2UVIA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with 4,5-unsaturated digalacturonic acid
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
404
structure length
404
Chain Sequence
EVNLRMSWWGGNGRHQVTLKALEEFHKQHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGKVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWINGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVEALGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
total genus 137
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uviA02
1Y9UA 4GVOA 3RTFB 3MUQA 4G77A 3T96B 4DCXA 4DXBA 4QFNA 1R9QA 1RYXA 1XHYA 3KOTA 4X1BA 2F6PA 1XVYA 2Z23A 4G4PA 5F1QA 1QJMA 1R9LA 3QSLA 3U94A 1B58A 2OCUA 4YKPA 1GVCA 1EZPA 1PB8A 5I56B 5IKBA 2ZYMA 1JW4A 3K02A 1PEBA 4U1ZA 4ONYA 4JB7A 1J1NA 1OLCA 2HAUA 2PBWA 3IJXB 3MVWA 1SW2A 3U93A 4F3BA 2O7IA 1PC3A 1F9BA 2QL3A 4EXKA 1AH5A 3FIRA 1UIUA 1VSOA 5DTBA 5I2KA 2H9BA 5I2NB 5ITPA 1B40A 4R6YA 5EHSA 1N76A 3HV1A 1MPDA 2VOZA 3LBSA 4DXUA 3QUJA 4F3GA 1N04A 3V5AA 4PE5B 2R6GE 1AOVA 3LSFB 1JVYA 1NH8A 1QKAA 3OSRA 4X48A 4RK2A 3IO4A 1Y3PA 4ZDMA 3CG1A 3C32A 4GWOA 4TQUQ 4XIGQ 2P1SA 2FNCA 3H06B 3C34A 3PUWE 4ZS9A 4ZZAA 2Y7KA 2M8CA 2RCAA 1B7HA 4Q0CA 2Q9TA 1IXCA 3BBRA 1FW0A 3ILUB 3E13X 3K1MA 4IGRA 4XXUA 4F3SA 4RK9A 2XHDA 4OFLA 1Q35A 3OENA 3MAMA 1FTLA 1DTGA 3MP1A 4QSDA 5ICTA 4F3PA 5BUUA 4LZ5A 1B4ZA 2DXYA 1Y1ZA 1A55A 1MG1A 4TOZA 4WXJA 3ODBA 1D9YA 3DELB 3FVGA 1MDQA 1OVTA 5FHNA 4DZ1A 5HM4B 1MPCA 2ZYKA 3P7IA 3RT8A 2IA4A 1DPEA 3RUMA 1FTOA 3G3JA 2Q8JA 3IL1B 4WEDA 2LAOA 1ELJA 4NE4A 3SEUA 5J1DA 3FV1A 1B9JA 2OLBA 1MH3A 2DYXA 2VHAA 4X9TA 5DVIA 3TTRA 1ZBMA 3IOUA 2F8DA 4M1VA 3TDJA 3TCHA 1SI0A 3UP9A 1MPBA 2Y7IA 2Y84A 3SEYA 4DE8A 2I48A 1D3KA 1URDA 4O3BA 4U23A 3TTLA 2G29A 2XXXA 4FJPA 3R7XA 2VD2A 5H8NA 3ZKLA 3T66A 4FAJA 2ANJA 4OXVA 1IZ1A 4JWYA 1ATGA 2O7UA 3EF7A 1GGGA 1LAFE 1B5IA 1OQGA 1URGA 2I3VA 1MY2A 1A7LA 3C35A 4ZEBA 1YAEA 2XXWA 3BFTA 4PFTA 3MBPA 1US5A 4FE8A 3TCFA 1A40A 3T22A 1SDXA 3K6UA 2O68A 3H7MA 4GF8A 2V3TA 3LC8A 3DP6A 4GL8A 1UTBB 1B0HA 5I57B 4YKJA 3KEIA 4KCCA 1B05A 2V84A 1B4HA 3KJ7A 2XXHA 3KSXA 3N6TA 4U22A 4U4XA 4Z7EA 2Q2AA 3MWBA 3I5OA 2P2AA 2XXPA 3RLFE 1SI1A 2NXOA 3I3VA 4YB5A 2ONRA 5AA2A 1ZIUA 4AB6A 3RN8A 4BDNA 1NL5A 2Y7WA 4MH5A 5EYFA 3VDFA 3O6GA 2IEEA 2CMOA 5H8HB 4MF3A 1EZOA 4OQOA 4ZEIA 3OO6A 1FCKA 2THIA 3MVZA 4OENA 3MW0A 1FQFA 2Q2CA 3EHTA 1P99A 4ELQA 3S9EA 1BIYA 4ELPA 4JWOA 1LAXA 1Y4TA 3RGYA 1MY0A 3G3FA 4WEPA 4Q5TA 3RTWB 4LQ2A 4FECA 5I57A 1B3EA 4EQBA 1OVBA 1XC1A 2B65A 1M5FA 2XD3A 2YPNA 1I6QA 4GLIA 4N07A 5H8QB 1XOCA 3H3GA 1B46A 1QUJA 1YTVA 4F2OA 4R6HA 1N3WA 1M5BA 3JV9A 3KG2A 1FTJA 3VE1B 1MQHA 3G3HA 5DVJA 2YJPA 1B1XA 4P11A 4AQ4A 3T9UA 2UYFA 1IIWA 2Q88A 3N6UA 4NTLA 2NUVA 4HS7A 1FTMA 3LSWA 4BLAA 4E0WA 3OSQA 1P1NA 3TELA 5JK4A 1H45A 1LSTA 3EHSA 1MQIA 3SETA 2DXRA 1USYH 1B52A 3CSGA 1LAGE 2QS4A 2XXQA 3IORA 4K3FA 4O3CA 4OFJA 5CRYA 3MPKA 3V8XB 5KZTA 4FATA 1TFDA 4IO7A 3G7WA 3OO8A 4ELRA 4Q8RA 3U72A 2NWJA 2F36A 3KGCA 3O29A 4R75A 3VLUA 2XXTA 1SYIA 2D3IA 1IXGA 2G93A 1QW0A 1WODA 2H98A 2I0CA 4G2ZA 5I59A 1ZJLA 5DVFA 2ZNUA 1BTJA 2QMWA 4ZE9A 5AE4A 3CSBA 3OELA 3TZAA 3IOVA 3B6WA 3LR1A 5CMCA 3TODA 1PDAA 1TT1A 2F35A 4LZ7A 4LONB 4U1OA 1FQDA 4EQ7A 4F22A 1OLAA 2A5TA 4M4GA 3QIMA 2AL4A 1HSLA 1JVXA 2OJTA 2UVJA 1B5JA 4LVQA 2PT1A 1SW1A 1M5DA 1BP5A 2Q89A 3MC2A 5H8QA 4ZECA 1UQWA 3FJMA 1YPNA 4IB2A 4LUBA 4DXCA 4R9FA 4R2BA 2GFEA 1NMUA 3I6VA 1N0TA 4FORA 3FASA 3WAEA 3RY3A 1UTHA 