFA 5ILGA 3RIHA 4EBFA 3L77A 5AQ1A 1BMDA 4HBGA 1EZ4A 3RKUA 3JQ7B 1FDSA 1HZJA 1ZVMA 3KHUA 3FCOA 3NYWA 2D5AA 3PJFA 1SB9A 1B0AA 3BAZA 4PIVA 4OOFA 1K6IA 1X7GA 3SJ7A 3RKRA 1GYRA 3TZHA 2C07A 4NI5A 4J90A 2FPPA 4PLWA 4XIJA 1MFPA 2BFPA 3U0BA 3KLMX 1I30A 1QXSA 4UEJA 3ZGYA 3OICA 3ZV4A 4AJNA 4E2YA 4FOSA 4QSMA 3LC2O 3Q6IA 5IG2A 3DOOA 1ADFA 1F06A 1HYEA 1J0XO 1GZ4A 2G0TA 3D3WA 3WIEA 4RL6A 3HB5X 1V8BA 2FY8A 3R0IA 5I8ZA 3QA9A 2TMGA 1JAXA 4IQGA 4ZGWA 1H5QA 4WLOA 5CDTA 5HM8A 3JQEA 3FR8A 2FPIA 4URFA 1UJMA 5TNXA 4CL8A 4M54A 2DBQA 1FJHA 1N8KA 1PR3A 1EVJA 1QV6A 3S2FA 4GPD1 4CLRB 1RM4A 4DBVO 4NNJA 1MFZA 1O8CA 3L0DA 1WZEA 2CNBA 1VL8A 4BNZA 4CM4A 4PZCA 1HT0A 1U5AA 1HEUA 4B7XA 1UUFA 4BMNA 3VZRA 2PWZA 3T7EA 2AQIA 3KYDB 3OJOA 2PA3A 3AM3A 3F1KA 4IMRA 1VE9A 3OQBA 4OQYA 4A2CA 3EZLA 3GNTA 5A9SA 1I8TA 2HMTA 1V3UA 1WMAA 4MKZA 5CG2A 1ADCA 3W4KA 5HA5A 2P91A 3L9WA 1VJ0A 1PL8A 4TRNA 3F5QA 3U3XA 2EJVA 4DREA 4MDHA 3WTBA 1EVIA 4E21A 1F8FA 1NYTA 1T4BA 5ITWA 4KWHA 4RDIA 1XR3A 4PRKA 1XU7A 3RC1A 1X15A 2AEFA 3ZU3A 2E37A 5TX7A 1YB4A 1E77A 2PNFA 2VZ8A 1VJ1A 4ZRNA 4BMSA 4J3FA 1KVRA 4XYEA 4YQZA 4G65A 4MVJA 1T1SA 1F0YA 4QQRA 1D7OA 1VPDA 3ZWPA 3SLKA 4E5MA 1ZXBA 5KJ6A 1GU7A 3LT1A 2IZ0A 1HWYA 4WKGA 4M8SA 4J4BA 2OP1A 3H3JA 4UVDA 4Z3DA 4AL4A 4R9RA 3ZWWA 1JLLA 4J91A 2VTEA 2C5EA 3K8ZA 1E7WA 1N92A 4YJDA 2QRKA 3D4PA 1ZUD1 5G4KB 3G1UA 3R3SA 3OHSX 1R37A 3B6ZA 3CIFA 3QWFA 4HADA 1PQUA 4E5YA 4ZN6A 4CQMD 4N5LA 3EGOA 1GDHA 5DCYA 2IDZA 4TROA 3AY7A 3NRCA 5G0WA 3K30A 4RPGA 3R6DA 3HFGA 4Q3DA 3FBGA 1X1EA 3RWBA 3PQFA 1C0PA 4YAJA 3LT4A 3JQBC 4FW8A 5CPBA 4WCFA 5L7WA 1HDOA 3IJPA 4MOWA 1QLHA 4HNGA 4CR6A 4YXFA 3HDJA 3AW9A 2C59A 4FC7A 2ZJ0A 5JLAA 4OL9A 5CPFA 3H8VA 3MEQA 4CR7A 1EFKA 1KEVA 1P74A 3T7CA 1LDMA 1P1KA 1YQDA 3E5RA 3GZ4A 1JN0A 2Y1FA 3DHEA 1UP6A 3SEFA 2RAFA 5JC8A 2J3KA 2Q2QA 3W4JA 1ISMA 1YL7A 4P8RA 4CMIA 2D2IA 1SPXA 2C5AA 2EP7A 4CUKA 4I9UA 2VZ0A 1HZZA 3KSDO 4KWIA 4FGWA 3VPSA 1UDAA 2I3GA 4ND1A 3K9QO 3UAGA 5FWNA 4NBTA 3BTOA 2PKQO 3HDQA 4R16A 2YJZA 4TZKA 3TRIA 4C7KA 1EUCA 2X0RA 2P9CA 4XRGA 4J9UE 4Z0PA 2O50A 2IYPA 4DPMA 2RHCA 3ROKA 2VHVA 2R00C 4CMEC 4MVJG 4R68A 1HE2A 1I36A 3AUSA 2PGDA 4BGUA 2DQ4A 1EFLA 1R16A 4CMAA 1M76A
chains in the Genus database with same CATH superfamily
2Z3VA 3GRFA 5CBPB 2NYAA 3I83A 2DWCA 4FCCA 3V80A 4HO1X 5K3AA 2Z4RA 1T9GS 1EHCA 2HDHA 4BRZA 1X39A 3OMLA 2X9NA 2CNKA 2LDXA 2PQ0A 2R85A 1VYTA 1ZW1A 1DT5A 1I2BA 1TYBE 3D7SA 1XKQA 4RA9B 1DHRA 2OZKA 3I0NA 4FILA 3VX4A 3FPSA 4I1YA 1USIA 2FLKA 2RGXA 4TOIA 1HDYA 2C78A 3B9RA 4LY6A 3RFVA 3O8BA 4O4JB 3STYA 3HC7A 5HZGA 4H7FA 4XKJA 2QX9A 3VR4H 4UASA 4A82A 1BVHA 4KLRA 4CUJA 1VGVA 5E9JA 2JBAB 1B6RA 2GZMA 4Z9AA 4J03A 1A9PA 