2UVIA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with 4,5-unsaturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA02
3C35A 5EYFA 4MFIA 3OSQA 3IO4A 3N26A 3UP9A 3B6TA 1IUDA 1MXYA 2H99A 2FNCA 4PFUA 2HZKA 2H5YA 3IJOB 3TAJA 1TWYA 3VVFA 4GOTA 2DWJA 2O7IA 1H76A 4L17A 1FCKA 3H7MA 2DE4A 2B65A 3CG1A 1ZMGA 3SEVA 1OIBA 1Z7ME 5ITPA 4DDDA 2PMSA 3IOWA 2XXYA 3CFZA 3TTMA 3TFLA 3A3UA 2CMOA 3KEIA 3SESA 4FECA 5ITOA 3F11A 2I58A 4QF9A 3MQ9A 3OO6A 3Q27A 1LGBC 4F22A 2QS2A 3HCQA 2Y7KA 3OEMA 3KFMA 3TPAA 3N6TA 1H45A 3H03A 3H6VA 4G8NA 4LONB 4PFWA 3TODA 4JSOA 4YKKA 1IEJA 3EN3A 1N7XA 2HAVA 3MJNA 3LUYA 2Q8JA 3VXCA 1JQFA 4RYAA 1YPNA 1P1UA 4BDLA 1LCFA 3TCHA 4GQOA 4YMBA 2F36A 4PFTA 1MQDA 1OLCA 4H8JA 5EHSA 2V3UA 2DSFA 1IZ1A 2G29A 3MP1A 3HV1A 5L9SA 1JW5A 4H5FA 3IB2A 4F39A 4C1TA 4ZEIA 4HTGA 2XXRA 1B3FA 2V3TA 1SW4A 3SEYA 4R75A 3CG3A 3BFTA 3UN6A 3O9PA 1M5DA 1QKAA 4EF1A 1ZLQA 1NNFA 5DVIA 1A55A 1XVXA 4LZ7A 4YKJA 3G3FA 3MPKA 3DP8A 1EH3A 1FTKA 2NUVA 4OZ9A 3TELA 1LAHE 2X26A 3Q26A 1RYXA 3MP8A 3M3FA 2XD3A 3MVWA 4X1DA 2NXOA 3T93B 4IGRA 4F29A 3IB0A 4KHZE 1I69A 4GD5A 3T9UA 1B3LA 4GLIA 1Y1ZA 2ONKE 3MZ9A 3FXRA 1FTLA 3OO7A 1N76A 4H1XA 1M5EA 3SEXA 4H0WA 4DCXA 2F7CA 4PFYA 2FA7A 3JZJA 2XXIA 3PUVE 1QULA 2GRVA 4N6PA 4F3BA 3SEWA 1BTJA 1VFDA 4KYSA 3VDFA 4OERA 1PBQA 5TP9B 2D5WA 4ESWA 5DEXA 1XS5A 4GWOA 1HSEA 4QSEA 4RK9A 4R6KA 2QMWA 2RC8A 3GBAA 2AL4A 5BUUA 2I49A 2F5XA 1RYOA 1XVYA 2ZYNA 1NMUA 3T96B 4XIGQ 1P99A 2VD2A 3E4RA 4BDOA 1H3DA 4ESXA 5KZTA 1US4A 3O28A 3M3KA 5FTHA 1LFHA 3UA8A 4G4PA 2Y7RA 1MQHA 1A99A 2QL3A 2W7YA 2I4BA 4GXSB 1B5JA 3U72A 2RKMA 2PVUA 4JWYA 3Q28A 4QFNA 1LAXA 4ZS9A 2F97A 1MXVA 4TLMB 4DLDA 1I6QA 1IXCA 4OXVA 2VP1A 1OVTA 4NTLA 3M8UA 3LSXA 3RT8A 1Y1MA 4H6DA 2HCAA 5CM6A 3T9VA 2ANJA 2XX7A 4JB7A 1SI1A 1B3HA 3C36A 5L9MA 1LBBA 4F1VA 1B52A 3IB1A 1UIVA 1B4HA 4GL8A 4G8MA 3VXBA 3IX1A 3PUZE 1MXXA 1N04A 4LVQA 4MH5A 4BDMA 2DXRA 4LZ5A 1LLSA 4EXKA 4EF2A 4OENA 2H9BA 2ZNUA 4IO6A 4ZZEA 5HM4B 2XXXA 1JEUA 1SYHA 1JEVA 2DWAA 1QUJA 2Y7IA 1JETA 1WODA 2VGQA 4RA1A 4OHNA 1VFEA 2Q89A 5AA2D 2Y84A 1MQGA 4IO4A 3QAXA 4POWA 2XHDA 3TEPA 4GVOA 3EHUA 3VVEA 4RNSA 1O63A 4UACA 1UQWA 2IA4A 3R7XA 2HQ0A 2OJTA 2OLBA 3VE1B 4GF8A 1URSA 3PPQA 4AB5A 1SI0A 2Z23A 3Q25A 4NF8A 2R6GE 4LQ2A 2ZYMA 1P1WA 1WVJA 2I0CA 2QJEA 5DT6A 3H6TA 1DTZA 4BDNA 1A54A 4OEUA 4MLQA 4QHQA 3B6QA 2ZMBA 4P0GA 1NNPA 4GIZA 2Q2AA 1M5BA 5I59B 3E3KA 1B3EA 3HSTA 2E1SA 1FW0A 4QFOA 3OMBA 3PV0E 5AA2A 4R73A 1M5CA 1IITA 1UTBA 1AOVA 4KCCA 5H8FA 3S9EA 1NH7A 4I62A 4QSCA 1YTVA 3PGFA 1B0LA 3S9LC 3T9XB 1URGA 4YKPA 1MY4A 3OO9A 4EXLA 4I9DA 4XKQA 5H8NB 4U1OA 1POTA 5AE4A 4MF3A 5CMBA 5KDTB 4R6YA 3KBRA 1S9TA 3DELB 3OELA 3ODBA 4OETA 1B4ZA 4G68B 1S50A 5I2KB 3IOUA 5ICTA 3K02A 3PD8A 5JK4A 3TTLA 2XX8A 4GRKA 3U93A 4NF6A 4U4XA 2DVZA 4EQ7A 5ELVA 2DXYA 2A5TA 4OFJA 3KOTA 3ZKLA 3RQTA 2P0SA 4R9FA 1DOTA 2FYIA 4NF8B 3O97A 4NEDA 2PT2A 2F34A 4Q5TA 4O3AA 3OSRA 1FTMA 1VE4A 3SDFA 3OEKA 3S9MC 1QUIA 4GXAA 3I3VA 3MVZA 4JDFA 3O66A 4OESA 4QFLA 1DMBA 4KCDA 3RGYA 3H4ZA 1P1NA 1A8EA 3IO6A 5M2VA 4R72A 3B7DA 3TZAA 1FQAA 5KCJB 2DE2A 2F6PA 2O69A 2GHBA 4ELOA 2VHAA 3FIRA 4O3BA 3MUQA 5AA2B 4R9GA 1LCTA 1N3XA 2QS3A 4Z7EA 3RTFB 1UIUA 2Z22A 1DSNA 5CRYA 2UVHA 5HBCA 1D9YA 1UTBB 1MDQA 1KWHA 4UA8A 3IL1B 1B6HA 4DXBA 3IORA 5DVFA 1B9JA 5H8FB 2DVCA 4XTCQ 3A3CA 1Q35A 4H5GA 4ZE8A 2R9JA 3SERA 5TP9A 1D9VA 2ZXTA 3KJTA 4JXIA 4FIMA 2V3QA 3G3KA 1SBPA 3HHGA 4WEPA 1T0KA 2NVUB 2OZZA 4WEDA 4ELRA 3FUZA 2DWHA 3BBRA 4U21A 2V84A 1MG1A 2PYYA 4X1BA 4G2ZA 3WAEA 3K6UA 3RTWB 3EHSA 2M8CA 3VVDA 4EQBA 3FVGA 2I3VA 4IO3A 1EU8A 2UVIA 4LQ5A 4OQOA 3QYTA 2ONSA 4LP2B 1NNTA 2D3IA 4NF6B 4DE8A 2A5TB 1GV8A 4KPTA 2NWJA 4KYDA 3ILUB 3KGCA 1VR5A 1MXUA 3C4MA 3JYRA 4OFOA 1A40A 1PBPA 3K01A 3MPLA 2A5SA 4THIA 1FTOA 4ZEFA 3TKDA 4YAHX 5F7VA 4IO7A 4ZE9A 3BFUA 4DZ1A 4ND9A 4EDPA 2E0SA 3CSBA 4KI0E 3JV9A 3FXUA 3P7IA 4G77A 3WAFA 2ZYOA 5AA1A 3KSJA 4PQJA 4EQ9A 1MY2A 2UYFA 3K1PA 4MBPA 1SW2A 3OENA 2O51A 3K6VA 1LFIA 4I1DA 5JTYB 1N0TA 1POY1 3O6HA 2VD3A 1NKXA 1HSJA 4H67A 5B7DA 2OBGA 4OEVA 1B51A 2WKYA 3CFLA 3A09A 1Y9UA 3RUMA 4DXUA 3PMWA 4KD5A 2RINA 4C0RA 1XT8A 3H6UA 3G3JA 4HW8A 3SKPA 4N13A 2UVJA 4Q30B 1AMFA 4U23A 3T9HB 2DS9A 3C34A 3FZVA 4NWDA 2HFBA 3O6IA 1BKAA 3C32A 3FXQA 3MP6A 1OQHA 3U1OA 3CR9A 1A7LA 3KJ7A 3D4CA 3TCFA 5H8HB 5DYHA 3L6HA 4ELPA 5I59A 5CMCA 1H44A 3PPPA 4R2BA 3FASA 1EZOA 3G3GA 1WDNA 1SVXB 1QW0A 2X7PA 3OD7A 3PUWE 4F31B 1MXWA 4ZEKA 3MAMA 4X48A 4R2FA 5H8QA 3FVKA 3ZSFA 2ALUA 3KN3A 3D4GA 2Y7PA 3N94A 1US5A 3OOAA 3TQWA 2BJJX 3PMVA 1TT1A 3H06B 2ZNSA 4C1UA 2H98A 1TFDA 1LB9A 5I58B 5H8NA 5KDTA 4ZECA 3PD9A 1N7WA 4QFKA 3VLWA 3MWBA 1MDP1 4G68A 2Q9TA 1ZU0A 1JW1A 3LSWA 1LBCA 2I4CA 1FQCA 3PPRA 5I2KA 3G7WA 1P1QA 1A8FA 1F9BA 1Y4TA 5AA3A 1JVXA 3PUXE 3FJ7A 1ANFA 4F3PA 5FHMA 1MQJA 1VSOA 4YB6A 1USYE 4OVJA 4H8IA 3DM0A 1M5FA 1EZPA 1SYIA 5CMKA 1CB6A 3DP4A 1GTKA 3TMGA 5TU0A 3C9HA 3EQ1A 2I0BA 3TTRA 1HSLA 3TYHA 3PU5A 5I57B 3FATA 1SW5A 1LAGE 3HN0A 4XKPA 3S4UA 1B2HA 2DQVA 1B40A 3CI8A 3C33A 4OWDA 3LR1A 3V8XB 1JW4A 3KOSA 1MS7A 3U92A 3TDJA 4RPOA 4XXUA 1XHYA 3IOVA 1NNKA 2I6EA 5KCJA 4JWXA 4FAJA 1DPPA 2UXAA 3GLBA 4U1ZA 1IXGA 2P1SA 3QIMA 4GFRA 1QKBA 4U2RA 2DWIA 2ZNTA 4OFLA 4YU0A 2F6GA 3PPOA 3K2DA 1B7HA 3PPNA 1PB9A 1MM6A 5H8QB 4KYEA 4HCWA 1BIYA 2Q2CA 5L8DA 3FD3A 4IGTA 4QSDA 4IO2A 2GH9A 2XXPA 3OO8A 5K2YA 3FV1A 2F7BA 4ZEBA 4G8HA 3VLUA 2REJA 4YB7A 1II5A 1OMPA 3CSGA 3IAZA 4E0XA 1FTJA 3VV5A 5I2NA 4KQPA 1SD3A 4FORA 3SEUA 3EF7A 3K6XA 3TCGA 3EHTA 4IY5A 5CBRA 1TXFA 4N07A 1P1OA 5DVJA 4ECFA 1CE2A 3K0VA 4M1VA 4DCYA 4WXJA 5HPQA 1TFAA 4FE8A 4F2OA 3FV2A 4YB5A 1B05A 3O2AA 4HS7A 1D4NA 3KN7A 4PETA 4BLAA 3LBSA 1R9QA 1ZKBA 4QRZA 3FVNA 3B6WA 2DE3A 2AYSA 3UK4A 1QUKA 4PE5B 4YMAA 4Q8RA 1DPEA 3VLVA 2R71A 4OMBA 3IK6B 3Q29A 1MM7A 2F78A 5I56A 2F35A 1YAEA 2THIA 4F3GA 3RY3A 1B7UA 1NL5A 4QFPA 5TPAB 1OLAA 2RC9A 4F1UA 3CIJA 5L9OA 3FJMA 1B32A 1GVCA 1OVBA 2RC7A 4I8CA 3GZGA 3MBPA 2IEEA 5CBSA 3QSLA 3H6WA 5FTIA 1Y20A 4JWOA 2QS4A 3ILTB 5JEIA 4OYVA 1ATGA 2HEUA 4E0WA 1ZTYA 2OK2A 3RN8A 1IIWA 1J1NA 4IO5A 5JTYA 2H25A 3W9VA 2KLFA 1B58A 5IKBA 4BDQA 4F18A 3TTKA 1MQIA 1PC3A 3DP6A 1D3KA 1Z7NE 1PB7A 1FQFA 3H3GA 1LAFE 2V93A 3RNNA 3E13X 1I6BA 5CMMA 1MY3A 2I3WA 3TTNA 2XXUA 2RCAA 2RF1A 5I2NB 2B3BA 1SDXA 3HPIA 3TQLA 3K6WA 3T22A 1PDAA 3RPWA 3ECRA 2O1MA 3ZS6A 5H8HA 3V5AA 3THIA 2OWSA 2OWTA 3TUSA 4RY1A 1QVSA 3T66A 3N5LA 2F8DA 4OTEA 5FHOA 2XXHA 3FVOA 3AXFA 2VOZA 4WKMA 4NF4A 1B5IA 3G3HA 3CFXA 5B70A 2O68A 1B0HA 2QMXA 1GGGA 3HO7A 4FATA 3UGWA 3K1NA 1R6ZA 5I56B 1B46A 4LZ8A 1XC1A 5FHNA 4Q0CA 1MY0A 4YICA 3MVYA 4M4GA 2LAOA 3O29A 3IJXB 4ISUA 4KR5A 5I58A 1PB8A 1ZBMA 3N6UA 1FQEA 4F2QA 5EHMA 4R6HA 1R1NA 4PP0A 4H65A 3UIFA 4POXA 1GR2A 2PT1A 4ELQA 2ESNA 1FQDA 3FJGA 1JVYA 2Z8FA 2X7QA 3KN8A 1PEBA 3R26A 3MVXA 1B3GA 4TOZA 3CRBA 1NH8A 3I5OA 4NF5A 3S9NC 4F1YA 3MZBA 4YKIA 2G93A 5CI5A 1Q1KA 4F19A 3FGSA 5I84A 5I57A 3DLNA 1YCJA 2XXQA 3GBBA 3ZKKA 4ZEDA 3G3IA 3PUYE 4R74A 3K1MA 2ABHA 5AA4A 2AIXA 4K3FA 2HAUA 5J1DA 3MC2A 3SETA 5A5XA 1Y3QA 2AL5A 3L6GA 2UVGA 3ONMA 3OXNA 1L5TA 4AQ4A 4RK2A 4FEDA 5H8SA 2I48A 3O6GA 1B7ZA 1XOCA 4XKNA 5ICQA 5F1QA 1EZ9A 3HHFA 4NF4B 3MZ1A 3KG2A 3IR1A 2GHAA 1I6AA 5DTBA 4JBZA 3QXMA 1OQGA 5ISUA 1URDA 2QS1A 3QK6A 2PX1A 1Y3PA 3QUFA 1AIVA 2O1LA 3I6VA 2NOOA 2UYEA 4NWCA 3RT6B 1MH3A 1MPCA 1AH5A 4FEBA 1IXHA 1LSTA 4FJPA 1B1HA 1MY1A 4Z0IA 4ZZAA 1SW1A 1ZJLA 1S7YA 3K00A 3PMXA 5LOMA 3LC8A 3KSXA 2XXVA 3E9XA 1MH4A 3R6UA 2GFEA 4DXCA 4RPNA 4O3CA 1MRPA 1O7TA 2YPNA 4TLLB 3V83A 2RCBA 3LSFB 3W9WA 4NF5B 2XXWA 2QRYA 1UTHA 2P2AA 1Y4CA 4X9TA 1MXZA 2QPQA 5IAIA 4IB2A 1NFTA 5DEXB 2H4IA 3RLFE 1LB8A 3QUJA 4AB6A 4BDRA 2OCUA 5AA4B 5BWJA 1FQBA 5TPAA 1MPBA 4RXLA 3V89B 3U94A 4DIGA 1R9LA 1USYH 5A5XB 1H43A 4MLVA 2ONRA 1ZIUA 2DYXA 4EUOA 1ELJA 1JNFA 1B5HA 2O84X 2REGA 1N3WA 2D21A 3KZGA 3S2VA 4U4SA 4LATA 4P11A 3UORA 4RJZA 1Y3NA 2O7UA 1MPDA 1SQYA 3LSLA 2DOJA 2F7AA 4ZDMA 5K2XA 4ONYA 2Q88A 3M3LA 4LUBA 4F3SA 4P0IA 1IXIA 2B3FA 3MW0A 4YZZA 2HZLA 2XX9A 4IY6A 4U22A 2HXWA 2YLNA 4LA9A 1IQ7A 4GL0A 2Z8EA 1QJMA 1B1XA 2V25A 2O6AA 3USDA 4KFQA 1DTGA 2DP8A 4TQUQ 2XD2A 1N84A 3W15C 1RKMA 1LFGA 1AL3A 2Y7WA 3BKIB 4JSDA 3EPEA 4G68C 5CC2A 2QSXA 2ZYKA 3K4UA 4NE4A 4XKRA 3U8QA 2Z8DA 1BP5A 1UTHB 4NMYA 3CVGA 4HCYA 3IOTA 3VFJA 2CZLA 1BLFA 2YJPA 2XXTA 3C31A 2PBWA 1O64A 3GXAA
