2UVIA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with 4,5-unsaturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA02
4F19A 2HZLA 3MPLA 5AE4A 1JW1A 3PMWA 4GF8A 4MF3A 3U1OA 4BDOA 1VFDA 1M5EA 3MWBA 3KJTA 5CRYA 3TQWA 3N6UA 4ESWA 3HSTA 4RK9A 3DELB 2F8DA 2HAUA 1IXHA 2Z8FA 1NNPA 1B51A 1PBPA 4R74A 2I58A 1NMUA 4U4SA 1S7YA 1ANFA 1I6AA 2HAVA 2PT1A 4ZEFA 5KDTB 1FQDA 3TQLA 3P7IA 1D3KA 3IOWA 3KOTA 2Y84A 3ZKKA 3EF7A 5B7DA 1IXIA 1XC1A 4JSOA 4KPTA 4ZZAA 3E13X 4F29A 1B3FA 2B3BA 2RC8A 2Y7RA 3LR1A 5FHOA 2NWJA 1IZ1A 1M5FA 2W7YA 3O9PA 4OYVA 3EHUA 3ZS6A 4F3BA 1FTKA 4ELOA 2DWHA 2CZLA 3TUSA 4F1UA 3SEUA 2RC9A 3C33A 3RPWA 2O1LA 3TEPA 1O63A 2DOJA 4Q30B 3TKDA 4LA9A 5L9SA 2PVUA 2G93A 4PFUA 4XIGQ 5DEXB 4QF9A 2H25A 2F78A 1OLCA 4GIZA 4G2ZA 4YICA 4BDQA 2QMXA 4IO4A 2HCAA 4P0IA 3V83A 3CSGA 1N04A 2HXWA 4H8JA 4Q5TA 4NF8A 4R6HA 4YMBA 5F1QA 1H44A 1DPEA 3S2VA 3PPRA 2F7BA 2AL5A 3R7XA 3FVOA 4NF6A 1ZMGA 4FIMA 2GH9A 4C0RA 4QSEA 2XXVA 4Z7EA 5K2XA 3PD8A 3PD9A 4IO6A 1PB9A 4JSDA 2F97A 1EU8A 3O2AA 2Y7PA 4KHZE 2ANJA 3IOUA 5FTIA 3JV9A 3A3CA 1I69A 3MZ1A 4BLAA 4F31B 4N13A 5JTYB 3FJGA 3S9NC 1Q1KA 2Z23A 4DXUA 1Y20A 3MP8A 4GD5A 4HS7A 4LVQA 4QFLA 5CMBA 1MY3A 3CFXA 4E0WA 1ELJA 2PYYA 4GRKA 4HCWA 4NF6B 5I2NA 3LSFB 5CMCA 1SQYA 3E3KA 3FXRA 3W9WA 1OQGA 4PFYA 1L5TA 2F5XA 1JETA 3VLUA 4ELPA 1LGBC 4RXLA 4ZE8A 1JEUA 4H65A 2CMOA 3HHGA 4OETA 3S4UA 4H5FA 4ELQA 1H3DA 1LFGA 2PX1A 2QMWA 3K6XA 3Q28A 3SEYA 4FORA 2OJTA 1FQEA 1JEVA 4PE5B 3TAJA 2DYXA 2UYEA 1IXGA 4KCDA 1CB6A 4RYAA 2Q2AA 1A99A 2HZKA 2OWSA 1XOCA 2ZMBA 2DE3A 2IA4A 4YZZA 5I56B 4XTCQ 1MG1A 2ONRA 5F7VA 1N3XA 3T9VA 1WODA 1P1WA 5JTYA 2X7PA 4PFTA 2FYIA 1IIWA 3GXAA 3PMVA 3VFJA 2RINA 3VXBA 3TTRA 5DTBA 3FUZA 4N6PA 5H8QB 4KYSA 4EQ9A 5HPQA 1ZTYA 4AQ4A 1WVJA 5LOMA 1T0KA 1H45A 3TCFA 1FTOA 2I48A 2QS2A 4ZZEA 4G68C 4C1TA 3RT8A 1TXFA 3MJNA 4KFQA 4TQUQ 3EHTA 3F11A 1SYIA 1Y3NA 2Z8DA 3R26A 4I8CA 1N76A 3FXQA 3SETA 1FTMA 3MP1A 3FD3A 1LBCA 1NH7A 2E0SA 2QS1A 1P1NA 2VGQA 4K3FA 1QJMA 2Z8EA 2HEUA 2DS9A 1SVXB 2ZNTA 4ONYA 3CRBA 2AIXA 4YKIA 1MY4A 2I49A 4TLLB 4U4XA 1JW5A 3GLBA 2OBGA 3IJOB 5I56A 1IITA 2XX7A 3MC2A 3EN3A 3K6UA 3UIFA 1EZPA 2DE2A 2PBWA 3ONMA 1JVYA 1N3WA 3K02A 4G77A 3CFLA 3QAXA 3IR1A 5ITPA 5EYFA 1NNKA 2V3UA 1B7HA 2DVZA 3B6QA 5TU0A 3GBBA 3U72A 3W9VA 4EDPA 4EQ7A 4F1YA 5CMKA 4BDMA 3H6WA 2Z22A 5AA2D 1ZIUA 3UGWA 4FEBA 1KWHA 3LSXA 4G68A 4GQOA 2A5TB 4HW8A 5L9MA 2ABHA 3V89B 4P11A 3SEXA 2O84X 1XVXA 1LAXA 3IAZA 4TOZA 3VDFA 2DXRA 1N84A 4LUBA 2XD2A 4JBZA 1MXVA 4X1DA 1D9VA 2X26A 3CIJA 3MP6A 3C35A 1LAFE 4OEUA 1MY1A 5H8NA 2DVCA 4OVJA 3H03A 3W15C 4QFPA 1UQWA 4ZECA 4UA8A 5B70A 1MM6A 1US5A 1POTA 2ZYMA 3KN3A 3QYTA 1SYHA 1AL3A 2V3TA 2XXHA 3IX1A 2H5YA 1LAHE 3HO7A 3O6GA 2P0SA 4U22A 1M5DA 1QUKA 1GR2A 1HSJA 1R9QA 4G8MA 4ZEKA 3IL1B 2YPNA 5KCJB 3VV5A 4R6YA 1VSOA 3K2DA 1MPDA 4NF8B 2QPQA 2OWTA 3FASA 4FAJA 3AXFA 3SEWA 1WDNA 3LC8A 4F22A 4F1VA 3N5LA 5ICTA 5ISUA 2UVIA 4OENA 2WKYA 2X7QA 3TMGA 4DCXA 1Z7ME 2F7CA 1DPPA 4DIGA 4EXKA 3QUFA 4R9GA 4NF5A 3EPEA 5DYHA 2UVJA 3K00A 1N0TA 1I6QA 2ESNA 5A5XA 2R6GE 2M8CA 4JB7A 1LAGE 5I59A 1LBBA 1Y1ZA 2DWAA 1SI1A 3IOTA 4JWYA 4GL8A 4ZEDA 4F3GA 5I59B 1RYOA 2D3IA 4NWDA 1OVTA 1SW5A 1M5BA 1EH3A 2QSXA 4GVOA 5DVFA 4EUOA 5A5XB 4TLMB 3TDJA 4GXSB 1LCTA 1ZBMA 4IO3A 2P2AA 3TYHA 4NEDA 3TCHA 5KDTA 3VXCA 2THIA 1J1NA 1NNTA 2DWIA 2UVGA 3OD7A 4ISUA 3ZSFA 5CI5A 4EQBA 1B4ZA 3K1MA 4R2BA 3S9MC 1PBQA 1URGA 1Y4TA 1N7WA 2Q2CA 2XX8A 3H6UA 4GXAA 3BFTA 3M8UA 5CMMA 2XXYA 4FECA 3CFZA 4OFJA 4NF4B 4HTGA 2R9JA 4Q8RA 2ALUA 1OLAA 2H98A 1XVYA 1NKXA 3CR9A 1NH8A 1JQFA 2DWJA 2F35A 3IORA 3KFMA 1MQDA 3L6GA 3N26A 5FTHA 5HBCA 1HSEA 4ZDMA 3I3VA 4H67A 2I6EA 2VHAA 3TCGA 4WEDA 3KG2A 2F34A 3FIRA 1SI0A 2OZZA 1VR5A 3FV1A 3K0VA 3K1NA 3KN8A 3M3LA 3PUXE 3PPNA 3PUWE 2XXQA 3G3IA 1MY2A 3HN0A 4OEVA 3Q25A 2VP1A 3SDFA 2QRYA 4M4GA 3E4RA 3PV0E 4O3AA 5H8NB 1II5A 3JYRA 1QKBA 3RNNA 1AIVA 4IO7A 1DOTA 1IUDA 3KJ7A 3OO9A 5I57B 2H99A 2I3VA 1JW4A 3MZ9A 4GOTA 3TTLA 4KR5A 1OIBA 2O7UA 4C1UA 1LCFA 1BKAA 4G68B 1FCKA 1YAEA 3FVKA 2QS3A 4ZS9A 4ELRA 4UACA 3DM0A 4MBPA 1SW1A 1VE4A 3Q27A 4OESA 3C31A 1VFEA 4Q0CA 1SW4A 3OO7A 1GVCA 4YMAA 2GRVA 2O69A 4MLVA 2ZYNA 5DVIA 2V84A 4NWCA 5IAIA 1MH3A 2REGA 4FEDA 4PETA 4OMBA 4EF1A 1B1HA 1MS7A 3O29A 3USDA 3LSLA 3RUMA 4QHQA 4QFOA 1LFHA 1FTLA 4YKPA 3UA8A 1Y9UA 1DMBA 2GFEA 3TZAA 3DP6A 1B5HA 1LLSA 3N94A 3O28A 3C9HA 3PU5A 4POWA 4RA1A 4F3PA 4NMYA 3V5AA 3EQ1A 5AA4B 2OLBA 1B3HA 4JXIA 2F36A 4N07A 4YB7A 3H06B 2O1MA 3HV1A 4OXVA 3FATA 3I5OA 3TELA 3G3JA 3IB2A 3ZKLA 1O7TA 4I1DA 1I6BA 1MH4A 1ZU0A 3T9UA 4THIA 4ND9A 3OEMA 3SEVA 1MQJA 3KSJA 2FNCA 1EZ9A 4IO5A 1XS5A 5I58B 2DSFA 4F39A 3BKIB 4WEPA 3TTNA 3WAFA 5JK4A 1BP5A 1NFTA 3PPOA 3R6UA 5M2VA 3T22A 4IY5A 5H8HA 4BDNA 3FJ7A 3LSWA 5I58A 1R6ZA 3ODBA 3CI8A 3S9LC 3HHFA 3TTKA 1B3GA 2ZYOA 5AA2B 5I84A 3HCQA 1MXXA 1S50A 2ONSA 1XT8A 2XXRA 3D4GA 3B6TA 3OSRA 4R73A 1MM7A 4YB5A 1B52A 4E0XA 5FHMA 1AMFA 2AL4A 2NVUB 4DE8A 3N6TA 2VD3A 1MDP1 2F6GA 3RGYA 3FVGA 3VLWA 1Y4CA 4FATA 4LZ5A 5AA4A 3V8XB 4POXA 3MPKA 1Q35A 3LBSA 1N7XA 1MXZA 3T93B 1B05A 3VVDA 1MPBA 2RCBA 1FTJA 3DP4A 3FVNA 1R1NA 1B6HA 2NUVA 4X9TA 4U1OA 1P1QA 2ZNUA 3PUZE 3JZJA 1B32A 4YAHX 1USYH 3B7DA 2QL3A 1B5JA 4AB6A 3SKPA 1BTJA 3K1PA 4OFOA 4BDLA 1YCJA 1TFDA 1FQAA 5I2KB 3GZGA 4AB5A 5ELVA 3VVEA 2XXWA 5KZTA 4G8HA 4OFLA 4X1BA 1SBPA 2ZXTA 1A7LA 3MAMA 4KQPA 3T9HB 1B9JA 2I3WA 1LB8A 3G3HA 3OELA 4X48A 1GV8A 4O3BA 4PFWA 1USYE 3FXUA 4RY1A 1B3EA 1PDAA 3CSBA 3K4UA 4FJPA 1OQHA 3UK4A 5AA2A 1A55A 2IEEA 1FQFA 1ZLQA 4GLIA 4KCCA 3VLVA 3IB0A 2XXUA 3M3FA 2B3FA 3H4ZA 3FGSA 1Y1MA 4LATA 3SESA 4U21A 3RN8A 4M1VA 3PGFA 4YB6A 3OEKA 3HPIA 1FQBA 2I4CA 1IEJA 2F7AA 4XKQA 3G3GA 2I0CA 4LZ7A 5BUUA 3MVYA 4H6DA 3IO6A 4ZEIA 2DXYA 3C36A 3TFLA 3RTWB 2O6AA 3H7MA 4NF5B 2V93A 3FJMA 4H0WA 2O7IA 4U1ZA 3QSLA 4WKMA 4LQ5A 3U94A 3G3KA 3KZGA 3FV2A 3SERA 4ESXA 1B1XA 1TWYA 3MVWA 2GHBA 2KLFA 2Y7IA 2GHAA 3C4MA 1POY1 3M3KA 1A8EA 4DZ1A 1UIVA 1JVXA 3ILTB 4P0GA 2AYSA 3L6HA 4QSDA 3K6WA 1MXYA 1F9BA 1P1OA 4H8IA 1P99A 3KN7A 1MQGA 3LUYA 4YU0A 2F6PA 5DVJA 2DP8A 2I4BA 3KBRA 4DCYA 4KYEA 4DXCA 3KSXA 4LZ8A 1QKAA 3QIMA 2OCUA 5H8QA 5K2YA 1MPCA 4GL0A 2Q9TA 3MZBA 1HSLA 1MY0A 2Q89A 2RF1A 2PT2A 3A3UA 5H8HB 3U93A 3OENA 2HFBA 3CG3A 3K01A 4MLQA 2XD3A 5EHMA 3D4CA 1GTKA 4DXBA 1URDA 3EHSA 1DSNA 4GWOA 4IY6A 4XKPA 1YTVA 4YKKA 3RTFB 1A8FA 3KOSA 1R9LA 1ZKBA 1B40A 1SD3A 4QFKA 3OOAA 5TPAB 1UTBA 3VE1B 3WAEA 5CC2A 4MH5A 1RYXA 4R6KA 2A5TA 4Z0IA 3IK6B 5L9OA 1UTHA 4QRZA 1QVSA 3GBAA 1FQCA 3MVXA 4KYDA 5H8SA 1LSTA 3CG1A 1QULA 1CE2A 4OQOA 2YLNA 4PP0A 4RPNA 1EZOA 5I2KA 1MRPA 2E1SA 2V25A 2H9BA 5DT6A 5CM6A 1MDQA 1NL5A 1XHYA 2O68A 3TODA 5I2NB 1B7UA 3OMBA 1D9YA 4JWOA 4OHNA 2H4IA 1B2HA 4DDDA 1B5IA 3FZVA 2G29A 2O51A 1RKMA 2VD2A 3PUYE 3S9EA 1YPNA 4BDRA 2QS4A 4IB2A 4F2QA 2UXAA 4LONB 3PUVE 3O97A 2RKMA 2Y7WA 1A40A 2Q88A 3Q26A 3UN6A 4ZEBA 1BIYA 5HM4B 2PMSA 5IKBA 4H5GA 3B6WA 2DE4A 2RC7A 3THIA 1A54A 5J1DA 1QUJA 4JDFA 4KD5A 1UTHB 4IGTA 3DP8A 1ZJLA 3T9XB 4ZE9A 2UYFA 1AH5A 2RCAA 2QJEA 3RY3A 1OVBA 1PC3A 1URSA 4L17A 4NTLA 1UTBB 4XKNA 1PEBA 3IO4A 4G8NA 5TP9B 4ECFA 3OXNA 3G7WA 3RQTA 2XXIA 3U92A 5I57A 1B0HA 1LFIA 4IGRA 4EXLA 2FA7A 3QUJA 4QFNA 3G3FA 5BWJA 1UIUA 3IJXB 1FW0A 2XHDA 3OO6A 1PB7A 2OK2A 3QK6A 4OTEA 2UVHA 3ECRA 4H1XA 3MQ9A 2DQVA 3I6VA 4U2RA 3VVFA 1B3LA 3OSQA 5CBRA 1PB8A 4O3CA 4R2FA 2D5WA 4RJZA 3A09A 3RLFE 5FHNA 4F18A 4RK2A 3H6VA 1OMPA 3O66A 1US4A 3CVGA 3PPPA 3TPAA 4NF4A 1B46A 1SDXA 2A5SA 2NXOA 4LP2B 4R75A 3U8QA 1BLFA 4RPOA 3IOVA 2HQ0A 3UORA 1Y3PA 3KEIA 4NE4A 4KI0E 3T66A 4XKRA 4DLDA 3K6VA 4WXJA 2P1SA 5TP9A 4IO2A 5CBSA 4FE8A 5AA3A 1IXCA 3C34A 1JNFA 1MXWA 3MUQA 4GFRA 1B4HA 1TT1A 4F2OA 1H43A 3MVZA 4XXUA 2BJJX 5KCJA 5ITOA 3RT6B 3ILUB 4LQ2A 1MQIA 1SW2A 3E9XA 3QXMA 3Q29A 1Z7NE 2NOOA 4HCYA 1S9TA 2I0BA 1DTGA 3H3GA 2XXTA 2VOZA 2Y7KA 4OWDA 1M5CA 3MW0A 3PMXA 1MXUA 4EF2A 1AOVA 4OZ9A 2V3QA 1DTZA 1IQ7A 4YKJA 1ATGA 5JEIA 1B7ZA 4R72A 3IB1A 2Q8JA 3T96B 1GGGA 3O6IA 2ONKE 3KGCA 4JWXA 1B58A 2LAOA 2ZNSA 3DLNA 4MFIA 5H8FB 2XXPA 1NNFA 2REJA 3OO8A 3PPQA 4I62A 2ZYKA 1MQHA 4QSCA 1Y3QA 3O6HA 1QW0A 5DEXA 4G4PA 2YJPA 1B0LA 1P1UA 5H8FA 4U23A 5TPAA 3MBPA 4OERA 3UP9A 1LB9A 3BFUA 1H76A 3TTMA 1QUIA 4I9DA 1O64A 1TFAA 4RNSA 1D4NA 3BBRA 4F3SA 5ICQA 4PQJA 4R9FA 2D21A 3H6TA 5AA1A 5L8DA 5EHSA 2B65A 2XXXA 2R71A 2XX9A 3C32A