4ECFA 1PB7A 2OBGA 5JTYB 1SQYA 1O7TA 3O66A 3Q29A 1H43A 4QF9A 5H8HA 4F29A 5A5XB 1Y3NA 2X26A 1VFEA 3Q28A 2QS2A 2GHBA 4OZ9A 1IITA 3C31A 1TWYA 1Y3QA 2F97A 1MDP1 3PPPA 3KZGA 1H3DA 2DVCA 2PT2A 5DEXA 1B32A 3S2VA 1D4NA 3UA8A 4GXAA 1GTKA 2Z8DA 1JEUA 3K0VA 4TLMB 5TP9A 5ISUA 4NEDA 4JXIA 3SERA 3S4UA 4F19A 3C33A 1NKXA 3FV2A 3K1PA 4IY5A 3SEXA 3EHUA 1VFDA 4GQOA 4UACA 3VV5A 4F18A 3FXQA 4HCWA 3LSLA 4G8MA 1ZTYA 1LGBC 1IXIA 1TFAA 1H44A 2RC7A 1AL3A 4GFRA 2CZLA 4GRKA 2RF1A 4HCYA 3CRBA 1NNKA 3M3LA 2X7QA 1VE4A 1MXXA 2HCAA 3GBAA 1EU8A 3SDFA 3EN3A 2F78A 3PGFA 1I6AA 3FVOA 3LUYA 1I6BA 3R26A 2DE4A 1LBCA 4JDFA 4DLDA 4ESXA 3ZKKA 4KYEA 2I4BA 2A5TB 4ND9A 4F1YA 2ONKE 4IGTA 2FYIA 4H1XA 4QFKA 3TPAA 2OZZA 3V89B 2QMXA 3GXAA 3HSTA 1NH7A 1QKBA 4EDPA 4PFYA 2UVIA 4OYVA 3TQWA 2F7AA 3ZSFA 2XXYA 1DPPA 3PU5A 1L5TA 3JZJA 5CBSA 5H8NB 3A09A 5KCJB 3TFLA 3TCGA 2DE3A 2ZXTA 4XTCQ 1O63A 1MRPA 3TTKA 1XVXA 2HXWA 3DLNA 1MQDA 2BJJX 5ELVA 4ZZEA 3H03A 4YMBA 2Z8EA 4DIGA 1LAHE 3L6GA 1QVSA 4KYSA 4RJZA 4XKNA 3C4MA 4NF4A 4NF4B 3SESA 2Y7RA 3W15C 2PMSA 1JETA 4QHQA 5CM6A 3E3KA 1MM6A 2DQVA 2PX1A 5DYHA 3KN8A 3DM0A 3O2AA 4RA1A 5CMKA 4H5GA 4GIZA 2OWTA 4H6DA 2F5XA 3K2DA 4YKKA 1A8EA 4XKPA 4FEBA 3UORA 1URSA 1HSJA 5M2VA 4OTEA 3IX1A 1FTKA 4KR5A 5I58B 2Z22A 1MXVA 3K4UA 4R6KA 3FATA 2XX9A 4NWCA 5I56A 4ZEFA 3SEVA 5AA3A 5IAIA 3OOAA 4IO2A 4QRZA 4BDMA 2DWJA 4NF6B 4YU0A 5TU0A 1SW5A 1JW1A 1H76A 5DEXB 1SVXB 3LSXA 2I6EA 2ABHA 3D4GA 3TTMA 4OMBA 3PUXE 3RNNA 1B3FA 4JBZA 3QYTA 5AA2B 1ANFA 3IOWA 3KBRA 2RCBA 1D9VA 1SW4A 3KOSA 2I49A 3VVEA 1FQAA 3OO9A 1MY3A 1LB9A 1P1OA 1USYE 4GOTA 2H5YA 1WVJA 3VLVA 4IO6A 4QFLA 4UA8A 4OESA 1YCJA 1AIVA 3KFMA 3OD7A 1M5CA 3FD3A 5K2XA 3T93B 3W9VA 3G3IA 1JQFA 3B6QA 4NF6A 1LFIA 3VXCA 3IB2A 5CBRA 2GH9A 2WKYA 1CE2A 3QXMA 4U21A 1ZU0A 3FVNA 4OWDA 4R73A 3TYHA 1Z7NE 3PMWA 4NF5A 3T9HB 1T0KA 1MM7A 4HW8A 3PMXA 3S9MC 3FJGA 1HSEA 1B7ZA 3FUZA 3ONMA 4N13A 2ALUA 2ESNA 2GHAA 1FQBA 3HHFA 3UIFA 3FXRA 4EF1A 2H99A 4GD5A 5A5XA 1IEJA 1P1UA 4R74A 3RPWA 5JTYA 2DS9A 2B3FA 3H6VA 3O9PA 3HN0A 1LBBA 4KHZE 4OEUA 2I0BA 1QUKA 4JSOA 4U2RA 3T9VA 4POWA 2F7CA 2Y7PA 3FVKA 3MPLA 3QUFA 1S50A 2DWIA 4GL0A 3IB0A 1MY4A 4KFQA 4MBPA 1MXUA 5TPAB 4IO5A 2DWAA 1B6HA 2Z8FA 2F34A 3CVGA 4H5FA 1B1HA 2H25A 1B51A 3KN7A 4IY6A 2ZNTA 1N7WA 4ELOA 4C0RA 3C36A 4LATA 4C1UA 5CC2A 4RPOA 1OMPA 3CFZA 1TXFA 2VD3A 3PUYE 1JW5A 3K6VA 4EUOA 4HTGA 4KQPA 3RQTA 4EXLA 3BFUA 4F2QA 2QSXA 1WDNA 2O51A 3FXUA 5EHMA 3M3KA 1FQEA 3WAFA 5I59B 2O6AA 5I58A 2RC9A 3MQ9A 1B3HA 1UTHB 2RKMA 4ZEDA 1MXYA 5KDTA 3IJOB 1MH4A 1XS5A 4P0IA 1US4A 3CR9A 3S9LC 4F31B 1BLFA 3TKDA 3OO7A 3H6UA 1JEVA 5AA4A 5I2KB 1MXZA 1QUIA 3DP4A 1QULA 2FA7A 4G68A 4TLLB 4POXA 3PD8A 2DSFA 4OETA 1PBPA 1MQGA 3TTNA 5B70A 5BWJA 5HPQA 5K2YA 4BDOA 2HZLA 4BDRA 1O64A 5L9OA 2GRVA 3CFLA 3FGSA 1ZMGA 4H65A 2REGA 4LZ8A 4NMYA 5CMMA 4YZZA 1GV8A 3THIA 4DCYA 4NF8A 5F7VA 4EF2A 5I84A 3USDA 3G3GA 4BDLA 4GXSB 5B7DA 5FHOA 1EH3A 3GZGA 1DOTA 4YKIA 2XXRA 3AXFA 4YB6A 4PFWA 4I8CA 3PPNA 5FTHA 1UTBA 4RNSA 1LFHA 3F11A 4R2FA 5L8DA 1B5HA 1S9TA 1Y20A 2ZYNA 3A3UA 3B7DA 4QSEA 1UIVA 4Z0IA 4KYDA 5HBCA 1SYHA 3HPIA 3PPOA 4X1DA 3IAZA 2UVHA 4YAHX 3ECRA 5FHMA 1PBQA 2H4IA 4NF5B 1FQCA 2A5SA 3PMVA 3SEWA 2YLNA 2O1MA 2V3QA 3A3CA 3IO6A 3O97A 1JNFA 2V3UA 3PUZE 4BDQA 1P1QA 2ZNSA 1LCTA 1A8FA 1AMFA 3PPQA 5H8SA 3M3FA 2DP8A 3TQLA 3VVFA 3GLBA 3TAJA 2VGQA 2P0SA 4ZE8A 5L9SA 2I58A 2UVGA 4NWDA 4DDDA 3DP8A 1KWHA 4YMAA 1A54A 2X7PA 4G8HA 5AA1A 4RXLA 2XXVA 1B3GA 