chains in the Genus database with same CATH superfamily
3C35A 5EYFA 4MFIA 3OSQA 3IO4A 3N26A 4XF5A 1CNQA 3UP9A 3B6TA 1IUDA 1FTAA 1MXYA 2P3VA 2H99A 2FNCA 4PFUA 2HZKA 2QVVA 2H5YA 3IJOB 3TAJA 1TWYA 3VVFA 1LBYA 1AWBA 4GOTA 2DWJA 2O7IA 1H76A 4L17A 1FCKA 4PAKA 3H7MA 2DE4A 2B65A 3CG1A 1ZMGA 2HHMA 3SEVA 4PDDA 1OIBA 1Z7ME 5ITPA 1K9ZA 4DDDA 2PMSA 3IOWA 2XXYA 3CFZA 3TTMA 3TFLA 3A3UA 2CMOA 3KEIA 3SESA 4FECA 2XWIA 5ITOA 3F11A 2I58A 4QF9A 5ET8A 3MQ9A 4AS5A 3OO6A 3Q27A 3GYYA 1FBHA 1LGBC 4F22A 2QS2A 3HCQA 2Y7KA 1FBPA 3OEMA 3KFMA 3TPAA 3N6TA 1H45A 3H03A 3H6VA 4G8NA 4LONB 4PFWA 3TODA 1IMEA 4JSOA 4YKKA 1IEJA 3EN3A 1N7XA 2HAVA 3MJNA 4NF0A 3LUYA 2Q8JA 3VXCA 1JQFA 4RYAA 1YPNA 3KBZA 1P1UA 4BDLA 1LCFA 3TCHA 4GQOA 4YMBA 2F36A 4PFTA 1MQDA 1OLCA 1DBZA 4H8JA 5EHSA 2V3UA 2DSFA 1IZ1A 3T1BA 2G29A 3MP1A 2XA5A 3HV1A 5L9SA 1JW5A 4H5FA 3IB2A 4F39A 4C1TA 4ZEIA 4N91A 4HTGA 2XXRA 1B3FA 2V3TA 1SW4A 3SEYA 4R75A 3CG3A 3BFTA 3UN6A 4GWYA 3O9PA 1M5DA 1QKAA 4EF1A 1ZLQA 1NNFA 5DVIA 1A55A 1XVXA 4LZ7A 4YKJA 3G3FA 3MPKA 3DP8A 1EH3A 1FTKA 2NUVA 4OZ9A 1LAHE 2X26A 3TELA 3Q26A 1RYXA 3MP8A 2CZHA 3M3FA 2XD3A 3MVWA 4X1DA 2NXOA 3T93B 4IGRA 4F29A 3IB0A 4KHZE 1I69A 4GD5A 5DW8A 3T9UA 3KC0A 1B3LA 4GLIA 1Y1ZA 2ONKE 3MZ9A 3FXRA 1FTLA 3OO7A 1N76A 4H1XA 1M5EA 3SEXA 4H0WA 4DCXA 2F7CA 4PFYA 2FA7A 3JZJA 2XXIA 4PE3A 3A29A 3PUVE 1QULA 2GRVA 4N6PA 4F3BA 3SEWA 1BTJA 1VFDA 4KYSA 4I3EA 3VDFA 4OERA 1PBQA 5TP9B 2D5WA 4ESWA 5DEXA 1XS5A 4GWOA 1HSEA 4QSEA 4RK9A 4R6KA 1FBCA 4P3LA 2QMWA 2RC8A 3GBAA 2AL4A 5BUUA 2I49A 2F5XA 1RYOA 1XVYA 2ZYNA 3CHGA 1NMUA 3T96B 4XIGQ 4GBVA 1P99A 2VD2A 3E4RA 4MIJA 4BDOA 1H3DA 4ESXA 5KZTA 1US4A 3O28A 3M3KA 4MNPA 5FTHA 1LFHA 3UA8A 4G4PA 2Y7RA 1MQHA 1A99A 2QL3A 1EYJA 2W7YA 2I4BA 4GXSB 1B5JA 3U72A 1FPGA 2RKMA 2PVUA 4JWYA 4O94A 3Q28A 4QFNA 1LAXA 4ZS9A 2F97A 4N8GA 1MXVA 4QXDA 2Q74A 4NQ8A 4TLMB 4DLDA 2XWOA 1I6QA 1IXCA 2MKZA 4OXVA 2VP1A 3U65A 5LDZA 1OVTA 4NTLA 3M8UA 3LSXA 3RT8A 1Y1MA 4H6DA 2HCAA 5CM6A 3T9VA 2ANJA 2XX7A 4JB7A 3ROJA 1SI1A 2F3BA 1B3HA 2PFYA 3C36A 5L9MA 1LBBA 4F1VA 1B52A 3IB1A 1UIVA 5J16A 1B4HA 4GL8A 1IMCA 4G8MA 3VXBA 3IX1A 3PUZE 1MXXA 1N04A 4LVQA 2VPOA 4MH5A 4BDMA 2DXRA 4LZ5A 1LLSA 4OVTA 2KR0A 4EXKA 4P56A 4EF2A 4OENA 3HFUA 2H9BA 4O8MA 2ZNUA 1FPIA 4IO6A 4X04A 1VDWA 4ZZEA 5HM4B 2XXXA 1JEUA 1FPJA 4NAPA 1SYHA 4PF8A 1JEVA 2DWAA 1G0HA 1QUJA 2Y7IA 1JETA 1WODA 2VGQA 4RA1A 4OHNA 1VFEA 4NN3A 2Q89A 5AA2D 2QVRA 2Y84A 1MQGA 4IO4A 3QAXA 4POWA 2XHDA 3TEPA 4GVOA 3EHUA 3VVEA 4P1LA 3QMFA 4RNSA 1O63A 4UACA 2ZZVA 1UQWA 2IA4A 3R7XA 2HQ0A 2OJTA 2OLBA 2B4MA 3VE1B 3LV0A 1FJ6A 5EQ8A 4GF8A 3IFAA 1URSA 3PPQA 4AB5A 1SI0A 2Z23A 3Q25A 4NF8A 2WYPA 2R6GE 4LQ2A 2ZYMA 1P1WA 1WVJA 2I0CA 2QJEA 5DT6A 3H6TA 1DTZA 4BDNA 1A54A 4OEUA 4MLQA 4HE2A 4QHQA 4PF6A 3B6QA 2ZMBA 2Y5LA 4P0GA 1NNPA 4GIZA 2Q2AA 1M5BA 5I59B 3E3KA 1B3EA 3HSTA 1FBFA 2E1SA 4OVQA 1FW0A 4QFOA 3OMBA 3PV0E 5AA2A 4R73A 1M5CA 1IITA 3LUZA 1LBWA 1UTBA 3MSTA 1AOVA 4KCCA 5H8FA 3S9EA 1NH7A 4I62A 4QSCA 1YZ0A 1YTVA 3PGFA 1B0LA 3S9LC 3T9XB 4MNCA 1URGA 4YKPA 1MY4A 3OO9A 4EXLA 4I9DA 5ET7A 4XKQA 5H8NB 4U1OA 1POTA 5AE4A 2HXRA 4GWXA 4MF3A 5CMBA 2WBDA 5KDTB 4R6YA 3KBRA 1S9TA 3DELB 3OELA 3ODBA 4OETA 1B4ZA 2HPGA 1FSAA 4G68B 1S50A 5LTCA 1LEVA 5I2KB 3IOUA 5ICTA 1NI9A 3K02A 3PD8A 2CEXA 5JK4A 2F3DA 3TTLA 2XX8A 4GRKA 3U93A 4NF6A 4U4XA 5IZ1A 1FRPA 2DVZA 4EQ7A 5ELVA 2DXYA 2A5TA 4OFJA 5ESYA 3KOTA 4FBPA 1NUXA 3ZKLA 3RQTA 2P0SA 4R9FA 3RPLB 1DOTA 2FYIA 4PAIA 3O97A 4GX3A 4NF8B 4NEDA 2PT2A 2F34A 4Q5TA 4O3AA 3OSRA 1FTMA 1VE4A 3SDFA 3OEKA 3S9MC 1QUIA 4GXAA 4GBWA 3I3VA 3MVZA 4JDFA 3O66A 4OESA 4QFLA 1DMBA 4KCDA 3RGYA 2R8TA 3H4ZA 1P1NA 1A8EA 3IO6A 5M2VA 4R72A 3B7DA 3TZAA 1FQAA 5KCJB 2DE2A 2F6PA 2O69A 2GHBA 4ELOA 2VHAA 3FIRA 4O3BA 3MUQA 5AA2B 4R9GA 1LCTA 1N3XA 2QS3A 3RTFB 4Z7EA 1UIUA 2Z22A 4P8BA 1DSNA 5CRYA 4I3YA 2UVHA 5HBCA 1D9YA 1UTBB 1MDQA 1KWHA 4UA8A 3IL1B 1B6HA 4DXBA 3IORA 5DVFA 1B9JA 4N8YA 5H8FB 2DVCA 4MCOA 3FBPA 4XTCQ 3A3CA 1Q35A 4H5GA 4ZE8A 2R9JA 3SERA 5TP9A 1D9VA 2ZXTA 3KJTA 4JXIA 4FIMA 2V3QA 3G3KA 1IMAA 1SBPA 3HHGA 4WEPA 1T0KA 2NVUB 2OZZA 3T0JA 5A5LA 4WEDA 4ELRA 3FUZA 2DWHA 3BBRA 4U21A 2V84A 1MG1A 2PYYA 4X1BA 4G2ZA 3WAEA 3K6UA 3EKIA 3RTWB 4PAFA 3EHSA 2M8CA 3VVDA 4EQBA 1FJ9A 3FVGA 2I3VA 4IO3A 1EU8A 2UVIA 4LQ5A 4OQOA 3QYTA 2BJIA 4MMPA 2ONSA 4LP2B 1NNTA 2D3IA 2WBBA 1FBGA 1NV3A 4NF6B 4DE8A 2A5TB 4PCDA 4KPTA 1GV8A 2NWJA 4KYDA 3ILUB 3KGCA 1VR5A 1MXUA 3C4MA 3JYRA 1NUZA 4OFOA 1A40A 1PBPA 3K01A 3MPLA 2A5SA 4THIA 1FTOA 4ZEFA 3TKDA 3D1RA 1SPIA 4YAHX 5F7VA 4IO7A 2CZKA 4ZE9A 3BFUA 4DZ1A 4ND9A 4EDPA 2E0SA 3CSBA 4KI0E 1FPEA 3JV9A 3FXUA 3P7IA 5IM2A 4G77A 3WAFA 2ZYOA 5AA1A 3KSJA 4PQJA 4EQ9A 4GWZA 1MY2A 2UYFA 3K1PA 4MBPA 1SW2A 3OENA 4KXPA 2O51A 3K6VA 1LFIA 4I1DA 3FXBA 5JTYB 4N17A 1N0TA 1POY1 3O6HA 2VD3A 1NKXA 1HSJA 4HE1A 4H67A 5B7DA 3PTYA 2OBGA 4OEVA 1Q9DA 1B51A 1G0IA 2WKYA 1D9QA 1DCUA 5I3SA 3CFLA 3A09A 1Y9UA 3RUMA 4DXUA 3PMWA 4KD5A 1BK4A 4PGNA 2RINA 4C0RA 5IZ3B 1XT8A 3H6UA 3G3JA 4HW8A 3SKPA 4N13A 1FBEA 2UVJA 4Q30B 1AMFA 4H46A 4U23A 3T9HB 2DS9A 3C34A 3FZVA 2GQ1A 4NWDA 2KQZA 2HFBA 3O6IA 1BKAA 3C32A 3FXQA 3MP6A 1OQHA 3U1OA 3CR9A 2WEFA 1A7LA 3KJ7A 3D4CA 3TCFA 5H8HB 1RDZA 5DYHA 3L6HA 4ELPA 5I59A 5CMCA 1H44A 3PPPA 5EQ9A 4P1EA 4R2BA 3FASA 1EZOA 3G3GA 2V4CA 1WDNA 1SVXB 1QW0A 2X7PA 3OD7A 3PUWE 4AS4A 4F31B 1MXWA 2FIXA 2WYKA 4ZEKA 3MAMA 4X48A 2FIEA 4R2FA 5H8QA 3FVKA 1NV6A 3ZSFA 2ALUA 3KN3A 3D4GA 5F24A 2Y7PA 3N94A 1US5A 3OOAA 4HXVA 3TQWA 2BJJX 3PMVA 5FBPA 1TT1A 3H06B 2ZNSA 1FPBA 4C1UA 2H98A 1TFDA 1LB9A 5I58B 5H8NA 5KDTA 4ZECA 3PD9A 4JVCA 1N7WA 4QFKA 3VLWA 3MWBA 1MDP1 4G68A 2Q9TA 1ZU0A 1JW1A 3LSWA 1LBCA 2I4CA 1FQCA 3PPRA 5I2KA 3G7WA 4PBHA 1P1QA 1A8FA 1F9BA 1Y4TA 5AA3A 1JVXA 3PUXE 3FJ7A 1ANFA 4F3PA 5FHMA 1MQJA 1VSOA 4YB6A 1USYE 5T3JA 4OVJA 4H8IA 3DM0A 1M5FA 1EZPA 1SYIA 1LBVA 5CMKA 1CB6A 3DP4A 1GTKA 1FPKA 5TU0A 3TMGA 4NG7A 3C9HA 3EQ1A 1NV7A 2I0BA 3TTRA 1HSLA 3TYHA 3PU5A 3RPLA 5I57B 4GX6A 3FATA 1SW5A 1LAGE 3HN0A 1NUWA 4XKPA 4N4UA 3S4UA 1B2HA 2DQVA 4LN5A 3E79A 1B40A 3CI8A 3C33A 4OWDA 3LR1A 3V8XB 1JW4A 3KOSA 1MS7A 1FPLA 3TDJA 3U92A 3MYUA 4RPOA 4XXUA 1XHYA 3IOVA 1NNKA 2I6EA 4OVSA 5KCJA 4JWXA 5IZZA 2DDKA 4FAJA 1DPPA 2UXAA 3GLBA 4U1ZA 1IXGA 3BIHA 2P1SA 3QIMA 4GFRA 1QKBA 4U2RA 2VT5A 2DWIA 2ZNTA 4OFLA 4YU0A 2F6GA 3PPOA 3K2DA 1B7HA 3PPNA 1PB9A 1MM6A 5H8QB 4KYEA 4HCWA 1BIYA 2Q2CA 5L8DA 3FD3A 4IGTA 4QSDA 4IO2A 2GH9A 2XXPA 3OO8A 5K2YA 2FHYA 3FV1A 2F7BA 4ZEBA 4G8HA 3VLUA 1RDXA 1LBZA 2REJA 4YB7A 1II5A 1OMPA 1DK4A 3CSGA 3IAZA 4E0XA 1FTJA 3VV5A 5I2NA 4KQPA 2CZIA 1SD3A 3IFCA 4FORA 3SEUA 3EF7A 2Y5KA 3K6XA 2B4LA 3TCGA 3EHTA 4IY5A 1NUYA 5CBRA 1TXFA 4N07A 1P1OA 5DVJA 4ECFA 1CE2A 3K0VA 4M1VA 2CEYA 2ZZXA 4DCYA 4WXJA 5HPQA 1TFAA 4FE8A 4F2OA 3FV2A 4MAGA 4YB5A 1B05A 3O2AA 4HS7A 1D4NA 3KN7A 1YYZA 4PETA 4BLAA 3LBSA 1R9QA 1ZKBA 4QRZA 3FVNA 4PFRA 4XEQA 3B6WA 3KC1A 2DE3A 4NX1A 2AYSA 3UK4A 1NV0A 5EQ7A 1QUKA 4PE5B 4YMAA 4Q8RA 1DPEA 3VLVA 2R71A 4OMBA 4OVPA 3IK6B 3Q29A 1MM7A 2F78A 4N81A 5I56A 2F35A 1YAEA 2THIA 4F3GA 3RY3A 2FVZA 1B7UA 1NL5A 4QFPA 4QBAA 5TPAB 1OLAA 2RC9A 2P3NA 2XWVA 4F1UA 5I7IA 3CIJA 5L9OA 3FJMA 1B32A 1GVCA 1QGXA 1OVBA 2L5VA 2RC7A 3SZPA 1FPFA 4I8CA 3GZGA 3MBPA 2IEEA 5CBSA 3QSLA 3H6WA 5FTIA 1Y20A 4JWOA 2QS4A 3ILTB 5JEIA 4O7IA 4OYVA 1ATGA 2HEUA 4E0WA 1ZTYA 5ET5A 2OK2A 3RN8A 1IIWA 1J1NA 1K9YA 1KZ8A 4IO5A 5JTYA 2H25A 3W9VA 2KLFA 1B58A 1XI6A 1EYIA 5IKBA 1FBDA 4BDQA 2Q8MA 4F18A 4PGPA 3TTKA 2ZZWA 4NGUA 4I40A 1MQIA 1PC3A 3DP6A 1D3KA 1Z7NE 1PB7A 1FQFA 2XWKA 3H3GA 1LAFE 2V93A 3RNNA 3E13X 1I6BA 4PC9A 4OANA 5CMMA 1MY3A 2I3WA 5IZ3A 3TTNA 2XXUA 2RCAA 2RF1A 5I2NB 4OVRA 4MEVA 2B3BA 1SDXA 3HPIA 3TQLA 3K6WA 3T22A 4MJOA 1PDAA 4JVDA 3RPWA 3ECRA 2O1MA 3ZS6A 5H8HA 3V5AA 5EQAA 3THIA 2OWSA 2OWTA 3TUSA 4RY1A 1QVSA 3T66A 3E78A 3N5LA 2F8DA 4OTEA 5FHOA 2XXHA 3FVOA 3AXFA 2VOZA 4WKMA 4NF4A 1B5IA 3G3HA 3CFXA 5B70A 2O68A 4N6KA 2QVUA 1B0HA 3B50A 2QMXA 1GGGA 3HO7A 4FATA 1NV1A 3UGWA 3K1NA 1R6ZA 5I56B 1B46A 4LZ8A 1XC1A 5FHNA 4Q0CA 1MY0A 4YICA 3MVYA 4M4GA 4PFBA 2LAOA 3O29A 3IJXB 4ISUA 4KR5A 4JVIA 5I58A 1PB8A 1ZBMA 3N6UA 1FQEA 4F2QA 4DI3D 5EHMA 4R6HA 1R1NA 4PP0A 4H65A 4OA4A 3BIGA 3UIFA 4POXA 1LBXA 1GR2A 2WX9A 2PT1A 4ELQA 2ESNA 4XFEA 1FQDA 4IR8A 3FJGA 1JVYA 2Z8FA 2X7QA 3KN8A 1PEBA 3R26A 3MVXA 1KA0A 4N15A 3NOHA 4PDHA 1B3GA 4TOZA 3CRBA 1IMBA 