chains in the Genus database with same CATH superfamily
2CZHA 5AE4A 3MWBA 3TQWA 3KJTA 3N6UA 4O8MA 1B51A 1NMUA 1S7YA 2HAVA 4ZEFA 2PT1A 3P7IA 1D3KA 3KOTA 2Y84A 4MMPA 1IXIA 4ZZAA 1B3FA 2RC8A 3ZS6A 4F3BA 4ELOA 3TUSA 2RC9A 2O1LA 3TEPA 3TKDA 5DEXB 4QF9A 2H25A 2F78A 4G2ZA 1FPIA 2HCAA 4P0IA 4Q5TA 1N04A 2HXWA 1VDWA 2F7BA 2AL5A 3FVOA 4GWWA 4NF6A 4C0RA 4IO6A 2F97A 4PF8A 4KHZE 4N13A 5JTYB 1Q1KA 2Z23A 1Y20A 3MP8A 2P3NA 3CFXA 4E0WA 4GRKA 3W9WA 1FPLA 1H3DA 2PX1A 2QMWA 3K6XA 2DYXA 2UYEA 4MNCA 4PBQA 4RYAA 1A99A 2HZKA 5I56B 4XTCQ 1MG1A 5F7VA 4PFTA 3PMVA 4KYSA 5HPQA 4AQ4A 5LOMA 1FTOA 4ZZEA 3RT8A 1TXFA 3EHTA 1SYIA 3R26A 1NH7A 2HEUA 2AIXA 1DCUA 4TLLB 3MC2A 1EZPA 1NUYA 2DE2A 4N81A 3ONMA 4G77A 3QAXA 5EYFA 1NNKA 2V3UA 4MNPA 3H6WA 5AA2D 3LSXA 3V89B 4LUBA 2Y5LA 3CIJA 3C35A 2DVCA 4OVJA 3H03A 3W15C 1UQWA 4ZECA 5B70A 2WYPA 3QYTA 2FIXA 4KXPA 1SYHA 1Q9DA 2V3TA 3IX1A 2H5YA 1LAHE 3HO7A 2R8TA 1HSJA 1R9QA 2OWTA 4FAJA 4OVSA 1G0IA 4DCXA 1DPPA 4R9GA 4NF5A 2UVJA 5I7IA 2M8CA 4F3GA 1NUZA 2D3IA 4NWDA 1SW5A 1M5BA 4GVOA 5DVFA 4OVQA 1ZBMA 4IO3A 4NEDA 3VXCA 1J1NA 3U65A 3ZSFA 1YXIA 1PBQA 3H6UA 1Y4TA 5CMMA 1LEVA 4OFJA 2Y5KA 2OWZA 1OLAA 3T93B 4ZEDA 5FTHA 5I3SA 1MQDA 4ZDMA 1HSEA 4WEDA 3K0VA 1SI0A 2OZZA 3M3LA 3K1NA 1MY2A 2QRYA 1II5A 3OO9A 3TTLA 1OIBA 2WEFA 1YAEA 4ZS9A 4PE3A 5EQ8A 3C31A 1VFEA 2GRVA 5IAIA 4FEDA 4OMBA 3O29A 1MS7A 1NUXA 3USDA 5T3JA 3UA8A 1B5HA 1LLSA 3V5AA 3EQ1A 2OLBA 4YB7A 3FATA 3TELA 1KA0A 2ZZXA 4PGNA 3SEVA 3OEMA 1QGXA 1XS5A 2B4MA 1YZ0A 3PPOA 5M2VA 1K9YA 3LSWA 3ODBA 5ET6A 2ZYOA 4G61A 1FSAA 4R73A 4E0XA 4PF6A 2AL4A 2NVUB 4DE8A 3VLWA 4FATA 4LZ5A 3V8XB 2XWOA 1N7XA 3VVDA 4X9TA 1B32A 3B7DA 4GX3A 3SKPA 4BDLA 5LDZA 1FQAA 3VVEA 5KZTA 4G8HA 3T9HB 1B9JA 2I3WA 3OELA 2KR0A 4X48A 4PFWA 3FXUA 2IEEA 1FQFA 3H4ZA 1Y1MA 4U21A 4XKQA 2F7AA 3KC1A 1FPGA 5BUUA 4ZEIA 3TFLA 3H7MA 3QSLA 4LQ5A 3G3KA 3KZGA 4PTKA 1B1XA 1POY1 1A8EA 3ILTB 1MXYA 1F9BA 5IM2A 4AS4A 4H8IA 5DVJA 2F3BA 4LZ8A 5H8HB 3A3UA 2PT2A 2HFBA 4DXBA 3EHSA 4YKKA 1A8FA 3KOSA 1ZKBA 4QFKA 5CC2A 3OOAA 1RYXA 4QRZA 4PAFA 3CG1A 4PP0A 5I2NB 1NL5A 1G0HA 2XA5A 1B5IA 2VD2A 4LONB 2RKMA 2Q88A 4ZEBA 5HM4B 5IKBA 2RC7A 5J1DA 4KD5A 1UTHB 4IGTA 3DP8A 3T9XB 3RY3A 1AH5A 2RCAA 2XXKA 1PEBA 3RQTA 5I57A 4IGRA 4EXLA 4MCOA 4AS5A 5BWJA 3IJXB 4N15A 3OO6A 1PB7A 4U2RA 5CBRA 1PB8A 3RLFE 4NX1A 3H6VA 3TPAA 4NF4A 4LP2B 3U8QA 1NV0A 4RPOA 4NE4A 4WXJA 1FJ6A 5AA3A 3C34A 1JNFA 1MXWA 5IZ1A 1B4HA 4F2OA 5ITOA 3ILUB 5F24A 5J16A 5A5LA 1SW2A 3H3GA 1M5CA 3MW0A 3PMXA 1FBFA 4OZ9A 1IQ7A 1ATGA 5JEIA 2FVZA 4PFRA 1NV5A 3T96B 1GGGA 1B58A 3DLNA 5H8FB 3OO8A 1XI6A 4I62A 4QSCA 3O6HA 1P1UA 5EYGA 4GBVA 1TFAA 4N8YA 4R9FA 2B65A 2R71A 5IZ3B 4DI4B 4F19A 2HZLA 1VFDA 3DELB 4OVRA 2Z8FA 1I6AA 3IOWA 1FJ9A 3ZKKA 5B7DA 1XC1A 4KPTA 2B3BA 2Y7RA 3LR1A 5FHOA 2NWJA 1IZ1A 1M5FA 3EHUA 4HE0A 2CZLA 4GX4A 3SEUA 1OLCA 4GIZA 3E79A 4IO4A 4H8JA 5F1QA 3R7XA 3PD9A 2FIEA 4JSDA 3KBZA 3IOUA 5FTIA 3JV9A 4BLAA 4F31B 4LVQA 4HS7A 4QFLA 1ELJA 5I2NA 1SQYA 4PAIA 4PFYA 1JETA 1LGBC 4OETA 3HHGA 3S4UA 4H5FA 1LFGA 3D1RA 4FORA 3NOHA 4OA4A 3SZPA 5LTCA 2IA4A 4YZZA 2FYIA 3VXBA 5H8QB 1WVJA 2QS2A 4G68C 4C1TA 3EKIA 3T1BA 3F11A 1FTMA 2Q8MA 2E0SA 4K3FA 1KZ8A 2Z8EA 4YKIA 2DS9A 4ONYA 1MY4A 3GLBA 2OBGA 5I56A 1IITA 2XX7A 3K6UA 1JVYA 1N3WA 3CFLA 3B6QA 2DVZA 4EDPA 3W9VA 3GBBA 4FEBA 1KWHA 2WYKA 3SEXA 1XVXA 1LAXA 2DXRA 1N84A 2QVUA 2XD2A 4X1DA 2X26A 4OEUA 4NAPA 1FBGA 1D9QA 4P3LA 3FBPA 3O6GA 4U22A 4DI3D 1M5DA 1QUKA 4G8MA 4ZEKA 3IL1B 2V4CA 2YPNA 3VV5A 3K2DA 1MPDA 4NF8B 2QPQA 4F1VA 1NV6A 2X7QA 2F7CA 1I6QA 2ESNA 4PBHA 4JWYA 4GL8A 1RYOA 4ELQA 3TDJA 4GXSB 4MEVA 3TYHA 2THIA 4X8RA 2UVGA 3OD7A 2WX9A 4ISUA 1B4ZA 4UABA 3S9MC 1URGA 2Q2CA 1IMEA 4Q8RA 3CR9A 1XVYA 1NH8A 2F35A 3KFMA 3N26A 2DDKA 3I3VA 3FIRA 4C1UA 2VP1A 4M4GA 3E4RA 4O3AA 5H8NB 4IO7A 3KJ7A 5I57B 4GOTA 4ELRA 4MBPA 1SW1A 4OESA 1GVCA 2O69A 4MLVA 2V84A 4NWCA 1MH3A 3BIHA 1RDYA 3LSLA 3RUMA 4QHQA 1LFHA 4H46A 1DMBA 2GFEA 3TZAA 3PU5A 5AA4B 2F36A 2XWIA 3HV1A 1INPA 1I6BA 4THIA 5I58B 4F39A 3BKIB 3WAFA 5JK4A 4IY5A 5H8HA 4BDNA 2ZZWA 3TTKA 3HCQA 1MXXA 2ONSA 4YB5A 3OSRA 1B52A 2VD3A 4HXVA 2F6GA 3FVGA 4POXA 1Q35A 2ZZVA 1B05A 1MPBA 1FTJA 3FVNA 1R1NA 5ET5A 2NUVA 4U1OA 1P1QA 2ZNUA 3PUZE 2QL3A 4AB6A 1EYKA 1YCJA 3GZGA 5I5PA 4OFLA 4X1BA 2ZXTA 3MAMA 4KQPA 1LB8A 4N6DA 3FXBA 1B3EA 1PDAA 3CSBA 3UK4A 1OQHA 3VLVA 4GLIA 3MSTA 2B3FA 3PGFA 3HPIA 2WBDA 4H6DA 2DXYA 3C36A 2V93A 4H0WA 2O7IA 2KLFA 2Y7IA 3C4MA 1UIVA 4QSDA 2AYSA 3L6HA 3KN7A 4YU0A 2I4BA 4DCYA 4KYEA 4DXCA 3KSXA 1QKAA 5K2YA 4GL0A 2Q9TA 1HSLA 2Q89A 3U93A 3OENA 2XD3A 2GQ1A 1DSNA 4IY6A 3RTFB 1R9LA 1B40A 5TPAB 3VE1B 2HXRA 4MH5A 3IK6B 1FQCA 3MVXA 1QULA 1EZOA 2V25A 1MDQA 1XHYA 2B4LA 2O68A 1D9YA 4JWOA 2H4IA 4DDDA 1YPNA 4IB2A 5FBPA 3O97A 1A40A 3Q26A 2PMSA 5DW8A 2DE4A 1A54A 1QUJA 4JDFA 1OVBA 4NTLA 5TP9B 1URSA 4L17A 1UTBB 4G8NA 3B50A 3U92A 2FA7A 3G3FA 1FW0A 3QK6A 2OK2A 1DK4A 2UVHA 2DQVA 3I6VA 3A09A 1FPBA 5FHNA 4F18A 1B46A 2NXOA 3KC0A 4R75A 2HQ0A 4NG7A 3E78A 3T66A 4KI0E 4XKRA 2P1SA 5TP9A 1IXCA 4MJOA 3LUZA 3MVZA 4XXUA 2BJJX 1LBYA 4LQ2A 4QBAA 3Q29A 2NOOA 4HCYA 2I0BA 1DTGA 1FBHA 4MAGA 1KA1A 1MXUA 4PDHA 4R72A 3IB1A 3KGCA 4MFIA 2XXPA 1Y3QA 5DEXA 4G4PA 2YJPA 5H8FA 5TPAA 4OERA 3UP9A 1LB9A 2F3DA 3BFUA 3BBRA 4F3SA 5AA1A 2XXXA 4IR8A 1JW1A 4GF8A 4MF3A 4BDOA 1M5EA 3HSTA 2F8DA 1NNPA 1ANFA 5KDTB 4MIJA 1EYJA 4JVDA 2OX3A 4JSOA 3O9PA 2W7YA 1FTKA 4F1UA 3C33A 1O63A 2DOJA 2XWVA 4Q30B 4LA9A 4XIGQ 4NN3A 4BDQA 4YMBA 1DPEA 3S2VA 4FIMA 4QSEA 2XXVA 4Z7EA 1PB9A 4QXDA 2MKZA 2Y7PA 5ET7A 3A3CA 3MZ1A 3FJGA 4I3YA 4DXUA 4GD5A 3B8BA 5CMBA 4HCWA 1OQGA 1LBWA 3VLUA 1L5TA 2F5XA 2CEXA 4RXLA 4ZE8A 2CMOA 3SEYA 2OJTA 4PE5B 3TAJA 4KCDA 1CB6A 2OWSA 4P1LA 2ONRA 3BIGA 1NV7A 3GXAA 3VFJA 2RINA 4N6PA 4EQ9A 1ZTYA 1T0KA 1H45A 1AWBA 3MJNA 4NQ8A 4KFQA 4TQUQ 1N76A 3SETA 3MP1A 3FD3A 2QS1A 1P1NA 2I49A 4U4XA 1JW5A 4P47A 3UIFA 3K02A 4F1YA 4EQ7A 4BDMA 2Z22A 1ZIUA 3UGWA 4G68A 4GQOA 3CHGA 2A5TB 5L9MA 2ABHA 2PCRA 4P11A 3VDFA 3IAZA 4TOZA 1MXVA 4PC9A 1MY1A 4QFPA 4I40A 2QFLA 4UA8A 1POTA 2ZYMA 1AL3A 2XXHA 1FPKA 1GR2A 4PCDA 1VSOA 3PTYA 3AXFA 1WDNA 4P9KA 3LC8A 3N5LA 5ISUA 2UVIA 4OENA 2WKYA 1IMCA 5A5XA 4GWSA 2R6GE 3RPLA 5I59A 1LBBA 3IOTA 4PDDA 5I59B 1OVTA 1DBZA 1LCTA 5EQ9A 1NNTA 5EYHA 2DWIA 5CI5A 3K1MA 2XX8A 4GXAA 1N7WA 3BFTA 1YYZA 3CFZA 1BK4A 4HTGA 5IZ3A 2ALUA 1NKXA 2DWJA 4X04A 5HBCA 1JP4A 2F34A 3FV1A 3OO7A 3PUXE 3G3IA 4OEVA 3Q25A 3SDFA 1LBXA 3JYRA 1QKBA 3RNNA 1IUDA 2H99A 3MZ9A 1JW4A 2O7UA 3ISPA 1LCFA 4G68B 3FVKA 4UACA 2CEYA 1VE4A 4NHBA 4YMAA 4XEQA 5DVIA 2ZYNA 2REGA 1FBCA 4QFOA 3DP6A 3N94A 4NGUA 4NMYA 4JXIA 4N07A 3H06B 2O1MA 3I5OA 3IB2A 3ZKLA 1O7TA 1MQJA 4IO5A 2DSFA 1NV4A 4H45A 4WEPA 1BP5A 1NFTA 3T22A 5I58A 2HPGA 1R6ZA 3S9LC 3HHFA 1B3GA 4DIGA 1AMFA 4OVPA 3RGYA 3N6TA 1MDP1 2Q74A 1SPIA 1FPEA 3LBSA 3JZJA 1USYH 3GYYA 4AB5A 5ELVA 4P56A 2XXWA 1SBPA 3G3HA 1USYE 3K4UA 4FJPA 1A55A 1ZLQA 3SESA 2I4CA 1IEJA 3G3GA 3IO6A 3RTWB 2O6AA 4U1ZA 3U94A 4GWUA 4WKMA 3FV2A 1TWYA 2GHBA 2QVVA 2GHAA 4DZ1A 1FBDA 1JVXA 3LUYA 3KBRA 3QIMA 2OCUA 1MPCA 3MYUA 3CG3A 4JVIA 4FBPA 1GTKA 4XKPA 1YTVA 1SD3A 3WAEA 4Z0IA 3GBAA 1LSTA 1CE2A 5I2KA 1MRPA 2E1SA 3RYDA 5CM6A 3TODA 2QVRA 3OMBA 4OHNA 2VT5A 1B2HA 2G29A 2O51A 1RKMA 3PUYE 3S9EA 4BDRA 2QS4A 2UXAA 3A29A 3UN6A 1BIYA 1FRPA 3THIA 1IMAA 2UYFA 2FBPA 4EQBA 4XKNA 3IO4A 2WBBA 1LFIA 3QUJA 4QFNA 2PFZA 1UIUA 2XHDA 3ECRA 3VVFA 3MQ9A 1B3LA 3OSQA 2D5WA 4RK2A 1OMPA 3O66A 3PPPA 4GWZA 2A5SA 3UORA 1Y3PA 3KEIA 3K6VA 4P8BA 4FE8A 1K9ZA 1TT1A 5KCJA 1MQIA 3QXMA 1NV2A 2XXTA 2Y7KA 1AOVA 1FTAA 2CZKA 1B7ZA 3O6IA 2ONKE 3T0JA 1NNFA 1MQHA 4XFEA 4U23A 3TTMA 1QUIA 5EQ7A 4PQJA 2D21A 1IMFA 1EYIA 3H6TA 5L8DA 5EHSA 3D4GA 3C32A 3MPLA 3PMWA 3U1OA 4ESWA 5CRYA 2VPOA 4RK9A 2HAUA 1IXHA 1PBPA 4R74A 2I58A 4U4SA 1FQDA 3TQLA 3EF7A 3E13X 4F29A 4HE1A 4OYVA 2JJKA 4HE2A 2DWHA 3RPWA 5L9SA 2PVUA 2G93A 4PFUA 4YICA 2QMXA 1FPDA 3V83A 3CSGA 4NF8A 4R6HA 1H44A 3PPRA 5IGAA 1ZMGA 2GH9A 5K2XA 3PD8A 1EU8A 3O2AA 2ANJA 1I69A 3S9NC 2VPNA 1MY3A 2PYYA 4NF6B 3LSFB 5CMCA 3E3KA 3FXRA 4ELPA 1JEUA 4H65A 4PFIA 3Q28A 1IMDA 1FQEA 1JEVA 1LBZA 3LV0A 1IXGA 2Q2AA 2ZMBA 1XOCA 2DE3A 5JTYA 3T9VA 1N3XA 1WODA 1P1WA 2X7PA 1IIWA 3TTRA 5DTBA 3FUZA 4GBWA 3TCFA 2I48A 1Y3NA 4I8CA 1FBPA 2Z8DA 4N8GA 4NF0A 3FXQA 1LBCA 2VGQA 1QJMA 1SVXB 2ZNTA 4LN5A 3CRBA 3IJOB 3EN3A 4N4UA 2XWKA 2PBWA 3IR1A 5ITPA 1B7HA 3U72A 