5TP9B 4N6PA 3U92A 3CG3A 1B7UA 1P1WA 4O3AA 4F1VA 1Y4CA 3U8QA 3OXNA 5H8FB 4YB7A 1VR5A 3ILTB 2I3WA 3MZ9A 2I4CA 5CI5A 4PP0A 3VFJA 1ZLQA 3VXBA 3CFXA 3N5LA 2R71A 2NOOA 5JEIA 1LCFA 3U1OA 1GR2A 4PQJA 3FJ7A 4R9GA 3FZVA 4IO4A 4G8NA 4ISUA 1Q1KA 4H8JA 1OIBA 3RT6B 4LP2B 2NVUB 4KD5A 1IUDA 3IB1A 2QPQA 1Y1MA 1MQJA 1IXHA 3MZBA 3PPRA 2HQ0A 1RKMA 1RYOA 4AB5A 1MXWA 3N94A 1CB6A 2XD2A 4E0XA 3IR1A 3VLWA 3K00A 3CI8A 2KLFA 1II5A 2OK2A 4IO3A 5AA4B 3H6WA 5AA2D 3JYRA 3MVYA 2QS1A 3E9XA 1S7YA 4G68B 3OMBA 4OEVA 3T9XB 3K01A 3L6HA 2V93A 2ZYOA 3O6HA 4ZEKA 4QFOA 3V83A 1MS7A 2ZMBA 3IK6B 1DTZA 1XT8A 4KPTA 4QSCA 3N26A 3CIJA 4I9DA 2DVZA 1NFTA 1OQHA 3D4CA 1A99A 3B6TA 3M8UA 2XXIA 3MVXA 3O6IA 2HEUA 2E0SA 3HO7A 3MP8A 1IQ7A 1LB8A 4U4SA 1ZKBA 1POTA 2QRYA 2DE2A 4NF8B 3IOTA 1N84A 4MFIA 2DOJA 3Q25A 4F39A 2E1SA 2OWSA 2QJEA 2F6GA 2QS3A 2XXUA 4I1DA 4RPNA 3W9WA 5CMBA 2O69A 4H0WA 2V25A 2D21A 4PFUA 3EQ1A 4YICA 4FIMA 5TPAA 1DMBA 1M5EA 1B3LA 2UYEA 3PUVE 4KI0E 2D5WA 4ESWA 3BKIB 4RY1A 2HZKA 3TMGA 3UK4A 2PYYA 4F1UA 3R6UA 4FEDA 2RC8A 4Q30B 2O1LA 3G3KA 1BKAA 4L17A 3GBBA 4PETA 3PD9A 4RYAA 1MY1A 4P0GA 2O84X 4OFOA 1SBPA 4JWXA 3UN6A 4EQ9A 4C1TA 1NNPA 2REJA 2PVUA 4THIA 5FTIA 5KDTB 1B2HA 3KJTA 1B0LA 4KCDA 2B3BA 4MLVA 1SD3A 2RINA 3MP6A 3QK6A 3H6TA 4WKMA 3S9NC 2VP1A 3Q27A 3VVDA 4OVJA 1N3XA 4QFPA 2AL5A 3EPEA 4H8IA 2ONSA 3KN3A 4G68C 4XKQA 4OERA 3SKPA 2XX7A 2UXAA 5I2NA 3E4RA 4JSDA 2DWHA 2R9JA 3MZ1A 1EZ9A 2XX8A 3PV0E 3O28A 4LA9A 1Z7ME 3H4ZA 5LOMA 3K6XA 5ICQA 1NNTA 3TEPA 3K1NA 5H8FA 4MLQA 5L9MA 4R72A 3Q26A 1LLSA 1LFGA 2W7YA 5KCJA 1DSNA 3HHGA 1PB9A 1R6ZA 4XKRA 1I69A 3OEKA 4I62A 3TUSA 3K6WA 3KSJA 3QAXA 1POY1 3C9HA 2HFBA 1R1NA 3UGWA 1NNFA 2HAVA 3HCQA 4H67A 4LQ5A 4OHNA 2AIXA 3OEMA 2F7BA 1N7XA 5DT6A 2AYSA 5ITOA 3MJNA 3ZS6A
chains in the Genus database with same CATH superfamily
1Y9UA 4DCXA 3EKIA 3U94A 1B58A 4NAPA 4ONYA 2HAUA 3IJXB 4F3BA 1VSOA 5I2NB 3MSTA 2VOZA 3QUJA 1AOVA 4FBPA 4X48A 3IO4A 1Y3PA 1K9ZA 4ZS9A 4GWSA 2RCAA 3ILUB 3BBRA 3K1MA 4I40A 1IMAA 3MP1A 4QSDA 5ICTA 4F3PA 4LZ5A 1B4ZA 3KC1A 4WXJA 3ODBA 5FHNA 2IA4A 3IL1B 2LAOA 4NE4A 5J1DA 1B9JA 2DYXA 3UK4A 4M1VA 3TDJA 3TCHA 1SI0A 4DE8A 1URDA 4U23A 3TTLA 2F3BA 2F3DA 4JWYA 1OQGA 3C35A 1YAEA 3MBPA 1FPDA 4LN5A 4GL8A 1B0HA 5I57B 1DCUA 2XXHA 4U22A 4NX1A 3I5OA 1YZ0A 4AB6A 3RN8A 4BDNA 3O6GA 2CMOA 5H8HB 3E78A 1FCKA 3MVZA 4NF0A 3EHTA 1Y4TA 3RGYA 1MY0A 2WBDA 3G3FA 4Q5TA 4WEPA 3RTWB 4LQ2A 1B3EA 4N07A 1I6QA 3H3GA 1B46A 2KQZA 4F2OA 5ESYA 2QVUA 2XXKA 4AQ4A 2UYFA 3OSQA 1P1NA 5JK4A 1H45A 1MQIA 1RDYA 2ZZVA 4K3FA 1LAGE 3IORA 3OO8A 2F36A 3KGCA 2XXTA 1SYIA 2G93A 1QW0A 2I0CA 2BJIA 2ZNUA 4PFRA 4ZE9A 1G0IA 3LR1A 3RYDA 1FQDA 2A5TA 4M4GA 1IMDA 1CNQA 1SW1A 5H8QA 1UQWA 1YPNA 4LUBA 1UTHA 1PB7A 2OBGA 1SQYA 1O7TA 4QF9A 5H8HA 2GHBA 1KA1A 3PPPA 3KZGA 5DEXA 3S2VA 1GTKA 5ISUA 4JXIA 1NKXA 3RPLB 4UACA 4F18A 3VV5A 4HCWA 3LSLA 2QVRA 1TFAA 4HCYA 2RF1A 2VPOA 1I6AA 3R26A 1LBCA 4DLDA 4ND9A 4IGTA 2OZZA 3V89B 1FPKA 1LBXA 1NH7A 4EDPA 5I7IA 3TQWA 2F7AA 2XXYA 3PU5A 1L5TA 5CBSA 3TFLA 2DE3A 3TTKA 3DLNA 4I3EA 1AWBA 3L6GA 2CZKA 2Y7RA 5CM6A 5DYHA 3O2AA 1DK4A 2FHYA 4H5GA 1LEVA 2OWTA 5I3SA 4YKKA 2Z22A 4NWCA 4ZEFA 4IO2A 4YU0A 5TU0A 5DEXB 2I6EA 3RNNA 4JBZA 5AA2B 1D9VA 1SW4A 2Y5LA 3VVEA 1FQAA 3OO9A 1LB9A 1VDWA 4NQ8A 2H5YA 4QFLA 1AIVA 3KFMA 3OD7A 3FD3A 3T93B 4NF6A 5CBRA 2GH9A 1CE2A 1Z7NE 4NF5A 3S9MC 1HSEA 4N13A 2GHAA 3FXRA 4EF1A 2H99A 4GD5A 1IEJA 3RPWA 3O9PA 3HN0A 4OEUA 4I3YA 4H45A 4KCCA 4KFQA 4MBPA 