1E5XA 3PL1A 4QNMA 4OX9B 2WSMA 2YWCA 5J2UA 3JX9A 5T64A 1K89A 1RYEA 4UD2A 4C6RA 3B70A 3EF0A 1XI2A 3FDZA 1W44A 1AG9A 2P2CA 2QRGA 3NBZC 1NF9A 4GMKA 2Z6UA 4DABA 1V9CA 1GGKA 3I0MA 2C8LA 3ZXIA 1ADBA 4Z8YA 1P31A 2XRYA 1U7UA 2I1WA 3EDYA 3CLKA 3LQ2A 3OOWA 4LRWA 4QBTA 1EPUA 4Q0MA 6NULA 4WK6A 2GLXA 4DA7A 3L0BA 1I3LA 2XRFA 4OVKA 3PGJA 2AD1A 1QQTA 1GTL1 2RAUA 3NWBA 4WNIA 3ZCVA 5LOVF 1SU8A 1VHWA 1PFQA 1TT5A 1QK5A 1VLZA 1LD3A 4QFMA 4OXYA 3HR7A 1RAIA 1Z33A 3C2QA 3G2PA 2RH5A 3CLVA 3EZ6A 3KXPA 4HZUB 3I9JA 4PO9A 4LMBA 2REOA 3HY4A 2MYTA 1TADA 1V6CA 4U00A 5JTUA 2UYCA 1QGZA 3TJRA 2VSNA 1SCKA 4H35A 1W4LA 2PNJA 4D8XA 1TK3A 3B3GA 1R50A 3PDCA 3T54A 1ZSYA 4NJEA 4PU0A 1JH8A 2AA3A 3CPEA 2JFHA 3FUWA 2AXQA 3FDXA 5AK0A 4DEXA 5C8XA 1NUUA 1X7DA 3EULA 2OBYA 2PXXA 4JELA 2GM4A 4EJ6A 4WRRA 2CEKA 3IBCA 1DIOB 4RU1A 4W6ZA 1K7CA 1EUDB 3JATA 4RO0A 4XW2A 5BORA 1KJYA 2G40A 4B34A 5JZMA 4RPLA 3HS3A 3ZI0A 4BRSA 1MRNA 3E3AA 3DPSA 3PTLA 1ZLXA 1JR3A 2L0XA 4MWCA 4QDZA 2ODNA 3B52X 2ZTLA 1JEEA 3H2YA 4WGGA 2O2XA 1LTQA 2GAOA 3CZRA 4LZJA 2VHXA 4HL6A 3R3WA 4HEA1 1Y3AA 2APJA 1ZVQA 2QJWA 1BX0A 1FNBA 1GPAA 3N8KA 4ZVPA 5AK5A 3W90A 3TGPA 4OMUA 3KO8A 4RH1A 1J09A 1LBIA 1T6NA 1JFVA 2X0NA 4D0RA 1ZS9A 2YHUA 3KG2A 1RJWA 1V96A 1Y7HA 2A59A 4JDUA 3A2KA 1IHDA 2JJQA 3FGNA 5E2AA 4DCPA 4G5SA 2WPDD 2C9CA 2Y0PA 1LS6A 1NJ6A 2IOQA 5LWHA 4C30A 4GKKB 4PX3A 4GSKA 1DVRA 2C4MA 2PYDA 2QI9F 1NG1A 2XMSA 1I3KA 3OO0A 4HWSA 4LYDA 3SI7A 5C8ZA 5ES4B 3PLAE 2AZXA 4WECA 1II8A 1P17A 2YQ5A 2R5FA 3GXBA 3UJAA 3D64A 3IVMA 3WB1A 4B3FX 5C80A 1OLXA 1AK2A 3H5OA 3D1VA 3THWA 4KQ2A 2GZAA 4P5DA 5JD5A 3C45A 3FLMA 1ARZA 4JN6B 3K73O 1ZU5A 5C5DA 1KI7A 4B71A 1M2WA 3DVQX 2A9VA 5F98A 2PRKA 2Q3FA 2WFAA 3P7MA 4U7PB 1XROA 3CUKA 3ENKA 2OYRA 3V34A 3T1HB 7ABPA 1KMHB 2GVZC 4MJXA 1KDOA 2CL5A 1TT7A 2H4XA 4ICIA 4XLZA 4EYEA 4MVJI 3HXPA 4J7CA 4IIGA 5KJCA 1FP2A 1XZGA 5DBFA 5JROA 4HDNA 1F8XA 1KVUA 3B82A 4UNIA 1P1FA 4JI2B 3TSWA 1XCBA 4IXNA 3RARA 2UKDA 3G9ZA 3RSZA 3HCWA 1Z18A 4JODA 1W5FA 1PVDA 2PIAA 4XEHA 3HLYA 2P2NA 2VCEA 2WU0A 3MJSA 5KQGA 2FSHA 1U0RA 1HG1A 4KQFA 4IZ6A 5I7AA 5IHPA 3I3SR 1YZQA 2DQSA 2Q5EA 4IOJA 4LDAA 4L0CA 4MULA 4YJ3B 1MLDA 1JSXA 3HN7A 4LF8B 2CW5A 2JAUA 2JFQA 3COVA 3TLMA 4RQBA 3VQTA 2HB6A 4LJ9A 4ZRMA 1XMIA 3JY6A 4RACA 3KTAB 2P2SA 3OKAA 3N5KA 5G3YA 1X92A 2Y3IA 4D56A 2UUAB 3HEMA 5KYWA 4DIUA 4QFCA 2QUKA 4Y0AA 1TTPB 1TIKA 1ZIDA 3WL4A 1T29A 3EG5A 3KPUA 2GPYA 2X42A 3MLEA 1ZOSA 3R7SA 3U19A 1UMDA 4HDMA 4UMFA 2JFYA 3WMEA 1YK0A 1MAHA 4ZQGA 3QFRA 3JWHA 4A16A 1R18A 2Q6LA 5DFAA 5FPPA 4ALIA 1EVKA 2QM3A 3F9IA 5K0JA 1XVLA 3PEWA 1DAMA 5IFLA 2D3WA 3OA0A 3AOEA 2X7HA 5ALZA 1H1DA 5J59A 2GCOB 3SVLA 1EFTA 1CUEA 5LP6A 3VV2A 3FWNA 3GN1A 