4HW8A 2O84X 4OVTA 2HHMA 4JBZA 1D9VA 3MP6A 1LAFE 5H8NA 1RDXA 1MM6A 4GWYA 1US5A 3KN3A 2P0SA 2CZIA 5KCJB 4R6YA 3FASA 1RDZA 3SEWA 4F22A 5ICTA 3TMGA 1Z7ME 4EXKA 3QUFA 3EPEA 5DYHA 3K00A 1N0TA 1LAGE 1Y1ZA 2DWAA 1SI1A 2QSXA 4EUOA 1EH3A 5A5XB 4TLMB 4GX6A 2P2AA 4XF5A 4OANA 5KDTA 3TCHA 5ET8A 4MX6A 4R2BA 1LBVA 5IZZA 3M8UA 4I3EA 2XXYA 4FECA 4NF4B 2R9JA 2H98A 3IORA 3L6GA 1JQFA 4H67A 2I6EA 2VHAA 3TCGA 5TU0A 3KG2A 4RA1A 1VR5A 5ESYA 3KN8A 3PUWE 3PPNA 2XXQA 3HN0A 3PV0E 1AIVA 1DOTA 2I3VA 3IFCA 4KR5A 1FBEA 1BKAA 1FCKA 2QS3A 3DM0A 3Q27A 5CMKA 4Q0CA 1NV1A 1SW4A 2FHYA 4PETA 4EF1A 1B1HA 1FTLA 4YKPA 1Y9UA 3O28A 3C9HA 4POWA 4F3PA 1B3HA 4OXVA 3G3JA 4I1DA 1ZU0A 1MH4A 3T9UA 4ND9A 3KSJA 2FNCA 1EZ9A 3TTNA 3R6UA 3FJ7A 4P1EA 3CI8A 4MNIA 5AA2B 5I84A 1S50A 2XXRA 1XT8A 3B6TA 1MM7A 4O94A 5FHMA 1FPFA 1Y4CA 5AA4A 1CNQA 3MPKA 1MXZA 2RCBA 3DP4A 4JVCA 1B6HA 4YAHX 1B5JA 2KQZA 1BTJA 2P3VA 3K1PA 4OFOA 1TFDA 4PGPA 5I2KB 4PFBA 2BJIA 1A7LA 1NI9A 1GV8A 4O3BA 4RY1A 5AA2A 4KCCA 2PFYA 3IB0A 2XXUA 3M3FA 3FGSA 4LATA 3RN8A 4M1VA 4YB6A 3OEKA 1FQBA 2I0CA 4LZ7A 4O7IA 3MVYA 4NF5B 3FJMA 4N91A 3SERA 4ESXA 3MVWA 3M3KA 4P0GA 3IFAA 3K6WA 1P1OA 1P99A 1MQGA 2F6PA 2DP8A 4N6KA 5H8QA 3MZBA 1MY0A 2RF1A 3K01A 4MLQA 5EHMA 3D4CA 1NV3A 1URDA 4GWOA 1UTBA 4GWXA 4R6KA 2A5TA 5L9OA 1UTHA 1QVSA 5H8SA 4KYDA 4OQOA 2YLNA 4RPNA 5EQAA 2H9BA 4N17A 5DT6A 3QMFA 4PAKA 1B7UA 3FZVA 4F2QA 3PUVE 2Y7WA 4H5GA 3B6WA 1ZJLA 4ZE9A 1FPJA 2QJEA 1PC3A 4ECFA 3OXNA 3G7WA 2XXIA 1B0HA 4OTEA 4H1XA 4MHFA 4O7MA 4RJZA 4O3CA 4R2FA 3ROJA 1US4A 3CVGA 1SDXA 1BLFA 3IOVA 4DLDA 1IMBA 4IO2A 5CBSA 4GFRA 3MUQA 1H43A 3RT6B 3E9XA 1Z7NE 1S9TA 2VOZA 4OWDA 4EF2A 2V3QA 3RPLB 1DTZA 4YKJA 3HFUA 2Q8JA 4JWXA 2LAOA 2ZNSA 1NUWA 2REJA 3PPQA 2ZYKA 2L5VA 1QW0A 1B0LA 3MBPA 1H76A 4I9DA 1O64A 4RNSA 1D4NA 5ICQA 2XX9A 4JB7A
chains in the Genus database with same CATH topology
4F19A 2HZLA 3MPLA 5AE4A 1JW1A 3PMWA 4GF8A 4MF3A 3U1OA 4BDOA 1VFDA 1M5EA 3MWBA 3KJTA 5CRYA 3TQWA 3N6UA 4ESWA 3HSTA 4RK9A 3DELB 2F8DA 2HAUA 1IXHA 2Z8FA 1NNPA 1B51A 1PBPA 4R74A 2I58A 1NMUA 4U4SA 1S7YA 1ANFA 1I6AA 2HAVA 2PT1A 4ZEFA 5KDTB 1FQDA 3TQLA 3P7IA 1D3KA 3IOWA 3KOTA 2Y84A 3ZKKA 3EF7A 5B7DA 1IXIA 1XC1A 4JSOA 4KPTA 4ZZAA 3E13X 4F29A 1B3FA 2B3BA 2RC8A 2Y7RA 3LR1A 5FHOA 2NWJA 1IZ1A 1M5FA 2W7YA 3O9PA 4OYVA 3EHUA 3ZS6A 4F3BA 1FTKA 4ELOA 2DWHA 2CZLA 3TUSA 4F1UA 3SEUA 2RC9A 3C33A 3RPWA 2O1LA 3TEPA 1O63A 2DOJA 4Q30B 3TKDA 4LA9A 5L9SA 2PVUA 2G93A 4PFUA 4XIGQ 5DEXB 4QF9A 2H25A 2F78A 1OLCA 4GIZA 4G2ZA 4YICA 4BDQA 2QMXA 4IO4A 2HCAA 4P0IA 3V83A 3CSGA 1N04A 2HXWA 4H8JA 4Q5TA 4NF8A 4R6HA 4YMBA 5F1QA 1H44A 1DPEA 3S2VA 3PPRA 2F7BA 2AL5A 3R7XA 3FVOA 4NF6A 1ZMGA 4FIMA 2GH9A 4C0RA 4QSEA 2XXVA 4Z7EA 5K2XA 3PD8A 3PD9A 4IO6A 1PB9A 4JSDA 2F97A 1EU8A 3O2AA 2Y7PA 4KHZE 2ANJA 3IOUA 5FTIA 3JV9A 3A3CA 1I69A 3MZ1A 4BLAA 4F31B 4N13A 5JTYB 3FJGA 3S9NC 1Q1KA 2Z23A 4DXUA 1Y20A 3MP8A 4GD5A 4HS7A 4LVQA 4QFLA 5CMBA 1MY3A 3CFXA 4E0WA 1ELJA 2PYYA 4GRKA 4HCWA 4NF6B 5I2NA 3LSFB 5CMCA 1SQYA 3E3KA 3FXRA 3W9WA 1OQGA 4PFYA 1L5TA 2F5XA 1JETA 3VLUA 4ELPA 1LGBC 4RXLA 4ZE8A 1JEUA 4H65A 2CMOA 3HHGA 4OETA 3S4UA 4H5FA 4ELQA 1H3DA 1LFGA 2PX1A 2QMWA 3K6XA 3Q28A 3SEYA 4FORA 2OJTA 1FQEA 1JEVA 4PE5B 3TAJA 2DYXA 2UYEA 1IXGA 4KCDA 1CB6A 4RYAA 2Q2AA 1A99A 2HZKA 2OWSA 1XOCA 2ZMBA 2DE3A 2IA4A 4YZZA 5I56B 4XTCQ 1MG1A 2ONRA 5F7VA 1N3XA 3T9VA 1WODA 1P1WA 5JTYA 2X7PA 4PFTA 2FYIA 1IIWA 3GXAA 3PMVA 3VFJA 2RINA 3VXBA 3TTRA 5DTBA 3FUZA 4N6PA 5H8QB 4KYSA 4EQ9A 5HPQA 1ZTYA 4AQ4A 1WVJA 5LOMA 1T0KA 1H45A 3TCFA 1FTOA 2I48A 2QS2A 4ZZEA 4G68C 4C1TA 3RT8A 1TXFA 3MJNA 4KFQA 4TQUQ 3EHTA 3F11A 1SYIA 1Y3NA 2Z8DA 3R26A 4I8CA 1N76A 3FXQA 3SETA 1FTMA 3MP1A 3FD3A 1LBCA 1NH7A 2E0SA 2QS1A 1P1NA 2VGQA 4K3FA 1QJMA 2Z8EA 2HEUA 2DS9A 1SVXB 2ZNTA 4ONYA 3CRBA 2AIXA 4YKIA 1MY4A 2I49A 4TLLB 4U4XA 1JW5A 3GLBA 2OBGA 3IJOB 5I56A 1IITA 2XX7A 3MC2A 3EN3A 3K6UA 3UIFA 1EZPA 2DE2A 2PBWA 3ONMA 1JVYA 1N3WA 3K02A 4G77A 3CFLA 3QAXA 3IR1A 5ITPA 5EYFA 1NNKA 2V3UA 1B7HA 2DVZA 3B6QA 5TU0A 3GBBA 3U72A 3W9VA 4EDPA 4EQ7A 4F1YA 5CMKA 4BDMA 3H6WA 2Z22A 5AA2D 1ZIUA 3UGWA 4FEBA 1KWHA 3LSXA 4G68A 4GQOA 2A5TB 4HW8A 5L9MA 2ABHA 3V89B 4P11A 3SEXA 2O84X 1XVXA 1LAXA 3IAZA 4TOZA 3VDFA 2DXRA 1N84A 4LUBA 2XD2A 4JBZA 1MXVA 4X1DA 1D9VA 2X26A 3CIJA 3MP6A 3C35A 1LAFE 4OEUA 1MY1A 5H8NA 2DVCA 4OVJA 3H03A 3W15C 4QFPA 1UQWA 4ZECA 4UA8A 5B70A 1MM6A 1US5A 1POTA 2ZYMA 3KN3A 3QYTA 1SYHA 1AL3A 2V3TA 2XXHA 3IX1A 2H5YA 1LAHE 3HO7A 3O6GA 2P0SA 4U22A 1M5DA 1QUKA 1GR2A 1HSJA 1R9QA 4G8MA 4ZEKA 3IL1B 2YPNA 5KCJB 3VV5A 4R6YA 1VSOA 3K2DA 1MPDA 4NF8B 2QPQA 2OWTA 3FASA 4FAJA 3AXFA 3SEWA 1WDNA 3LC8A 4F22A 4F1VA 3N5LA 5ICTA 5ISUA 2UVIA 4OENA 2WKYA 2X7QA 3TMGA 4DCXA 1Z7ME 2F7CA 1DPPA 4DIGA 4EXKA 3QUFA 4R9GA 4NF5A 3EPEA 5DYHA 2UVJA 3K00A 1N0TA 1I6QA 2ESNA 5A5XA 2R6GE 2M8CA 4JB7A 1LAGE 5I59A 1LBBA 1Y1ZA 2DWAA 1SI1A 3IOTA 4JWYA 4GL8A 4ZEDA 4F3GA 5I59B 1RYOA 2D3IA 4NWDA 1OVTA 1SW5A 1M5BA 1EH3A 2QSXA 4GVOA 5DVFA 4EUOA 5A5XB 4TLMB 3TDJA 4GXSB 1LCTA 1ZBMA 4IO3A 2P2AA 3TYHA 4NEDA 3TCHA 5KDTA 3VXCA 2THIA 1J1NA 1NNTA 2DWIA 2UVGA 3OD7A 4ISUA 3ZSFA 5CI5A 4EQBA 1B4ZA 3K1MA 4R2BA 3S9MC 1PBQA 1URGA 1Y4TA 1N7WA 2Q2CA 2XX8A 3H6UA 4GXAA 3BFTA 3M8UA 5CMMA 2XXYA 4FECA 3CFZA 4OFJA 4NF4B 4HTGA 2R9JA 4Q8RA 2ALUA 1OLAA 2H98A 1XVYA 1NKXA 3CR9A 1NH8A 1JQFA 2DWJA 2F35A 3IORA 3KFMA 1MQDA 3L6GA 3N26A 5FTHA 5HBCA 1HSEA 4ZDMA 3I3VA 4H67A 2I6EA 2VHAA 3TCGA 4WEDA 3KG2A 2F34A 3FIRA 1SI0A 2OZZA 1VR5A 3FV1A 3K0VA 3K1NA 3KN8A 3M3LA 3PUXE 3PPNA 3PUWE 2XXQA 3G3IA 1MY2A 3HN0A 4OEVA 3Q25A 2VP1A 3SDFA 2QRYA 4M4GA 3E4RA 3PV0E 4O3AA 5H8NB 1II5A 3JYRA 1QKBA 3RNNA 1AIVA 4IO7A 1DOTA 1IUDA 3KJ7A 3OO9A 5I57B 2H99A 2I3VA 1JW4A 3MZ9A 4GOTA 3TTLA 4KR5A 1OIBA 2O7UA 4C1UA 1LCFA 1BKAA 4G68B 1FCKA 1YAEA 3FVKA 2QS3A 4ZS9A 4ELRA 4UACA 3DM0A 4MBPA 1SW1A 1VE4A 3Q27A 4OESA 3C31A 1VFEA 4Q0CA 1SW4A 3OO7A 1GVCA 4YMAA 2GRVA 2O69A 4MLVA 2ZYNA 5DVIA 2V84A 4NWCA 5IAIA 1MH3A 2REGA 4FEDA 4PETA 4OMBA 4EF1A 1B1HA 1MS7A 3O29A 3USDA 3LSLA 3RUMA 4QHQA 4QFOA 1LFHA 1FTLA 4YKPA 3UA8A 1Y9UA 1DMBA 2GFEA 3TZAA 3DP6A 1B5HA 1LLSA 3N94A 3O28A 3C9HA 3PU5A 4POWA 4RA1A 4F3PA 4NMYA 3V5AA 3EQ1A 5AA4B 2OLBA 1B3HA 4JXIA 2F36A 4N07A 4YB7A 3H06B 2O1MA 3HV1A 4OXVA 3FATA 3I5OA 3TELA 3G3JA 3IB2A 3ZKLA 1O7TA 4I1DA 1I6BA 1MH4A 1ZU0A 3T9UA 4THIA 4ND9A 3OEMA 3SEVA 1MQJA 3KSJA 2FNCA 1EZ9A 4IO5A 1XS5A 5I58B 2DSFA 4F39A 3BKIB 4WEPA 3TTNA 3WAFA 5JK4A 1BP5A 1NFTA 3PPOA 3R6UA 5M2VA 3T22A 4IY5A 5H8HA 4BDNA 3FJ7A 3LSWA 5I58A 1R6ZA 3ODBA 3CI8A 3S9LC 3HHFA 3TTKA 1B3GA 2ZYOA 5AA2B 5I84A 3HCQA 1MXXA 1S50A 2ONSA 1XT8A 2XXRA 3D4GA 3B6TA 3OSRA 4R73A 1MM7A 4YB5A 1B52A 4E0XA 5FHMA 1AMFA 2AL4A 2NVUB 4DE8A 3N6TA 2VD3A 1MDP1 2F6GA 3RGYA 3FVGA 3VLWA 1Y4CA 4FATA 4LZ5A 5AA4A 3V8XB 4POXA 3MPKA 1Q35A 3LBSA 1N7XA 1MXZA 3T93B 1B05A 3VVDA 1MPBA 2RCBA 1FTJA 3DP4A 3FVNA 1R1NA 1B6HA 2NUVA 4X9TA 4U1OA 1P1QA 2ZNUA 3PUZE 3JZJA 1B32A 4YAHX 1USYH 3B7DA 2QL3A 1B5JA 4AB6A 3SKPA 1BTJA 3K1PA 4OFOA 4BDLA 1YCJA 1TFDA 1FQAA 5I2KB 3GZGA 4AB5A 5ELVA 3VVEA 2XXWA 5KZTA 4G8HA 4OFLA 4X1BA 1SBPA 2ZXTA 1A7LA 3MAMA 4KQPA 3T9HB 1B9JA 2I3WA 1LB8A 3G3HA 3OELA 4X48A 1GV8A 4O3BA 4PFWA 1USYE 3FXUA 4RY1A 1B3EA 1PDAA 3CSBA 3K4UA 4FJPA 1OQHA 3UK4A 5AA2A 1A55A 2IEEA 1FQFA 1ZLQA 4GLIA 4KCCA 3VLVA 3IB0A 2XXUA 3M3FA 2B3FA 3H4ZA 3FGSA 1Y1MA 4LATA 3SESA 4U21A 3RN8A 4M1VA 3PGFA 4YB6A 3OEKA 3HPIA 1FQBA 2I4CA 1IEJA 2F7AA 4XKQA 3G3GA 2I0CA 4LZ7A 5BUUA 3MVYA 4H6DA 3IO6A 4ZEIA 2DXYA 3C36A 3TFLA 3RTWB 2O6AA 3H7MA 4NF5B 2V93A 3FJMA 4H0WA 2O7IA 4U1ZA 3QSLA 4WKMA 4LQ5A 3U94A 3G3KA 3KZGA 3FV2A 3SERA 4ESXA 1B1XA 1TWYA 3MVWA 2GHBA 2KLFA 2Y7IA 2GHAA 3C4MA 1POY1 3M3KA 1A8EA 4DZ1A 1UIVA 1JVXA 3ILTB 4P0GA 2AYSA 3L6HA 4QSDA 3K6WA 1MXYA 1F9BA 1P1OA 4H8IA 1P99A 3KN7A 1MQGA 3LUYA 4YU0A 2F6PA 5DVJA 2DP8A 2I4BA 3KBRA 4DCYA 4KYEA 4DXCA 3KSXA 4LZ8A 1QKAA 3QIMA 2OCUA 5H8QA 5K2YA 1MPCA 4GL0A 2Q9TA 3MZBA 1HSLA 1MY0A 2Q89A 2RF1A 2PT2A 3A3UA 5H8HB 3U93A 3OENA 2HFBA 3CG3A 3K01A 4MLQA 2XD3A 5EHMA 3D4CA 1GTKA 4DXBA 1URDA 3EHSA 1DSNA 4GWOA 4IY6A 4XKPA 1YTVA 4YKKA 3RTFB 1A8FA 3KOSA 1R9LA 1ZKBA 1B40A 1SD3A 4QFKA 3OOAA 5TPAB 1UTBA 3VE1B 3WAEA 5CC2A 4MH5A 1RYXA 4R6KA 2A5TA 4Z0IA 3IK6B 5L9OA 1UTHA 4QRZA 1QVSA 3GBAA 1FQCA 3MVXA 4KYDA 5H8SA 1LSTA 3CG1A 1QULA 1CE2A 4OQOA 2YLNA 4PP0A 4RPNA 1EZOA 5I2KA 1MRPA 