2DWIA 1MY4A 5TPAB 3CVGA 2H25A 1B51A 4GX6A 1NV7A 1OMPA 3CFZA 4EUOA 4HTGA 3M3KA 1FQEA 3WAFA 2RKMA 1MXYA 3IJOB 4NG7A 1US4A 3CR9A 2FIXA 3OO7A 3H6UA 1JEVA 1PBPA 5BWJA 4KXPA 2HZLA 4H65A 3FGSA 1ZMGA 4YZZA 4LZ8A 4OANA 1LBYA 1LFHA 4R2FA 1B5HA 1S9TA 3A3UA 4QSEA 4HXVA 5T3JA 5HBCA 3HPIA 4YAHX 1PBQA 1NUYA 4NF5B 3PMVA 3O97A 5LDZA 2DP8A 3TQLA 3GLBA 2XWIA 2ZZXA 5L9SA 2UVGA 1KWHA 4YMAA 1FBFA 1YXIA 4G8HA 5TP9B 1B7UA 4YB7A 5CI5A 2I4CA 1ZLQA 4P8BA 4GBVA 2R71A 1GR2A 4IO4A 4ISUA 1Q1KA 1OIBA 4MAGA 1MQJA 3PPRA 4F1YA 4AB5A 2XD2A 3K00A 4MX6A 3MVYA 4N17A 3E9XA 3T9XB 4OEVA 5IM2A 2QVVA 3O6HA 4ZEKA 3V83A 2ZMBA 4KPTA 1DTZA 1A99A 3B6TA 3MP8A 1POTA 4O94A 4NHBA 2E1SA 2OWSA 2QJEA 2F6GA 1Q9DA 3W9WA 2O69A 2V25A 5TPAA 4ESWA 2PYYA 2RC8A 2O1LA 3G3KA 1KA0A 2O84X 4JWXA 4C1TA 5KDTB 3KJTA 1B0LA 3D1RA 3MP6A 3QK6A 3Q27A 3VVDA 2AL5A 2ONSA 4G68C 4XKQA 5I2NA 3MZ1A 4XEQA 3K1NA 5H8FA 3Q26A 1NI9A 3K6WA 3QAXA 4LQ5A 1EYKA 2VPNA 5EQ7A 5M2VA 3MJNA 3RTFB 4HE2A 3MUQA 4QFNA 1XHYA 4X1BA 4G4PA 2OCUA 1JW4A 4U1ZA 1OLCA 2PBWA 2CEXA 3U93A 2Y5KA 2QL3A 3FIRA 1UIUA 5DTBA 5I2KA 4GWWA 2H9BA 4DXUA 4F3GA 3OSRA 1NH8A 3CG1A 4ZZAA 3H06B 2FNCA 2M8CA 1B7HA 2XHDA 4DI4B 3OENA 3MAMA 1Y1ZA 1MG1A 4DZ1A 3DELB 4MIJA 3P7IA 4PTKA 1FTOA 2Q8JA 4WEDA 2OLBA 1MH3A 5DVIA 1ZBMA 3IOUA 2Y7IA 3SEYA 3QMFA 1D3KA 2Q74A 2XXXA 3T0JA 3ISPA 3T66A 2ANJA 4OXVA 1ATGA 3EF7A 1GGGA 1URGA 4P9KA 3BFTA 4FE8A 1US5A 3TCFA 3T22A 2V3TA 3KSXA 3N6TA 4U4XA 2B4LA 2Q2AA 3MWBA 1BK4A 2NXOA 3I3VA 4YB5A 5AA2A 3VDFA 1EZOA 4PFBA 4OQOA 4X04A 2THIA 3GYYA 3S9EA 1P99A 1LAXA 4FECA 5I57A 2YPNA 1M5FA 5H8QB 3U65A 3KG2A 1FTJA 3G3HA 2WBBA 5DVJA 1B1XA 4P11A 2Q88A 3N6UA 1FTMA 4NN3A 1B52A 2XXQA 1FJ9A 3MPKA 3PTYA 3KC0A 1TFDA 3G7WA 3U72A 4R75A 3O29A 1IXGA 4G2ZA 4DI3D 5DVFA 1QGXA 2QMWA 5AE4A 3TZAA 3B6WA 3TODA 1PDAA 4LZ7A 4LONB 4U1OA 2AL4A 2UVJA 1B5JA 4LVQA 2PT1A 2Q89A 4N8GA 3FJMA 4IB2A 4GWUA 2R8TA 4FORA 4AS5A 4ECFA 5A5XB 1H43A 2X26A 4QRZA 2QS2A 1TWYA 1Y3QA 1MDP1 2PT2A 3UA8A 4NEDA 4F19A 4OVSA 3IFCA 3FXQA 4GRKA 1IXIA 1H44A 4GFRA 1AL3A 3GBAA 2HCAA 3LUYA 1I6BA 4ESXA 4KYEA 4H1XA 3HSTA 4OYVA 3ZSFA 5H8NB 2FVZA 3TCGA 2ZXTA 4XTCQ 2BJJX 4ZZEA 4YMBA 2WX9A 4KYSA 3SESA 1NV6A 2PMSA 3E3KA 2QFLA 1LBZA 3T1BA 4FEBA 3UORA 1URSA 1HSJA 4OTEA 5I56A 5IAIA 4X8RA 4BDMA 1FBGA 4HE1A 3KOSA 1MY3A 2WEFA 4UA8A 1YCJA 2DDKA 3W9VA 1JQFA 3B6QA 1LFIA 4U21A 3QXMA 3T9HB 2FIEA 5EQAA 3PMXA 4HW8A 3ONMA 2ALUA 2ESNA 1FQBA 1LBWA 3UIFA 1P1UA 4JSOA 2F7CA 3MPLA 4IO5A 2DWAA 4IY6A 2ZNTA 4ELOA 4C0RA 5CC2A 1JW5A 4KQPA 4EXLA 1WDNA 4P1EA 5I59B 1NV0A 4OVTA 4ZEDA 1XS5A 5I2KB 4TLLB 2FA7A 4G68A 4PE3A 3TTNA 5B70A 1DBZA 5K2YA 3CFLA 2XWVA 5I84A 4NF8A 5F7VA 5B7DA 4MNCA 4MMPA 1UTBA 5L8DA 3B7DA 4OVPA 1SYHA 2H4IA 1FQCA 2YLNA 2O1MA 2V3QA 4BDQA 1P1QA 3PPQA 5H8SA 3M3FA 2I58A 4NWDA 4PGPA 2X7PA 5AA1A 5LTCA 3CG3A 1P1WA 4O3AA 3U8QA 2V4CA 1VR5A 3ILTB 1NUWA 3VXBA 4PP0A 1LCFA 4PQJA 4R9GA 4H8JA 1IXHA 3MZBA 4E0XA 3H6WA 2QS1A 1S7YA 4G68B 3OMBA 2V93A 4QFOA 1MS7A 4PAKA 3N26A 4I9DA 1NFTA 3D4CA 4U4SA 2HEUA 3UN6A 1ZKBA 1N84A 3Q25A 4IR8A 4F39A 4PFUA 1DMBA 1B3LA 4KI0E 4F1UA 3R6UA 4FEDA 4Q30B 4PETA 3PD9A 4RYAA 1MY1A 1NNPA 1FPEA 1B2HA 4KCDA 4MLVA 1SD3A 4MJOA 3H6TA 3S9NC 1FPIA 1N3XA 4QFPA 2KR0A 4H8IA 3SKPA 2XX7A 4G61A 2XX8A 3O28A 5LOMA 3H4ZA 1NNTA 4MLQA 1LLSA 1LFGA 5IZ3B 1R6ZA 1I69A 3KSJA 2HFBA 1NNFA 3BIGA 4H67A 1IMEA 4OHNA 2AIXA 2B4MA 3OEMA 2F7BA 1INPA 4OVRA 4O7IA 2AYSA 3T96B 4DXBA 1R9QA 1RYXA 3KOTA 1XVYA 5F1QA 3QSLA 5I56B 5IKBA 2WYPA 