3RYDA 1NH8A 3I5OA 4NF5A 3S9NC 4F1YA 3MZBA 4YKIA 2G93A 5CI5A 1Q1KA 4F19A 3FGSA 5EYGA 5I84A 5I57A 3DLNA 1YCJA 2XXQA 3GBBA 3ZKKA 4ZEDA 3G3IA 3PUYE 4R74A 3K1MA 2ABHA 4P9KA 5AA4A 2AIXA 4K3FA 2HAUA 5J1DA 3MC2A 2QFLA 3SETA 5A5XA 1Y3QA 2AL5A 3L6GA 2UVGA 3ONMA 3OXNA 1L5TA 4AQ4A 4RK2A 4FEDA 5H8SA 2I48A 3O6GA 1B7ZA 1XOCA 4XKNA 5ICQA 4O7MA 5F1QA 1IMFA 1EZ9A 3HHFA 4NF4B 3MZ1A 3KG2A 3IR1A 2GHAA 1I6AA 5DTBA 4JBZA 4PTKA 3QXMA 4X8RA 1OQGA 5ISUA 1URDA 1NV2A 2QS1A 3QK6A 1NV5A 2PFZA 2PX1A 1Y3PA 4GWUA 3QUFA 4MHFA 1AIVA 4UABA 2O1LA 3I6VA 2NOOA 2UYEA 4NWCA 1EYKA 3RT6B 1FPDA 1MH3A 1MPCA 1AH5A 4FEBA 1IXHA 1LSTA 4FJPA 1B1HA 1MY1A 4MNIA 4Z0IA 4ZZAA 1SW1A 1ZJLA 1S7YA 3K00A 3PMXA 5LOMA 3LC8A 3KSXA 2XXVA 3E9XA 1MH4A 3R6UA 4GWWA 2GFEA 4DXCA 4RPNA 4O3CA 1MRPA 1O7TA 2YPNA 1KA1A 4TLLB 1YXIA 3V83A 2RCBA 3LSFB 3W9WA 4NF5B 2XXWA 2QRYA 1UTHA 2P2AA 1Y4CA 4X9TA 1MXZA 2QPQA 5IAIA 4DI4B 4IB2A 1NFTA 5DEXB 5I5PA 2H4IA 3RLFE 1LB8A 3QUJA 4AB6A 4BDRA 2OCUA 5AA4B 5BWJA 4H45A 1FQBA 5TPAA 1MPBA 1NV4A 4RXLA 3V89B 3U94A 4DIGA 1R9LA 2VPNA 1USYH 5A5XB 1H43A 4MLVA 2ONRA 1ZIUA 4P47A 2DYXA 1ELJA 4EUOA 1JNFA 1B5HA 2O84X 2REGA 1N3WA 2D21A 3KZGA 3S2VA 4U4SA 4LATA 4P11A 3UORA 4PBQA 4RJZA 1Y3NA 2O7UA 1MPDA 1SQYA 3LSLA 2DOJA 2F7AA 4ZDMA 5K2XA 4ONYA 2Q88A 3M3LA 4LUBA 4F3SA 4P0IA 1IXIA 4G61A 1IMDA 2B3FA 4N6DA 3MW0A 4YZZA 4PFIA 2HZLA 2XX9A 3ISPA 4IY6A 2PCRA 4U22A 2HXWA 2YLNA 4LA9A 1IQ7A 4GL0A 2Z8EA 1JP4A 1QJMA 4HE0A 5ET6A 1B1XA 2OWZA 1INPA 2V25A 2O6AA 3USDA 4KFQA 4MX6A 1DTGA 2DP8A 4TQUQ 2XD2A 2FBPA 1N84A 3W15C 1RKMA 1LFGA 1AL3A 2Y7WA 3BKIB 4JSDA 4GWSA 3EPEA 4G68C 5CC2A 2QSXA 2ZYKA 4GX4A 3K4UA 4NE4A 4XKRA 3U8QA 2Z8DA 1BP5A 1UTHB 4NMYA 1RDYA 2OX3A 3CVGA 4HCYA 5IGAA 3IOTA 2JJKA 3VFJA 2CZLA 1BLFA 2YJPA 5EYHA 2XXTA 3C31A 2PBWA 2XXKA 3B8BA 1O64A 3GXAA 4NHBA
chains in the Genus database with same CATH topology
3C35A 5EYFA 4MFIA 3OSQA 3IO4A 3N26A 3UP9A 3B6TA 1IUDA 1MXYA 2H99A 2FNCA 4PFUA 2HZKA 2H5YA 3IJOB 3TAJA 1TWYA 3VVFA 4GOTA 2DWJA 2O7IA 1H76A 4L17A 1FCKA 3H7MA 2DE4A 2B65A 3CG1A 1ZMGA 3SEVA 1OIBA 1Z7ME 5ITPA 4DDDA 2PMSA 3IOWA 2XXYA 3CFZA 3TTMA 3TFLA 3A3UA 2CMOA 3KEIA 3SESA 4FECA 5ITOA 3F11A 2I58A 4QF9A 3MQ9A 3OO6A 3Q27A 1LGBC 4F22A 2QS2A 3HCQA 2Y7KA 3OEMA 3KFMA 3TPAA 3N6TA 1H45A 3H03A 3H6VA 4G8NA 4LONB 4PFWA 3TODA 4JSOA 4YKKA 1IEJA 3EN3A 1N7XA 2HAVA 3MJNA 3LUYA 2Q8JA 3VXCA 1JQFA 4RYAA 1YPNA 1P1UA 4BDLA 1LCFA 3TCHA 4GQOA 4YMBA 2F36A 4PFTA 1MQDA 1OLCA 4H8JA 5EHSA 2V3UA 2DSFA 1IZ1A 2G29A 3MP1A 3HV1A 5L9SA 1JW5A 4H5FA 3IB2A 4F39A 4C1TA 4ZEIA 4HTGA 2XXRA 1B3FA 2V3TA 1SW4A 3SEYA 4R75A 3CG3A 3BFTA 3UN6A 3O9PA 1M5DA 1QKAA 4EF1A 1ZLQA 1NNFA 5DVIA 1A55A 1XVXA 4LZ7A 4YKJA 3G3FA 3MPKA 3DP8A 1EH3A 1FTKA 2NUVA 4OZ9A 3TELA 1LAHE 2X26A 3Q26A 1RYXA 3MP8A 3M3FA 2XD3A 3MVWA 4X1DA 2NXOA 3T93B 4IGRA 4F29A 3IB0A 4KHZE 1I69A 4GD5A 3T9UA 1B3LA 4GLIA 1Y1ZA 2ONKE 3MZ9A 3FXRA 1FTLA 3OO7A 1N76A 4H1XA 1M5EA 3SEXA 4H0WA 4DCXA 2F7CA 4PFYA 2FA7A 3JZJA 2XXIA 3PUVE 1QULA 2GRVA 4N6PA 4F3BA 3SEWA 1BTJA 1VFDA 4KYSA 3VDFA 4OERA 1PBQA 5TP9B 2D5WA 4ESWA 5DEXA 1XS5A 4GWOA 1HSEA 4QSEA 4RK9A 4R6KA 2QMWA 2RC8A 3GBAA 2AL4A 5BUUA 2I49A 2F5XA 1RYOA 1XVYA 2ZYNA 1NMUA 3T96B 4XIGQ 1P99A 2VD2A 3E4RA 4BDOA 1H3DA 4ESXA 5KZTA 1US4A 3O28A 3M3KA 5FTHA 1LFHA 3UA8A 4G4PA 2Y7RA 1MQHA 1A99A 2QL3A 2W7YA 2I4BA 4GXSB 1B5JA 3U72A 2RKMA 2PVUA 4JWYA 3Q28A 4QFNA 1LAXA 4ZS9A 2F97A 1MXVA 4TLMB 4DLDA 1I6QA 1IXCA 4OXVA 2VP1A 1OVTA 4NTLA 3M8UA 3LSXA 3RT8A 1Y1MA 4H6DA 2HCAA 5CM6A 3T9VA 2ANJA 2XX7A 4JB7A 1SI1A 1B3HA 3C36A 5L9MA 1LBBA 4F1VA 1B52A 3IB1A 1UIVA 1B4HA 4GL8A 4G8MA 3VXBA 3IX1A 3PUZE 1MXXA 1N04A 4LVQA 4MH5A 4BDMA 2DXRA 4LZ5A 1LLSA 4EXKA 4EF2A 4OENA 2H9BA 2ZNUA 4IO6A 4ZZEA 5HM4B 2XXXA 1JEUA 1SYHA 1JEVA 2DWAA 1QUJA 2Y7IA 1JETA 1WODA 2VGQA 4RA1A 4OHNA 1VFEA 2Q89A 5AA2D 2Y84A 1MQGA 4IO4A 3QAXA 4POWA 2XHDA 3TEPA 4GVOA 3EHUA 3VVEA 4RNSA 1O63A 4UACA 1UQWA 2IA4A 3R7XA 2HQ0A 2OJTA 2OLBA 3VE1B 4GF8A 1URSA 3PPQA 4AB5A 1SI0A 2Z23A 3Q25A 4NF8A 2R6GE 4LQ2A 2ZYMA 1P1WA 1WVJA 2I0CA 2QJEA 5DT6A 3H6TA 1DTZA 4BDNA 1A54A 4OEUA 4MLQA 4QHQA 3B6QA 2ZMBA 4P0GA 1NNPA 4GIZA 2Q2AA 1M5BA 5I59B 3E3KA 1B3EA 3HSTA 2E1SA 1FW0A 4QFOA 3OMBA 3PV0E 5AA2A 4R73A 1M5CA 1IITA 1UTBA 1AOVA 4KCCA 5H8FA 3S9EA 1NH7A 4I62A 4QSCA 1YTVA 3PGFA 1B0LA 3S9LC 3T9XB 1URGA 4YKPA 1MY4A 3OO9A 4EXLA 4I9DA 4XKQA 5H8NB 4U1OA 1POTA 5AE4A 4MF3A 5CMBA 5KDTB 4R6YA 3KBRA 1S9TA 3DELB 3OELA 3ODBA 4OETA 1B4ZA 4G68B 1S50A 5I2KB 3IOUA 5ICTA 3K02A 3PD8A 5JK4A 3TTLA 2XX8A 4GRKA 3U93A 4NF6A 4U4XA 2DVZA 4EQ7A 5ELVA 2DXYA 2A5TA 4OFJA 3KOTA 3ZKLA 3RQTA 2P0SA 4R9FA 1DOTA 2FYIA 4NF8B 3O97A 4NEDA 2PT2A 2F34A 4Q5TA 4O3AA 3OSRA 1FTMA 1VE4A 3SDFA 3OEKA 3S9MC 1QUIA 4GXAA 3I3VA 3MVZA 4JDFA 3O66A 4OESA 4QFLA 1DMBA 4KCDA 3RGYA 3H4ZA 1P1NA 1A8EA 3IO6A 5M2VA 4R72A 3B7DA 3TZAA 1FQAA 5KCJB 2DE2A 2F6PA 2O69A 2GHBA 4ELOA 2VHAA 3FIRA 4O3BA 3MUQA 5AA2B 4R9GA 1LCTA 1N3XA 2QS3A 4Z7EA 3RTFB 1UIUA 2Z22A 1DSNA 5CRYA 2UVHA 5HBCA 1D9YA 1UTBB 1MDQA 1KWHA 4UA8A 3IL1B 1B6HA 4DXBA 3IORA 5DVFA 1B9JA 5H8FB 2DVCA 4XTCQ 3A3CA 1Q35A 4H5GA 4ZE8A 2R9JA 3SERA 5TP9A 1D9VA 2ZXTA 3KJTA 4JXIA 4FIMA 2V3QA 3G3KA 1SBPA 3HHGA 4WEPA 1T0KA 2NVUB 2OZZA 4WEDA 4ELRA 3FUZA 2DWHA 3BBRA 4U21A 2V84A 1MG1A 2PYYA 4X1BA 4G2ZA 3WAEA 3K6UA 3RTWB 3EHSA 2M8CA 3VVDA 4EQBA 3FVGA 2I3VA 4IO3A 1EU8A 2UVIA 4LQ5A 4OQOA 3QYTA 2ONSA 4LP2B 1NNTA 2D3IA 4NF6B 4DE8A 2A5TB 1GV8A 4KPTA 2NWJA 4KYDA 3ILUB 3KGCA 1VR5A 1MXUA 3C4MA 3JYRA 4OFOA 1A40A 1PBPA 3K01A 3MPLA 2A5SA 4THIA 1FTOA 4ZEFA 3TKDA 4YAHX 5F7VA 4IO7A 4ZE9A 3BFUA 4DZ1A 4ND9A 4EDPA 2E0SA 3CSBA 4KI0E 3JV9A 3FXUA 3P7IA 4G77A 3WAFA 2ZYOA 5AA1A 3KSJA 4PQJA 4EQ9A 1MY2A 2UYFA 3K1PA 4MBPA 1SW2A 3OENA 2O51A 3K6VA 1LFIA 4I1DA 5JTYB 1N0TA 1POY1 3O6HA 2VD3A 1NKXA 1HSJA 4H67A 5B7DA 2OBGA 4OEVA 1B51A 2WKYA 3CFLA 3A09A 1Y9UA 3RUMA 4DXUA 3PMWA 4KD5A 2RINA 4C0RA 1XT8A 3H6UA 3G3JA 4HW8A 3SKPA 4N13A 2UVJA 4Q30B 1AMFA 4U23A 3T9HB 2DS9A 3C34A 3FZVA 4NWDA 2HFBA 3O6IA 1BKAA 3C32A 3FXQA 3MP6A 1OQHA 3U1OA 3CR9A 1A7LA 3KJ7A 3D4CA 3TCFA 5H8HB 5DYHA 3L6HA 4ELPA 5I59A 5CMCA 1H44A 3PPPA 4R2BA 3FASA 1EZOA 3G3GA 1WDNA 1SVXB 1QW0A 2X7PA 3OD7A 3PUWE 4F31B 1MXWA 4ZEKA 3MAMA 4X48A 4R2FA 5H8QA 3FVKA 3ZSFA 2ALUA 3KN3A 3D4GA 2Y7PA 3N94A 1US5A 3OOAA 3TQWA 2BJJX 3PMVA 1TT1A 3H06B 2ZNSA 4C1UA 2H98A 1TFDA 1LB9A 5I58B 5H8NA 5KDTA 4ZECA 3PD9A 1N7WA 4QFKA 3VLWA 3MWBA 1MDP1 4G68A 2Q9TA 1ZU0A 1JW1A 3LSWA 1LBCA 2I4CA 1FQCA 3PPRA 5I2KA 3G7WA 1P1QA 1A8FA 1F9BA 1Y4TA 5AA3A 1JVXA 3PUXE 3FJ7A 1ANFA 4F3PA 5FHMA 1MQJA 1VSOA 4YB6A 1USYE 4OVJA 4H8IA 3DM0A 1M5FA 1EZPA 1SYIA 5CMKA 1CB6A 3DP4A 1GTKA 3TMGA 5TU0A 3C9HA 3EQ1A 2I0BA 3TTRA 1HSLA 3TYHA 3PU5A 5I57B 3FATA 1SW5A 1LAGE 3HN0A 4XKPA 3S4UA 1B2HA 2DQVA 1B40A 3CI8A 3C33A 4OWDA 3LR1A 3V8XB 1JW4A 3KOSA 1MS7A 3U92A 3TDJA 4RPOA 4XXUA 1XHYA 3IOVA 1NNKA 2I6EA 5KCJA 4JWXA 4FAJA 1DPPA 2UXAA 3GLBA 4U1ZA 1IXGA 2P1SA 3QIMA 4GFRA 1QKBA 4U2RA 2DWIA 2ZNTA 4OFLA 4YU0A 2F6GA 3PPOA 3K2DA 1B7HA 3PPNA 1PB9A 1MM6A 5H8QB 4KYEA 4HCWA 1BIYA 2Q2CA 5L8DA 3FD3A 4IGTA 4QSDA 4IO2A 2GH9A 2XXPA 3OO8A 5K2YA 3FV1A 2F7BA 4ZEBA 4G8HA 3VLUA 2REJA 4YB7A 1II5A 1OMPA 3CSGA 3IAZA 4E0XA 1FTJA 3VV5A 5I2NA 4KQPA 1SD3A 4FORA 3SEUA 3EF7A 3K6XA 3TCGA 3EHTA 4IY5A 5CBRA 1TXFA 4N07A 1P1OA 5DVJA 4ECFA 1CE2A 3K0VA 4M1VA 4DCYA 4WXJA 5HPQA 1TFAA 4FE8A 4F2OA 3FV2A 4YB5A 1B05A 3O2AA 4HS7A 1D4NA 3KN7A 4PETA 4BLAA 3LBSA 1R9QA 1ZKBA 4QRZA 3FVNA 3B6WA 2DE3A 2AYSA 3UK4A 1QUKA 4PE5B 4YMAA 4Q8RA 1DPEA 3VLVA 2R71A 4OMBA 3IK6B 3Q29A 1MM7A 2F78A 5I56A 2F35A 1YAEA 2THIA 4F3GA 3RY3A 1B7UA 1NL5A 4QFPA 5TPAB 1OLAA 2RC9A 4F1UA 3CIJA 5L9OA 3FJMA 1B32A 1GVCA 1OVBA 2RC7A 4I8CA 3GZGA 3MBPA 2IEEA 5CBSA 3QSLA 3H6WA 5FTIA 1Y20A 4JWOA 2QS4A 3ILTB 5JEIA 4OYVA 1ATGA 2HEUA 4E0WA 1ZTYA 2OK2A 3RN8A 1IIWA 1J1NA 4IO5A 5JTYA 2H25A 3W9VA 2KLFA 1B58A 5IKBA 4BDQA 4F18A 3TTKA 1MQIA 1PC3A 3DP6A 1D3KA 1Z7NE 1PB7A 1FQFA 3H3GA 1LAFE 2V93A 3RNNA 3E13X 1I6BA 5CMMA 1MY3A 2I3WA 3TTNA 2XXUA 2RCAA 2RF1A 5I2NB 2B3BA 1SDXA 3HPIA 3TQLA 3K6WA 3T22A 1PDAA 3RPWA 3ECRA 2O1MA 3ZS6A 5H8HA 3V5AA 3THIA 2OWSA 2OWTA 3TUSA 4RY1A 1QVSA 3T66A 3N5LA 2F8DA 4OTEA 5FHOA 2XXHA 3FVOA 3AXFA 2VOZA 4WKMA 4NF4A 1B5IA 3G3HA 3CFXA 5B70A 2O68A 1B0HA 2QMXA 1GGGA 3HO7A 4FATA 3UGWA 3K1NA 1R6ZA 5I56B 1B46A 4LZ8A 1XC1A 5FHNA 4Q0CA 1MY0A 4YICA 3MVYA 