2E1SA 2V25A 2H9BA 5DT6A 5CM6A 1MDQA 1NL5A 1XHYA 2O68A 3TODA 5I2NB 1B7UA 3OMBA 1D9YA 4JWOA 4OHNA 2H4IA 1B2HA 4DDDA 1B5IA 3FZVA 2G29A 2O51A 1RKMA 2VD2A 3PUYE 3S9EA 1YPNA 4BDRA 2QS4A 4IB2A 4F2QA 2UXAA 4LONB 3PUVE 3O97A 2RKMA 2Y7WA 1A40A 2Q88A 3Q26A 3UN6A 4ZEBA 1BIYA 5HM4B 2PMSA 5IKBA 4H5GA 3B6WA 2DE4A 2RC7A 3THIA 1A54A 5J1DA 1QUJA 4JDFA 4KD5A 1UTHB 4IGTA 3DP8A 1ZJLA 3T9XB 4ZE9A 2UYFA 1AH5A 2RCAA 2QJEA 3RY3A 1OVBA 1PC3A 1URSA 4L17A 4NTLA 1UTBB 4XKNA 1PEBA 3IO4A 4G8NA 5TP9B 4ECFA 3OXNA 3G7WA 3RQTA 2XXIA 3U92A 5I57A 1B0HA 1LFIA 4IGRA 4EXLA 2FA7A 3QUJA 4QFNA 3G3FA 5BWJA 1UIUA 3IJXB 1FW0A 2XHDA 3OO6A 1PB7A 2OK2A 3QK6A 4OTEA 2UVHA 3ECRA 4H1XA 3MQ9A 2DQVA 3I6VA 4U2RA 3VVFA 1B3LA 3OSQA 5CBRA 1PB8A 4O3CA 4R2FA 2D5WA 4RJZA 3A09A 3RLFE 5FHNA 4F18A 4RK2A 3H6VA 1OMPA 3O66A 1US4A 3CVGA 3PPPA 3TPAA 4NF4A 1B46A 1SDXA 2A5SA 2NXOA 4LP2B 4R75A 3U8QA 1BLFA 4RPOA 3IOVA 2HQ0A 3UORA 1Y3PA 3KEIA 4NE4A 4KI0E 3T66A 4XKRA 4DLDA 3K6VA 4WXJA 2P1SA 5TP9A 4IO2A 5CBSA 4FE8A 5AA3A 1IXCA 3C34A 1JNFA 1MXWA 3MUQA 4GFRA 1B4HA 1TT1A 4F2OA 1H43A 3MVZA 4XXUA 2BJJX 5KCJA 5ITOA 3RT6B 3ILUB 4LQ2A 1MQIA 1SW2A 3E9XA 3QXMA 3Q29A 1Z7NE 2NOOA 4HCYA 1S9TA 2I0BA 1DTGA 3H3GA 2XXTA 2VOZA 2Y7KA 4OWDA 1M5CA 3MW0A 3PMXA 1MXUA 4EF2A 1AOVA 4OZ9A 2V3QA 1DTZA 1IQ7A 4YKJA 1ATGA 5JEIA 1B7ZA 4R72A 3IB1A 2Q8JA 3T96B 1GGGA 3O6IA 2ONKE 3KGCA 4JWXA 1B58A 2LAOA 2ZNSA 3DLNA 4MFIA 5H8FB 2XXPA 1NNFA 2REJA 3OO8A 3PPQA 4I62A 2ZYKA 1MQHA 4QSCA 1Y3QA 3O6HA 1QW0A 5DEXA 4G4PA 2YJPA 1B0LA 1P1UA 5H8FA 4U23A 5TPAA 3MBPA 4OERA 3UP9A 1LB9A 3BFUA 1H76A 3TTMA 1QUIA 4I9DA 1O64A 1TFAA 4RNSA 1D4NA 3BBRA 4F3SA 5ICQA 4PQJA 4R9FA 2D21A 3H6TA 5AA1A 5L8DA 5EHSA 2B65A 2XXXA 2R71A 2XX9A 3C32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F19 A;  2HZL A;  3MPL A;  5AE4 A;  1JW1 A;  3PMW A;  4GF8 A;  4MF3 A;  3U1O A;  4BDO A;  1VFD A;  1M5E A;  3MWB A;  3KJT A;  5CRY A;  3TQW A;  3N6U A;  4ESW A;  3HST A;  4RK9 A;  3DEL B;  2F8D A;  2HAU A;  1IXH A;  2Z8F A;  1NNP A;  1B51 A;  1PBP A;  4R74 A;  2I58 A;  1NMU A;  4U4S A;  1S7Y A;  1ANF A;  1I6A A;  2HAV A;  2PT1 A;  4ZEF A;  5KDT B;  1FQD A;  3TQL A;  3P7I A;  1D3K A;  3IOW A;  3KOT A;  2Y84 A;  3ZKK A;  3EF7 A;  5B7D A;  1IXI A;  1XC1 A;  4JSO A;  4KPT A;  4ZZA A;  3E13 X;  4F29 A;  1B3F A;  2B3B A;  2RC8 A;  2Y7R A;  3LR1 A;  5FHO A;  2NWJ A;  1IZ1 A;  1M5F A;  2W7Y A;  3O9P A;  4OYV A;  3EHU A;  3ZS6 A;  4F3B A;  1FTK A;  4ELO A;  2DWH A;  2CZL A;  3TUS A;  4F1U A;  3SEU A;  2RC9 A;  3C33 A;  3RPW A;  2O1L A;  3TEP A;  1O63 A;  2DOJ A;  4Q30 B;  3TKD A;  4LA9 A;  5L9S A;  2PVU A;  2G93 A;  4PFU A;  4XIG Q;  5DEX B;  4QF9 A;  2H25 A;  2F78 A;  1OLC A;  4GIZ A;  4G2Z A;  4YIC A;  4BDQ A;  2QMX A;  4IO4 A;  2HCA A;  4P0I A;  3V83 A;  3CSG A;  1N04 A;  2HXW A;  4H8J A;  4Q5T A;  4NF8 A;  4R6H A;  4YMB A;  5F1Q A;  1H44 A;  1DPE A;  3S2V A;  3PPR A;  2F7B A;  2AL5 A;  3R7X A;  3FVO A;  4NF6 A;  1ZMG A;  4FIM A;  2GH9 A;  4C0R A;  4QSE A;  2XXV A;  4Z7E A;  5K2X A;  3PD8 A;  3PD9 A;  4IO6 A;  1PB9 A;  4JSD A;  2F97 A;  1EU8 A;  3O2A A;  2Y7P A;  4KHZ E;  2ANJ A;  3IOU A;  5FTI A;  3JV9 A;  3A3C A;  1I69 A;  3MZ1 A;  4BLA A;  4F31 B;  4N13 A;  5JTY B;  3FJG A;  3S9N C;  1Q1K A;  2Z23 A;  4DXU A;  1Y20 A;  3MP8 A;  4GD5 A;  4HS7 A;  4LVQ A;  4QFL A;  5CMB A;  1MY3 A;  3CFX A;  4E0W A;  1ELJ A;  2PYY A;  4GRK A;  4HCW A;  4NF6 B;  5I2N A;  3LSF B;  5CMC A;  1SQY A;  3E3K A;  3FXR A;  3W9W A;  1OQG A;  4PFY A;  1L5T A;  2F5X A;  1JET A;  3VLU A;  4ELP A;  1LGB C;  4RXL A;  4ZE8 A;  1JEU A;  4H65 A;  2CMO A;  3HHG A;  4OET A;  3S4U A;  4H5F A;  4ELQ A;  1H3D A;  1LFG A;  2PX1 A;  2QMW A;  3K6X A;  3Q28 A;  3SEY A;  4FOR A;  2OJT A;  1FQE A;  1JEV A;  4PE5 B;  3TAJ A;  2DYX A;  2UYE A;  1IXG A;  4KCD A;  1CB6 A;  4RYA A;  2Q2A A;  1A99 A;  2HZK A;  2OWS A;  1XOC A;  2ZMB A;  2DE3 A;  2IA4 A;  4YZZ A;  5I56 B;  4XTC Q;  1MG1 A;  2ONR A;  5F7V A;  1N3X A;  3T9V A;  1WOD A;  1P1W A;  5JTY A;  2X7P A;  4PFT A;  2FYI A;  1IIW A;  3GXA A;  3PMV A;  3VFJ A;  2RIN A;  3VXB A;  3TTR A;  5DTB A;  3FUZ A;  4N6P A;  5H8Q B;  4KYS A;  4EQ9 A;  5HPQ A;  1ZTY A;  4AQ4 A;  1WVJ A;  5LOM A;  1T0K A;  1H45 A;  3TCF A;  1FTO A;  2I48 A;  2QS2 A;  4ZZE A;  4G68 C;  4C1T A;  3RT8 A;  1TXF A;  3MJN A;  4KFQ A;  4TQU Q;  3EHT A;  3F11 A;  1SYI A;  1Y3N A;  2Z8D A;  3R26 A;  4I8C A;  1N76 A;  3FXQ A;  3SET A;  1FTM A;  3MP1 A;  3FD3 A;  1LBC A;  1NH7 A;  2E0S A;  2QS1 A;  1P1N A;  2VGQ A;  4K3F A;  1QJM A;  2Z8E A;  2HEU A;  2DS9 A;  1SVX B;  2ZNT A;  4ONY A;  3CRB A;  2AIX A;  4YKI A;  1MY4 A;  2I49 A;  4TLL B;  4U4X A;  1JW5 A;  3GLB A;  2OBG A;  3IJO B;  5I56 A;  1IIT A;  2XX7 A;  3MC2 A;  3EN3 A;  3K6U A;  3UIF A;  1EZP A;  2DE2 A;  2PBW A;  3ONM A;  1JVY A;  1N3W A;  3K02 A;  4G77 A;  3CFL A;  3QAX A;  3IR1 A;  5ITP A;  5EYF A;  1NNK A;  2V3U A;  1B7H A;  2DVZ A;  3B6Q A;  5TU0 A;  3GBB A;  3U72 A;  3W9V A;  4EDP A;  4EQ7 A;  4F1Y A;  5CMK A;  4BDM A;  3H6W A;  2Z22 A;  5AA2 D;  1ZIU A;  3UGW A;  4FEB A;  1KWH A;  3LSX A;  4G68 A;  4GQO A;  2A5T B;  4HW8 A;  5L9M A;  2ABH A;  3V89 B;  4P11 A;  3SEX A;  2O84 X;  1XVX A;  1LAX A;  3IAZ A;  4TOZ A;  3VDF A;  2DXR A;  1N84 A;  4LUB A;  2XD2 A;  4JBZ A;  1MXV A;  4X1D A;  1D9V A;  2X26 A;  3CIJ A;  3MP6 A;  3C35 A;  1LAF E;  4OEU A;  1MY1 A;  5H8N A;  2DVC A;  4OVJ A;  3H03 A;  3W15 C;  4QFP A;  1UQW A;  4ZEC A;  4UA8 A;  5B70 A;  1MM6 A;  1US5 A;  1POT A;  2ZYM A;  3KN3 A;  3QYT A;  1SYH A;  1AL3 A;  2V3T A;  2XXH A;  3IX1 A;  2H5Y A;  1LAH E;  3HO7 A;  3O6G A;  2P0S A;  4U22 A;  1M5D A;  1QUK A;  1GR2 A;  1HSJ A;  1R9Q A;  4G8M A;  4ZEK A;  3IL1 B;  2YPN A;  5KCJ B;  3VV5 A;  4R6Y A;  1VSO A;  3K2D A;  1MPD A;  4NF8 B;  2QPQ A;  2OWT A;  3FAS A;  4FAJ A;  3AXF A;  3SEW A;  1WDN A;  3LC8 A;  4F22 A;  4F1V A;  3N5L A;  5ICT A;  5ISU A;  2UVI A;  4OEN A;  2WKY A;  2X7Q A;  3TMG A;  4DCX A;  1Z7M E;  2F7C A;  1DPP A;  4DIG A;  4EXK A;  3QUF A;  4R9G A;  4NF5 A;  3EPE A;  5DYH A;  2UVJ A;  3K00 A;  1N0T A;  1I6Q A;  2ESN A;  5A5X A;  2R6G E;  2M8C A;  4JB7 A;  1LAG E;  5I59 A;  1LBB A;  1Y1Z A;  2DWA A;  1SI1 A;  3IOT A;  4JWY A;  4GL8 A;  4ZED A;  4F3G A;  5I59 B;  1RYO A;  2D3I A;  4NWD A;  1OVT A;  1SW5 A;  1M5B A;  1EH3 A;  2QSX A;  4GVO A;  5DVF A;  4EUO A;  5A5X B;  4TLM B;  3TDJ A;  4GXS B;  1LCT A;  1ZBM A;  4IO3 A;  2P2A A;  3TYH A;  4NED A;  3TCH A;  5KDT A;  3VXC A;  2THI A;  1J1N A;  1NNT A;  2DWI A;  2UVG A;  3OD7 A;  4ISU A;  3ZSF A;  5CI5 A;  4EQB A;  1B4Z A;  3K1M A;  4R2B A;  3S9M C;  1PBQ A;  1URG A;  1Y4T A;  1N7W A;  2Q2C A;  2XX8 A;  3H6U A;  4GXA A;  3BFT A;  3M8U A;  5CMM A;  2XXY A;  4FEC A;  3CFZ A;  4OFJ A;  4NF4 B;  4HTG A;  2R9J A;  4Q8R A;  2ALU A;  1OLA A;  2H98 A;  1XVY A;  1NKX A;  3CR9 A;  1NH8 A;  1JQF A;  2DWJ A;  2F35 A;  3IOR A;  3KFM A;  1MQD A;  3L6G A;  3N26 A;  5FTH A;  5HBC A;  1HSE A;  4ZDM A;  3I3V A;  4H67 A;  2I6E A;  2VHA A;  3TCG A;  4WED A;  3KG2 A;  2F34 A;  3FIR A;  1SI0 A;  2OZZ A;  1VR5 A;  3FV1 A;  3K0V A;  3K1N A;  3KN8 A;  3M3L A;  3PUX E;  3PPN A;  3PUW E;  2XXQ A;  3G3I A;  1MY2 A;  3HN0 A;  4OEV A;  3Q25 A;  2VP1 A;  3SDF A;  2QRY A;  4M4G A;  3E4R A;  3PV0 E;  4O3A A;  5H8N B;  1II5 A;  3JYR A;  1QKB A;  3RNN A;  1AIV A;  4IO7 A;  1DOT A;  1IUD A;  3KJ7 A;  3OO9 A;  5I57 B;  2H99 A;  2I3V A;  1JW4 A;  3MZ9 A;  4GOT A;  3TTL A;  4KR5 A;  1OIB A;  2O7U A;  4C1U A;  1LCF A;  1BKA A;  4G68 B;  1FCK A;  1YAE A;  3FVK A;  2QS3 A;  4ZS9 A;  4ELR A;  4UAC A;  3DM0 A;  4MBP A;  1SW1 A;  1VE4 A;  3Q27 A;  4OES A;  3C31 A;  1VFE A;  4Q0C A;  1SW4 A;  3OO7 A;  1GVC A;  4YMA A;  2GRV A;  2O69 A;  4MLV A;  2ZYN A;  5DVI A;  2V84 A;  4NWC A;  5IAI A;  1MH3 A;  2REG A;  4FED A;  4PET A;  4OMB A;  4EF1 A;  1B1H A;  1MS7 A;  3O29 A;  3USD A;  3LSL A;  3RUM A;  4QHQ A;  4QFO A;  1LFH A;  1FTL A;  4YKP A;  3UA8 A;  1Y9U A;  1DMB A;  2GFE A;  3TZA A;  3DP6 A;  1B5H A;  1LLS A;  3N94 A;  3O28 A;  3C9H A;  3PU5 A;  4POW A;  4RA1 A;  4F3P A;  4NMY A;  3V5A A;  3EQ1 A;  5AA4 B;  2OLB A;  1B3H A;  4JXI A;  2F36 A;  4N07 A;  4YB7 A;  3H06 B;  2O1M A;  3HV1 A;  4OXV A;  3FAT A;  3I5O