5L3ZA 2H5LA 3R9KA 1PTJC 2FAXA 3CA8A 4N7RA 2XZDA 2NN3C 2ZSFA 5AI4A 1PR4A 2F1HA 4PFJA 4QOEA 5DTIA 5J23A 5EUCA 2W58A 2A0KA 3C7CB 4EG8A 5I7WA 2GKOA 3WLSA 2XTJA 3AR8A 1Z5PA 2VRCD 3H86A 5JCOC 3KZKA 3JR7A 4XIFA 4QXOA 1EIZA 1SO8A 2QW8A 5J3JA 1PN3A 1J5EB 3LVQE 5D5PA 3REOA 3HFSA 3IEMA 1IN1A 1D2HA 2Q0HA 1S89A 3O8QB 1HMPA 5DTEA 5BSFA 1XD9A 4UHCA 1PJQA 4MIOA 1RM5A 1BQ4A 2RGBA 1SC9A 3CZAA 2TS1A 3LKZA 4R54A 3OPQA 5DP1A 2QTAA 1MOSA 3ACDA 3KX2A 1Z8HA 2FGKA 2OXIA 2QT0A 2JFOA 1ZJ6A 4EHHA 4MI9A 3NNDA 5H82A 4DIDA 1T8WA 2GXSA 4E22A 3LBFA 5LM3A 4YDQA 2HTEA 2II6A 2G7ZA 1G9SA 4NCHA 4K81B 1SCQA 1HDXA 2J3IA 4J2OA 4GZ6A 3HZZA 5HP4A 2G1KA 5K2MA 1TU4A 3IIKA 2C9MA 3OEEA 4FMCB 2WJ4A 1JDPA 1WUKS 2JCBA 4M7PA 1T5LA 2GZ2A 4DPLA 3UBTA 4F91B 4QLBA 2RGRA 1MD9A 1VMEA 2FR8C 3FSEA 2Q50A 2EJTA 3G3EA 4LWZA 5M3BA 5JSYA 5KKCA 2HXSA 2J59A 4LOIA 2ZSJA 4QUKA 4C1NA 1YS7A 3H2GA 4BFWA 1UMKA 2C20A 2GN6A 1M2FA 2V7EA 4UAGA 2REXB 4K9PA 5EYPA 4BN4A 4KGDA 1E3JA 1FFWA 3I23A 4X1OA 4RTRA 4BNGA 1JGTA 2FFRA 1SKUA 3CLUD 1NHGA 3EGWA 1R5BA 4CLHA 2CFIA 3E9MA 3EOAI 2K87A 3H5NA 4IGKA 2PGOA 4G8JA 5B30A 2ZAYA 1INLA 3HP4A 2Q5CA 5EP1A 1WSDA 3UENA 1R3DA 1MR3F 4ZDKA 4IUYA 5DSTA 2PLFA 4GT1A 4E1VA 3IUYA 3ND6A 1EFPA 2BFNA 2LCIA 2Y2UA 3HZOA 4XVCA 2JFBA 1YJAA 2CY0A 2FK7A 4ZK2A 4DXDA 3DE2X 4LJYA 5K9ZA 4GYKA 4L8VA 3TRJA 4YTEA 3BBPA 3ER6A 8MHTA 1VMDA 5CFNA 2VG8A 3HKDA 5DU2A 3DTNA 4LE1A 1QAMA 5F4ZA 1JIXA 1XDDA 1J2TA 4B3DA 5I7RA 3IUSA 5ISMA 4EI7A 3AZQA 2OPHA 3L4BC 2ZR8A 4YR9A 2C3MA 2WNSA 1UJBA 4P93A 4XSHA 5LYJB 5KI6A 5AM2A 1NOJA 1XRLA 3MF4A 1AC5A 4DILA 2ZJ5A 1ZD5A 4S0ZA 2WTBA 3C3XA 3OTGA 3LGXA 3Q7PA 2CNDA 3HR8A 3FCUB 4CMKA 1A82A 4ZJPA 2P0YA 2F9MA 2XHEA 1SIBE 4EY3A 1XDWA 1B8PA 1W8IA 3AFNA 4L16A 4B09A 5EWJA 5BUSA 1HNXB 2BMVA 3VYTB 4JVSB 4BBZA 5AVXA 2HH9A 3FTQA 521PA 2Y1OA 3WDSA 1AKQA 5IYZF 2Z6QA 3QUCA 2YHBA 4B87A 5KYNA 1E32A 3SIPA 1SA0A 2VP5A 3ED5A 2FUNB 1HM5A 8OHMA 1WQ4A 1XNRB 2VT3A 3INGA 5KOJA 2R8PA 3FKJA 4LDJA 4J1SA 4QUBA 4J7XA 2IZ1A 4AMVA 2JKVA 1C5KA 4AXBA 1V6SA 4JLKA 4E46A 2DMRA 4XR9A 4URYR 3UT5A 3PV0A 3ECAA 3PFHA 4LOAA 2XGMA 2DPMA 3GU3A 4XEUA 1CCWA 1E2IA 3D3WB 1VKHA 5SZIA 4AF7A 3SYMA 5CA1F 2DULA 3C43A 3CXRA 3E2IA 4O4HB 4TV9B 4QDUA 4D46A 3FFWA 4AJPA 3MJFA 2Q27A 2CLSA 4QYXA 4BO3A 3RBAA 2A8YA 3R5SA 4CF3A 1NYQA 3DFUA 1UJ5A 1VPEA 3ST7A 1M75A 3F46A 4HDKB 4CU2A 1XD2A 3CVJA 3G5UA 3JD2A 2XCUA 3GR6A 1H22A 3GXOA 3K3PA 3OCXA 2VPTA 1YR1A 1EFRD 4LWQA 5ARBA 1MAVA 4TWRA 3N7TA 5KQLA 1EX6A 4ARIA 2JLZA 2X0IA 4G0NA 1I3NA 3VBCA 1DJPA 2C1ZA 4TXLA 5FWAA 4ER7A 6REQA 2GVNA 4RZUA 4LYFA 1YMQA 2AS0A 1RU3A 2PIDA 1H2HA 4S1PA 3SZUA 1L4YA 2XJ4A 4XYBA 4PYJA 3G9TA 2JK1A 4QGSA 3F7MA 3P9ZA 1OFHA 3T3IA 4ETIA 3IOCA 