4M4GA 2LAOA 3O29A 3IJXB 4ISUA 4KR5A 5I58A 1PB8A 1ZBMA 3N6UA 1FQEA 4F2QA 5EHMA 4R6HA 1R1NA 4PP0A 4H65A 3UIFA 4POXA 1GR2A 2PT1A 4ELQA 2ESNA 1FQDA 3FJGA 1JVYA 2Z8FA 2X7QA 3KN8A 1PEBA 3R26A 3MVXA 1B3GA 4TOZA 3CRBA 1NH8A 3I5OA 4NF5A 3S9NC 4F1YA 3MZBA 4YKIA 2G93A 5CI5A 1Q1KA 4F19A 3FGSA 5I84A 5I57A 3DLNA 1YCJA 2XXQA 3GBBA 3ZKKA 4ZEDA 3G3IA 3PUYE 4R74A 3K1MA 2ABHA 5AA4A 2AIXA 4K3FA 2HAUA 5J1DA 3MC2A 3SETA 5A5XA 1Y3QA 2AL5A 3L6GA 2UVGA 3ONMA 3OXNA 1L5TA 4AQ4A 4RK2A 4FEDA 5H8SA 2I48A 3O6GA 1B7ZA 1XOCA 4XKNA 5ICQA 5F1QA 1EZ9A 3HHFA 4NF4B 3MZ1A 3KG2A 3IR1A 2GHAA 1I6AA 5DTBA 4JBZA 3QXMA 1OQGA 5ISUA 1URDA 2QS1A 3QK6A 2PX1A 1Y3PA 3QUFA 1AIVA 2O1LA 3I6VA 2NOOA 2UYEA 4NWCA 3RT6B 1MH3A 1MPCA 1AH5A 4FEBA 1IXHA 1LSTA 4FJPA 1B1HA 1MY1A 4Z0IA 4ZZAA 1SW1A 1ZJLA 1S7YA 3K00A 3PMXA 5LOMA 3LC8A 3KSXA 2XXVA 3E9XA 1MH4A 3R6UA 2GFEA 4DXCA 4RPNA 4O3CA 1MRPA 1O7TA 2YPNA 4TLLB 3V83A 2RCBA 3LSFB 3W9WA 4NF5B 2XXWA 2QRYA 1UTHA 2P2AA 1Y4CA 4X9TA 1MXZA 2QPQA 5IAIA 4IB2A 1NFTA 5DEXB 2H4IA 3RLFE 1LB8A 3QUJA 4AB6A 4BDRA 2OCUA 5AA4B 5BWJA 1FQBA 5TPAA 1MPBA 4RXLA 3V89B 3U94A 4DIGA 1R9LA 1USYH 5A5XB 1H43A 4MLVA 2ONRA 1ZIUA 2DYXA 4EUOA 1ELJA 1JNFA 1B5HA 2O84X 2REGA 1N3WA 2D21A 3KZGA 3S2VA 4U4SA 4LATA 4P11A 3UORA 4RJZA 1Y3NA 2O7UA 1MPDA 1SQYA 3LSLA 2DOJA 2F7AA 4ZDMA 5K2XA 4ONYA 2Q88A 3M3LA 4LUBA 4F3SA 4P0IA 1IXIA 2B3FA 3MW0A 4YZZA 2HZLA 2XX9A 4IY6A 4U22A 2HXWA 2YLNA 4LA9A 1IQ7A 4GL0A 2Z8EA 1QJMA 1B1XA 2V25A 2O6AA 3USDA 4KFQA 1DTGA 2DP8A 4TQUQ 2XD2A 1N84A 3W15C 1RKMA 1LFGA 1AL3A 2Y7WA 3BKIB 4JSDA 3EPEA 4G68C 5CC2A 2QSXA 2ZYKA 3K4UA 4NE4A 4XKRA 3U8QA 2Z8DA 1BP5A 1UTHB 4NMYA 3CVGA 4HCYA 3IOTA 3VFJA 2CZLA 1BLFA 2YJPA 2XXTA 3C31A 2PBWA 1O64A 3GXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C35 A;  5EYF A;  4MFI A;  3OSQ A;  3IO4 A;  3N26 A;  3UP9 A;  3B6T A;  1IUD A;  1MXY A;  2H99 A;  2FNC A;  4PFU A;  2HZK A;  2H5Y A;  3IJO B;  3TAJ A;  1TWY A;  3VVF A;  4GOT A;  2DWJ A;  2O7I A;  1H76 A;  4L17 A;  1FCK A;  3H7M A;  2DE4 A;  2B65 A;  3CG1 A;  1ZMG A;  3SEV A;  1OIB A;  1Z7M E;  5ITP A;  4DDD A;  2PMS A;  3IOW A;  2XXY A;  3CFZ A;  3TTM A;  3TFL A;  3A3U A;  2CMO A;  3KEI A;  3SES A;  4FEC A;  5ITO A;  3F11 A;  2I58 A;  4QF9 A;  3MQ9 A;  3OO6 A;  3Q27 A;  1LGB C;  4F22 A;  2QS2 A;  3HCQ A;  2Y7K A;  3OEM A;  3KFM A;  3TPA A;  3N6T A;  1H45 A;  3H03 A;  3H6V A;  4G8N A;  4LON B;  4PFW A;  3TOD A;  4JSO A;  4YKK A;  1IEJ A;  3EN3 A;  1N7X A;  2HAV A;  3MJN A;  3LUY A;  2Q8J A;  3VXC A;  1JQF A;  4RYA A;  1YPN A;  1P1U A;  4BDL A;  1LCF A;  3TCH A;  4GQO A;  4YMB A;  2F36 A;  4PFT A;  1MQD A;  1OLC A;  4H8J A;  5EHS A;  2V3U A;  2DSF A;  1IZ1 A;  2G29 A;  3MP1 A;  3HV1 A;  5L9S A;  1JW5 A;  4H5F A;  3IB2 A;  4F39 A;  4C1T A;  4ZEI A;  4HTG A;  2XXR A;  1B3F A;  2V3T A;  1SW4 A;  3SEY A;  4R75 A;  3CG3 A;  3BFT A;  3UN6 A;  3O9P A;  1M5D A;  1QKA A;  4EF1 A;  1ZLQ A;  1NNF A;  5DVI A;  1A55 A;  1XVX A;  4LZ7 A;  4YKJ A;  3G3F A;  3MPK A;  3DP8 A;  1EH3 A;  1FTK A;  2NUV A;  4OZ9 A;  3TEL A;  1LAH E;  2X26 A;  3Q26 A;  1RYX A;  3MP8 A;  3M3F A;  2XD3 A;  3MVW A;  4X1D A;  2NXO A;  3T93 B;  4IGR A;  4F29 A;  3IB0 A;  4KHZ E;  1I69 A;  4GD5 A;  3T9U A;  1B3L A;  4GLI A;  1Y1Z A;  2ONK E;  3MZ9 A;  3FXR A;  1FTL A;  3OO7 A;  1N76 A;  4H1X A;  1M5E A;  3SEX A;  4H0W A;  4DCX A;  2F7C A;  4PFY A;  2FA7 A;  3JZJ A;  2XXI A;  3PUV E;  1QUL A;  2GRV A;  4N6P A;  4F3B A;  3SEW A;  1BTJ A;  1VFD A;  4KYS A;  3VDF A;  4OER A;  1PBQ A;  5TP9 B;  2D5W A;  4ESW A;  5DEX A;  1XS5 A;  4GWO A;  1HSE A;  4QSE A;  4RK9 A;  4R6K A;  2QMW A;  2RC8 A;  3GBA A;  2AL4 A;  5BUU A;  2I49 A;  2F5X A;  1RYO A;  1XVY A;  2ZYN A;  1NMU A;  3T96 B;  4XIG Q;  1P99 A;  2VD2 A;  3E4R A;  4BDO A;  1H3D A;  4ESX A;  5KZT A;  1US4 A;  3O28 A;  3M3K A;  5FTH A;  1LFH A;  3UA8 A;  4G4P A;  2Y7R A;  1MQH A;  1A99 A;  2QL3 A;  2W7Y A;  2I4B A;  4GXS B;  1B5J A;  3U72 A;  2RKM A;  2PVU A;  4JWY A;  3Q28 A;  4QFN A;  1LAX A;  4ZS9 A;  2F97 A;  1MXV A;  4TLM B;  4DLD A;  1I6Q A;  1IXC A;  4OXV A;  2VP1 A;  1OVT A;  4NTL A;  3M8U A;  3LSX A;  3RT8 A;  1Y1M A;  4H6D A;  2HCA A;  5CM6 A;  3T9V A;  2ANJ A;  2XX7 A;  4JB7 A;  1SI1 A;  1B3H A;  3C36 A;  5L9M A;  1LBB A;  4F1V A;  1B52 A;  3IB1 A;  1UIV A;  1B4H A;  4GL8 A;  4G8M A;  3VXB A;  3IX1 A;  3PUZ E;  1MXX A;  1N04 A;  4LVQ A;  4MH5 A;  4BDM A;  2DXR A;  4LZ5 A;  1LLS A;  4EXK A;  4EF2 A;  4OEN A;  2H9B A;  2ZNU A;  4IO6 A;  4ZZE A;  5HM4 B;  2XXX A;  1JEU A;  1SYH A;  1JEV A;  2DWA A;  1QUJ A;  2Y7I A;  1JET A;  1WOD A;  2VGQ A;  4RA1 A;  4OHN A;  1VFE A;  2Q89 A;  5AA2 D;  2Y84 A;  1MQG A;  4IO4 A;  3QAX A;  4POW A;  2XHD A;  3TEP A;  4GVO A;  3EHU A;  3VVE A;  4RNS A;  1O63 A;  4UAC A;  1UQW A;  2IA4 A;  3R7X A;  2HQ0 A;  2OJT A;  2OLB A;  3VE1 B;  4GF8 A;  1URS A;  3PPQ A;  4AB5 A;  1SI0 A;  2Z23 A;  3Q25 A;  4NF8 A;  2R6G E;  4LQ2 A;  2ZYM A;  1P1W A;  1WVJ A;  2I0C A;  2QJE A;  5DT6 A;  3H6T A;  1DTZ A;  4BDN A;  1A54 A;  4OEU A;  4MLQ A;  4QHQ A;  3B6Q A;  2ZMB A;  4P0G A;  1NNP A;  4GIZ A;  2Q2A A;  1M5B A;  5I59 B;  3E3K A;  1B3E A;  3HST A;  2E1S A;  1FW0 A;  4QFO A;  3OMB A;  3PV0 E;  5AA2 A;  4R73 A;  1M5C A;  1IIT A;  1UTB A;  1AOV A;  4KCC A;  5H8F A;  3S9E A;  1NH7 A;  4I62 A;  4QSC A;  1YTV A;  3PGF A;  1B0L A;  3S9L C;  3T9X B;  1URG A;  4YKP A;  1MY4 A;  3OO9 A;  4EXL A;  4I9D A;  4XKQ A;  5H8N B;  4U1O A;  1POT A;  5AE4 A;  4MF3 A;  5CMB A;  5KDT B;  4R6Y A;  3KBR A;  1S9T A;  3DEL B;  3OEL A;  3ODB A;  4OET A;  1B4Z A;  4G68 B;  1S50 A;  5I2K B;  3IOU A;  5ICT A;  3K02 A;  3PD8 A;  5JK4 A;  3TTL A;  2XX8 A;  4GRK A;  3U93 A;  4NF6 A;  4U4X A;  2DVZ A;  4EQ7 A;  5ELV A;  2DXY A;  2A5T A;  4OFJ A;  3KOT A;  3ZKL A;  3RQT A;  2P0S A;  4R9F A;  1DOT A;  2FYI A;  4NF8 B;  3O97 A;  4NED A;  2PT2 A;  2F34 A;  4Q5T A;  4O3A A;  3OSR A;  1FTM A;  1VE4 A;  3SDF A;  3OEK A;  3S9M C;  1QUI A;  4GXA A;  3I3V A;  3MVZ A;  4JDF A;  3O66 A;  4OES A;  4QFL A;  1DMB A;  4KCD A;  3RGY A;  3H4Z A;  1P1N A;  1A8E A;  3IO6 A;  5M2V A;  4R72 A;  3B7D A;  3TZA A;  1FQA A;  5KCJ B;  2DE2 A;  2F6P A;  2O69 A;  2GHB A;  4ELO A;  2VHA A;  3FIR A;  4O3B A;  3MUQ A;  5AA2 B;  4R9G A;  1LCT A;  1N3X A;  2QS3 A;  4Z7E A;  3RTF B;  1UIU A;  2Z22 A;  1DSN A;  5CRY A;  2UVH A;  5HBC A;  1D9Y A;  1UTB B;  1MDQ A;  1KWH A;  4UA8 A;  3IL1 B;  1B6H A;  4DXB A;  3IOR A;  5DVF A;  1B9J A;  5H8F B;  2DVC A;  4XTC Q;  3A3C A;  1Q35 A;  4H5G A;  4ZE8 A;  2R9J A;  3SER A;  5TP9 A;  1D9V A;  2ZXT A;  3KJT A;  4JXI A;  4FIM A;  2V3Q A;  3G3K A;  1SBP A;  3HHG A;  4WEP A;  1T0K A;  2NVU B;  2OZZ A;  4WED A;  4ELR A;  3FUZ A;  2DWH A;  3BBR A;  4U21 A;  2V84 A;  1MG1 A;  2PYY A;  4X1B A;  4G2Z A;  3WAE A;  3K6U A;  3RTW B;  3EHS A;  2M8C A;  3VVD A;  4EQB A;  3FVG A;  2I3V A;  4IO3 A;  1EU8 A;  2UVI A;  4LQ5 A;  4OQO A;  3QYT A;  2ONS A;  4LP2 B;  1NNT A;  2D3I A;  4NF6 B;  4DE8 A;  2A5T B;  1GV8 A;  4KPT A;  2NWJ A;  4KYD A;  3ILU B;  3KGC A;  1VR5 A;  1MXU A;  3C4M A;  3JYR A;  4OFO A;  1A40 A;  1PBP A;  3K01 A;  3MPL A;  2A5S A;  4THI A;  1FTO A;  4ZEF A;  3TKD A;  4YAH X;  5F7V A;  4IO7 A;  4ZE9 A;  3BFU A;  4DZ1 A;  4ND9 A;  4EDP A;  2E0S A;  3CSB A;  4KI0 E;  3JV9 A;  3FXU A;  3P7I A;  4G77 A;  3WAF A;  2ZYO A;  5AA1 A;  3KSJ A;  4PQJ A;  4EQ9 A;  1MY2 A;  2UYF A;  3K1P A;  4MBP A;  1SW2 A;  3OEN A;  2O51 A;  3K6V A;  1LFI A;  4I1D A;  5JTY B;  1N0T A;  1POY 1;  3O6H A;  2VD3 A;  1NKX A;  1HSJ A;  4H67 A;  5B7D A;  2OBG A;  4OEV A;  1B51 A;  2WKY A;  3CFL A;  3A09 A;  1Y9U A;  3RUM A;  4DXU A;  3PMW A;  4KD5 A;  2RIN A;  4C0R A;  1XT8 A;  3H6U A;  3G3J A;  4HW8 A;  3SKP A;  4N13 A;  2UVJ A;  4Q30 B;  1AMF A;  4U23 A;  3T9H B;  2DS9 A;  3C34 A;  3FZV A;  4NWD A;  2HFB A;  3O6I A;  1BKA A;  3C32 A;  3FXQ A;  3MP6 A;  1OQH A;  3U1O A;  3CR9 A;  1A7L A;  3KJ7 A;  3D4C A;  3TCF A;  5H8H B;  5DYH A;  3L6H A;  4ELP A;  5I59 A;  5CMC A;  1H44 A;  3PPP A;  4R2B A;  3FAS A;  1EZO A;  3G3G A;  1WDN A;  1SVX B;  1QW0 A;  2X7P A;  3OD7 A;  3PUW E;  4F31 B;  1MXW A;  4ZEK A;  3MAM A;  4X48 A;  4R2F A;  5H8Q A;  3FVK A;  3ZSF A;  2ALU A;  3KN3 A;  3D4G A;  2Y7P