3K02A 1PEBA 4JB7A 3MVWA 2O7IA 1AH5A 4R6YA 3HV1A 1MPDA 3LBSA 1N04A 1IMBA 1QKAA 4GWOA 3PUWE 3C34A 2Y7KA 4Q0CA 1EYIA 1IXCA 2Q9TA 4IGRA 4F3SA 4XXUA 4RK9A 1FTLA 1DTGA 3KBZA 5ET8A 5BUUA 1A55A 1FBDA 2XWKA 3FVGA 1OVTA 1FPFA 3RUMA 3G3JA 1ELJA 1FPJA 2VHAA 4EQ7A 3TTRA 2F8DA 3UP9A 1FBCA 2Y84A 2I48A 4O3BA 4FJPA 4UABA 2VD2A 5H8NA 1FJ6A 3ZKLA 4FAJA 3O66A 2O7UA 4ZEBA 2XXWA 4PFTA 2O68A 3B50A 3DP6A 1NV4A 1B05A 2V84A 1B4HA 4Z7EA 4XF5A 2XA5A 2P2AA 2XXPA 1FPGA 3RLFE 1SI1A 2ONRA 1ZIUA 3RPLA 1NL5A 2Y7WA 2IEEA 4MF3A 3OO6A 4OENA 4MHFA 2Q2CA 4ELQA 4ELPA 4JWOA 4EQBA 1OVBA 1XC1A 4GLIA 2XD3A 1M5BA 3VE1B 1MQHA 2YJPA 1IIWA 4HS7A 3FXBA 3LSWA 4BLAA 4N4UA 4AS4A 3EHSA 2DXRA 1USYH 4O3CA 4OFJA 4FATA 4Q8RA 1WODA 3OELA 3IOVA 5CMCA 1TT1A 4F22A 1HSLA 1JVXA 2OJTA 3MC2A 3MYUA 4DXCA 4R2BA 3I6VA 4F29A 1Y3NA 5ET6A 4OZ9A 5I5PA 1IITA 5ET7A 4GXAA 3K0VA 4TLMB 5DW8A 3S4UA 4O7MA 3C33A 3K1PA 3EHUA 1VFDA 2P3VA 2CZLA 2X7QA 1VE4A 1MXXA 2F78A 2DE4A 2I4BA 4GWYA 2FYIA 4QFKA 3TPAA 2QMXA 3GXAA 4PAFA 1QKBA 2UVIA 1DPPA 3JZJA 5IZ3A 3A09A 1MRPA 5ELVA 1MQDA 3H03A 4DIGA 1QVSA 4RJZA 4XKNA 3C4MA 4NF4A 2HPGA 3W15C 2DQVA 1FBEA 3KN8A 4RA1A 4GIZA 2F5XA 3K2DA 5I58B 2XX9A 3SEVA 4P56A 3OOAA 2DWJA 1SW5A 1H76A 4PFIA 1SVXB 3LSXA 3D4GA 4OMBA 3QYTA 3IOWA 3KBRA 2I49A 4MEVA 1KZ8A 1P1OA 3VLVA 4IO6A 3VXCA 3IB2A 5IGAA 2WKYA 1ZU0A 5F24A 4OWDA 4R73A 3PMWA 1MM7A 3FJGA 1NV2A 1B7ZA 5A5XA 1LBBA 4KHZE 1QUKA 4U2RA 4POWA 2Y7PA 3FVKA 3QUFA 4GL0A 3IB0A 1MXUA 1B6HA 2Z8FA 2F34A 4H5FA 3KN7A 4PGNA 3CHGA 4LATA 4C1UA 2VD3A 3BFUA 2QSXA 2O51A 2PCRA 2O6AA 5I58A 2RC9A 3MQ9A 1MH4A 4F31B 3DP4A 4POXA 4OETA 2OX3A 5HPQA 4BDRA 5L9OA 5CMMA 4NMYA 3LV0A 4DCYA 3USDA 4GXSB 1DOTA 2XXRA 4YB6A 4PFWA 4I8CA 2ZZWA 4RNSA 4N15A 1Y20A 4KYDA 4X1DA 5FHMA 3IAZA 3ECRA 2A5SA 3SEWA 3IO6A 1JNFA 2V3UA 1FBHA 3VVFA 3TAJA 2VGQA 3DP8A 1A54A 4RXLA 2XXVA 1B3GA 4N6PA 3U92A 4F1VA 3LUZA 5H8FB 2I3WA 3VFJA 1FTAA 3CFXA 3N5LA 5JEIA 2NOOA 3FJ7A 4LP2B 2NVUB 4KD5A 3IB1A 1RDXA 1Y1MA 2HQ0A 1RKMA 3N94A 2KLFA 2OK2A 5AA2D 3JYRA 4JVIA 2ZYOA 3IK6B 4O8MA 2XXIA 2E0SA 1IQ7A 3IOTA 4MFIA 4I1DA 2QS3A 4RPNA 5EQ9A 4XFEA 4H0WA 4YICA 3EQ1A 3B8BA 3PUVE 2D5WA 3BKIB 4RY1A 2HZKA 4P3LA 1RDZA 3GBBA 4EQ9A 1SBPA 2REJA 2PVUA 2GQ1A 5FTIA 4PCDA 2VP1A 4OVJA 3EPEA 3KN3A 1EZ9A 1Z7ME 2CZHA 1YYZA 4R72A 4QXDA 5KCJA 2W7YA 1FSAA 3HHGA 1PB9A 4XKRA 4I62A 3OEKA 1POY1 3UGWA 4GX4A 4GWXA 3ZS6A 4GVOA 4G77A 4OA4A 2F6PA 2Z23A 1QJMA 1R9LA 4YKPA 1EZPA 1GVCA 1PB8A 2ZYMA 4N91A 1J1NA 1SW2A 1PC3A 1F9BA 3A29A 4EXKA 2FBPA 5ITPA 1B40A 5EHSA 3FBPA 1N76A 3V5AA 4PF6A 4PE5B 2R6GE 3LSFB 1JVYA 5FBPA 4RK2A 4ZDMA 4TQUQ 3C32A 2P1SA 5EYHA 1FW0A 3E13X 4OFLA 1Q35A 2DXYA 4TOZA 1D9YA 5HM4B 1MDQA 3IFAA 4GWZA 1MPCA 2ZYKA 3RT8A 1DPEA 3SEUA 3FV1A 4N81A 4X9TA 1MPBA 4PC9A 1IMFA 2G29A 3R7XA 1IZ1A 1LAFE 1B5IA 3ROJA 1EYJA 2I3VA 1MY2A 1A7LA 1A40A 1SDXA 3K6UA 4HE0A 3H7MA 4GF8A 3LC8A 1UTBB 4YKJA 3KEIA 3KJ7A 2PFYA 1JP4A 1FRPA 2VT5A 4MH5A 5EYFA 4ZEIA 4PBQA 3MW0A 1FQFA 4PBHA 1BIYA 2OWZA 2B65A 4N6DA 1XOCA 1QUJA 1YTVA 4R6HA 1N3WA 2Q8MA 3JV9A 4MCOA 4GX3A 1NUXA 3T9UA 4JVCA 4NTLA 2NUVA 4E0WA 3TELA 4OVQA 1LSTA 3SETA 3CSGA 2QS4A 3V8XB 5A5LA 4N6KA 5CRYA 5KZTA 4IO7A 4ELRA 2NWJA 3VLUA 2D3IA 1IMCA 5I59A 2H98A 1ZJLA 1BTJA 3CSBA 3E79A 4MNIA 2F35A 1OLAA 3QIMA 1M5DA 1BP5A 4QBAA 4ZECA 4R9FA 2GFEA 1NMUA 1N0TA 3FASA 3RY3A 5JTYB 3Q29A 1VFEA 3Q28A 3C31A 2F97A 4MNPA 1H3DA 2DVCA 1B32A 1D4NA 2JJKA 2Z8DA 1JEUA 5TP9A 2CEYA 4PDHA 3SERA 3FV2A 3SEXA 4IY5A 4GQOA 4G8MA 