4CWAA 1H2XA 1Q3TA 1YQ9A 2JH3A 3EWSA 4MUJA 4MI6A 2C29D 1H1TA 2J9ZB 3DMPA 1JPVA 1HE3A 3EQ8A 2ZUBA 3T0FA 5JUWA 5B3JC 3O47A 1AD2A 3BK7A 2Q3DA 1XFDA 3GH3A 2O8BB 5DYIA 2CYCA 1XTZA 1L8AA 2P2ZA 3DR5A 3DT9A 3R8CA 4EX6A 4GS5A 3R24A 1MABA 1IZ0A 4BNIA 3CLUC 4PGMA 3DE7X 4JXJA 4DWJA 3HUFA 4DYHA 3VDQA 5JWRA 1YE8A 4HGPA 1YZHA 4ROSA 4GLBA 2VTKA 3MT9A 1XTKA 3UF0A 1Z56C 4L73A 1DJNA 3N2IA 3LUHA 2DFVA 1WHTA 3AV3A 2ECKA 4KCGA 1QFXA 2BFAA 2H0AA 3HCAA 3P32A 2P4QA 1RYFA 4XXHA 2HMWA 2YRXA 1BSVA 1RYMA 3CO0S 1XHLA 4QTUB 4TMKA 2VL7A 2YR0A 3AR2A 2X14A 1KJWA 2VHWA 3DL2A 4Q9LA 4AAYA 4BQIA 1BXZA 2FQWA 1O77A 3ZBPA 4RIGA 1CY2A 1MAUA 1U9IA 5LDDC 4GICA 3UA4A 3QW4B 1U5BA 4RW0A 3SKXA 1PNVA 1Z5GA 2O2YA 3CZCA 4E5KA 4ZOQI 1FQKA 4H6PA 1Q16A 3HFRA 1B93A 1N6NA 3UW3A 3E27A 3CH7A 1JDNA 4TN1A 2HD4A 1V5WA 2XB6A 4ER0A 4PG7A 4WN3A 2QIPA 3ZS8A 3HXTA 4DDUA 2RHJA 1YF3A 3TQOA 3D8TA 2Y9MB 3DP7A 1FVHA 1CUJA 3RRNA 3EH2A 1W88B 3H42B 3T5TA 4AJ9A 4E4TA 1ZISA 3RVJA 5BURA 3FYUB 4JEIA 5IXJA 4XVRA 1B7GO 1GWNA 1OYWA 2KPOA 4I50A 3T5GA 2RGWA 3O8DA 4JJGA 3KYCA 3GJSA 5HKKA 4IAOA 4MV6A 1LNZA 3D5QA 3DE6X 3FNHA 2C4UA 1DBQA 2AE2A 4K46A 2B36A 4WNAB 4YI5A 4X65B 2UUBB 5C5IA 5B4VA 1Z28A 1OKKD 4JAVC 5I9SA 1HC7A 1M2VB 4HAUA 4B45A 5TS2A 4D8VA 1XLWA 1NXVA 1SB8A 4TYPA 1U65A 3SR4A 4F2GA 2WHEA 3O9ZA 4KFTA 3F0TA 4HLQB 3KEFA 2W2OA 2PX5A 3I01M 4AT1A 3DPUA 1FUYB 2XV1A 1B1CA 4MS4A 4BWFB 4AS2A 4HNUA 5KTOA 1YQXA 4WBSA 1UDWA 2XCOA 1DQYA 1G9XA 1TUIA 4F8EA 1EWQA 4FDLA 4NJOA 1RXSA 1YBMA 1MV8A 2P6MA 3DKVA 4BZXA 1F38A 1MAAA 2Z2JA 3ABZA 3OZTA 3ZGXA 1RS0A 4WLEA 4U6SA 5JXWA 4QYSA 3MG9A 3ZZ0A 1PFUA 4IILA 1LW6E 2ENUA 5B6PA 2YYZA 1WB5A 1DG9A 1WF3A 1H2WA 2RHTA 3HVUA 4I7EA 4N0QA 1EDZA 3RYTC 1ST3A 4FDTA 4M86A 4EELA 5TY0A 3ZX5A 1XMQB 2H2IA 3II6X 1PWYE 4FLEA 1TFRA 2Y1CA 1OAKA 3I1FA 2C4NA 3LPAA 4FVTA 2QQEA 3EB9A 4IVQA 2A3RA 3JXEA 3TW8B 3I61A 4F84A 4RXUA 3GARA 3IMEA 4EHAA 1Z4MA 5E1BA 3GCDA 3IP3A 4BCBA 4D6PA 5E1DA 5KTSA 2XZTA 5BT9A 4MUBA 2L82A 3EK2A 1WSAA 1FTGA 4E1AA 1W36B 2O8EB 2A2ZA 3F67A 3G8BA 3VSEA 2NSYA 3EPKA 4N5IX 5BQOA 4I14A 1C7JA 1C30B 2XGGA 1F5NA 4I19A 3IERA 3H05A 3K72B 4CCWA 1WMEA 2L42A 3LBNA 2NWQA 3F4LA 5AXCA 5A06A 4CCYA 1JA0A 3EAGA 1X9GA 4G0UA 1LFAA 4NBUA 3DZHA 4BU0A 2TMDA 3STVA 3WRXA 4RJKA 2NUPA 3OWXA 4NECA 2RHDA 4TSKA 3HV2A 1YMVA 1DKNA 1UPXA 2W6QA 2CB0A 1ZY2A 1RADA 5KNDH 3C4JA 4G4SO 4UARA 4XASA 5TJHA 5CNKA 3TTXA 3BHMA 5JBIA 5KYYB 3ZE1B 3TN7A 1GU1A 1BW9A 1NLUA 1NQXA 2IHKA 2QP4A 3JQ9C 3PUYA 5DYWA 3VC1A 3RVSA 3MUFA 4FJ1A 3UPDA 5AM3A 2Z2YA 1F9EA 2Y92A 4BVAA 4AY6A 2QDXA 1NPDA 1BA3A 1I4DD 1GT6A 1MJ5A 2HWKA 5EINA 3WWEA 4QPDA 2EF0A 3GFPA 4O4LB 1EXDA 5TLSA 1JBQA 2A94A 3G89A 4LNAA 2AQKA 2R6FA 3QIVA 1SN7A 