A;  3TEL A;  3G3J A;  3IB2 A;  3ZKL A;  1O7T A;  4I1D A;  1I6B A;  1MH4 A;  1ZU0 A;  3T9U A;  4THI A;  4ND9 A;  3OEM A;  3SEV A;  1MQJ A;  3KSJ A;  2FNC A;  1EZ9 A;  4IO5 A;  1XS5 A;  5I58 B;  2DSF A;  4F39 A;  3BKI B;  4WEP A;  3TTN A;  3WAF A;  5JK4 A;  1BP5 A;  1NFT A;  3PPO A;  3R6U A;  5M2V A;  3T22 A;  4IY5 A;  5H8H A;  4BDN A;  3FJ7 A;  3LSW A;  5I58 A;  1R6Z A;  3ODB A;  3CI8 A;  3S9L C;  3HHF A;  3TTK A;  1B3G A;  2ZYO A;  5AA2 B;  5I84 A;  3HCQ A;  1MXX A;  1S50 A;  2ONS A;  1XT8 A;  2XXR A;  3D4G A;  3B6T A;  3OSR A;  4R73 A;  1MM7 A;  4YB5 A;  1B52 A;  4E0X A;  5FHM A;  1AMF A;  2AL4 A;  2NVU B;  4DE8 A;  3N6T A;  2VD3 A;  1MDP 1;  2F6G A;  3RGY A;  3FVG A;  3VLW A;  1Y4C A;  4FAT A;  4LZ5 A;  5AA4 A;  3V8X B;  4POX A;  3MPK A;  1Q35 A;  3LBS A;  1N7X A;  1MXZ A;  3T93 B;  1B05 A;  3VVD A;  1MPB A;  2RCB A;  1FTJ A;  3DP4 A;  3FVN A;  1R1N A;  1B6H A;  2NUV A;  4X9T A;  4U1O A;  1P1Q A;  2ZNU A;  3PUZ E;  3JZJ A;  1B32 A;  4YAH X;  1USY H;  3B7D A;  2QL3 A;  1B5J A;  4AB6 A;  3SKP A;  1BTJ A;  3K1P A;  4OFO A;  4BDL A;  1YCJ A;  1TFD A;  1FQA A;  5I2K B;  3GZG A;  4AB5 A;  5ELV A;  3VVE A;  2XXW A;  5KZT A;  4G8H A;  4OFL A;  4X1B A;  1SBP A;  2ZXT A;  1A7L A;  3MAM A;  4KQP A;  3T9H B;  1B9J A;  2I3W A;  1LB8 A;  3G3H A;  3OEL A;  4X48 A;  1GV8 A;  4O3B A;  4PFW A;  1USY E;  3FXU A;  4RY1 A;  1B3E A;  1PDA A;  3CSB A;  3K4U A;  4FJP A;  1OQH A;  3UK4 A;  5AA2 A;  1A55 A;  2IEE A;  1FQF A;  1ZLQ A;  4GLI A;  4KCC A;  3VLV A;  3IB0 A;  2XXU A;  3M3F A;  2B3F A;  3H4Z A;  3FGS A;  1Y1M A;  4LAT A;  3SES A;  4U21 A;  3RN8 A;  4M1V A;  3PGF A;  4YB6 A;  3OEK A;  3HPI A;  1FQB A;  2I4C A;  1IEJ A;  2F7A A;  4XKQ A;  3G3G A;  2I0C A;  4LZ7 A;  5BUU A;  3MVY A;  4H6D A;  3IO6 A;  4ZEI A;  2DXY A;  3C36 A;  3TFL A;  3RTW B;  2O6A A;  3H7M A;  4NF5 B;  2V93 A;  3FJM A;  4H0W A;  2O7I A;  4U1Z A;  3QSL A;  4WKM A;  4LQ5 A;  3U94 A;  3G3K A;  3KZG A;  3FV2 A;  3SER A;  4ESX A;  1B1X A;  1TWY A;  3MVW A;  2GHB A;  2KLF A;  2Y7I A;  2GHA A;  3C4M A;  1POY 1;  3M3K A;  1A8E A;  4DZ1 A;  1UIV A;  1JVX A;  3ILT B;  4P0G A;  2AYS A;  3L6H A;  4QSD A;  3K6W A;  1MXY A;  1F9B A;  1P1O A;  4H8I A;  1P99 A;  3KN7 A;  1MQG A;  3LUY A;  4YU0 A;  2F6P A;  5DVJ A;  2DP8 A;  2I4B A;  3KBR A;  4DCY A;  4KYE A;  4DXC A;  3KSX A;  4LZ8 A;  1QKA A;  3QIM A;  2OCU A;  5H8Q A;  5K2Y A;  1MPC A;  4GL0 A;  2Q9T A;  3MZB A;  1HSL A;  1MY0 A;  2Q89 A;  2RF1 A;  2PT2 A;  3A3U A;  5H8H B;  3U93 A;  3OEN A;  2HFB A;  3CG3 A;  3K01 A;  4MLQ A;  2XD3 A;  5EHM A;  3D4C A;  1GTK A;  4DXB A;  1URD A;  3EHS A;  1DSN A;  4GWO A;  4IY6 A;  4XKP A;  1YTV A;  4YKK A;  3RTF B;  1A8F A;  3KOS A;  1R9L A;  1ZKB A;  1B40 A;  1SD3 A;  4QFK A;  3OOA A;  5TPA B;  1UTB A;  3VE1 B;  3WAE A;  5CC2 A;  4MH5 A;  1RYX A;  4R6K A;  2A5T A;  4Z0I A;  3IK6 B;  5L9O A;  1UTH A;  4QRZ A;  1QVS A;  3GBA A;  1FQC A;  3MVX A;  4KYD A;  5H8S A;  1LST A;  3CG1 A;  1QUL A;  1CE2 A;  4OQO A;  2YLN A;  4PP0 A;  4RPN A;  1EZO A;  5I2K A;  1MRP A;  2E1S A;  2V25 A;  2H9B A;  5DT6 A;  5CM6 A;  1MDQ A;  1NL5 A;  1XHY A;  2O68 A;  3TOD A;  5I2N B;  1B7U A;  3OMB A;  1D9Y A;  4JWO A;  4OHN A;  2H4I A;  1B2H A;  4DDD A;  1B5I A;  3FZV A;  2G29 A;  2O51 A;  1RKM A;  2VD2 A;  3PUY E;  3S9E A;  1YPN A;  4BDR A;  2QS4 A;  4IB2 A;  4F2Q A;  2UXA A;  4LON B;  3PUV E;  3O97 A;  2RKM A;  2Y7W A;  1A40 A;  2Q88 A;  3Q26 A;  3UN6 A;  4ZEB A;  1BIY A;  5HM4 B;  2PMS A;  5IKB A;  4H5G A;  3B6W A;  2DE4 A;  2RC7 A;  3THI A;  1A54 A;  5J1D A;  1QUJ A;  4JDF A;  4KD5 A;  1UTH B;  4IGT A;  3DP8 A;  1ZJL A;  3T9X B;  4ZE9 A;  2UYF A;  1AH5 A;  2RCA A;  2QJE A;  3RY3 A;  1OVB A;  1PC3 A;  1URS A;  4L17 A;  4NTL A;  1UTB B;  4XKN A;  1PEB A;  3IO4 A;  4G8N A;  5TP9 B;  4ECF A;  3OXN A;  3G7W A;  3RQT A;  2XXI A;  3U92 A;  5I57 A;  1B0H A;  1LFI A;  4IGR A;  4EXL A;  2FA7 A;  3QUJ A;  4QFN A;  3G3F A;  5BWJ A;  1UIU A;  3IJX B;  1FW0 A;  2XHD A;  3OO6 A;  1PB7 A;  2OK2 A;  3QK6 A;  4OTE A;  2UVH A;  3ECR A;  4H1X A;  3MQ9 A;  2DQV A;  3I6V A;  4U2R A;  3VVF A;  1B3L A;  3OSQ A;  5CBR A;  1PB8 A;  4O3C A;  4R2F A;  2D5W A;  4RJZ A;  3A09 A;  3RLF E;  5FHN A;  4F18 A;  4RK2 A;  3H6V A;  1OMP A;  3O66 A;  1US4 A;  3CVG A;  3PPP A;  3TPA A;  4NF4 A;  1B46 A;  1SDX A;  2A5S A;  2NXO A;  4LP2 B;  4R75 A;  3U8Q A;  1BLF A;  4RPO A;  3IOV A;  2HQ0 A;  3UOR A;  1Y3P A;  3KEI A;  4NE4 A;  4KI0 E;  3T66 A;  4XKR A;  4DLD A;  3K6V A;  4WXJ A;  2P1S A;  5TP9 A;  4IO2 A;  5CBS A;  4FE8 A;  5AA3 A;  1IXC A;  3C34 A;  1JNF A;  1MXW A;  3MUQ A;  4GFR A;  1B4H A;  1TT1 A;  4F2O A;  1H43 A;  3MVZ A;  4XXU A;  2BJJ X;  5KCJ A;  5ITO A;  3RT6 B;  3ILU B;  4LQ2 A;  1MQI A;  1SW2 A;  3E9X A;  3QXM A;  3Q29 A;  1Z7N E;  2NOO A;  4HCY A;  1S9T A;  2I0B A;  1DTG A;  3H3G A;  2XXT A;  2VOZ A;  2Y7K A;  4OWD A;  1M5C A;  3MW0 A;  3PMX A;  1MXU A;  4EF2 A;  1AOV A;  4OZ9 A;  2V3Q A;  1DTZ A;  1IQ7 A;  4YKJ A;  1ATG A;  5JEI A;  1B7Z A;  4R72 A;  3IB1 A;  2Q8J A;  3T96 B;  1GGG A;  3O6I A;  2ONK E;  3KGC A;  4JWX A;  1B58 A;  2LAO A;  2ZNS A;  3DLN A;  4MFI A;  5H8F B;  2XXP A;  1NNF A;  2REJ A;  3OO8 A;  3PPQ A;  4I62 A;  2ZYK A;  1MQH A;  4QSC A;  1Y3Q A;  3O6H A;  1QW0 A;  5DEX A;  4G4P A;  2YJP A;  1B0L A;  1P1U A;  5H8F A;  4U23 A;  5TPA A;  3MBP A;  4OER A;  3UP9 A;  1LB9 A;  3BFU A;  1H76 A;  3TTM A;  1QUI A;  4I9D A;  1O64 A;  1TFA A;  4RNS A;  1D4N A;  3BBR A;  4F3S A;  5ICQ A;  4PQJ A;  4R9F A;  2D21 A;  3H6T A;  5AA1 A;  5L8D A;  5EHS A;  2B65 A;  2XXX A;  2R71 A;  2XX9 A;  3C32 A; 
#chains in the Genus database with same CATH topology
 2CZH A;  5AE4 A;  3MWB A;  3TQW A;  3KJT A;  3N6U A;  4O8M A;  1B51 A;  1NMU A;  1S7Y A;  2HAV A;  4ZEF A;  2PT1 A;  3P7I A;  1D3K A;  3KOT A;  2Y84 A;  4MMP A;  1IXI A;  4ZZA A;  1B3F A;  2RC8 A;  3ZS6 A;  4F3B A;  4ELO A;  3TUS A;  2RC9 A;  2O1L A;  3TEP A;  3TKD A;  5DEX B;  4QF9 A;  2H25 A;  2F78 A;  4G2Z A;  1FPI A;  2HCA A;  4P0I A;  4Q5T A;  1N04 A;  2HXW A;  1VDW A;  2F7B A;  2AL5 A;  3FVO A;  4GWW A;  4NF6 A;  4C0R A;  4IO6 A;  2F97 A;  4PF8 A;  4KHZ E;  4N13 A;  5JTY B;  1Q1K A;  2Z23 A;  1Y20 A;  3MP8 A;  2P3N A;  3CFX A;  4E0W A;  4GRK A;  3W9W A;  1FPL A;  1H3D A;  2PX1 A;  2QMW A;  3K6X A;  2DYX A;  2UYE A;  4MNC A;  4PBQ A;  4RYA A;  1A99 A;  2HZK A;  5I56 B;  4XTC Q;  1MG1 A;  5F7V A;  4PFT A;  3PMV A;  4KYS A;  5HPQ A;  4AQ4 A;  5LOM A;  1FTO A;  4ZZE A;  3RT8 A;  1TXF A;  3EHT A;  1SYI A;  3R26 A;  1NH7 A;  2HEU A;  2AIX A;  1DCU A;  4TLL B;  3MC2 A;  1EZP A;  1NUY A;  2DE2 A;  4N81 A;  3ONM A;  4G77 A;  3QAX A;  5EYF A;  1NNK A;  2V3U A;  4MNP A;  3H6W A;  5AA2 D;  3LSX A;  3V89 B;  4LUB A;  2Y5L A;  3CIJ A;  3C35 A;  2DVC A;  4OVJ A;  3H03 A;  3W15 C;  1UQW A;  4ZEC A;  5B70 A;  2WYP A;  3QYT A;  2FIX A;  4KXP A;  1SYH A;  1Q9D A;  2V3T A;  3IX1 A;  2H5Y A;  1LAH E;  3HO7 A;  2R8T A;  1HSJ A;  1R9Q A;  2OWT A;  4FAJ A;  4OVS A;  1G0I A;  4DCX A;  1DPP A;  4R9G A;  4NF5 A;  2UVJ A;  5I7I A;  2M8C A;  4F3G A;  1NUZ A;  2D3I A;  4NWD A;  1SW5 A;  1M5B A;  4GVO A;  5DVF A;  4OVQ A;  1ZBM A;  4IO3 A;  4NED A;  3VXC A;  1J1N A;  3U65 A;  3ZSF A;  1YXI A;  1PBQ A;  3H6U A;  1Y4T A;  5CMM A;  1LEV A;  4OFJ A;  2Y5K A;  2OWZ A;  1OLA A;  3T93 B;  4ZED A;  5FTH A;  5I3S A;  1MQD A;  4ZDM A;  1HSE A;  4WED A;  3K0V A;  1SI0 A;  2OZZ A;  3M3L A;  3K1N A;  1MY2 A;  2QRY A;  1II5 A;  3OO9 A;  3TTL A;  1OIB A;  2WEF A;  1YAE A;  4ZS9 A;  4PE3 A;  5EQ8 A;  3C31 A;  1VFE A;  2GRV A;  5IAI A;  4FED A;  4OMB A;  3O29 A;  1MS7 A;  1NUX A;  3USD A;  5T3J A;  3UA8 A;  1B5H A;  1LLS A;  3V5A A;  3EQ1 A;  2OLB A;  4YB7 A;  3FAT A;  3TEL A;  1KA0 A;  2ZZX A;  4PGN A;  3SEV A;  3OEM A;  1QGX A;  1XS5 A;  2B4M A;  1YZ0 A;  3PPO A;  5M2V A;  1K9Y A;  3LSW A;  3ODB A;  5ET6 A;  2ZYO A;  4G61 A;  1FSA A;  4R73 A;  4E0X A;  4PF6 A;  2AL4 A;  2NVU B;  4DE8 A;  3VLW A;  4FAT A;  4LZ5 A;  3V8X B;  2XWO A;  1N7X A;  3VVD A;  4X9T A;  1B32 A;  3B7D A;  4GX3 A;  3SKP A;  4BDL A;  5LDZ A;  1FQA A;  3VVE A;  5KZT A;  4G8H A;  3T9H B;  1B9J A;  2I3W A;  3OEL A;  2KR0 A;  4X48 A;  