1ZTYA 1LGBC 2RC7A 3CRBA 1NNKA 3M3LA 3SDFA 1EU8A 3EN3A 3PGFA 3FVOA 4JDFA 3ZKKA 2A5TB 2ONKE 2CZIA 4PFYA 1FPBA 2HHMA 5KCJB 4JVDA 1O63A 2HXRA 1XVXA 2HXWA 1G0HA 2Z8EA 1LAHE 1SPIA 4NF4B 4QHQA 1JETA 1MM6A 2PX1A 3DM0A 5CMKA 4H6DA 1NUZA 1A8EA 5EYGA 4XKPA 3IX1A 1FTKA 4KR5A 1MXVA 3K4UA 4R6KA 3FATA 5AA3A 4NF6B 1JW1A 2P3NA 1NV3A 2ABHA 3TTMA 3PUXE 1B3FA 1ANFA 2XWOA 2RCBA 4N8YA 1USYE 4GOTA 1WVJA 4OESA 1M5CA 5K2XA 3G3IA 2WYKA 3FVNA 3TYHA 1T0KA 5J16A 3FUZA 3HHFA 4R74A 5JTYA 2DS9A 2B3FA 3H6VA 2I0BA 3T9VA 1S50A 4PDDA 3HFUA 4XIGQ 1B1HA 1N7WA 3C36A 4RPOA 3PUYE 1TXFA 3K6VA 4F2QA 3SZPA 3RQTA 2L5VA 3FXUA 5EHMA 1B3HA 1UTHB 5KDTA 1D9QA 4P0IA 3S9LC 1BLFA 3TKDA 5AA4A 1MXZA 1QUIA 1QULA 3PD8A 2DSFA 1MQGA 4BDOA 4PAIA 1O64A 4P47A 2GRVA 1GV8A 2REGA 3THIA 1FPLA 4EF2A 3G3GA 4BDLA 5FHOA 1EH3A 3GZGA 4YKIA 3AXFA 5FTHA 3PPNA 3F11A 2ZYNA 1UIVA 4Z0IA 3PPOA 2UVHA 5ET5A 5IZ1A 3A3CA 3PUZE 2ZNSA 1LCTA 1A8FA 1AMFA 1K9YA 5IZZA 2P0SA 4ZE8A 4NGUA 4DDDA 4GBWA 1Y4CA 3OXNA 3MZ9A 1LBVA 3U1OA 1XI6A 3FZVA 4G8NA 3RT6B 4H46A 1IUDA 2QPQA 2PFZA 1RYOA 1MXWA 1CB6A 3IR1A 3VLWA 3CI8A 1II5A 4IO3A 5AA4B 3K01A 3L6HA 3BIHA 1XT8A 4QSCA 3CIJA 2DVZA 1OQHA 3M8UA 3MVXA 5EQ8A 3O6IA 3HO7A 3WAEA 1LB8A 2QRYA 4NF8B 2DE2A 2DOJA 2XXUA 5CMBA 2D21A 2MKZA 4FIMA 1M5EA 2UYEA 1NV5A 3TMGA 1BKAA 4L17A 4P0GA 4OFOA 4PF8A 4THIA 2B3BA 2RINA 1FBPA 4WKMA 4P1LA 3NOHA 4OERA 1NV1A 2UXAA 3E4RA 4JSDA 2DWHA 2R9JA 3PV0E 4LA9A 3K6XA 5ICQA 3TEPA 5L9MA 1DSNA 3TUSA 3C9HA 1R1NA 3HCQA 1N7XA 5DT6A 2HAVA 5ITOA
chains in the Genus database with same CATH topology
1Y9UA 4GVOA 3RTFB 3MUQA 4G77A 3T96B 4DCXA 4DXBA 4QFNA 1R9QA 1RYXA 1XHYA 3KOTA 4X1BA 2F6PA 1XVYA 2Z23A 4G4PA 5F1QA 1QJMA 1R9LA 3QSLA 3U94A 1B58A 2OCUA 4YKPA 1GVCA 1EZPA 1PB8A 5I56B 5IKBA 2ZYMA 1JW4A 3K02A 1PEBA 4U1ZA 4ONYA 4JB7A 1J1NA 1OLCA 2HAUA 2PBWA 3IJXB 3MVWA 1SW2A 3U93A 4F3BA 2O7IA 1PC3A 1F9BA 2QL3A 4EXKA 1AH5A 3FIRA 1UIUA 1VSOA 5DTBA 5I2KA 2H9BA 5I2NB 5ITPA 1B40A 4R6YA 5EHSA 1N76A 3HV1A 1MPDA 2VOZA 3LBSA 4DXUA 3QUJA 4F3GA 1N04A 3V5AA 4PE5B 2R6GE 1AOVA 3LSFB 1JVYA 1NH8A 1QKAA 3OSRA 4X48A 4RK2A 3IO4A 1Y3PA 4ZDMA 3CG1A 3C32A 4GWOA 4TQUQ 4XIGQ 2P1SA 2FNCA 3H06B 3C34A 3PUWE 4ZS9A 4ZZAA 2Y7KA 2M8CA 2RCAA 1B7HA 4Q0CA 2Q9TA 1IXCA 3BBRA 1FW0A 3ILUB 3E13X 3K1MA 4IGRA 4XXUA 4F3SA 4RK9A 2XHDA 4OFLA 1Q35A 3OENA 3MAMA 1FTLA 1DTGA 3MP1A 4QSDA 5ICTA 4F3PA 5BUUA 4LZ5A 1B4ZA 2DXYA 1Y1ZA 1A55A 1MG1A 4TOZA 4WXJA 3ODBA 1D9YA 3DELB 3FVGA 1MDQA 1OVTA 5FHNA 4DZ1A 5HM4B 1MPCA 2ZYKA 3P7IA 3RT8A 2IA4A 1DPEA 3RUMA 1FTOA 3G3JA 2Q8JA 3IL1B 4WEDA 2LAOA 1ELJA 4NE4A 3SEUA 5J1DA 3FV1A 1B9JA 2OLBA 1MH3A 2DYXA 2VHAA 4X9TA 5DVIA 3TTRA 1ZBMA 3IOUA 2F8DA 4M1VA 3TDJA 3TCHA 1SI0A 3UP9A 1MPBA 2Y7IA 2Y84A 3SEYA 4DE8A 2I48A 1D3KA 1URDA 4O3BA 4U23A 3TTLA 2G29A 2XXXA 4FJPA 3R7XA 2VD2A 5H8NA 3ZKLA 3T66A 4FAJA 2ANJA 4OXVA 1IZ1A 4JWYA 1ATGA 2O7UA 3EF7A 1GGGA 1LAFE 1B5IA 1OQGA 1URGA 2I3VA 1MY2A 1A7LA 3C35A 4ZEBA 1YAEA 2XXWA 3BFTA 4PFTA 3MBPA 1US5A 4FE8A 3TCFA 1A40A 3T22A 1SDXA 3K6UA 2O68A 3H7MA 4GF8A 2V3TA 3LC8A 3DP6A 4GL8A 1UTBB 1B0HA 5I57B 4YKJA 3KEIA 4KCCA 1B05A 2V84A 1B4HA 3KJ7A 2XXHA 3KSXA 3N6TA 4U22A 4U4XA 4Z7EA 2Q2AA 3MWBA 3I5OA 2P2AA 2XXPA 3RLFE 1SI1A 2NXOA 3I3VA 4YB5A 2ONRA 5AA2A 1ZIUA 4AB6A 3RN8A 4BDNA 1NL5A 2Y7WA 4MH5A 5EYFA 3VDFA 3O6GA 2IEEA 2CMOA 5H8HB 4MF3A 1EZOA 4OQOA 4ZEIA 3OO6A 1FCKA 2THIA 3MVZA 4OENA 3MW0A 1FQFA 2Q2CA 3EHTA 1P99A 4ELQA 3S9EA 1BIYA 4ELPA 4JWOA 1LAXA 1Y4TA 3RGYA 1MY0A 