2BGLA 2FSSA 3PRJA 1NKSA 1RE1A 3CFYA 4ZHSA 3UCFA 4CKWB 3EOBI 2QTTA 2YJNA 1Z4JA 4YS6A 1R0YA 2YCLA 3QMMA 4G5QA 4O4HF 4YLEA 5ALIA 5HG0A 3S2GA 5DDIP 3W5SA 3R7BA 5HQJA 5KSPA 3W8RA 3QF4A 1G8FA 4J1NA 4IVPA 1E3IA 1D07A 1NDHA 1PJRA 4L9SA 5JE8A 1OX4A 3HP1A 4GC5A 3TXYA 3OQMA 3PF8A 3ADKA 4RF4A 4JB0A 2AFRA 2QSZA 2YTZA 3D6AA 4KAFA 3EA4A 4IV5A 2HF2A 4ZO9A 1TAUA 2VWGA 2X19A 4FHZA 1G5PA 3H0KA 4LZZA 4C01A 5LBTA 3ZQ6A 4P7FA 3NHJA 4C2TA 2Q07A 3EISA 3HWWA 5JLJA 3QBDA 4P7GA 2AOUA 4XRRA 1OXSC 3I9OA 5CP8A 1AH2A 3MWEA 3W3AA 3VR4D 4EPVA 1EXWA 2Y0CA 4UNPA 2VTVA 2YICA 4MQ5A 4R83A 4KREA 4TWBA 5J2TB 3KKZA 3M1LA 1TKCA 1N7JA 1IN8A 1G0OA 4XR4A 5BQPA 2IU0A 3WQBA 3Q10A 4BRUA 4E30A 2NX2A 5JJKA 1HTTA 3C8ZA 1IUOA 3GHHA 2A5DA 3IC5A 1R7RA 2B2CA 1Y8RB 3MAAC 4I5IA 1HT1E 1QBKC 3NFRA 3VYWA 2P3LA 2R6GA 1ULHA 2P6RA 4IMJB 1TUBA 4TLDA 3DXYA 1UPUA 4KQMA 2VHEA 3TIVA 1Y1TA 4F4HA 1R88A 4NBWA 1HPLA 4TSFA 2Q4TA 3IOMA 2ZR9A 1CRZA 3H6GA 4AJKA 4MJ3A 1QMPA 3UAWA 4JUDX 4WN9A 3TBHA 3UWMA 5I48A 4M1MA 5A4MS 3LGAA 4N76A 1C0LA 1ZGZA 2DEUA 4LRSB 5TMDA 2IU4A 2XXJA 2PX2A 4J6EA 1I5OA 1QQ7A 3GUZA 1QGUB 3KQWA 5AHWA 5KNCD 1MX1A 4KUEA 1WLYA 2WF6A 4YCLA 1UZLA 1S4QA 3HJCA 1E20A 4HXYA 6YASA 2QPTA 4NS4A 4RWZA 1ZI9A 4JBXA 4OKNA 1JRLA 4Q6WA 4RFSA 5L3SA 3QELA 2GJAA 2I1LA 2X5KO 1Z22A 3JQ8B 1E6MA 5IJ9A 3U7FB 3DA8A 1WB6A 3AKCA 1DIGA 3HU3A 2W2PA 1GG2A 3P9KA 4G1VA 4EGAA 3QVTA 4JBLA 1XMXA 4G2NA 3IURA 5ALTA 2X0KA 5DRYA 3X1KA 3IODA 4EJSC 1J49A 1OI7A 1TZJA 1QVAA 1ABBA 2OXEA 3UMJA 2YZ7A 4L9WA 6Q21A 3A6EA 4DA6A 1UIRA 3VC3A 3RK0A 3ZZ1A 5IUJC 3WLQA 2BF4A 4CV1A 1N2CE 4Q66C 4A03A 3V4OA 2VJPA 1NM5A 4D96A 3FAKA 5DW0A 2XB8A 4I55B 3ZIDA 2HDOA 3BL5A 5HCIA 4UU8A 4CFYA 1E2MA 1OW3B 1GUFA 3TQFA 3KAJA 3GA7A 4K40A 2Z56A 1TVEA 2XLCA 3F4BA 3SY8A 4E4YA 3VZBA 1WVGA 5AM0A 1PX2A 2VFAA 3ZY5A 3FFTA 3VPDA 2V98A 2WRZA 3HYSA 2DM6A 4MP8A 1L3BA 4PBTA 3ZJUA 1MRZA 3HYLA 1DEHA 1HE4A 2W6JD 2QTVA 2NO0A 4H0CA 2B5OA 5ENZA 4JENA 4PLFA 4P0TA 3PXEA 4CTKA 4CLRA 1ZVJA 1BXGB 1Z3IX 2DR0A 3CLRC 4C9BA 4Z6KA 3OOJA 5LZ9A 1KJJA 3AEYA 3I9V1 4J4TA 1NNUA 1KOFA 3GP3A 3ELUA 5FWDA 3VOSA 4EMTA 1BIFA 3H8JA 4IXWA 5KNLA 2B92A 4NEHB 3MBIA 2CXXA 3S44A 4YMGA 4A5OA 1Y89A 1OOEA 2O7RA 3CF4A 3I39X 2QKYA 1XV5A 1Z8NA 1KAGA 3D2CA 2XE4A 4FOOA 4IDDA 4BQEA 1ESCA 2XUJA 2ZB8A 4MCJA 4AJIA 5DBEX 2PSEA 4J0JA 2XQIA 2QN6A 3MJEA 3KT3A 2P9QA 2I76A 1DV2A 1D2MA 1G8SA 1FFXA 1UK6A 2XIJA 4TRRA 3SFVA 3TMKA 1KS9A 3ZVMA 4X44A 3CPSA 5E7QA 1OBOA 2PU5A 3R7DA 4C29A 3THXB 2VDPB 4EUFA 3P2YA 1V8FA 3L0CA 4EF4A 4A8JA 4HGQA 1H2ZA 4ILKA 1R6AA 3AQ4A 1KE1A 2QJTA 3ZCRA 4U7DA 4ZAGA 1L5HB 1J0AA 5F7JA 3THYB 1N9ZA 2VYND 4UBMA 3A28A 1LGYA 2OQVA 5C5EA 1YO6A 2VPIA 4I5GA 3WHPA 2ZUCA 2TSYB 1KZHA 4DZTA 