A;  3N94 A;  1US5 A;  3OOA A;  3TQW A;  2BJJ X;  3PMV A;  1TT1 A;  3H06 B;  2ZNS A;  4C1U A;  2H98 A;  1TFD A;  1LB9 A;  5I58 B;  5H8N A;  5KDT A;  4ZEC A;  3PD9 A;  1N7W A;  4QFK A;  3VLW A;  3MWB A;  1MDP 1;  4G68 A;  2Q9T A;  1ZU0 A;  1JW1 A;  3LSW A;  1LBC A;  2I4C A;  1FQC A;  3PPR A;  5I2K A;  3G7W A;  1P1Q A;  1A8F A;  1F9B A;  1Y4T A;  5AA3 A;  1JVX A;  3PUX E;  3FJ7 A;  1ANF A;  4F3P A;  5FHM A;  1MQJ A;  1VSO A;  4YB6 A;  1USY E;  4OVJ A;  4H8I A;  3DM0 A;  1M5F A;  1EZP A;  1SYI A;  5CMK A;  1CB6 A;  3DP4 A;  1GTK A;  3TMG A;  5TU0 A;  3C9H A;  3EQ1 A;  2I0B A;  3TTR A;  1HSL A;  3TYH A;  3PU5 A;  5I57 B;  3FAT A;  1SW5 A;  1LAG E;  3HN0 A;  4XKP A;  3S4U A;  1B2H A;  2DQV A;  1B40 A;  3CI8 A;  3C33 A;  4OWD A;  3LR1 A;  3V8X B;  1JW4 A;  3KOS A;  1MS7 A;  3U92 A;  3TDJ A;  4RPO A;  4XXU A;  1XHY A;  3IOV A;  1NNK A;  2I6E A;  5KCJ A;  4JWX A;  4FAJ A;  1DPP A;  2UXA A;  3GLB A;  4U1Z A;  1IXG A;  2P1S A;  3QIM A;  4GFR A;  1QKB A;  4U2R A;  2DWI A;  2ZNT A;  4OFL A;  4YU0 A;  2F6G A;  3PPO A;  3K2D A;  1B7H A;  3PPN A;  1PB9 A;  1MM6 A;  5H8Q B;  4KYE A;  4HCW A;  1BIY A;  2Q2C A;  5L8D A;  3FD3 A;  4IGT A;  4QSD A;  4IO2 A;  2GH9 A;  2XXP A;  3OO8 A;  5K2Y A;  3FV1 A;  2F7B A;  4ZEB A;  4G8H A;  3VLU A;  2REJ A;  4YB7 A;  1II5 A;  1OMP A;  3CSG A;  3IAZ A;  4E0X A;  1FTJ A;  3VV5 A;  5I2N A;  4KQP A;  1SD3 A;  4FOR A;  3SEU A;  3EF7 A;  3K6X A;  3TCG A;  3EHT A;  4IY5 A;  5CBR A;  1TXF A;  4N07 A;  1P1O A;  5DVJ A;  4ECF A;  1CE2 A;  3K0V A;  4M1V A;  4DCY A;  4WXJ A;  5HPQ A;  1TFA A;  4FE8 A;  4F2O A;  3FV2 A;  4YB5 A;  1B05 A;  3O2A A;  4HS7 A;  1D4N A;  3KN7 A;  4PET A;  4BLA A;  3LBS A;  1R9Q A;  1ZKB A;  4QRZ A;  3FVN A;  3B6W A;  2DE3 A;  2AYS A;  3UK4 A;  1QUK A;  4PE5 B;  4YMA A;  4Q8R A;  1DPE A;  3VLV A;  2R71 A;  4OMB A;  3IK6 B;  3Q29 A;  1MM7 A;  2F78 A;  5I56 A;  2F35 A;  1YAE A;  2THI A;  4F3G A;  3RY3 A;  1B7U A;  1NL5 A;  4QFP A;  5TPA B;  1OLA A;  2RC9 A;  4F1U A;  3CIJ A;  5L9O A;  3FJM A;  1B32 A;  1GVC A;  1OVB A;  2RC7 A;  4I8C A;  3GZG A;  3MBP A;  2IEE A;  5CBS A;  3QSL A;  3H6W A;  5FTI A;  1Y20 A;  4JWO A;  2QS4 A;  3ILT B;  5JEI A;  4OYV A;  1ATG A;  2HEU A;  4E0W A;  1ZTY A;  2OK2 A;  3RN8 A;  1IIW A;  1J1N A;  4IO5 A;  5JTY A;  2H25 A;  3W9V A;  2KLF A;  1B58 A;  5IKB A;  4BDQ A;  4F18 A;  3TTK A;  1MQI A;  1PC3 A;  3DP6 A;  1D3K A;  1Z7N E;  1PB7 A;  1FQF A;  3H3G A;  1LAF E;  2V93 A;  3RNN A;  3E13 X;  1I6B A;  5CMM A;  1MY3 A;  2I3W A;  3TTN A;  2XXU A;  2RCA A;  2RF1 A;  5I2N B;  2B3B A;  1SDX A;  3HPI A;  3TQL A;  3K6W A;  3T22 A;  1PDA A;  3RPW A;  3ECR A;  2O1M A;  3ZS6 A;  5H8H A;  3V5A A;  3THI A;  2OWS A;  2OWT A;  3TUS A;  4RY1 A;  1QVS A;  3T66 A;  3N5L A;  2F8D A;  4OTE A;  5FHO A;  2XXH A;  3FVO A;  3AXF A;  2VOZ A;  4WKM A;  4NF4 A;  1B5I A;  3G3H A;  3CFX A;  5B70 A;  2O68 A;  1B0H A;  2QMX A;  1GGG A;  3HO7 A;  4FAT A;  3UGW A;  3K1N A;  1R6Z A;  5I56 B;  1B46 A;  4LZ8 A;  1XC1 A;  5FHN A;  4Q0C A;  1MY0 A;  4YIC A;  3MVY A;  4M4G A;  2LAO A;  3O29 A;  3IJX B;  4ISU A;  4KR5 A;  5I58 A;  1PB8 A;  1ZBM A;  3N6U A;  1FQE A;  4F2Q A;  5EHM A;  4R6H A;  1R1N A;  4PP0 A;  4H65 A;  3UIF A;  4POX A;  1GR2 A;  2PT1 A;  4ELQ A;  2ESN A;  1FQD A;  3FJG A;  1JVY A;  2Z8F A;  2X7Q A;  3KN8 A;  1PEB A;  3R26 A;  3MVX A;  1B3G A;  4TOZ A;  3CRB A;  1NH8 A;  3I5O A;  4NF5 A;  3S9N C;  4F1Y A;  3MZB A;  4YKI A;  2G93 A;  5CI5 A;  1Q1K A;  4F19 A;  3FGS A;  5I84 A;  5I57 A;  3DLN A;  1YCJ A;  2XXQ A;  3GBB A;  3ZKK A;  4ZED A;  3G3I A;  3PUY E;  4R74 A;  3K1M A;  2ABH A;  5AA4 A;  2AIX A;  4K3F A;  2HAU A;  5J1D A;  3MC2 A;  3SET A;  5A5X A;  1Y3Q A;  2AL5 A;  3L6G A;  2UVG A;  3ONM A;  3OXN A;  1L5T A;  4AQ4 A;  4RK2 A;  4FED A;  5H8S A;  2I48 A;  3O6G A;  1B7Z A;  1XOC A;  4XKN A;  5ICQ A;  5F1Q A;  1EZ9 A;  3HHF A;  4NF4 B;  3MZ1 A;  3KG2 A;  3IR1 A;  2GHA A;  1I6A A;  5DTB A;  4JBZ A;  3QXM A;  1OQG A;  5ISU A;  1URD A;  2QS1 A;  3QK6 A;  2PX1 A;  1Y3P A;  3QUF A;  1AIV A;  2O1L A;  3I6V A;  2NOO A;  2UYE A;  4NWC A;  3RT6 B;  1MH3 A;  1MPC A;  1AH5 A;  4FEB A;  1IXH A;  1LST A;  4FJP A;  1B1H A;  1MY1 A;  4Z0I A;  4ZZA A;  1SW1 A;  1ZJL A;  1S7Y A;  3K00 A;  3PMX A;  5LOM A;  3LC8 A;  3KSX A;  2XXV A;  3E9X A;  1MH4 A;  3R6U A;  2GFE A;  4DXC A;  4RPN A;  4O3C A;  1MRP A;  1O7T A;  2YPN A;  4TLL B;  3V83 A;  2RCB A;  3LSF B;  3W9W A;  4NF5 B;  2XXW A;  2QRY A;  1UTH A;  2P2A A;  1Y4C A;  4X9T A;  1MXZ A;  2QPQ A;  5IAI A;  4IB2 A;  1NFT A;  5DEX B;  2H4I A;  3RLF E;  1LB8 A;  3QUJ A;  4AB6 A;  4BDR A;  2OCU A;  5AA4 B;  5BWJ A;  1FQB A;  5TPA A;  1MPB A;  4RXL A;  3V89 B;  3U94 A;  4DIG A;  1R9L A;  1USY H;  5A5X B;  1H43 A;  4MLV A;  2ONR A;  1ZIU A;  2DYX A;  4EUO A;  1ELJ A;  1JNF A;  1B5H A;  2O84 X;  2REG A;  1N3W A;  2D21 A;  3KZG A;  3S2V A;  4U4S A;  4LAT A;  4P11 A;  3UOR A;  4RJZ A;  1Y3N A;  2O7U A;  1MPD A;  1SQY A;  3LSL A;  2DOJ A;  2F7A A;  4ZDM A;  5K2X A;  4ONY A;  2Q88 A;  3M3L A;  4LUB A;  4F3S A;  4P0I A;  1IXI A;  2B3F A;  3MW0 A;  4YZZ A;  2HZL A;  2XX9 A;  4IY6 A;  4U22 A;  2HXW A;  2YLN A;  4LA9 A;  1IQ7 A;  4GL0 A;  2Z8E A;  1QJM A;  1B1X A;  2V25 A;  2O6A A;  3USD A;  4KFQ A;  1DTG A;  2DP8 A;  4TQU Q;  2XD2 A;  1N84 A;  3W15 C;  1RKM A;  1LFG A;  1AL3 A;  2Y7W A;  3BKI B;  4JSD A;  3EPE A;  4G68 C;  5CC2 A;  2QSX A;  2ZYK A;  3K4U A;  4NE4 A;  4XKR A;  3U8Q A;  2Z8D A;  1BP5 A;  1UTH B;  4NMY A;  3CVG A;  4HCY A;  3IOT A;  3VFJ A;  2CZL A;  1BLF A;  2YJP A;  2XXT A;  3C31 A;  2PBW A;  1O64 A;  3GXA A; 
#chains in the Genus database with same CATH topology
 3C35 A;  5EYF A;  4MFI A;  3OSQ A;  3IO4 A;  3N26 A;  4XF5 A;  1CNQ A;  3UP9 A;  3B6T A;  1IUD A;  1FTA A;  1MXY A;  2P3V A;  2H99 A;  2FNC A;  4PFU A;  2HZK A;  2QVV A;  2H5Y A;  3IJO B;  3TAJ A;  1TWY A;  3VVF A;  1LBY A;  1AWB A;  4GOT A;  2DWJ A;  2O7I A;  1H76 A;  4L17 A;  1FCK A;  4PAK A;  3H7M A;  2DE4 A;  2B65 A;  3CG1 A;  1ZMG A;  2HHM A;  3SEV A;  4PDD A;  1OIB A;  1Z7M E;  5ITP A;  1K9Z A;  4DDD A;  2PMS A;  3IOW A;  2XXY A;  3CFZ A;  3TTM A;  3TFL A;  3A3U A;  2CMO A;  3KEI A;  3SES A;  4FEC A;  2XWI A;  5ITO A;  3F11 A;  2I58 A;  4QF9 A;  5ET8 A;  3MQ9 A;  4AS5 A;  3OO6 A;  3Q27 A;  3GYY A;  1FBH A;  1LGB C;  4F22 A;  2QS2 A;  3HCQ A;  2Y7K A;  1FBP A;  3OEM A;  3KFM A;  3TPA A;  3N6T A;  1H45 A;  3H03 A;  3H6V A;  4G8N A;  4LON B;  4PFW A;  3TOD A;  1IME A;  4JSO A;  4YKK A;  1IEJ A;  3EN3 A;  1N7X A;  2HAV A;  3MJN A;  4NF0 A;  3LUY A;  2Q8J A;  3VXC A;  1JQF A;  4RYA A;  1YPN A;  3KBZ A;  1P1U A;  4BDL A;  1LCF A;  3TCH A;  4GQO A;  4YMB A;  2F36 A;  4PFT A;  1MQD A;  1OLC A;  1DBZ A;  4H8J A;  5EHS A;  2V3U A;  2DSF A;  1IZ1 A;  3T1B A;  2G29 A;  3MP1 A;  2XA5 A;  3HV1 A;  5L9S A;  1JW5 A;  4H5F A;  3IB2 A;  4F39 A;  4C1T A;  4ZEI A;  4N91 A;  4HTG A;  2XXR A;  1B3F A;  2V3T A;  1SW4 A;  3SEY A;  4R75 A;  3CG3 A;  3BFT A;  3UN6 A;  4GWY A;  3O9P A;  1M5D A;  1QKA A;  4EF1 A;  1ZLQ A;  1NNF A;  5DVI A;  1A55 A;  1XVX A;  4LZ7 A;  4YKJ A;  3G3F A;  3MPK A;  3DP8 A;  1EH3 A;  1FTK A;  2NUV A;  4OZ9 A;  1LAH E;  2X26 A;  3TEL A;  3Q26 A;  1RYX A;  3MP8 A;  2CZH A;  3M3F A;  2XD3 A;  3MVW A;  4X1D A;  2NXO A;  3T93 B;  4IGR A;  4F29 A;  3IB0 A;  4KHZ E;  1I69 A;  4GD5 A;  5DW8 A;  3T9U A;  3KC0 A;  1B3L A;  4GLI A;  1Y1Z A;  2ONK E;  3MZ9 A;  3FXR A;  1FTL A;  3OO7 A;  1N76 A;  4H1X A;  1M5E A;  3SEX A;  4H0W A;  4DCX A;  2F7C A;  4PFY A;  2FA7 A;  3JZJ A;  2XXI A;  4PE3 A;  3A29 A;  3PUV E;  1QUL A;  2GRV A;  4N6P A;  4F3B A;  3SEW A;  1BTJ A;  1VFD A;  4KYS A;  4I3E A;  3VDF A;  4OER A;  1PBQ A;  5TP9 B;  2D5W A;  4ESW A;  5DEX A;  1XS5 A;  4GWO A;  1HSE A;  4QSE A;  4RK9 A;  4R6K A;  1FBC A;  4P3L A;  2QMW A;  2RC8 A;  3GBA A;  2AL4 A;  5BUU A;  2I49 A;  2F5X A;  1RYO A;  1XVY A;  2ZYN A;  3CHG A;  1NMU A;  3T96 B;  4XIG Q;  4GBV A;  1P99 A;  2VD2 A;  3E4R A;  4MIJ A;  4BDO A;  1H3D A;  4ESX A;  5KZT A;  1US4 A;  3O28 A;  3M3K A;  4MNP A;  5FTH A;  1LFH A;  3UA8 A;  4G4P A;  2Y7R A;  1MQH A;  1A99 A;  2QL3 A;  1EYJ A;  2W7Y A;  2I4B A;  4GXS B;  