4PFW A;  3FXU A;  2IEE A;  1FQF A;  3H4Z A;  1Y1M A;  4U21 A;  4XKQ A;  2F7A A;  3KC1 A;  1FPG A;  5BUU A;  4ZEI A;  3TFL A;  3H7M A;  3QSL A;  4LQ5 A;  3G3K A;  3KZG A;  4PTK A;  1B1X A;  1POY 1;  1A8E A;  3ILT B;  1MXY A;  1F9B A;  5IM2 A;  4AS4 A;  4H8I A;  5DVJ A;  2F3B A;  4LZ8 A;  5H8H B;  3A3U A;  2PT2 A;  2HFB A;  4DXB A;  3EHS A;  4YKK A;  1A8F A;  3KOS A;  1ZKB A;  4QFK A;  5CC2 A;  3OOA A;  1RYX A;  4QRZ A;  4PAF A;  3CG1 A;  4PP0 A;  5I2N B;  1NL5 A;  1G0H A;  2XA5 A;  1B5I A;  2VD2 A;  4LON B;  2RKM A;  2Q88 A;  4ZEB A;  5HM4 B;  5IKB A;  2RC7 A;  5J1D A;  4KD5 A;  1UTH B;  4IGT A;  3DP8 A;  3T9X B;  3RY3 A;  1AH5 A;  2RCA A;  2XXK A;  1PEB A;  3RQT A;  5I57 A;  4IGR A;  4EXL A;  4MCO A;  4AS5 A;  5BWJ A;  3IJX B;  4N15 A;  3OO6 A;  1PB7 A;  4U2R A;  5CBR A;  1PB8 A;  3RLF E;  4NX1 A;  3H6V A;  3TPA A;  4NF4 A;  4LP2 B;  3U8Q A;  1NV0 A;  4RPO A;  4NE4 A;  4WXJ A;  1FJ6 A;  5AA3 A;  3C34 A;  1JNF A;  1MXW A;  5IZ1 A;  1B4H A;  4F2O A;  5ITO A;  3ILU B;  5F24 A;  5J16 A;  5A5L A;  1SW2 A;  3H3G A;  1M5C A;  3MW0 A;  3PMX A;  1FBF A;  4OZ9 A;  1IQ7 A;  1ATG A;  5JEI A;  2FVZ A;  4PFR A;  1NV5 A;  3T96 B;  1GGG A;  1B58 A;  3DLN A;  5H8F B;  3OO8 A;  1XI6 A;  4I62 A;  4QSC A;  3O6H A;  1P1U A;  5EYG A;  4GBV A;  1TFA A;  4N8Y A;  4R9F A;  2B65 A;  2R71 A;  5IZ3 B;  4DI4 B;  4F19 A;  2HZL A;  1VFD A;  3DEL B;  4OVR A;  2Z8F A;  1I6A A;  3IOW A;  1FJ9 A;  3ZKK A;  5B7D A;  1XC1 A;  4KPT A;  2B3B A;  2Y7R A;  3LR1 A;  5FHO A;  2NWJ A;  1IZ1 A;  1M5F A;  3EHU A;  4HE0 A;  2CZL A;  4GX4 A;  3SEU A;  1OLC A;  4GIZ A;  3E79 A;  4IO4 A;  4H8J A;  5F1Q A;  3R7X A;  3PD9 A;  2FIE A;  4JSD A;  3KBZ A;  3IOU A;  5FTI A;  3JV9 A;  4BLA A;  4F31 B;  4LVQ A;  4HS7 A;  4QFL A;  1ELJ A;  5I2N A;  1SQY A;  4PAI A;  4PFY A;  1JET A;  1LGB C;  4OET A;  3HHG A;  3S4U A;  4H5F A;  1LFG A;  3D1R A;  4FOR A;  3NOH A;  4OA4 A;  3SZP A;  5LTC A;  2IA4 A;  4YZZ A;  2FYI A;  3VXB A;  5H8Q B;  1WVJ A;  2QS2 A;  4G68 C;  4C1T A;  3EKI A;  3T1B A;  3F11 A;  1FTM A;  2Q8M A;  2E0S A;  4K3F A;  1KZ8 A;  2Z8E A;  4YKI A;  2DS9 A;  4ONY A;  1MY4 A;  3GLB A;  2OBG A;  5I56 A;  1IIT A;  2XX7 A;  3K6U A;  1JVY A;  1N3W A;  3CFL A;  3B6Q A;  2DVZ A;  4EDP A;  3W9V A;  3GBB A;  4FEB A;  1KWH A;  2WYK A;  3SEX A;  1XVX A;  1LAX A;  2DXR A;  1N84 A;  2QVU A;  2XD2 A;  4X1D A;  2X26 A;  4OEU A;  4NAP A;  1FBG A;  1D9Q A;  4P3L A;  3FBP A;  3O6G A;  4U22 A;  4DI3 D;  1M5D A;  1QUK A;  4G8M A;  4ZEK A;  3IL1 B;  2V4C A;  2YPN A;  3VV5 A;  3K2D A;  1MPD A;  4NF8 B;  2QPQ A;  4F1V A;  1NV6 A;  2X7Q A;  2F7C A;  1I6Q A;  2ESN A;  4PBH A;  4JWY A;  4GL8 A;  1RYO A;  4ELQ A;  3TDJ A;  4GXS B;  4MEV A;  3TYH A;  2THI A;  4X8R A;  2UVG A;  3OD7 A;  2WX9 A;  4ISU A;  1B4Z A;  4UAB A;  3S9M C;  1URG A;  2Q2C A;  1IME A;  4Q8R A;  3CR9 A;  1XVY A;  1NH8 A;  2F35 A;  3KFM A;  3N26 A;  2DDK A;  3I3V A;  3FIR A;  4C1U A;  2VP1 A;  4M4G A;  3E4R A;  4O3A A;  5H8N B;  4IO7 A;  3KJ7 A;  5I57 B;  4GOT A;  4ELR A;  4MBP A;  1SW1 A;  4OES A;  1GVC A;  2O69 A;  4MLV A;  2V84 A;  4NWC A;  1MH3 A;  3BIH A;  1RDY A;  3LSL A;  3RUM A;  4QHQ A;  1LFH A;  4H46 A;  1DMB A;  2GFE A;  3TZA A;  3PU5 A;  5AA4 B;  2F36 A;  2XWI A;  3HV1 A;  1INP A;  1I6B A;  4THI A;  5I58 B;  4F39 A;  3BKI B;  3WAF A;  5JK4 A;  4IY5 A;  5H8H A;  4BDN A;  2ZZW A;  3TTK A;  3HCQ A;  1MXX A;  2ONS A;  4YB5 A;  3OSR A;  1B52 A;  2VD3 A;  4HXV A;  2F6G A;  3FVG A;  4POX A;  1Q35 A;  2ZZV A;  1B05 A;  1MPB A;  1FTJ A;  3FVN A;  1R1N A;  5ET5 A;  2NUV A;  4U1O A;  1P1Q A;  2ZNU A;  3PUZ E;  2QL3 A;  4AB6 A;  1EYK A;  1YCJ A;  3GZG A;  5I5P A;  4OFL A;  4X1B A;  2ZXT A;  3MAM A;  4KQP A;  1LB8 A;  4N6D A;  3FXB A;  1B3E A;  1PDA A;  3CSB A;  3UK4 A;  1OQH A;  3VLV A;  4GLI A;  3MST A;  2B3F A;  3PGF A;  3HPI A;  2WBD A;  4H6D A;  2DXY A;  3C36 A;  2V93 A;  4H0W A;  2O7I A;  2KLF A;  2Y7I A;  3C4M A;  1UIV A;  4QSD A;  2AYS A;  3L6H A;  3KN7 A;  4YU0 A;  2I4B A;  4DCY A;  4KYE A;  4DXC A;  3KSX A;  1QKA A;  5K2Y A;  4GL0 A;  2Q9T A;  1HSL A;  2Q89 A;  3U93 A;  3OEN A;  2XD3 A;  2GQ1 A;  1DSN A;  4IY6 A;  3RTF B;  1R9L A;  1B40 A;  5TPA B;  3VE1 B;  2HXR A;  4MH5 A;  3IK6 B;  1FQC A;  3MVX A;  1QUL A;  1EZO A;  2V25 A;  1MDQ A;  1XHY A;  2B4L A;  2O68 A;  1D9Y A;  4JWO A;  2H4I A;  4DDD A;  1YPN A;  4IB2 A;  5FBP A;  3O97 A;  1A40 A;  3Q26 A;  2PMS A;  5DW8 A;  2DE4 A;  1A54 A;  1QUJ A;  4JDF A;  1OVB A;  4NTL A;  5TP9 B;  1URS A;  4L17 A;  1UTB B;  4G8N A;  3B50 A;  3U92 A;  2FA7 A;  3G3F A;  1FW0 A;  3QK6 A;  2OK2 A;  1DK4 A;  2UVH A;  2DQV A;  3I6V A;  3A09 A;  1FPB A;  5FHN A;  4F18 A;  1B46 A;  2NXO A;  3KC0 A;  4R75 A;  2HQ0 A;  4NG7 A;  3E78 A;  3T66 A;  4KI0 E;  4XKR A;  2P1S A;  5TP9 A;  1IXC A;  4MJO A;  3LUZ A;  3MVZ A;  4XXU A;  2BJJ X;  1LBY A;  4LQ2 A;  4QBA A;  3Q29 A;  2NOO A;  4HCY A;  2I0B A;  1DTG A;  1FBH A;  4MAG A;  1KA1 A;  1MXU A;  4PDH A;  4R72 A;  3IB1 A;  3KGC A;  4MFI A;  2XXP A;  1Y3Q A;  5DEX A;  4G4P A;  2YJP A;  5H8F A;  5TPA A;  4OER A;  3UP9 A;  1LB9 A;  2F3D A;  3BFU A;  3BBR A;  4F3S A;  5AA1 A;  2XXX A;  4IR8 A;  1JW1 A;  4GF8 A;  4MF3 A;  4BDO A;  1M5E A;  3HST A;  2F8D A;  1NNP A;  1ANF A;  5KDT B;  4MIJ A;  1EYJ A;  4JVD A;  2OX3 A;  4JSO A;  3O9P A;  2W7Y A;  1FTK A;  4F1U A;  3C33 A;  1O63 A;  2DOJ A;  2XWV A;  4Q30 B;  4LA9 A;  4XIG Q;  4NN3 A;  4BDQ A;  4YMB A;  1DPE A;  3S2V A;  4FIM A;  4QSE A;  2XXV A;  4Z7E A;  1PB9 A;  4QXD A;  2MKZ A;  2Y7P A;  5ET7 A;  3A3C A;  3MZ1 A;  3FJG A;  4I3Y A;  4DXU A;  4GD5 A;  3B8B A;  5CMB A;  4HCW A;  1OQG A;  1LBW A;  3VLU A;  1L5T A;  2F5X A;  2CEX A;  4RXL A;  4ZE8 A;  2CMO A;  3SEY A;  2OJT A;  4PE5 B;  3TAJ A;  4KCD A;  1CB6 A;  2OWS A;  4P1L A;  2ONR A;  3BIG A;  1NV7 A;  3GXA A;  3VFJ A;  2RIN A;  4N6P A;  4EQ9 A;  1ZTY A;  1T0K A;  1H45 A;  1AWB A;  3MJN A;  4NQ8 A;  4KFQ A;  4TQU Q;  1N76 A;  3SET A;  3MP1 A;  3FD3 A;  2QS1 A;  1P1N A;  2I49 A;  4U4X A;  1JW5 A;  4P47 A;  3UIF A;  3K02 A;  4F1Y A;  4EQ7 A;  4BDM A;  2Z22 A;  1ZIU A;  3UGW A;  4G68 A;  4GQO A;  3CHG A;  2A5T B;  5L9M A;  2ABH A;  2PCR A;  4P11 A;  3VDF A;  3IAZ A;  4TOZ A;  1MXV A;  4PC9 A;  1MY1 A;  4QFP A;  4I40 A;  2QFL A;  4UA8 A;  1POT A;  2ZYM A;  1AL3 A;  2XXH A;  1FPK A;  1GR2 A;  4PCD A;  1VSO A;  3PTY A;  3AXF A;  1WDN A;  4P9K A;  3LC8 A;  3N5L A;  5ISU A;  2UVI A;  4OEN A;  2WKY A;  1IMC A;  5A5X A;  4GWS A;  2R6G E;  3RPL A;  5I59 A;  1LBB A;  3IOT A;  4PDD A;  5I59 B;  1OVT A;  1DBZ A;  1LCT A;  5EQ9 A;  1NNT A;  5EYH A;  2DWI A;  5CI5 A;  3K1M A;  2XX8 A;  4GXA A;  1N7W A;  3BFT A;  1YYZ A;  3CFZ A;  1BK4 A;  4HTG A;  5IZ3 A;  2ALU A;  1NKX A;  2DWJ A;  4X04 A;  5HBC A;  1JP4 A;  2F34 A;  3FV1 A;  3OO7 A;  3PUX E;  3G3I A;  4OEV A;  3Q25 A;  3SDF A;  1LBX A;  3JYR A;  1QKB A;  3RNN A;  1IUD A;  2H99 A;  3MZ9 A;  1JW4 A;  2O7U A;  3ISP A;  1LCF A;  4G68 B;  3FVK A;  4UAC A;  2CEY A;  1VE4 A;  4NHB A;  4YMA A;  4XEQ A;  5DVI A;  2ZYN A;  2REG A;  1FBC A;  4QFO A;  3DP6 A;  3N94 A;  4NGU A;  4NMY A;  4JXI A;  4N07 A;  3H06 B;  2O1M A;  3I5O A;  3IB2 A;  3ZKL A;  1O7T A;  1MQJ A;  4IO5 A;  2DSF A;  1NV4 A;  4H45 A;  4WEP A;  1BP5 A;  1NFT A;  3T22 A;  5I58 A;  2HPG A;  1R6Z A;  3S9L C;  3HHF A;  1B3G A;  4DIG A;  1AMF A;  4OVP A;  3RGY A;  3N6T A;  1MDP 1;  2Q74 A;  1SPI A;  1FPE A;  3LBS A;  3JZJ A;  1USY H;  3GYY A;  4AB5 A;  5ELV A;  4P56 A;  2XXW A;  1SBP A;  3G3H A;  1USY E;  3K4U A;  4FJP A;  1A55 A;  1ZLQ A;  3SES A;  2I4C A;  1IEJ A;  3G3G A;  3IO6 A;  3RTW B;  2O6A A;  4U1Z A;  3U94 A;  4GWU A;  4WKM A;  3FV2 A;  1TWY A;  2GHB A;  2QVV A;  2GHA A;  4DZ1 A;  1FBD A;  1JVX A;  3LUY A;  3KBR A;  3QIM A;  2OCU A;  1MPC A;  3MYU A;  3CG3 A;  4JVI A;  4FBP A;  1GTK A;  4XKP A;  1YTV A;  1SD3 A;  3WAE A;  4Z0I A;  3GBA A;  1LST A;  1CE2 A;  5I2K A;  1MRP A;  2E1S A;  3RYD A;  5CM6 A;  3TOD A;  2QVR A;  3OMB A;  4OHN A;  2VT5 A;  1B2H A;  2G29 A;  2O51 A;  1RKM A;  3PUY E;  3S9E A;  4BDR A;  2QS4 A;  2UXA A;  3A29 A;  3UN6 A;  1BIY A;  1FRP A;  3THI A;  1IMA A;  2UYF A;  2FBP A;  4EQB A;  4XKN A;  3IO4 A;  2WBB