3M2PA 3QVXA 1VSTA 3F71A 5LMNB 4ATNA 1SCNE 3L84A 3IPRA 3QQPA 3R77A 2FG6C 1ZBQA 1LDBA 1NIPA 2A1UB 3WJ1A 1P6QA 1B15A 3EWIA 4PYRA 1NUHA 1P39A 1G9TA 3DTYA 3SQDA 5IHXA 2ZWIA 3GB9A 1CDZA 1AURA 1X86B 2ETVA 2I7XA 3FPBA 1Y9AA 3K0FA 4IWNA 5TF4A 1OFGA 3EVAA 4EG5A 1X1QA 2JD2A 2ZCJA 1B8OA 4OKIA 2FWNA 3CKMA 1K2VN 3JAKA 1V4NA 2XUOA 3DGFC 4IWYA 4D3YA 4KPGA 3O03A 2BGUA 1M6VA 2EVWX 3KKMA 4O4LF 5FTWA 1DUSA 4BVHA 3JAMA 1I6KA 2BBOA 3JPWA 3DZJA 1L5RA 1T2DA 2C61A 2O06A 2G9QA 4GOXA 4FMBB 4Q16A 2LBPA 5JCZA 2NXJA 3T5CA 3GLHE 1ZPDA 4EQ6B 5JH7F 1Q0PA 3LYLA 4FE4A 3PPWA 2WA1A 1GKUB 1Y1PA 2IPMA 3I9MA 1K7SN 2QRPA 2VQEB 1P3DA 1IY9A 1N5IA 1SH7A 3PKJA 4QBHA 3R7WB 1DQPA 2XE8A 4AY2A 4JWTA 2Q21A 4PPYA 5AOAA 1AKYA 5JG7A 3USES 4CNQA 3BMOB 1GFIA 1XP8A 3SEQA 4V02A 3W5BA 1Z0FA 3I30X 3ROQA 1BD4A 4C4YA 1TCBA 3CYFA 2ILVA 3NNNA 4R41A 3T9AA 4LXYA 4MKXA 1ZMTA 2BM1A 5K03A 1LC3A 2C9OA 4LJ6A 4RK4A 1EK6A 1XDGA 4Q9IA 3ZWKA 2ILTA 2QGFA 4OHOA 2IK8A 4JV5B 1EZ1A 3I05A 3PX3A 1ISGA 2OVBA 4BATA 3PC8C 2SKCA 4X94A 1T2NA 3H99A 2HIMA 3UBMA 2KYRA 3WYBA 5LMZA 1CNFA 2EOAA 3PDIB 4AKHA 4IXDA 3OQPA 2VSXA 4URZR 5JNSA 1KK0A 3NJ8A 4JP3A 1ZVKA 2B98A 3CB4A 4E14A 1GIAA 4MWOA 1FS4A 4XX1A 1GG5A 2F1IA 4GZ3A 4J6FA 5F76A 1VJGA 2RB4A 4RJIA 3UKDA 4FFBB 1CRQA 2QRNA 3JTEA 1AMNA 2VRBA 4RD0A 2YYSA 3JRWA 4PZEA 5L4SA 2PJDA 2MR5A 2AFHA 2FUKA 4QXPA 2JBHA 2AWNA 4G09A 4OKSA 3H16A 1YCHA 2Y27A 4YCJA 1U98A 3G1TA 4FBGA 4YI3A 1A8HA 1TKAA 4E2ZA 3WA6A 1JTEA 1LQUA 1XL0A 1QP0A 3HN2A 2PMBA 2KQUA 3WFZA 2Z98A 1RAFA 4FYIA 2QTMA 1T4MA 4PAQA 4XPZA 1G7TA 2G28A 2YXPX 1JQ3A 3K1AA 1RWWA 5GPBA 1NVDA 4ENVA 2WUWE 1C9MA 5T8KC 4E88A 3IJRA 4CQMA 2PR2A 4IL5A 4IRUB 4CTMA 5M2QA 2IW1A 1ZICA 1PEYA 1XQWA 4UTVA 1SK8A 2BE7A 3PFIA 3RE1A 3CX7A 4NOMA 2GFHA 3BREA 3K9LA 5IABA 3NDIA 1TEHA 1ZA2A 1IUNA 1J9EA 2XMRA 4HCJA 4IVNA 4W5TA 2P8JA 1PFWA 4G8CA 4UPDA 3U6KA 1GG9A 4H17A 3Q0IA 1VE7A 4IDBA 3GLIA 1CF2O 2JI6A 2CUKA 2PGNA 3T3GA 4MQMA 1S7GA 1XHEA 2YBEA 1Q91A 3E1GA 4Q6BA 1MN6A 1G6HA 1DAPA 4B3CA 3VHLB 4JROA 4V3BA 2B7CA 4U63A 3EODA 3DAPA 1KK3A 1IM5A 3NB0A 4UMDA 2J85A 3G0BA 3GCZA 1QK4A 5EOVA 5H4HA 2QGZA 5AVTA 3BE5A 1XKTA 1M0WA 1T9ZA 2VWQA 2WJ3A 3LS2A 3K4PA 1AB6A 1LPBB 4TLEA 1P4HA 1YIOA 2NZ2A 3TPCA 2EKZA 4M9XA 5CK5A 4KYVA 4MXDA 4DBZA 1DGQA 3OCYA 9ATCA 5A9TA 2DCUA 2O8FB 4IDGA 5BVGA 2VNAA 4CLXA 2C2XA 2WF8A 3C3PA 2F2TA 4FI3F 5C5CA 3ZWBA 3CXUA 1N5DA 2IHYA 1PS0A 5IT0A 1T0JB 1QHNA 2OAQ1 1Y7LA 4ZP1A 5K0LA 1K5DA 4EECA 4LMAA 5EIWA 1VRCA 3N0RA 4PSKA 4XWTA 4JBNA 1RIFA 2IA5A 1C9YA 1GEEA 2IYEA 3C6XA 5JMPA 3HJBA 3KKOA 5REQB 4BJ1A 1FFHA 4LXQA 3PEUA 1XE3A 3LUFA 4E1BA 1CDDA 3CNHA 2DBVO 3FNFA 4Q3AA 3DTVA 5C32A 1OBHA 1AN0A 1X13A 4RPKA 4YLYA 1E9BA 5EE0A 3DZIA 