3G3FA 4WEPA 4Q5TA 3RTWB 4LQ2A 4FECA 5I57A 1B3EA 4EQBA 1OVBA 1XC1A 2B65A 1M5FA 2XD3A 2YPNA 1I6QA 4GLIA 4N07A 5H8QB 1XOCA 3H3GA 1B46A 1QUJA 1YTVA 4F2OA 4R6HA 1N3WA 1M5BA 3JV9A 3KG2A 1FTJA 3VE1B 1MQHA 3G3HA 5DVJA 2YJPA 1B1XA 4P11A 4AQ4A 3T9UA 2UYFA 1IIWA 2Q88A 3N6UA 4NTLA 2NUVA 4HS7A 1FTMA 3LSWA 4BLAA 4E0WA 3OSQA 1P1NA 3TELA 5JK4A 1H45A 1LSTA 3EHSA 1MQIA 3SETA 2DXRA 1USYH 1B52A 3CSGA 1LAGE 2QS4A 2XXQA 3IORA 4K3FA 4O3CA 4OFJA 5CRYA 3MPKA 3V8XB 5KZTA 4FATA 1TFDA 4IO7A 3G7WA 3OO8A 4ELRA 4Q8RA 3U72A 2NWJA 2F36A 3KGCA 3O29A 4R75A 3VLUA 2XXTA 1SYIA 2D3IA 1IXGA 2G93A 1QW0A 1WODA 2H98A 2I0CA 4G2ZA 5I59A 1ZJLA 5DVFA 2ZNUA 1BTJA 2QMWA 4ZE9A 5AE4A 3CSBA 3OELA 3TZAA 3IOVA 3B6WA 3LR1A 5CMCA 3TODA 1PDAA 1TT1A 2F35A 4LZ7A 4LONB 4U1OA 1FQDA 4EQ7A 4F22A 1OLAA 2A5TA 4M4GA 3QIMA 2AL4A 1HSLA 1JVXA 2OJTA 2UVJA 1B5JA 4LVQA 2PT1A 1SW1A 1M5DA 1BP5A 2Q89A 3MC2A 5H8QA 4ZECA 1UQWA 3FJMA 1YPNA 4IB2A 4LUBA 4DXCA 4R9FA 4R2BA 2GFEA 1NMUA 3I6VA 1N0TA 4FORA 3FASA 3WAEA 3RY3A 1UTHA 4ECFA 1PB7A 2OBGA 5JTYB 1SQYA 1O7TA 3O66A 3Q29A 1H43A 4QF9A 5H8HA 4F29A 5A5XB 1Y3NA 2X26A 1VFEA 3Q28A 2QS2A 2GHBA 4OZ9A 1IITA 3C31A 1TWYA 1Y3QA 2F97A 1MDP1 3PPPA 3KZGA 1H3DA 2DVCA 2PT2A 5DEXA 1B32A 3S2VA 1D4NA 3UA8A 4GXAA 1GTKA 2Z8DA 1JEUA 3K0VA 4TLMB 5TP9A 5ISUA 4NEDA 4JXIA 3SERA 3S4UA 4F19A 3C33A 1NKXA 3FV2A 3K1PA 4IY5A 3SEXA 3EHUA 1VFDA 4GQOA 4UACA 3VV5A 4F18A 3FXQA 4HCWA 3LSLA 4G8MA 1ZTYA 1LGBC 1IXIA 1TFAA 1H44A 2RC7A 1AL3A 4GFRA 2CZLA 4GRKA 2RF1A 4HCYA 3CRBA 1NNKA 3M3LA 2X7QA 1VE4A 1MXXA 2HCAA 3GBAA 1EU8A 3SDFA 3EN3A 2F78A 3PGFA 1I6AA 3FVOA 3LUYA 1I6BA 3R26A 2DE4A 1LBCA 4JDFA 4DLDA 4ESXA 3ZKKA 4KYEA 2I4BA 2A5TB 4ND9A 4F1YA 2ONKE 4IGTA 2FYIA 4H1XA 4QFKA 3TPAA 2OZZA 3V89B 2QMXA 3GXAA 3HSTA 1NH7A 1QKBA 4EDPA 4PFYA 2UVIA 4OYVA 3TQWA 2F7AA 3ZSFA 2XXYA 1DPPA 3PU5A 1L5TA 3JZJA 5CBSA 5H8NB 3A09A 5KCJB 3TFLA 3TCGA 2DE3A 2ZXTA 4XTCQ 1O63A 1MRPA 3TTKA 1XVXA 2HXWA 3DLNA 1MQDA 2BJJX 5ELVA 4ZZEA 3H03A 4YMBA 2Z8EA 4DIGA 1LAHE 3L6GA 1QVSA 4KYSA 4RJZA 4XKNA 3C4MA 4NF4A 4NF4B 3SESA 2Y7RA 3W15C 2PMSA 1JETA 4QHQA 5CM6A 3E3KA 1MM6A 2DQVA 2PX1A 5DYHA 3KN8A 3DM0A 3O2AA 4RA1A 5CMKA 4H5GA 4GIZA 2OWTA 4H6DA 2F5XA 3K2DA 4YKKA 1A8EA 4XKPA 4FEBA 3UORA 1URSA 1HSJA 5M2VA 4OTEA 3IX1A 1FTKA 4KR5A 5I58B 2Z22A 1MXVA 3K4UA 4R6KA 3FATA 2XX9A 4NWCA 5I56A 4ZEFA 3SEVA 5AA3A 5IAIA 3OOAA 4IO2A 4QRZA 4BDMA 2DWJA 4NF6B 4YU0A 5TU0A 1SW5A 1JW1A 1H76A 5DEXB 1SVXB 3LSXA 2I6EA 2ABHA 3D4GA 3TTMA 4OMBA 3PUXE 3RNNA 1B3FA 4JBZA 3QYTA 5AA2B 1ANFA 3IOWA 3KBRA 2RCBA 1D9VA 1SW4A 3KOSA 2I49A 3VVEA 1FQAA 3OO9A 1MY3A 1LB9A 1P1OA 1USYE 4GOTA 2H5YA 1WVJA 3VLVA 4IO6A 4QFLA 4UA8A 4OESA 1YCJA 1AIVA 3KFMA 3OD7A 1M5CA 3FD3A 5K2XA 3T93B 3W9VA 3G3IA 1JQFA 3B6QA 4NF6A 1LFIA 3VXCA 3IB2A 5CBRA 2GH9A 2WKYA 1CE2A 3QXMA 4U21A 1ZU0A 3FVNA 4OWDA 4R73A 3TYHA 1Z7NE 3PMWA 4NF5A 3T9HB 1T0KA 1MM7A 4HW8A 3PMXA 3S9MC 3FJGA 1HSEA 1B7ZA 3FUZA 3ONMA 4N13A 2ALUA 2ESNA 2GHAA 1FQBA 3HHFA 3UIFA 3FXRA 4EF1A 2H99A 4GD5A 5A5XA 1IEJA 1P1UA 4R74A 3RPWA 5JTYA 2DS9A 2B3FA 3H6VA 3O9PA 3HN0A 1LBBA 4KHZE 4OEUA 2I0BA 1QUKA 4JSOA 4U2RA 3T9VA 4POWA 2F7CA 2Y7PA 3FVKA 3MPLA 3QUFA 1S50A 2DWIA 4GL0A 3IB0A 1MY4A 4KFQA 4MBPA 1MXUA 5TPAB 4IO5A 2DWAA 1B6HA 2Z8FA 2F34A 3CVGA 4H5FA 1B1HA 2H25A 1B51A 3KN7A 4IY6A 2ZNTA 1N7WA 4ELOA 4C0RA 3C36A 4LATA 4C1UA 5CC2A 4RPOA 1OMPA 3CFZA 1TXFA 2VD3A 3PUYE 1JW5A 3K6VA 4EUOA 4HTGA 4KQPA 3RQTA 4EXLA 3BFUA 4F2QA 2QSXA 1WDNA 2O51A 3FXUA 5EHMA 