A;  1LFI A;  3QUJ A;  4QFN A;  2PFZ A;  1UIU A;  2XHD A;  3ECR A;  3VVF A;  3MQ9 A;  1B3L A;  3OSQ A;  2D5W A;  4RK2 A;  1OMP A;  3O66 A;  3PPP A;  4GWZ A;  2A5S A;  3UOR A;  1Y3P A;  3KEI A;  3K6V A;  4P8B A;  4FE8 A;  1K9Z A;  1TT1 A;  5KCJ A;  1MQI A;  3QXM A;  1NV2 A;  2XXT A;  2Y7K A;  1AOV A;  1FTA A;  2CZK A;  1B7Z A;  3O6I A;  2ONK E;  3T0J A;  1NNF A;  1MQH A;  4XFE A;  4U23 A;  3TTM A;  1QUI A;  5EQ7 A;  4PQJ A;  2D21 A;  1IMF A;  1EYI A;  3H6T A;  5L8D A;  5EHS A;  3D4G A;  3C32 A;  3MPL A;  3PMW A;  3U1O A;  4ESW A;  5CRY A;  2VPO A;  4RK9 A;  2HAU A;  1IXH A;  1PBP A;  4R74 A;  2I58 A;  4U4S A;  1FQD A;  3TQL A;  3EF7 A;  3E13 X;  4F29 A;  4HE1 A;  4OYV A;  2JJK A;  4HE2 A;  2DWH A;  3RPW A;  5L9S A;  2PVU A;  2G93 A;  4PFU A;  4YIC A;  2QMX A;  1FPD A;  3V83 A;  3CSG A;  4NF8 A;  4R6H A;  1H44 A;  3PPR A;  5IGA A;  1ZMG A;  2GH9 A;  5K2X A;  3PD8 A;  1EU8 A;  3O2A A;  2ANJ A;  1I69 A;  3S9N C;  2VPN A;  1MY3 A;  2PYY A;  4NF6 B;  3LSF B;  5CMC A;  3E3K A;  3FXR A;  4ELP A;  1JEU A;  4H65 A;  4PFI A;  3Q28 A;  1IMD A;  1FQE A;  1JEV A;  1LBZ A;  3LV0 A;  1IXG A;  2Q2A A;  2ZMB A;  1XOC A;  2DE3 A;  5JTY A;  3T9V A;  1N3X A;  1WOD A;  1P1W A;  2X7P A;  1IIW A;  3TTR A;  5DTB A;  3FUZ A;  4GBW A;  3TCF A;  2I48 A;  1Y3N A;  4I8C A;  1FBP A;  2Z8D A;  4N8G A;  4NF0 A;  3FXQ A;  1LBC A;  2VGQ A;  1QJM A;  1SVX B;  2ZNT A;  4LN5 A;  3CRB A;  3IJO B;  3EN3 A;  4N4U A;  2XWK A;  2PBW A;  3IR1 A;  5ITP A;  1B7H A;  3U72 A;  4HW8 A;  2O84 X;  4OVT A;  2HHM A;  4JBZ A;  1D9V A;  3MP6 A;  1LAF E;  5H8N A;  1RDX A;  1MM6 A;  4GWY A;  1US5 A;  3KN3 A;  2P0S A;  2CZI A;  5KCJ B;  4R6Y A;  3FAS A;  1RDZ A;  3SEW A;  4F22 A;  5ICT A;  3TMG A;  1Z7M E;  4EXK A;  3QUF A;  3EPE A;  5DYH A;  3K00 A;  1N0T A;  1LAG E;  1Y1Z A;  2DWA A;  1SI1 A;  2QSX A;  4EUO A;  1EH3 A;  5A5X B;  4TLM B;  4GX6 A;  2P2A A;  4XF5 A;  4OAN A;  5KDT A;  3TCH A;  5ET8 A;  4MX6 A;  4R2B A;  1LBV A;  5IZZ A;  3M8U A;  4I3E A;  2XXY A;  4FEC A;  4NF4 B;  2R9J A;  2H98 A;  3IOR A;  3L6G A;  1JQF A;  4H67 A;  2I6E A;  2VHA A;  3TCG A;  5TU0 A;  3KG2 A;  4RA1 A;  1VR5 A;  5ESY A;  3KN8 A;  3PUW E;  3PPN A;  2XXQ A;  3HN0 A;  3PV0 E;  1AIV A;  1DOT A;  2I3V A;  3IFC A;  4KR5 A;  1FBE A;  1BKA A;  1FCK A;  2QS3 A;  3DM0 A;  3Q27 A;  5CMK A;  4Q0C A;  1NV1 A;  1SW4 A;  2FHY A;  4PET A;  4EF1 A;  1B1H A;  1FTL A;  4YKP A;  1Y9U A;  3O28 A;  3C9H A;  4POW A;  4F3P A;  1B3H A;  4OXV A;  3G3J A;  4I1D A;  1ZU0 A;  1MH4 A;  3T9U A;  4ND9 A;  3KSJ A;  2FNC A;  1EZ9 A;  3TTN A;  3R6U A;  3FJ7 A;  4P1E A;  3CI8 A;  4MNI A;  5AA2 B;  5I84 A;  1S50 A;  2XXR A;  1XT8 A;  3B6T A;  1MM7 A;  4O94 A;  5FHM A;  1FPF A;  1Y4C A;  5AA4 A;  1CNQ A;  3MPK A;  1MXZ A;  2RCB A;  3DP4 A;  4JVC A;  1B6H A;  4YAH X;  1B5J A;  2KQZ A;  1BTJ A;  2P3V A;  3K1P A;  4OFO A;  1TFD A;  4PGP A;  5I2K B;  4PFB A;  2BJI A;  1A7L A;  1NI9 A;  1GV8 A;  4O3B A;  4RY1 A;  5AA2 A;  4KCC A;  2PFY A;  3IB0 A;  2XXU A;  3M3F A;  3FGS A;  4LAT A;  3RN8 A;  4M1V A;  4YB6 A;  3OEK A;  1FQB A;  2I0C A;  4LZ7 A;  4O7I A;  3MVY A;  4NF5 B;  3FJM A;  4N91 A;  3SER A;  4ESX A;  3MVW A;  3M3K A;  4P0G A;  3IFA A;  3K6W A;  1P1O A;  1P99 A;  1MQG A;  2F6P A;  2DP8 A;  4N6K A;  5H8Q A;  3MZB A;  1MY0 A;  2RF1 A;  3K01 A;  4MLQ A;  5EHM A;  3D4C A;  1NV3 A;  1URD A;  4GWO A;  1UTB A;  4GWX A;  4R6K A;  2A5T A;  5L9O A;  1UTH A;  1QVS A;  5H8S A;  4KYD A;  4OQO A;  2YLN A;  4RPN A;  5EQA A;  2H9B A;  4N17 A;  5DT6 A;  3QMF A;  4PAK A;  1B7U A;  3FZV A;  4F2Q A;  3PUV E;  2Y7W A;  4H5G A;  3B6W A;  1ZJL A;  4ZE9 A;  1FPJ A;  2QJE A;  1PC3 A;  4ECF A;  3OXN A;  3G7W A;  2XXI A;  1B0H A;  4OTE A;  4H1X A;  4MHF A;  4O7M A;  4RJZ A;  4O3C A;  4R2F A;  3ROJ A;  1US4 A;  3CVG A;  1SDX A;  1BLF A;  3IOV A;  4DLD A;  1IMB A;  4IO2 A;  5CBS A;  4GFR A;  3MUQ A;  1H43 A;  3RT6 B;  3E9X A;  1Z7N E;  1S9T A;  2VOZ A;  4OWD A;  4EF2 A;  2V3Q A;  3RPL B;  1DTZ A;  4YKJ A;  3HFU A;  2Q8J A;  4JWX A;  2LAO A;  2ZNS A;  1NUW A;  2REJ A;  3PPQ A;  2ZYK A;  2L5V A;  1QW0 A;  1B0L A;  3MBP A;  1H76 A;  4I9D A;  1O64 A;  4RNS A;  1D4N A;  5ICQ A;  2XX9 A;  4JB7 A; 
#chains in the Genus database with same CATH homology
 4F19 A;  2HZL A;  3MPL A;  5AE4 A;  1JW1 A;  3PMW A;  4GF8 A;  4MF3 A;  3U1O A;  4BDO A;  1VFD A;  1M5E A;  3MWB A;  3KJT A;  5CRY A;  3TQW A;  3N6U A;  4ESW A;  3HST A;  4RK9 A;  3DEL B;  2F8D A;  2HAU A;  1IXH A;  2Z8F A;  1NNP A;  1B51 A;  1PBP A;  4R74 A;  2I58 A;  1NMU A;  4U4S A;  1S7Y A;  1ANF A;  1I6A A;  2HAV A;  2PT1 A;  4ZEF A;  5KDT B;  1FQD A;  3TQL A;  3P7I A;  1D3K A;  3IOW A;  3KOT A;  2Y84 A;  3ZKK A;  3EF7 A;  5B7D A;  1IXI A;  1XC1 A;  4JSO A;  4KPT A;  4ZZA A;  3E13 X;  4F29 A;  1B3F A;  2B3B A;  2RC8 A;  2Y7R A;  3LR1 A;  5FHO A;  2NWJ A;  1IZ1 A;  1M5F A;  2W7Y A;  3O9P A;  4OYV A;  3EHU A;  3ZS6 A;  4F3B A;  1FTK A;  4ELO A;  2DWH A;  2CZL A;  3TUS A;  4F1U A;  3SEU A;  2RC9 A;  3C33 A;  3RPW A;  2O1L A;  3TEP A;  1O63 A;  2DOJ A;  4Q30 B;  3TKD A;  4LA9 A;  5L9S A;  2PVU A;  2G93 A;  4PFU A;  4XIG Q;  5DEX B;  4QF9 A;  2H25 A;  2F78 A;  1OLC A;  4GIZ A;  4G2Z A;  4YIC A;  4BDQ A;  2QMX A;  4IO4 A;  2HCA A;  4P0I A;  3V83 A;  3CSG A;  1N04 A;  2HXW A;  4H8J A;  4Q5T A;  4NF8 A;  4R6H A;  4YMB A;  5F1Q A;  1H44 A;  1DPE A;  3S2V A;  3PPR A;  2F7B A;  2AL5 A;  3R7X A;  3FVO A;  4NF6 A;  1ZMG A;  4FIM A;  2GH9 A;  4C0R A;  4QSE A;  2XXV A;  4Z7E A;  5K2X A;  3PD8 A;  3PD9 A;  4IO6 A;  1PB9 A;  4JSD A;  2F97 A;  1EU8 A;  3O2A A;  2Y7P A;  4KHZ E;  2ANJ A;  3IOU A;  5FTI A;  3JV9 A;  3A3C A;  1I69 A;  3MZ1 A;  4BLA A;  4F31 B;  4N13 A;  5JTY B;  3FJG A;  3S9N C;  1Q1K A;  2Z23 A;  4DXU A;  1Y20 A;  3MP8 A;  4GD5 A;  4HS7 A;  4LVQ A;  4QFL A;  5CMB A;  1MY3 A;  3CFX A;  4E0W A;  1ELJ A;  2PYY A;  4GRK A;  4HCW A;  4NF6 B;  5I2N A;  3LSF B;  5CMC A;  1SQY A;  3E3K A;  3FXR A;  3W9W A;  1OQG A;  4PFY A;  1L5T A;  2F5X A;  1JET A;  3VLU A;  4ELP A;  1LGB C;  4RXL A;  4ZE8 A;  1JEU A;  4H65 A;  2CMO A;  3HHG A;  4OET A;  3S4U A;  4H5F A;  4ELQ A;  1H3D A;  1LFG A;  2PX1 A;  2QMW A;  3K6X A;  3Q28 A;  3SEY A;  4FOR A;  2OJT A;  1FQE A;  1JEV A;  4PE5 B;  3TAJ A;  2DYX A;  2UYE A;  1IXG A;  4KCD A;  1CB6 A;  4RYA A;  2Q2A A;  1A99 A;  2HZK A;  2OWS A;  1XOC A;  2ZMB A;  2DE3 A;  2IA4 A;  4YZZ A;  5I56 B;  4XTC Q;  1MG1 A;  2ONR A;  5F7V A;  1N3X A;  3T9V A;  1WOD A;  1P1W A;  5JTY A;  2X7P A;  4PFT A;  2FYI A;  1IIW A;  3GXA A;  3PMV A;  3VFJ A;  2RIN A;  3VXB A;  3TTR A;  5DTB A;  3FUZ A;  4N6P A;  5H8Q B;  4KYS A;  4EQ9 A;  5HPQ A;  1ZTY A;  4AQ4 A;  1WVJ A;  5LOM A;  1T0K A;  1H45 A;  3TCF A;  1FTO A;  2I48 A;  2QS2 A;  4ZZE A;  4G68 C;  4C1T A;  3RT8 A;  1TXF A;  3MJN A;  4KFQ A;  4TQU Q;  3EHT A;  3F11 A;  1SYI A;  1Y3N A;  2Z8D A;  3R26 A;  4I8C A;  1N76 A;  3FXQ A;  3SET A;  1FTM A;  3MP1 A;  3FD3 A;  1LBC A;  1NH7 A;  2E0S A;  2QS1 A;  1P1N A;  2VGQ A;  4K3F A;  1QJM A;  2Z8E A;  2HEU A;  2DS9 A;  1SVX B;  2ZNT A;  4ONY A;  3CRB A;  2AIX A;  4YKI A;  1MY4 A;  2I49 A;  4TLL B;  4U4X A;  1JW5 A;  3GLB A;  2OBG A;  3IJO B;  5I56 A;  1IIT A;  2XX7 A;  3MC2 A;  3EN3 A;  3K6U A;  3UIF A;  1EZP A;  2DE2 A;  2PBW A;  3ONM A;  1JVY A;  1N3W A;  3K02 A;  4G77 A;  3CFL A;  3QAX A;  3IR1 A;  5ITP A;  5EYF A;  1NNK A;  2V3U A;  1B7H A;  2DVZ A;  3B6Q A;  5TU0 A;  3GBB A;  3U72 A;  3W9V A;  4EDP A;  4EQ7 A;  4F1Y A;  5CMK A;  4BDM A;  3H6W A;  2Z22 A;  5AA2 D;  1ZIU A;  3UGW A;  4FEB A;  1KWH A;  3LSX A;  4G68 A;  4GQO A;  2A5T B;  4HW8 A;  5L9M A;  2ABH A;  3V89 B;  4P11 A;  3SEX A;  2O84 X;  1XVX A;  1LAX A;  3IAZ A;  4TOZ A;  3VDF A;  2DXR A;  1N84 A;  4LUB A;  2XD2 A;  4JBZ A;  1MXV A;  4X1D A;  1D9V A;  2X26 A;  3CIJ A;  3MP6 A;  3C35 A;  1LAF E;  4OEU A;  1MY1 A;  5H8N A;  2DVC A;  4OVJ A;  3H03 A;  3W15 C;  4QFP A;  1UQW A;  4ZEC A;  4UA8 A;  5B70 A;  1MM6 A;  1US5 A;  1POT A;  2ZYM A;  3KN3 A;  3QYT A;  1SYH A;  1AL3 A;  2V3T A;  2XXH A;  3IX1 A;  2H5Y A;  1LAH E;  3HO7 A;  3O6G A;  2P0S A;  4U22 A;  1M5D A;  1QUK A;  1GR2 A;  1HSJ A;  1R9Q A;  4G8M A;  4ZEK A;  3IL1 B;  