1Q7TA 4J8PA 1Q19A 5EXDA 1Z4OA 2C5LA 3DMTC 1ZRHA 1WD5A 4XLTA 5KVSA 2P41A 3ILSA 1OQAA 9ABPA 4L51A 1KAHA 1Q1QA 1UJ4A 1UH5A 3KR9A 1LUAA 3LBAA 3F74A 4XD7D 5F1YA 4CKBA 1EFUA 1O94C 3NKVA 4RHCA 5DN6D 3ILVA 3D02A 1EWKA 2EKPA 4LC0A 4YT5A 4HLNA 4IIFA 4FYPA 4UBLA 4E4RA 4KHZA 3AM4A 4BGDA 2O7SA 3KWFA 5DWQA 2QF7A 2AI2A 1PW7A 5IZCA 1EIWA 1EK5A 4QOJA 3A4YA 4MV5A 3VTAA 2FF5A 4X8MA 3MCTA 2DBRA 1WZUA 1JH9A 1FYDA 1RJ9A 5ERGB 2VJQA 3VX3A 1C2YA 1W8DA 2E6KA 2N1BA 4R1TA 1XLVA 1ZD9A 4AO7A 5IDQA 4NBKA 2GYUA 3WYGA 1Q21A 4NONA 4ZT7A 2PJRA 5I47A 1ZXLA 3OM0A 1H4VB 4LDQA 4MR8B 4IO1A 4NABA 3LHIA 1DKLA 3I9KA 1YAJA 1BWQA 3ONDA 4QFBA 3QPCA 4U7WA 3DL0A 4BFTA 4DADA 2IIVA 3F8TA 5FPKA 2NV0A 1TC1A 4WMLA 4I1PA 2XUZA 4BTLA 1XK6A 5IK2D 3LKDA 2ODPA 2H2WA 3NVKI 4RIHA 5AVZA 2F4NA 4NMWA 4PBSA 5EKUA 5P8WA 2WD7B 1SXIA 3SIRA 4ZANA 1MENA 1QUFA 3W04A 1KU0A 2H4JA 4EYGA 5AW2A 1ZIXA 1P2BA 5KREA 3PTAA 2W2KB 1F3OA 2NAPA 2ZYHA 1M8GA 2Q3LA 5K6AA 3FTFA 3EFOA 4KL8S 3S2SA 1S02A 3QBEA 3C3AA 3PT5A 5IVPA 2RHRA 3G5AA 3IESA 4LECA 5AICA 4FHDA 2WTMA 5A7HA 3TLZA 4BFYA 4CIVA 1QS0B 3PXUA 3WB9A 2HJ9A 3E6AA 1M2HA 1PK8A 4LNUB 2XGJA 3Q15C 1BS2A 2J3DA 4PQEA 3G0DA 4JCCA 1I7QB 4AG5A 5LA6F 2NO1A 5KYTA 4WCDA 1W5SA 3MELA 4MW0A 4RUKA 2CLMB 4WLUA 2ZUVA 4ZVQA 1DRJA 4DLZA 3CS3A 4XE5A 1GAXA 4B6SA 1AGRA 2XMGA 3L7YA 3ZCQA 3LQFA 4EIWA 2ZBRA 4AZ3A 721PA 1PEDA 2AK2A 3CMCO 3V9PA 4US2R 2P6PA 4QPZA 1ECBA 2DGDA 3UMFA 3VYUB 4AP9A 5CLGA 4BE9A 4P4SA 2YJGA 3HRIA 4MVJD 4GOND 3P5BA 5EAIA 4CDGA 3ZU2A 1AKVA 2JI4A 4L02A 4UPEA 4EHDA 3JYLA 4LZAA 3TLEA 4PHHA 2I7VA 1C1XA 1D1QA 1W34A 3O4IA 4L5JA 2GOYA 2JJ2A 3CLTC 3DVAA 3DCYA 1VG9B 1WBJB 4TPKA 1D6JA 1KP9A 4R7GA 2PV7A 3GPCA 3LDHA 4ZAXA 1P1BA 2WHQA 3HDVA 1H2BA 2DT5A 3JD3A 4FHGA 2N75A 4YA6A 1MQ9A 4Z4GA 3BWCA 2JIOA 3EA5A 2FMKA 4Y1RA 2VPPA 1QVRA 3USCS 1QIDA 2ZQZA 1ORRA 3BE6A 4KVZA 2O7VA 7MDHA 2J0QA 3KCNA 3MIIA 1I2CA 3TI7A 2WZDA 3TXXA 1WDTA 3LCCA 3RC8A 2R8EA 1GEGA 1MC4A 3GGDA 1ZJYA 3O3NB 2H4FA 3S2EA 3VSDA 1BVYF 3ZHYA 3CCBA 1QE0A 1Y4SA 3GFRA 4C07A 5K3OA 1G7CA 5CCBA 2FPXA 1H42A 4WFQA 5HXAA 1UOEA 1TIPA 1VSQA 2CCGA 2PM8A 2VHTA 3W1VA 4DA8A 1V0JA 4BMZA 4YLGA 4OXKA 2X9QA 3PJEA 1GCAA 1F17A 1XT6A 2WJIA 2WF9A 3WI7A 5GADl 3GLGB 1AF4A 1CR2A 4FGKA 4R4JA 4DVJA 1HYGA 1JEJA 2EFJA 2ESRA 3QOXA 4L8FA 5F9HA 5HZHA 4TYYA 1V25A 3C39A 1NAIA 4AZSA 3TXAA 2VJBA 3ZNPA 2IU3A 5B3KA 4C4AA 4IIUA 3JQAD 1B41A 2BR3A 3FFAA 4UHEA 2HQOA 1XNGA 1GNRA 2G6BA 4TKUA 1TM5E 5EMLA 4F85A 3BILA 4H1WA 1PK7A 1Z5UA 5DNVA 3ZNOA 2PT6A 3SC3A 5IF3A 3QKSB 2Q8NA 1LLDA 5KAPA 3ER8A 1GNTA 1RNLA 2JBWA 2XAUA 5C8DA 1VGRA 3BWMA 2A92A 3NIDB 3Q5EA 3EZ9A 5GJBA 1U1CA 1KY3A 2BTOA 5LP1A 3X1MA 2VKTA 3KHTA 3PWZA 4LXXA 4YIHA 2EBHX 5CXXA 