1B5J A;  3U72 A;  1FPG A;  2RKM A;  2PVU A;  4JWY A;  4O94 A;  3Q28 A;  4QFN A;  1LAX A;  4ZS9 A;  2F97 A;  4N8G A;  1MXV A;  4QXD A;  2Q74 A;  4NQ8 A;  4TLM B;  4DLD A;  2XWO A;  1I6Q A;  1IXC A;  2MKZ A;  4OXV A;  2VP1 A;  3U65 A;  5LDZ A;  1OVT A;  4NTL A;  3M8U A;  3LSX A;  3RT8 A;  1Y1M A;  4H6D A;  2HCA A;  5CM6 A;  3T9V A;  2ANJ A;  2XX7 A;  4JB7 A;  3ROJ A;  1SI1 A;  2F3B A;  1B3H A;  2PFY A;  3C36 A;  5L9M A;  1LBB A;  4F1V A;  1B52 A;  3IB1 A;  1UIV A;  5J16 A;  1B4H A;  4GL8 A;  1IMC A;  4G8M A;  3VXB A;  3IX1 A;  3PUZ E;  1MXX A;  1N04 A;  4LVQ A;  2VPO A;  4MH5 A;  4BDM A;  2DXR A;  4LZ5 A;  1LLS A;  4OVT A;  2KR0 A;  4EXK A;  4P56 A;  4EF2 A;  4OEN A;  3HFU A;  2H9B A;  4O8M A;  2ZNU A;  1FPI A;  4IO6 A;  4X04 A;  1VDW A;  4ZZE A;  5HM4 B;  2XXX A;  1JEU A;  1FPJ A;  4NAP A;  1SYH A;  4PF8 A;  1JEV A;  2DWA A;  1G0H A;  1QUJ A;  2Y7I A;  1JET A;  1WOD A;  2VGQ A;  4RA1 A;  4OHN A;  1VFE A;  4NN3 A;  2Q89 A;  5AA2 D;  2QVR A;  2Y84 A;  1MQG A;  4IO4 A;  3QAX A;  4POW A;  2XHD A;  3TEP A;  4GVO A;  3EHU A;  3VVE A;  4P1L A;  3QMF A;  4RNS A;  1O63 A;  4UAC A;  2ZZV A;  1UQW A;  2IA4 A;  3R7X A;  2HQ0 A;  2OJT A;  2OLB A;  2B4M A;  3VE1 B;  3LV0 A;  1FJ6 A;  5EQ8 A;  4GF8 A;  3IFA A;  1URS A;  3PPQ A;  4AB5 A;  1SI0 A;  2Z23 A;  3Q25 A;  4NF8 A;  2WYP A;  2R6G E;  4LQ2 A;  2ZYM A;  1P1W A;  1WVJ A;  2I0C A;  2QJE A;  5DT6 A;  3H6T A;  1DTZ A;  4BDN A;  1A54 A;  4OEU A;  4MLQ A;  4HE2 A;  4QHQ A;  4PF6 A;  3B6Q A;  2ZMB A;  2Y5L A;  4P0G A;  1NNP A;  4GIZ A;  2Q2A A;  1M5B A;  5I59 B;  3E3K A;  1B3E A;  3HST A;  1FBF A;  2E1S A;  4OVQ A;  1FW0 A;  4QFO A;  3OMB A;  3PV0 E;  5AA2 A;  4R73 A;  1M5C A;  1IIT A;  3LUZ A;  1LBW A;  1UTB A;  3MST A;  1AOV A;  4KCC A;  5H8F A;  3S9E A;  1NH7 A;  4I62 A;  4QSC A;  1YZ0 A;  1YTV A;  3PGF A;  1B0L A;  3S9L C;  3T9X B;  4MNC A;  1URG A;  4YKP A;  1MY4 A;  3OO9 A;  4EXL A;  4I9D A;  5ET7 A;  4XKQ A;  5H8N B;  4U1O A;  1POT A;  5AE4 A;  2HXR A;  4GWX A;  4MF3 A;  5CMB A;  2WBD A;  5KDT B;  4R6Y A;  3KBR A;  1S9T A;  3DEL B;  3OEL A;  3ODB A;  4OET A;  1B4Z A;  2HPG A;  1FSA A;  4G68 B;  1S50 A;  5LTC A;  1LEV A;  5I2K B;  3IOU A;  5ICT A;  1NI9 A;  3K02 A;  3PD8 A;  2CEX A;  5JK4 A;  2F3D A;  3TTL A;  2XX8 A;  4GRK A;  3U93 A;  4NF6 A;  4U4X A;  5IZ1 A;  1FRP A;  2DVZ A;  4EQ7 A;  5ELV A;  2DXY A;  2A5T A;  4OFJ A;  5ESY A;  3KOT A;  4FBP A;  1NUX A;  3ZKL A;  3RQT A;  2P0S A;  4R9F A;  3RPL B;  1DOT A;  2FYI A;  4PAI A;  3O97 A;  4GX3 A;  4NF8 B;  4NED A;  2PT2 A;  2F34 A;  4Q5T A;  4O3A A;  3OSR A;  1FTM A;  1VE4 A;  3SDF A;  3OEK A;  3S9M C;  1QUI A;  4GXA A;  4GBW A;  3I3V A;  3MVZ A;  4JDF A;  3O66 A;  4OES A;  4QFL A;  1DMB A;  4KCD A;  3RGY A;  2R8T A;  3H4Z A;  1P1N A;  1A8E A;  3IO6 A;  5M2V A;  4R72 A;  3B7D A;  3TZA A;  1FQA A;  5KCJ B;  2DE2 A;  2F6P A;  2O69 A;  2GHB A;  4ELO A;  2VHA A;  3FIR A;  4O3B A;  3MUQ A;  5AA2 B;  4R9G A;  1LCT A;  1N3X A;  2QS3 A;  3RTF B;  4Z7E A;  1UIU A;  2Z22 A;  4P8B A;  1DSN A;  5CRY A;  4I3Y A;  2UVH A;  5HBC A;  1D9Y A;  1UTB B;  1MDQ A;  1KWH A;  4UA8 A;  3IL1 B;  1B6H A;  4DXB A;  3IOR A;  5DVF A;  1B9J A;  4N8Y A;  5H8F B;  2DVC A;  4MCO A;  3FBP A;  4XTC Q;  3A3C A;  1Q35 A;  4H5G A;  4ZE8 A;  2R9J A;  3SER A;  5TP9 A;  1D9V A;  2ZXT A;  3KJT A;  4JXI A;  4FIM A;  2V3Q A;  3G3K A;  1IMA A;  1SBP A;  3HHG A;  4WEP A;  1T0K A;  2NVU B;  2OZZ A;  3T0J A;  5A5L A;  4WED A;  4ELR A;  3FUZ A;  2DWH A;  3BBR A;  4U21 A;  2V84 A;  1MG1 A;  2PYY A;  4X1B A;  4G2Z A;  3WAE A;  3K6U A;  3EKI A;  3RTW B;  4PAF A;  3EHS A;  2M8C A;  3VVD A;  4EQB A;  1FJ9 A;  3FVG A;  2I3V A;  4IO3 A;  1EU8 A;  2UVI A;  4LQ5 A;  4OQO A;  3QYT A;  2BJI A;  4MMP A;  2ONS A;  4LP2 B;  1NNT A;  2D3I A;  2WBB A;  1FBG A;  1NV3 A;  4NF6 B;  4DE8 A;  2A5T B;  4PCD A;  4KPT A;  1GV8 A;  2NWJ A;  4KYD A;  3ILU B;  3KGC A;  1VR5 A;  1MXU A;  3C4M A;  3JYR A;  1NUZ A;  4OFO A;  1A40 A;  1PBP A;  3K01 A;  3MPL A;  2A5S A;  4THI A;  1FTO A;  4ZEF A;  3TKD A;  3D1R A;  1SPI A;  4YAH X;  5F7V A;  4IO7 A;  2CZK A;  4ZE9 A;  3BFU A;  4DZ1 A;  4ND9 A;  4EDP A;  2E0S A;  3CSB A;  4KI0 E;  1FPE A;  3JV9 A;  3FXU A;  3P7I A;  5IM2 A;  4G77 A;  3WAF A;  2ZYO A;  5AA1 A;  3KSJ A;  4PQJ A;  4EQ9 A;  4GWZ A;  1MY2 A;  2UYF A;  3K1P A;  4MBP A;  1SW2 A;  3OEN A;  4KXP A;  2O51 A;  3K6V A;  1LFI A;  4I1D A;  3FXB A;  5JTY B;  4N17 A;  1N0T A;  1POY 1;  3O6H A;  2VD3 A;  1NKX A;  1HSJ A;  4HE1 A;  4H67 A;  5B7D A;  3PTY A;  2OBG A;  4OEV A;  1Q9D A;  1B51 A;  1G0I A;  2WKY A;  1D9Q A;  1DCU A;  5I3S A;  3CFL A;  3A09 A;  1Y9U A;  3RUM A;  4DXU A;  3PMW A;  4KD5 A;  1BK4 A;  4PGN A;  2RIN A;  4C0R A;  5IZ3 B;  1XT8 A;  3H6U A;  3G3J A;  4HW8 A;  3SKP A;  4N13 A;  1FBE A;  2UVJ A;  4Q30 B;  1AMF A;  4H46 A;  4U23 A;  3T9H B;  2DS9 A;  3C34 A;  3FZV A;  2GQ1 A;  4NWD A;  2KQZ A;  2HFB A;  3O6I A;  1BKA A;  3C32 A;  3FXQ A;  3MP6 A;  1OQH A;  3U1O A;  3CR9 A;  2WEF A;  1A7L A;  3KJ7 A;  3D4C A;  3TCF A;  5H8H B;  1RDZ A;  5DYH A;  3L6H A;  4ELP A;  5I59 A;  5CMC A;  1H44 A;  3PPP A;  5EQ9 A;  4P1E A;  4R2B A;  3FAS A;  1EZO A;  3G3G A;  2V4C A;  1WDN A;  1SVX B;  1QW0 A;  2X7P A;  3OD7 A;  3PUW E;  4AS4 A;  4F31 B;  1MXW A;  2FIX A;  2WYK A;  4ZEK A;  3MAM A;  4X48 A;  2FIE A;  4R2F A;  5H8Q A;  3FVK A;  1NV6 A;  3ZSF A;  2ALU A;  3KN3 A;  3D4G A;  5F24 A;  2Y7P A;  3N94 A;  1US5 A;  3OOA A;  4HXV A;  3TQW A;  2BJJ X;  3PMV A;  5FBP A;  1TT1 A;  3H06 B;  2ZNS A;  1FPB A;  4C1U A;  2H98 A;  1TFD A;  1LB9 A;  5I58 B;  5H8N A;  5KDT A;  4ZEC A;  3PD9 A;  4JVC A;  1N7W A;  4QFK A;  3VLW A;  3MWB A;  1MDP 1;  4G68 A;  2Q9T A;  1ZU0 A;  1JW1 A;  3LSW A;  1LBC A;  2I4C A;  1FQC A;  3PPR A;  5I2K A;  3G7W A;  4PBH A;  1P1Q A;  1A8F A;  1F9B A;  1Y4T A;  5AA3 A;  1JVX A;  3PUX E;  3FJ7 A;  1ANF A;  4F3P A;  5FHM A;  1MQJ A;  1VSO A;  4YB6 A;  1USY E;  5T3J A;  4OVJ A;  4H8I A;  3DM0 A;  1M5F A;  1EZP A;  1SYI A;  1LBV A;  5CMK A;  1CB6 A;  3DP4 A;  1GTK A;  1FPK A;  5TU0 A;  3TMG A;  4NG7 A;  3C9H A;  3EQ1 A;  1NV7 A;  2I0B A;  3TTR A;  1HSL A;  3TYH A;  3PU5 A;  3RPL A;  5I57 B;  4GX6 A;  3FAT A;  1SW5 A;  1LAG E;  3HN0 A;  1NUW A;  4XKP A;  4N4U A;  3S4U A;  1B2H A;  2DQV A;  4LN5 A;  3E79 A;  1B40 A;  3CI8 A;  3C33 A;  4OWD A;  3LR1 A;  3V8X B;  1JW4 A;  3KOS A;  1MS7 A;  1FPL A;  3TDJ A;  3U92 A;  3MYU A;  4RPO A;  4XXU A;  1XHY A;  3IOV A;  1NNK A;  2I6E A;  4OVS A;  5KCJ A;  4JWX A;  5IZZ A;  2DDK A;  4FAJ A;  1DPP A;  2UXA A;  3GLB A;  4U1Z A;  1IXG A;  3BIH A;  2P1S A;  3QIM A;  4GFR A;  1QKB A;  4U2R A;  2VT5 A;  2DWI A;  2ZNT A;  4OFL A;  4YU0 A;  2F6G A;  3PPO A;  3K2D A;  1B7H A;  3PPN A;  1PB9 A;  1MM6 A;  5H8Q B;  4KYE A;  4HCW A;  1BIY A;  2Q2C A;  5L8D A;  3FD3 A;  4IGT A;  4QSD A;  4IO2 A;  2GH9 A;  2XXP A;  3OO8 A;  5K2Y A;  2FHY A;  3FV1 A;  2F7B A;  4ZEB A;  4G8H A;  3VLU A;  1RDX A;  1LBZ A;  2REJ A;  4YB7 A;  1II5 A;  1OMP A;  1DK4 A;  3CSG A;  3IAZ A;  4E0X A;  1FTJ A;  3VV5 A;  5I2N A;  4KQP A;  2CZI A;  1SD3 A;  3IFC A;  4FOR A;  3SEU A;  3EF7 A;  2Y5K A;  3K6X A;  2B4L A;  3TCG A;  3EHT A;  4IY5 A;  1NUY A;  5CBR A;  1TXF A;  4N07 A;  1P1O A;  5DVJ A;  4ECF A;  1CE2 A;  3K0V A;  4M1V A;  2CEY A;  2ZZX A;  4DCY A;  4WXJ A;  5HPQ A;  1TFA A;  4FE8 A;  4F2O A;  3FV2 A;  4MAG A;  4YB5 A;  1B05 A;  3O2A A;  4HS7 A;  1D4N A;  3KN7 A;  1YYZ A;  4PET A;  4BLA A;  3LBS A;  1R9Q A;  1ZKB A;  4QRZ A;  3FVN A;  4PFR A;  4XEQ A;  3B6W A;  3KC1 A;  2DE3 A;  4NX1 A;  2AYS A;  3UK4 A;  1NV0 A;  5EQ7 A;  1QUK A;  4PE5 B;  4YMA A;  4Q8R A;  1DPE A;  3VLV A;  2R71 A;  4OMB A;  4OVP A;  3IK6 B;  3Q29 A;  1MM7 A;  2F78 A;  4N81 A;  5I56 A;  2F35 A;  1YAE A;  2THI A;  4F3G A;  3RY3 A;  2FVZ A;  1B7U A;  1NL5 A;  4QFP A;  4QBA A;  5TPA B;  1OLA A;  2RC9 A;  2P3N A;  2XWV A;  4F1U A;  5I7I A;  3CIJ A;  5L9O A;  3FJM A;  1B32 A;  1GVC A;  1QGX A;  1OVB A;  2L5V A;  2RC7 A;  3SZP A;  1FPF A;  4I8C A;  3GZG A;  3MBP A;  2IEE A;  5CBS A;  3QSL A;  3H6W A;  5FTI A;  1Y20 A;  4JWO A;  2QS4 A;  3ILT B;  5JEI A;  4O7I A;  4OYV A;  1ATG A;  2HEU A;  4E0W A;  1ZTY