2YPN A;  5KCJ B;  3VV5 A;  4R6Y A;  1VSO A;  3K2D A;  1MPD A;  4NF8 B;  2QPQ A;  2OWT A;  3FAS A;  4FAJ A;  3AXF A;  3SEW A;  1WDN A;  3LC8 A;  4F22 A;  4F1V A;  3N5L A;  5ICT A;  5ISU A;  2UVI A;  4OEN A;  2WKY A;  2X7Q A;  3TMG A;  4DCX A;  1Z7M E;  2F7C A;  1DPP A;  4DIG A;  4EXK A;  3QUF A;  4R9G A;  4NF5 A;  3EPE A;  5DYH A;  2UVJ A;  3K00 A;  1N0T A;  1I6Q A;  2ESN A;  5A5X A;  2R6G E;  2M8C A;  4JB7 A;  1LAG E;  5I59 A;  1LBB A;  1Y1Z A;  2DWA A;  1SI1 A;  3IOT A;  4JWY A;  4GL8 A;  4ZED A;  4F3G A;  5I59 B;  1RYO A;  2D3I A;  4NWD A;  1OVT A;  1SW5 A;  1M5B A;  1EH3 A;  2QSX A;  4GVO A;  5DVF A;  4EUO A;  5A5X B;  4TLM B;  3TDJ A;  4GXS B;  1LCT A;  1ZBM A;  4IO3 A;  2P2A A;  3TYH A;  4NED A;  3TCH A;  5KDT A;  3VXC A;  2THI A;  1J1N A;  1NNT A;  2DWI A;  2UVG A;  3OD7 A;  4ISU A;  3ZSF A;  5CI5 A;  4EQB A;  1B4Z A;  3K1M A;  4R2B A;  3S9M C;  1PBQ A;  1URG A;  1Y4T A;  1N7W A;  2Q2C A;  2XX8 A;  3H6U A;  4GXA A;  3BFT A;  3M8U A;  5CMM A;  2XXY A;  4FEC A;  3CFZ A;  4OFJ A;  4NF4 B;  4HTG A;  2R9J A;  4Q8R A;  2ALU A;  1OLA A;  2H98 A;  1XVY A;  1NKX A;  3CR9 A;  1NH8 A;  1JQF A;  2DWJ A;  2F35 A;  3IOR A;  3KFM A;  1MQD A;  3L6G A;  3N26 A;  5FTH A;  5HBC A;  1HSE A;  4ZDM A;  3I3V A;  4H67 A;  2I6E A;  2VHA A;  3TCG A;  4WED A;  3KG2 A;  2F34 A;  3FIR A;  1SI0 A;  2OZZ A;  1VR5 A;  3FV1 A;  3K0V A;  3K1N A;  3KN8 A;  3M3L A;  3PUX E;  3PPN A;  3PUW E;  2XXQ A;  3G3I A;  1MY2 A;  3HN0 A;  4OEV A;  3Q25 A;  2VP1 A;  3SDF A;  2QRY A;  4M4G A;  3E4R A;  3PV0 E;  4O3A A;  5H8N B;  1II5 A;  3JYR A;  1QKB A;  3RNN A;  1AIV A;  4IO7 A;  1DOT A;  1IUD A;  3KJ7 A;  3OO9 A;  5I57 B;  2H99 A;  2I3V A;  1JW4 A;  3MZ9 A;  4GOT A;  3TTL A;  4KR5 A;  1OIB A;  2O7U A;  4C1U A;  1LCF A;  1BKA A;  4G68 B;  1FCK A;  1YAE A;  3FVK A;  2QS3 A;  4ZS9 A;  4ELR A;  4UAC A;  3DM0 A;  4MBP A;  1SW1 A;  1VE4 A;  3Q27 A;  4OES A;  3C31 A;  1VFE A;  4Q0C A;  1SW4 A;  3OO7 A;  1GVC A;  4YMA A;  2GRV A;  2O69 A;  4MLV A;  2ZYN A;  5DVI A;  2V84 A;  4NWC A;  5IAI A;  1MH3 A;  2REG A;  4FED A;  4PET A;  4OMB A;  4EF1 A;  1B1H A;  1MS7 A;  3O29 A;  3USD A;  3LSL A;  3RUM A;  4QHQ A;  4QFO A;  1LFH A;  1FTL A;  4YKP A;  3UA8 A;  1Y9U A;  1DMB A;  2GFE A;  3TZA A;  3DP6 A;  1B5H A;  1LLS A;  3N94 A;  3O28 A;  3C9H A;  3PU5 A;  4POW A;  4RA1 A;  4F3P A;  4NMY A;  3V5A A;  3EQ1 A;  5AA4 B;  2OLB A;  1B3H A;  4JXI A;  2F36 A;  4N07 A;  4YB7 A;  3H06 B;  2O1M A;  3HV1 A;  4OXV A;  3FAT A;  3I5O A;  3TEL A;  3G3J A;  3IB2 A;  3ZKL A;  1O7T A;  4I1D A;  1I6B A;  1MH4 A;  1ZU0 A;  3T9U A;  4THI A;  4ND9 A;  3OEM A;  3SEV A;  1MQJ A;  3KSJ A;  2FNC A;  1EZ9 A;  4IO5 A;  1XS5 A;  5I58 B;  2DSF A;  4F39 A;  3BKI B;  4WEP A;  3TTN A;  3WAF A;  5JK4 A;  1BP5 A;  1NFT A;  3PPO A;  3R6U A;  5M2V A;  3T22 A;  4IY5 A;  5H8H A;  4BDN A;  3FJ7 A;  3LSW A;  5I58 A;  1R6Z A;  3ODB A;  3CI8 A;  3S9L C;  3HHF A;  3TTK A;  1B3G A;  2ZYO A;  5AA2 B;  5I84 A;  3HCQ A;  1MXX A;  1S50 A;  2ONS A;  1XT8 A;  2XXR A;  3D4G A;  3B6T A;  3OSR A;  4R73 A;  1MM7 A;  4YB5 A;  1B52 A;  4E0X A;  5FHM A;  1AMF A;  2AL4 A;  2NVU B;  4DE8 A;  3N6T A;  2VD3 A;  1MDP 1;  2F6G A;  3RGY A;  3FVG A;  3VLW A;  1Y4C A;  4FAT A;  4LZ5 A;  5AA4 A;  3V8X B;  4POX A;  3MPK A;  1Q35 A;  3LBS A;  1N7X A;  1MXZ A;  3T93 B;  1B05 A;  3VVD A;  1MPB A;  2RCB A;  1FTJ A;  3DP4 A;  3FVN A;  1R1N A;  1B6H A;  2NUV A;  4X9T A;  4U1O A;  1P1Q A;  2ZNU A;  3PUZ E;  3JZJ A;  1B32 A;  4YAH X;  1USY H;  3B7D A;  2QL3 A;  1B5J A;  4AB6 A;  3SKP A;  1BTJ A;  3K1P A;  4OFO A;  4BDL A;  1YCJ A;  1TFD A;  1FQA A;  5I2K B;  3GZG A;  4AB5 A;  5ELV A;  3VVE A;  2XXW A;  5KZT A;  4G8H A;  4OFL A;  4X1B A;  1SBP A;  2ZXT A;  1A7L A;  3MAM A;  4KQP A;  3T9H B;  1B9J A;  2I3W A;  1LB8 A;  3G3H A;  3OEL A;  4X48 A;  1GV8 A;  4O3B A;  4PFW A;  1USY E;  3FXU A;  4RY1 A;  1B3E A;  1PDA A;  3CSB A;  3K4U A;  4FJP A;  1OQH A;  3UK4 A;  5AA2 A;  1A55 A;  2IEE A;  1FQF A;  1ZLQ A;  4GLI A;  4KCC A;  3VLV A;  3IB0 A;  2XXU A;  3M3F A;  2B3F A;  3H4Z A;  3FGS A;  1Y1M A;  4LAT A;  3SES A;  4U21 A;  3RN8 A;  4M1V A;  3PGF A;  4YB6 A;  3OEK A;  3HPI A;  1FQB A;  2I4C A;  1IEJ A;  2F7A A;  4XKQ A;  3G3G A;  2I0C A;  4LZ7 A;  5BUU A;  3MVY A;  4H6D A;  3IO6 A;  4ZEI A;  2DXY A;  3C36 A;  3TFL A;  3RTW B;  2O6A A;  3H7M A;  4NF5 B;  2V93 A;  3FJM A;  4H0W A;  2O7I A;  4U1Z A;  3QSL A;  4WKM A;  4LQ5 A;  3U94 A;  3G3K A;  3KZG A;  3FV2 A;  3SER A;  4ESX A;  1B1X A;  1TWY A;  3MVW A;  2GHB A;  2KLF A;  2Y7I A;  2GHA A;  3C4M A;  1POY 1;  3M3K A;  1A8E A;  4DZ1 A;  1UIV A;  1JVX A;  3ILT B;  4P0G A;  2AYS A;  3L6H A;  4QSD A;  3K6W A;  1MXY A;  1F9B A;  1P1O A;  4H8I A;  1P99 A;  3KN7 A;  1MQG A;  3LUY A;  4YU0 A;  2F6P A;  5DVJ A;  2DP8 A;  2I4B A;  3KBR A;  4DCY A;  4KYE A;  4DXC A;  3KSX A;  4LZ8 A;  1QKA A;  3QIM A;  2OCU A;  5H8Q A;  5K2Y A;  1MPC A;  4GL0 A;  2Q9T A;  3MZB A;  1HSL A;  1MY0 A;  2Q89 A;  2RF1 A;  2PT2 A;  3A3U A;  5H8H B;  3U93 A;  3OEN A;  2HFB A;  3CG3 A;  3K01 A;  4MLQ A;  2XD3 A;  5EHM A;  3D4C A;  1GTK A;  4DXB A;  1URD A;  3EHS A;  1DSN A;  4GWO A;  4IY6 A;  4XKP A;  1YTV A;  4YKK A;  3RTF B;  1A8F A;  3KOS A;  1R9L A;  1ZKB A;  1B40 A;  1SD3 A;  4QFK A;  3OOA A;  5TPA B;  1UTB A;  3VE1 B;  3WAE A;  5CC2 A;  4MH5 A;  1RYX A;  4R6K A;  2A5T A;  4Z0I A;  3IK6 B;  5L9O A;  1UTH A;  4QRZ A;  1QVS A;  3GBA A;  1FQC A;  3MVX A;  4KYD A;  5H8S A;  1LST A;  3CG1 A;  1QUL A;  1CE2 A;  4OQO A;  2YLN A;  4PP0 A;  4RPN A;  1EZO A;  5I2K A;  1MRP A;  2E1S A;  2V25 A;  2H9B A;  5DT6 A;  5CM6 A;  1MDQ A;  1NL5 A;  1XHY A;  2O68 A;  3TOD A;  5I2N B;  1B7U A;  3OMB A;  1D9Y A;  4JWO A;  4OHN A;  2H4I A;  1B2H A;  4DDD A;  1B5I A;  3FZV A;  2G29 A;  2O51 A;  1RKM A;  2VD2 A;  3PUY E;  3S9E A;  1YPN A;  4BDR A;  2QS4 A;  4IB2 A;  4F2Q A;  2UXA A;  4LON B;  3PUV E;  3O97 A;  2RKM A;  2Y7W A;  1A40 A;  2Q88 A;  3Q26 A;  3UN6 A;  4ZEB A;  1BIY A;  5HM4 B;  2PMS A;  5IKB A;  4H5G A;  3B6W A;  2DE4 A;  2RC7 A;  3THI A;  1A54 A;  5J1D A;  1QUJ A;  4JDF A;  4KD5 A;  1UTH B;  4IGT A;  3DP8 A;  1ZJL A;  3T9X B;  4ZE9 A;  2UYF A;  1AH5 A;  2RCA A;  2QJE A;  3RY3 A;  1OVB A;  1PC3 A;  1URS A;  4L17 A;  4NTL A;  1UTB B;  4XKN A;  1PEB A;  3IO4 A;  4G8N A;  5TP9 B;  4ECF A;  3OXN A;  3G7W A;  3RQT A;  2XXI A;  3U92 A;  5I57 A;  1B0H A;  1LFI A;  4IGR A;  4EXL A;  2FA7 A;  3QUJ A;  4QFN A;  3G3F A;  5BWJ A;  1UIU A;  3IJX B;  1FW0 A;  2XHD A;  3OO6 A;  1PB7 A;  2OK2 A;  3QK6 A;  4OTE A;  2UVH A;  3ECR A;  4H1X A;  3MQ9 A;  2DQV A;  3I6V A;  4U2R A;  3VVF A;  1B3L A;  3OSQ A;  5CBR A;  1PB8 A;  4O3C A;  4R2F A;  2D5W A;  4RJZ A;  3A09 A;  3RLF E;  5FHN A;  4F18 A;  4RK2 A;  3H6V A;  1OMP A;  3O66 A;  1US4 A;  3CVG A;  3PPP A;  3TPA A;  4NF4 A;  1B46 A;  1SDX A;  2A5S A;  2NXO A;  4LP2 B;  4R75 A;  3U8Q A;  1BLF A;  4RPO A;  3IOV A;  2HQ0 A;  3UOR A;  1Y3P A;  3KEI A;  4NE4 A;  4KI0 E;  3T66 A;  4XKR A;  4DLD A;  3K6V A;  4WXJ A;  2P1S A;  5TP9 A;  4IO2 A;  5CBS A;  4FE8 A;  5AA3 A;  1IXC A;  3C34 A;  1JNF A;  1MXW A;  3MUQ A;  4GFR A;  1B4H A;  1TT1 A;  4F2O A;  1H43 A;  3MVZ A;  4XXU A;  2BJJ X;  5KCJ A;  5ITO A;  3RT6 B;  3ILU B;  4LQ2 A;  1MQI A;  1SW2 A;  3E9X A;  3QXM A;  3Q29 A;  1Z7N E;  2NOO A;  4HCY A;  1S9T A;  2I0B A;  1DTG A;  3H3G A;  2XXT A;  2VOZ A;  2Y7K A;  4OWD A;  1M5C A;  3MW0 A;  3PMX A;  1MXU A;  4EF2 A;  1AOV A;  4OZ9 A;  2V3Q A;  1DTZ A;  1IQ7 A;  4YKJ A;  1ATG A;  5JEI A;  1B7Z A;  4R72 A;  3IB1 A;  2Q8J A;  3T96 B;  1GGG A;  3O6I A;  2ONK E;  3KGC A;  4JWX A;  1B58 A;  2LAO A;  2ZNS A;  3DLN A;  4MFI A;  5H8F B;  2XXP A;  1NNF A;  2REJ A;  3OO8 A;  3PPQ A;  4I62 A;  2ZYK A;  1MQH A;  4QSC A;  1Y3Q A;  3O6H A;  1QW0 A;  5DEX A;  4G4P A;  2YJP A;  1B0L A;  1P1U A;  5H8F A;  4U23 A;  5TPA A;  3MBP A;  4OER A;  3UP9 A;  1LB9 A;  3BFU A;  1H76 A;  3TTM A;  1QUI A;  4I9D A;  1O64 A;  1TFA A;  4RNS A;  1D4N A;  3BBR A;  4F3S A;  5ICQ A;  4PQJ A;  4R9F A;  2D21 A;  3H6T A;  5AA1 A;  5L8D A;  5EHS A;  2B65 A;  2XXX A;  2R71 A;  2XX9 A;  3C32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...