1GD1O 4A2PA 3IVRA 4TVKA 3I76A 3WL6A 3CZ5A 2F62A 2A9JA 4LKRA 1KQOA 3DDHA 3S81A 3AHFA 5IVDA 1J70A 3U49A 1J8MF 3RUIA 2BCGY 4NU5A 1F0PA 1TMKA 3UMYA 5EUMA 1ZESA 1R66A 3ZLBA 3UYKA 5F2EA 3BH6A 4K0KB 4RHEA 4UHBA 3LVFO 4LFBB 3REGA 2XADA 1QCCA 4P7KA 2P5TB 2FA9A 2VA8A 2H1CA 1X77A 2VHCA 1HT3A 3QTLA 3HH8A 4PNEA 5ALDA 2WA2A 1R0ZA 2X2PA 2O2IA 3AI7A 4M1OA 4RKEA 3UYLA 1O0BA 1V4BA 5FTLA 1BROA 4HH1A 4CGYA 5U4QA 4IW3B 1O6ZA 1MOZA 3AL3A 1XCLA 5CTJA 3M4ZA 1HE5A 3L7IA 3TLGA 1OB2A 3W3AH 3BJZA 3B3AA 4BX2A 1KF0A 3HACA 1PLJA 1DOAA 2KB0A 1XVUA 2DTXA 2QB5A 2QW0X 2YQZA 3MC1A 4HXGA 1EB9A 4WL0A 2LGJA 5DNDA 5HKBA 2DBZA 2RBGA 5K3CA 1C4XA 5LMUB 4TMTA 4MQ4A 2E49A 3A4IA 4YVFA 3QV1A 5IBPA 4D42A 5BMVA 3GDHA 3F6PA 3LCMA 4B3IA 1Q22A 1AKEA 3A70A 3GGPA 4NZ9A 4LGVA 1I6WA 3I52A 3HXQA 1CQWA 3TR0A 1SUIA 5FOXA 1MA0A 2EGUA 3B6JA 3W7BA 3DQPA 2C7VA 1OCEA 2Z6VA 3NCTA 1TRHA 4I8XA 4WWHA 5EQTA 1ZD2P 1QIHA 3ZWCA 5JJ5A 4Z4HA 3D9QX 1TM4E 4PYOA 3D7MA 3NPMA 2AFHE 5T5QA 5BN5A 1O5OA 3CRVA 3M3PA 3JAWA 4JI6B 4UFOA 2DKNA 4TYNA 5FEUA 5KTPA 1SHZA 3PENA 5EJ7A 5EIXA 1K86A 2CN1A 1FE8A 4X91A 3TL2A 3B5JA 8LDHA 2YDXA 5ELMA 1BGVA 3L7MA 3RFFA 1LDGA 5DCUA 4DAEA 2CXTA 4ZDJA 5KNBA 2NPFA 4UTZA 4Q24A 1ZD3A 2VPXA 2H11A 5FBWB 5E6SB 2JKYA 2A0YA 1SIWA 5IMBA 3IUMA 1DKUA 1GUYA 4DCCA 2D2FA 2FEXA 2I3AA 2VDUE 1P7PA 3C3EA 3HSYA 3P2OA 3DBOB 3QVUA 4IP0A 3T1VA 4CJXA 4D82A 5A4JA 2DB3A 2B9VA 4M49A 4E6PA 1M2OA 3K70B 4NP6A 4F5ZA 5LDGA 4MQLA 1GDDA 2ZRDA 3B12A 1E92A 2P7IA 3H13A 4KOAA 4QZVA 2OHVA 2XVZA 3O0TA 2EJBA 4XAQA 4H9GA 3EZYA 2FU5C 4OQMA 5CDYA 1JR3D 2P6OA 2XDQA 3LDUA 2SECE 1PQWA 2X3FA 3L02A 1I0LA 2ZSDA 2VJDA 1RD4A 2Y1GA 4O2BF 5GM1A 1M6WA 3D8RA 1UT8A 5E4FA 2OR3A 1M1ZA 3L8MA 2BPOA 3BSFA 1KRWA 1DB3A 1MU0A 2JGMA 5A03A 1P19A 2XMDA 1DBRA 1PDVA 3BAFA 2QLJA 2VUSA 3GELA 3HMKA 3NG1A 2W9XA 3K1ZA 2BFFA 3T7JA 2F67A 3FCCA 1O7JA 4W7HA 3V1MA 3BHJA 5IBQA 3N05A 3IO5A 2RH9B 1G5QA 1NQUA 2H5JA 1VFPA 3D4IA 3EYWA 3BCSA 4X60A 1ESDA 1UEJA 1X7XB 3PA8A 2HKIA 3E7DA 3WLMA 4EG3A 1IOZA 1IQ0A 2UVDA 1USGA 1B8NA 1AE1A 3LRPA 1PR5A 3IVAA 5BSTA 2NUTA 1LSUA 1QG6A 2J7KA 3D8NA 3V2GA 3BB4A 4L85A 3O1LA 2WJHA 2Q4RA 4HTFB 1D1SA 1W47A 2IRWA 1BHO1 1M7GA 4NDNE 2G4LA 1EUZA 4D4JA 1JU4A 5MFPA 2Q8PA 1YI8A 5B1EA 3ACCA 5CAEB 3COWA 4D9KA 1KI3A 1EEXB 3NYRA 4YONB 3ECCA 1SD2A 1L4UA 1PQYA 4I2VA 3BA1A 3NH6A 3VBEA 4KYTA 1XCMA 4XTRA 4IF6A 4KGXA 3PCXA 4CLOB 1D6MA 2VPYA 2BM0A 4GBJA 3D5EA 4A6EA 4NCJA 1E6LA 5AVQA 5CJ2A 3MWFA 5F5NA 1JPUA 3ORYA 1YA6A 3KOXA 1XEXA 2H1VA 2WDZA 1IM2A 5BSVA 2G82A 2DTEA 3FLEA 1V3VA 4MB0A 4Q21A 3IIEA 4FGSA 4GVLA 1U8EA 3ITDA 1H6DA 3CWZA 3FFXA 3NHKA 1IDN1 1QLWA 1D09A 1UWKA 4MIKA 4PCVA 2P3QA 1KFBB 2IQIA 2JFWA 3ZKWA 1G20A 1PHPA 2JGJA