A;  5ET5 A;  2OK2 A;  3RN8 A;  1IIW A;  1J1N A;  1K9Y A;  1KZ8 A;  4IO5 A;  5JTY A;  2H25 A;  3W9V A;  2KLF A;  1B58 A;  1XI6 A;  1EYI A;  5IKB A;  1FBD A;  4BDQ A;  2Q8M A;  4F18 A;  4PGP A;  3TTK A;  2ZZW A;  4NGU A;  4I40 A;  1MQI A;  1PC3 A;  3DP6 A;  1D3K A;  1Z7N E;  1PB7 A;  1FQF A;  2XWK A;  3H3G A;  1LAF E;  2V93 A;  3RNN A;  3E13 X;  1I6B A;  4PC9 A;  4OAN A;  5CMM A;  1MY3 A;  2I3W A;  5IZ3 A;  3TTN A;  2XXU A;  2RCA A;  2RF1 A;  5I2N B;  4OVR A;  4MEV A;  2B3B A;  1SDX A;  3HPI A;  3TQL A;  3K6W A;  3T22 A;  4MJO A;  1PDA A;  4JVD A;  3RPW A;  3ECR A;  2O1M A;  3ZS6 A;  5H8H A;  3V5A A;  5EQA A;  3THI A;  2OWS A;  2OWT A;  3TUS A;  4RY1 A;  1QVS A;  3T66 A;  3E78 A;  3N5L A;  2F8D A;  4OTE A;  5FHO A;  2XXH A;  3FVO A;  3AXF A;  2VOZ A;  4WKM A;  4NF4 A;  1B5I A;  3G3H A;  3CFX A;  5B70 A;  2O68 A;  4N6K A;  2QVU A;  1B0H A;  3B50 A;  2QMX A;  1GGG A;  3HO7 A;  4FAT A;  1NV1 A;  3UGW A;  3K1N A;  1R6Z A;  5I56 B;  1B46 A;  4LZ8 A;  1XC1 A;  5FHN A;  4Q0C A;  1MY0 A;  4YIC A;  3MVY A;  4M4G A;  4PFB A;  2LAO A;  3O29 A;  3IJX B;  4ISU A;  4KR5 A;  4JVI A;  5I58 A;  1PB8 A;  1ZBM A;  3N6U A;  1FQE A;  4F2Q A;  4DI3 D;  5EHM A;  4R6H A;  1R1N A;  4PP0 A;  4H65 A;  4OA4 A;  3BIG A;  3UIF A;  4POX A;  1LBX A;  1GR2 A;  2WX9 A;  2PT1 A;  4ELQ A;  2ESN A;  4XFE A;  1FQD A;  4IR8 A;  3FJG A;  1JVY A;  2Z8F A;  2X7Q A;  3KN8 A;  1PEB A;  3R26 A;  3MVX A;  1KA0 A;  4N15 A;  3NOH A;  4PDH A;  1B3G A;  4TOZ A;  3CRB A;  1IMB A;  3RYD A;  1NH8 A;  3I5O A;  4NF5 A;  3S9N C;  4F1Y A;  3MZB A;  4YKI A;  2G93 A;  5CI5 A;  1Q1K A;  4F19 A;  3FGS A;  5EYG A;  5I84 A;  5I57 A;  3DLN A;  1YCJ A;  2XXQ A;  3GBB A;  3ZKK A;  4ZED A;  3G3I A;  3PUY E;  4R74 A;  3K1M A;  2ABH A;  4P9K A;  5AA4 A;  2AIX A;  4K3F A;  2HAU A;  5J1D A;  3MC2 A;  2QFL A;  3SET A;  5A5X A;  1Y3Q A;  2AL5 A;  3L6G A;  2UVG A;  3ONM A;  3OXN A;  1L5T A;  4AQ4 A;  4RK2 A;  4FED A;  5H8S A;  2I48 A;  3O6G A;  1B7Z A;  1XOC A;  4XKN A;  5ICQ A;  4O7M A;  5F1Q A;  1IMF A;  1EZ9 A;  3HHF A;  4NF4 B;  3MZ1 A;  3KG2 A;  3IR1 A;  2GHA A;  1I6A A;  5DTB A;  4JBZ A;  4PTK A;  3QXM A;  4X8R A;  1OQG A;  5ISU A;  1URD A;  1NV2 A;  2QS1 A;  3QK6 A;  1NV5 A;  2PFZ A;  2PX1 A;  1Y3P A;  4GWU A;  3QUF A;  4MHF A;  1AIV A;  4UAB A;  2O1L A;  3I6V A;  2NOO A;  2UYE A;  4NWC A;  1EYK A;  3RT6 B;  1FPD A;  1MH3 A;  1MPC A;  1AH5 A;  4FEB A;  1IXH A;  1LST A;  4FJP A;  1B1H A;  1MY1 A;  4MNI A;  4Z0I A;  4ZZA A;  1SW1 A;  1ZJL A;  1S7Y A;  3K00 A;  3PMX A;  5LOM A;  3LC8 A;  3KSX A;  2XXV A;  3E9X A;  1MH4 A;  3R6U A;  4GWW A;  2GFE A;  4DXC A;  4RPN A;  4O3C A;  1MRP A;  1O7T A;  2YPN A;  1KA1 A;  4TLL B;  1YXI A;  3V83 A;  2RCB A;  3LSF B;  3W9W A;  4NF5 B;  2XXW A;  2QRY A;  1UTH A;  2P2A A;  1Y4C A;  4X9T A;  1MXZ A;  2QPQ A;  5IAI A;  4DI4 B;  4IB2 A;  1NFT A;  5DEX B;  5I5P A;  2H4I A;  3RLF E;  1LB8 A;  3QUJ A;  4AB6 A;  4BDR A;  2OCU A;  5AA4 B;  5BWJ A;  4H45 A;  1FQB A;  5TPA A;  1MPB A;  1NV4 A;  4RXL A;  3V89 B;  3U94 A;  4DIG A;  1R9L A;  2VPN A;  1USY H;  5A5X B;  1H43 A;  4MLV A;  2ONR A;  1ZIU A;  4P47 A;  2DYX A;  1ELJ A;  4EUO A;  1JNF A;  1B5H A;  2O84 X;  2REG A;  1N3W A;  2D21 A;  3KZG A;  3S2V A;  4U4S A;  4LAT A;  4P11 A;  3UOR A;  4PBQ A;  4RJZ A;  1Y3N A;  2O7U A;  1MPD A;  1SQY A;  3LSL A;  2DOJ A;  2F7A A;  4ZDM A;  5K2X A;  4ONY A;  2Q88 A;  3M3L A;  4LUB A;  4F3S A;  4P0I A;  1IXI A;  4G61 A;  1IMD A;  2B3F A;  4N6D A;  3MW0 A;  4YZZ A;  4PFI A;  2HZL A;  2XX9 A;  3ISP A;  4IY6 A;  2PCR A;  4U22 A;  2HXW A;  2YLN A;  4LA9 A;  1IQ7 A;  4GL0 A;  2Z8E A;  1JP4 A;  1QJM A;  4HE0 A;  5ET6 A;  1B1X A;  2OWZ A;  1INP A;  2V25 A;  2O6A A;  3USD A;  4KFQ A;  4MX6 A;  1DTG A;  2DP8 A;  4TQU Q;  2XD2 A;  2FBP A;  1N84 A;  3W15 C;  1RKM A;  1LFG A;  1AL3 A;  2Y7W A;  3BKI B;  4JSD A;  4GWS A;  3EPE A;  4G68 C;  5CC2 A;  2QSX A;  2ZYK A;  4GX4 A;  3K4U A;  4NE4 A;  4XKR A;  3U8Q A;  2Z8D A;  1BP5 A;  1UTH B;  4NMY A;  1RDY A;  2OX3 A;  3CVG A;  4HCY A;  5IGA A;  3IOT A;  2JJK A;  3VFJ A;  2CZL A;  1BLF A;  2YJP A;  5EYH A;  2XXT A;  3C31 A;  2PBW A;  2XXK A;  3B8B A;  1O64 A;  3GXA A;  4NHB A; 
#chains in the Genus database with same CATH homology
 3C35 A;  5EYF A;  4MFI A;  3OSQ A;  3IO4 A;  3N26 A;  3UP9 A;  3B6T A;  1IUD A;  1MXY A;  2H99 A;  2FNC A;  4PFU A;  2HZK A;  2H5Y A;  3IJO B;  3TAJ A;  1TWY A;  3VVF A;  4GOT A;  2DWJ A;  2O7I A;  1H76 A;  4L17 A;  1FCK A;  3H7M A;  2DE4 A;  2B65 A;  3CG1 A;  1ZMG A;  3SEV A;  1OIB A;  1Z7M E;  5ITP A;  4DDD A;  2PMS A;  3IOW A;  2XXY A;  3CFZ A;  3TTM A;  3TFL A;  3A3U A;  2CMO A;  3KEI A;  3SES A;  4FEC A;  5ITO A;  3F11 A;  2I58 A;  4QF9 A;  3MQ9 A;  3OO6 A;  3Q27 A;  1LGB C;  4F22 A;  2QS2 A;  3HCQ A;  2Y7K A;  3OEM A;  3KFM A;  3TPA A;  3N6T A;  1H45 A;  3H03 A;  3H6V A;  4G8N A;  4LON B;  4PFW A;  3TOD A;  4JSO A;  4YKK A;  1IEJ A;  3EN3 A;  1N7X A;  2HAV A;  3MJN A;  3LUY A;  2Q8J A;  3VXC A;  1JQF A;  4RYA A;  1YPN A;  1P1U A;  4BDL A;  1LCF A;  3TCH A;  4GQO A;  4YMB A;  2F36 A;  4PFT A;  1MQD A;  1OLC A;  4H8J A;  5EHS A;  2V3U A;  2DSF A;  1IZ1 A;  2G29 A;  3MP1 A;  3HV1 A;  5L9S A;  1JW5 A;  4H5F A;  3IB2 A;  4F39 A;  4C1T A;  4ZEI A;  4HTG A;  2XXR A;  1B3F A;  2V3T A;  1SW4 A;  3SEY A;  4R75 A;  3CG3 A;  3BFT A;  3UN6 A;  3O9P A;  1M5D A;  1QKA A;  4EF1 A;  1ZLQ A;  1NNF A;  5DVI A;  1A55 A;  1XVX A;  4LZ7 A;  4YKJ A;  3G3F A;  3MPK A;  3DP8 A;  1EH3 A;  1FTK A;  2NUV A;  4OZ9 A;  3TEL A;  1LAH E;  2X26 A;  3Q26 A;  1RYX A;  3MP8 A;  3M3F A;  2XD3 A;  3MVW A;  4X1D A;  2NXO A;  3T93 B;  4IGR A;  4F29 A;  3IB0 A;  4KHZ E;  1I69 A;  4GD5 A;  3T9U A;  1B3L A;  4GLI A;  1Y1Z A;  2ONK E;  3MZ9 A;  3FXR A;  1FTL A;  3OO7 A;  1N76 A;  4H1X A;  1M5E A;  3SEX A;  4H0W A;  4DCX A;  2F7C A;  4PFY A;  2FA7 A;  3JZJ A;  2XXI A;  3PUV E;  1QUL A;  2GRV A;  4N6P A;  4F3B A;  3SEW A;  1BTJ A;  1VFD A;  4KYS A;  3VDF A;  4OER A;  1PBQ A;  5TP9 B;  2D5W A;  4ESW A;  5DEX A;  1XS5 A;  4GWO A;  1HSE A;  4QSE A;  4RK9 A;  4R6K A;  2QMW A;  2RC8 A;  3GBA A;  2AL4 A;  5BUU A;  2I49 A;  2F5X A;  1RYO A;  1XVY A;  2ZYN A;  1NMU A;  3T96 B;  4XIG Q;  1P99 A;  2VD2 A;  3E4R A;  4BDO A;  1H3D A;  4ESX A;  5KZT A;  1US4 A;  3O28 A;  3M3K A;  5FTH A;  1LFH A;  3UA8 A;  4G4P A;  2Y7R A;  1MQH A;  1A99 A;  2QL3 A;  2W7Y A;  2I4B A;  4GXS B;  1B5J A;  3U72 A;  2RKM A;  2PVU A;  4JWY A;  3Q28 A;  4QFN A;  1LAX A;  4ZS9 A;  2F97 A;  1MXV A;  4TLM B;  4DLD A;  1I6Q A;  1IXC A;  4OXV A;  2VP1 A;  1OVT A;  4NTL A;  3M8U A;  3LSX A;  3RT8 A;  1Y1M A;  4H6D A;  2HCA A;  5CM6 A;  3T9V A;  2ANJ A;  2XX7 A;  4JB7 A;  1SI1 A;  1B3H A;  3C36 A;  5L9M A;  1LBB A;  4F1V A;  1B52 A;  3IB1 A;  1UIV A;  1B4H A;  4GL8 A;  4G8M A;  3VXB A;  3IX1 A;  3PUZ E;  1MXX A;  1N04 A;  4LVQ A;  4MH5 A;  4BDM A;  2DXR A;  4LZ5 A;  1LLS A;  4EXK A;  4EF2 A;  4OEN A;  2H9B A;  2ZNU A;  4IO6 A;  4ZZE A;  5HM4 B;  2XXX A;  1JEU A;  1SYH A;  1JEV A;  2DWA A;  1QUJ A;  2Y7I A;  1JET A;  1WOD A;  2VGQ A;  4RA1 A;  4OHN A;  1VFE A;  2Q89 A;  5AA2 D;  2Y84 A;  1MQG A;  4IO4 A;  3QAX A;  4POW A;  2XHD A;  3TEP A;  4GVO A;  3EHU A;  3VVE A;  4RNS A;  1O63 A;  4UAC A;  1UQW A;  2IA4 A;  3R7X A;  2HQ0 A;  2OJT A;  2OLB A;  3VE1 B;  4GF8 A;  1URS A;  3PPQ A;  4AB5 A;  1SI0 A;  2Z23 A;  3Q25 A;  4NF8 A;  2R6G E;  4LQ2 A;  2ZYM A;  1P1W A;  1WVJ A;  2I0C A;  2QJE A;  5DT6 A;  3H6T A;  1DTZ A;  4BDN A;  1A54 A;  4OEU A;  4MLQ A;  4QHQ A;  3B6Q A;  2ZMB A;  4P0G A;  1NNP A;  4GIZ A;  2Q2A A;  1M5B A;  5I59 B;  3E3K A;  1B3E A;  3HST A;  2E1S A;  1FW0 A;  4QFO A;  3OMB A;  3PV0 E;  5AA2 A;  4R73 A;  1M5C A;  1IIT A;  1UTB A;  1AOV A;  4KCC A;  5H8F A;  3S9E A;  1NH7 A;  4I62 A;  4QSC A;  1YTV A;  3PGF A;  1B0L A;  3S9L C;  3T9X B;  1URG A;  4YKP A;  1MY4 A;  3OO9 A;  4EXL A;  4I9D A;  4XKQ A;  5H8N B;  4U1O A;  1POT A;  5AE4 A;  4MF3 A;  5CMB A;  5KDT B;  4R6Y A;  3KBR A;  1S9T A;  3DEL B;  3OEL A;  3ODB A;  4OET A;  1B4Z A;  4G68 B;  1S50 A;  5I2K B;  3IOU A;  5ICT A;  3K02 A;  3PD8 A;  5JK4 A;  3TTL A;  2XX8 A;  4GRK A;  3U93 A;  4NF6 A;  4U4X A;  2DVZ A;  4EQ7 A;  5ELV A;  2DXY A;  2A5T A;  4OFJ A;  3KOT A;  3ZKL A;  3RQT A;  2P0S A;  4R9F A;  1DOT A;  2FYI A;  4NF8 B;  3O97 A;  4NED A;  2PT2 A;  2F34 A;  4Q5T A;  4O3A A;  3OSR A;  1FTM A;  1VE4 A;  3SDF A;  3OEK A;  3S9M C;  1QUI A;  4GXA A;  3I3V A;  3MVZ A;  4JDF A;  3O66 A;  4OES A;  4QFL A;  1DMB A;  4KCD A;  3RGY A;  3H4Z A;  1P1N A;  1A8E A;  3IO6 A;  5M2V A;  4R72 A;  3B7D A;  3TZA A;  1FQA A;  5KCJ B;  2DE2 A;  2F6P A;  2O69 A;  2GHB A;  4ELO A;  2VHA A;  3FIR A;  4O3B A;  3MUQ A;  5AA2 B;  4R9G A;  1LCT A;  1N3X A;  2QS3 A;  4Z7E A;  3RTF B;  1UIU A;  2Z22 A;  1DSN A;  5CRY A;  2UVH A;  5HBC A;  1D9Y A;  1UTB B;  1MDQ A;  1KWH A;  4UA8 A;  3IL1 B;  1B6H A;  4DXB A;  3IOR A;  5DVF A;  1B9J A;  5H8F B;  2DVC A;  4XTC Q;  3A3C A;  1Q35 A;  4H5G A;  4ZE8 A;  2R9J A;  3SER A;  5TP9 A;  1D9V A;  2ZXT A;  3KJT A;  4JXI A;  4FIM A;  2V3Q A;  3G3K A;  1SBP A;  3HHG A;  4WEP A;  1T0K A;  2NVU B;  2OZZ A;  4WED A;  4ELR A;  3FUZ A;  2DWH A;  3BBR A;  4U21 A;  2V84 A;  1MG1 A;  2PYY A;  4X1B A;  4G2Z A;  3WAE A;  3K6U A;  3RTW B;  3EHS A;  2M8C A;  3VVD A;  4EQB A;  3FVG A;  2I3V A;  4IO3 A;  1EU8 A;  2UVI A;  4LQ5 A;  4OQO A;  3QYT A;  2ONS A;  4LP2 B;  1NNT A;  2D3I A;  4NF6 B;  4DE8 A;  2A5T B;  1GV8 A;  4KPT A;  2NWJ A;  4KYD A;  3ILU B;  3KGC A;  1VR5 A;  1MXU A;  3C4M A;  3JYR A;  4OFO A;  1A40 A;  1PBP A;  3K01 A;  3MPL A;  2A5S A;  4THI A;  1FTO A;  4ZEF A;  3TKD A;  4YAH X;  5F7V A;  4IO7 A;  4ZE9 A;  3BFU A;  4DZ1 A;  4ND9 A;  4EDP A;  2E0S A;  3CSB A;  4KI0 E;  3JV9 A;  3FXU A;  3P7I A;  4G77 A;  3WAF A;  2ZYO A;  5AA1 A;  3KSJ A;  4PQJ A;  4EQ9 A;  1MY2 A;  2UYF A;  3K1P A;  4MBP A;  1SW2 A;  3OEN A;  2O51 A;  3K6V A;  1LFI A;  4I1D A;  5JTY B;  1N0T A;  1POY 1;  3O6H A;  2VD3 A;  1NKX A;  1HSJ A;  4H67 A;  5B7D A;  2OBG A;  4OEV A;  1B51 A;  2WKY A;  3CFL A;  3A09 A;  1Y9U A;  3RUM A;  4DXU A;  3PMW A;  4KD5 A;  2RIN A;  4C0R A;  1XT8 A;  3H6U A;  3G3J A;  4HW8 A;  3SKP A;  4N13 A;  2UVJ A;  4Q30 B;  1AMF A;  4U23 A;  3T9H B;  2DS9 A;  3C34 A;  3FZV A;  4NWD A;  2HFB A;  3O6I A;  1BKA A;  3C32 A;  3FXQ A;  3MP6 A;  1OQH A;  3U1O A;  3CR9 A;  1A7L A;  3KJ7 A;  3D4C A;  3TCF A;  5H8H B;  5DYH A;  3L6H A;  4ELP A;  5I59 A;  5CMC A;  1H44 A;  3PPP A;  4R2B A;  3FAS A;  1EZO A;  3G3G A;  1WDN A;  1SVX B;  1QW0 A;  2X7P A;  3OD7 A;  3PUW E;  4F31 B;  1MXW A;  4ZEK A;  3MAM A;  4X48 A;  4R2F A;  5H8Q A;  3FVK A;  3ZSF A;  2ALU A;  3KN3 A;  3D4G A;  2Y7P A;  3N94 A;  1US5 A;  3OOA A;  3TQW A;  2BJJ X;  3PMV A;  1TT1 A;  3H06 B;  2ZNS A;  4C1U A;  2H98 A;  1TFD A;  1LB9 A;  5I58 B;  5H8N A;  5KDT A;  4ZEC A;  3PD9 A;  1N7W A;  4QFK A;  3VLW A;  3MWB A;  1MDP 1;  4G68 A;  2Q9T A;  1ZU0 A;  1JW1 A;  3LSW A;  1LBC A;  2I4C A;  1FQC A;  3PPR A;  5I2K A;  3G7W A;  1P1Q A;  1A8F A;  1F9B A;  1Y4T A;  5AA3 A;  1JVX A;  3PUX E;  3FJ7 A;  1ANF A;  4F3P A;  5FHM A;  1MQJ A;  1VSO A;  4YB6 A;  1USY E;  4OVJ A;  4H8I A;  3DM0 A;  1M5F A;  1EZP A;  1SYI A;  5CMK A;  1CB6 A;  3DP4 A;  1GTK A;  3TMG A;  5TU0 A;  3C9H A;  3EQ1 A;  2I0B A;  3TTR A;  1HSL A;  3TYH A;  3PU5 A;  5I57 B;  3FAT A;  1SW5 A;  1LAG E;  3HN0 A;  4XKP A;  3S4U A;  1B2H A;  2DQV A;  1B40 A;  3CI8 A;  3C33 A;  4OWD A;  3LR1 A;  3V8X B;  1JW4 A;  3KOS A;  1MS7 A;  3U92 A;  3TDJ A;  4RPO A;  4XXU A;  1XHY A;  3IOV A;  1NNK A;  2I6E A;  5KCJ A;  4JWX A;  4FAJ A;  1DPP A;  2UXA A;  3GLB A;  4U1Z A;  1IXG A;  2P1S A;  3QIM A;  4GFR A;  1QKB A;  4U2R A;  2DWI A;  2ZNT A;  4OFL A;  4YU0 A;  2F6G A;  3PPO A;  3K2D A;  1B7H A;  3PPN A;  1PB9 A;  1MM6 A;  5H8Q B;  4KYE A;  4HCW A;  1BIY A;  2Q2C A;  5L8D A;  3FD3 A;  4IGT A;  4QSD A;  4IO2 A;  2GH9 A;  2XXP A;  3OO8 A;  5K2Y A;  3FV1 A;  2F7B A;  4ZEB A;  4G8H A;  3VLU A;  2REJ A;  4YB7 A;  1II5 A;  1OMP A;  3CSG A;  3IAZ A;  4E0X A;  1FTJ A;  3VV5 A;  5I2N A;  4KQP A;  1SD3 A;  4FOR A;  3SEU A;  3EF7 A;  3K6X A;  3TCG A;  3EHT A;  4IY5 A;  5CBR A;  1TXF A;  4N07 A;  1P1O A;  5DVJ A;  4ECF A;  1CE2 A;  3K0V A;  4M1V A;  4DCY A;  4WXJ A;  5HPQ A;  1TFA A;  4FE8 A;  4F2O A;  3FV2 A;  4YB5 A;  1B05 A;  3O2A A;  4HS7 A;  1D4N A;  3KN7 A;  4PET A;  4BLA A;  3LBS A;  1R9Q A;  1ZKB A;  4QRZ A;  3FVN A;  3B6W A;  2DE3 A;  2AYS A;  3UK4 A;  1QUK A;  4PE5 B;  4YMA A;  4Q8R A;  1DPE A;  3VLV A;  2R71 A;  4OMB A;  3IK6 B;  3Q29 A;  1MM7 A;  2F78 A;  5I56 A;  2F35 A;  1YAE A;  2THI A;  4F3G A;  3RY3 A;  1B7U A;  1NL5 A;  4QFP A;  5TPA B;  1OLA A;  2RC9 A;  4F1U A;  3CIJ A;  5L9O A;  3FJM A;  1B32 A;  1GVC A;  1OVB A;  2RC7 A;  4I8C A;  3GZG A;  3MBP A;  2IEE A;  5CBS A;  3QSL A;  3H6W A;  5FTI A;  1Y20 A;  4JWO A;  2QS4 A;  3ILT B;  5JEI A;  4OYV A;  1ATG A;  2HEU A;  4E0W A;  1ZTY A;  2OK2 A;  3RN8 A;  1IIW A;  1J1N A;  4IO5 A;  5JTY A;  2H25 A;  3W9V A;  2KLF A;  1B58 A;  5IKB A;  4BDQ A;  4F18 A;  3TTK A;  1MQI A;  1PC3 A;  3DP6 A;  1D3K A;  1Z7N E;  1PB7 A;  1FQF A;  3H3G A;  1LAF E;  2V93 A;  3RNN A;  3E13 X;  1I6B A;  5CMM A;  1MY3 A;  2I3W A;  3TTN A;  2XXU A;  2RCA A;  2RF1 A;  5I2N B;  2B3B A;  1SDX A;  3HPI A;  3TQL A;  3K6W A;  3T22 A;  1PDA A;  3RPW A;  3ECR A;  2O1M A;  3ZS6 A;  5H8H A;  3V5A A;  3THI A;  2OWS A;  2OWT A;  3TUS A;  4RY1 A;  1QVS A;  3T66 A;  3N5L A;  2F8D A;  4OTE A;  5FHO A;  2XXH A;  3FVO A;  3AXF A;  2VOZ A;  4WKM A;  4NF4 A;  1B5I A;  3G3H A;  3CFX A;  5B70 A;  2O68 A;  1B0H A;  2QMX A;  1GGG A;  3HO7 A;  4FAT A;  3UGW A;  3K1N A;  1R6Z A;  5I56 B;  1B46 A;  4LZ8 A;  1XC1 A;  5FHN A;  4Q0C A;  1MY0 A;  4YIC A;  3MVY A;  4M4G A;  2LAO A;  3O29 A;  3IJX B;  4ISU A;  4KR5 A;  5I58 A;  1PB8 A;  1ZBM A;  3N6U A;  1FQE A;  4F2Q A;  5EHM A;  4R6H A;  1R1N A;  4PP0 A;  4H65 A;  3UIF A;  4POX A;  1GR2 A;  2PT1 A;  4ELQ A;  2ESN A;  1FQD A;  3FJG A;  1JVY A;  2Z8F A;  2X7Q A;  3KN8 A;  1PEB A;  3R26 A;  3MVX A;  1B3G A;  4TOZ A;  3CRB A;  1NH8 A;  3I5O A;  4NF5 A;  3S9N C;  4F1Y A;  3MZB A;  4YKI A;  2G93 A;  5CI5 A;  1Q1K A;  4F19 A;  3FGS A;  5I84 A;  5I57 A;  3DLN A;  1YCJ A;  2XXQ A;  3GBB A;  3ZKK A;  4ZED A;  3G3I A;  3PUY E;  4R74 A;  3K1M A;  2ABH A;  5AA4 A;  2AIX A;  4K3F A;  2HAU A;  5J1D A;  3MC2 A;  3SET A;  5A5X A;  1Y3Q A;  2AL5 A;  3L6G A;  2UVG A;  3ONM A;  3OXN A;  1L5T A;  4AQ4 A;  4RK2 A;  4FED A;  5H8S A;  2I48 A;  3O6G A;  1B7Z A;  1XOC A;  4XKN A;  5ICQ A;  5F1Q A;  1EZ9 A;  3HHF A;  4NF4 B;  3MZ1 A;  3KG2 A;  3IR1 A;  2GHA A;  1I6A A;  5DTB A;  4JBZ A;  3QXM A;  1OQG A;  5ISU A;  1URD A;  2QS1 A;  3QK6 A;  2PX1 A;  1Y3P A;  3QUF A;  1AIV A;  2O1L A;  3I6V A;  2NOO A;  2UYE A;  4NWC A;  3RT6 B;  1MH3 A;  1MPC A;  1AH5 A;  4FEB A;  1IXH A;  1LST A;  4FJP A;  1B1H A;  1MY1 A;  4Z0I A;  4ZZA A;  1SW1 A;  1ZJL A;  1S7Y A;  3K00 A;  3PMX A;  5LOM A;  3LC8 A;  3KSX A;  2XXV A;  3E9X A;  1MH4 A;  3R6U A;  2GFE A;  4DXC A;  4RPN A;  4O3C A;  1MRP A;  1O7T A;  2YPN A;  4TLL B;  3V83 A;  2RCB A;  3LSF B;  3W9W A;  4NF5 B;  2XXW A;  2QRY A;  1UTH A;  2P2A A;  1Y4C A;  4X9T A;  1MXZ A;  2QPQ A;  5IAI A;  4IB2 A;  1NFT A;  5DEX B;  2H4I A;  3RLF E;  1LB8 A;  3QUJ A;  4AB6 A;  4BDR A;  2OCU A;  5AA4 B;  5BWJ A;  1FQB A;  5TPA A;  1MPB A;  4RXL A;  3V89 B;  3U94 A;  4DIG A;  1R9L A;  1USY H;  5A5X B;  1H43 A;  4MLV A;  2ONR A;  1ZIU A;  2DYX A;  4EUO A;  1ELJ A;  1JNF A;  1B5H A;  2O84 X;  2REG A;  1N3W A;  2D21 A;  3KZG A;  3S2V A;  4U4S A;  4LAT A;  4P11 A;  3UOR A;  4RJZ A;  1Y3N A;  2O7U A;  1MPD A;  1SQY A;  3LSL A;  2DOJ A;  2F7A A;  4ZDM A;  5K2X A;  4ONY A;  2Q88 A;  3M3L A;  4LUB A;  4F3S A;  4P0I A;  1IXI A;  2B3F A;  3MW0 A;  4YZZ A;  2HZL A;  2XX9 A;  4IY6 A;  4U22 A;  2HXW A;  2YLN A;  4LA9 A;  1IQ7 A;  4GL0 A;  2Z8E A;  1QJM A;  1B1X A;  2V25 A;  2O6A A;  3USD A;  4KFQ A;  1DTG A;  2DP8 A;  4TQU Q;  2XD2 A;  1N84 A;  3W15 C;  1RKM A;  1LFG A;  1AL3 A;  2Y7W A;  3BKI B;  4JSD A;  3EPE A;  4G68 C;  5CC2 A;  2QSX A;  2ZYK A;  3K4U A;  4NE4 A;  4XKR A;  3U8Q A;  2Z8D A;  1BP5 A;  1UTH B;  4NMY A;  3CVG A;  4HCY A;  3IOT A;  3VFJ A;  2CZL A;  1BLF A;  2YJP A;  2XXT A;  3C31 A;  2PBW A;  1O64 A;  3GXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...