3M3KA 1FQEA 3WAFA 5I59B 2O6AA 5I58A 2RC9A 3MQ9A 1B3HA 1UTHB 2RKMA 4ZEDA 1MXYA 5KDTA 3IJOB 1MH4A 1XS5A 4P0IA 1US4A 3CR9A 3S9LC 4F31B 1BLFA 3TKDA 3OO7A 3H6UA 1JEVA 5AA4A 5I2KB 1MXZA 1QUIA 3DP4A 1QULA 2FA7A 4G68A 4TLLB 4POXA 3PD8A 2DSFA 4OETA 1PBPA 1MQGA 3TTNA 5B70A 5BWJA 5HPQA 5K2YA 4BDOA 2HZLA 4BDRA 1O64A 5L9OA 2GRVA 3CFLA 3FGSA 1ZMGA 4H65A 2REGA 4LZ8A 4NMYA 5CMMA 4YZZA 1GV8A 3THIA 4DCYA 4NF8A 5F7VA 4EF2A 5I84A 3USDA 3G3GA 4BDLA 4GXSB 5B7DA 5FHOA 1EH3A 3GZGA 1DOTA 4YKIA 2XXRA 3AXFA 4YB6A 4PFWA 4I8CA 3PPNA 5FTHA 1UTBA 4RNSA 1LFHA 3F11A 4R2FA 5L8DA 1B5HA 1S9TA 1Y20A 2ZYNA 3A3UA 3B7DA 4QSEA 1UIVA 4Z0IA 4KYDA 5HBCA 1SYHA 3HPIA 3PPOA 4X1DA 3IAZA 2UVHA 4YAHX 3ECRA 5FHMA 1PBQA 2H4IA 4NF5B 1FQCA 2A5SA 3PMVA 3SEWA 2YLNA 2O1MA 2V3QA 3A3CA 3IO6A 3O97A 1JNFA 2V3UA 3PUZE 4BDQA 1P1QA 2ZNSA 1LCTA 1A8FA 1AMFA 3PPQA 5H8SA 3M3FA 2DP8A 3TQLA 3VVFA 3GLBA 3TAJA 2VGQA 2P0SA 4ZE8A 5L9SA 2I58A 2UVGA 4NWDA 4DDDA 3DP8A 1KWHA 4YMAA 1A54A 2X7PA 4G8HA 5AA1A 4RXLA 2XXVA 1B3GA 5TP9B 4N6PA 3U92A 3CG3A 1B7UA 1P1WA 4O3AA 4F1VA 1Y4CA 3U8QA 3OXNA 5H8FB 4YB7A 1VR5A 3ILTB 2I3WA 3MZ9A 2I4CA 5CI5A 4PP0A 3VFJA 1ZLQA 3VXBA 3CFXA 3N5LA 2R71A 2NOOA 5JEIA 1LCFA 3U1OA 1GR2A 4PQJA 3FJ7A 4R9GA 3FZVA 4IO4A 4G8NA 4ISUA 1Q1KA 4H8JA 1OIBA 3RT6B 4LP2B 2NVUB 4KD5A 1IUDA 3IB1A 2QPQA 1Y1MA 1MQJA 1IXHA 3MZBA 3PPRA 2HQ0A 1RKMA 1RYOA 4AB5A 1MXWA 3N94A 1CB6A 2XD2A 4E0XA 3IR1A 3VLWA 3K00A 3CI8A 2KLFA 1II5A 2OK2A 4IO3A 5AA4B 3H6WA 5AA2D 3JYRA 3MVYA 2QS1A 3E9XA 1S7YA 4G68B 3OMBA 4OEVA 3T9XB 3K01A 3L6HA 2V93A 2ZYOA 3O6HA 4ZEKA 4QFOA 3V83A 1MS7A 2ZMBA 3IK6B 1DTZA 1XT8A 4KPTA 4QSCA 3N26A 3CIJA 4I9DA 2DVZA 1NFTA 1OQHA 3D4CA 1A99A 3B6TA 3M8UA 2XXIA 3MVXA 3O6IA 2HEUA 2E0SA 3HO7A 3MP8A 1IQ7A 1LB8A 4U4SA 1ZKBA 1POTA 2QRYA 2DE2A 4NF8B 3IOTA 1N84A 4MFIA 2DOJA 3Q25A 4F39A 2E1SA 2OWSA 2QJEA 2F6GA 2QS3A 2XXUA 4I1DA 4RPNA 3W9WA 5CMBA 2O69A 4H0WA 2V25A 2D21A 4PFUA 3EQ1A 4YICA 4FIMA 5TPAA 1DMBA 1M5EA 1B3LA 2UYEA 3PUVE 4KI0E 2D5WA 4ESWA 3BKIB 4RY1A 2HZKA 3TMGA 3UK4A 2PYYA 4F1UA 3R6UA 4FEDA 2RC8A 4Q30B 2O1LA 3G3KA 1BKAA 4L17A 3GBBA 4PETA 3PD9A 4RYAA 1MY1A 4P0GA 2O84X 4OFOA 1SBPA 4JWXA 3UN6A 4EQ9A 4C1TA 1NNPA 2REJA 2PVUA 4THIA 5FTIA 5KDTB 1B2HA 3KJTA 1B0LA 4KCDA 2B3BA 4MLVA 1SD3A 2RINA 3MP6A 3QK6A 3H6TA 4WKMA 3S9NC 2VP1A 3Q27A 3VVDA 4OVJA 1N3XA 4QFPA 2AL5A 3EPEA 4H8IA 2ONSA 3KN3A 4G68C 4XKQA 4OERA 3SKPA 2XX7A 2UXAA 5I2NA 3E4RA 4JSDA 2DWHA 2R9JA 3MZ1A 1EZ9A 2XX8A 3PV0E 3O28A 4LA9A 1Z7ME 3H4ZA 5LOMA 3K6XA 5ICQA 1NNTA 3TEPA 3K1NA 5H8FA 4MLQA 5L9MA 4R72A 3Q26A 1LLSA 1LFGA 2W7YA 5KCJA 1DSNA 3HHGA 1PB9A 1R6ZA 4XKRA 1I69A 3OEKA 4I62A 3TUSA 3K6WA 3KSJA 3QAXA 1POY1 3C9HA 2HFBA 1R1NA 3UGWA 1NNFA 2HAVA 3HCQA 4H67A 4LQ5A 4OHNA 2AIXA 3OEMA 2F7BA 1N7XA 5DT6A 2AYSA 5ITOA 3MJNA 3ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9U A;  4GVO A;  3RTF B;  3MUQ A;  4G77 A;  3T96 B;  4DCX A;  4DXB A;  4QFN A;  1R9Q A;  1RYX A;  1XHY A;  3KOT A;  4X1B A;  2F6P A;  1XVY A;  2Z23 A;  4G4P A;  5F1Q A;  1QJM A;  1R9L A;  3QSL A;  3U94 A;  1B58 A;  2OCU A;  4YKP A;  1GVC A;  1EZP A;  1PB8 A;  5I56 B;  5IKB A;  2ZYM A;  1JW4 A;  3K02 A;  1PEB A;  4U1Z A;  4ONY A;  4JB7 A;  1J1N A;  1OLC A;  2HAU A;  2PBW A;  3IJX B;  3MVW A;  1SW2 A;  3U93 A;  4F3B A;  2O7I A;  1PC3 A;  1F9B A;  2QL3 A;  4EXK A;  1AH5 A;  3FIR A;  1UIU A;  1VSO A;  5DTB A;  5I2K A;  2H9B A;  5I2N B;  5ITP A;  1B40 A;  4R6Y A;  5EHS A;  1N76 A;  3HV1 A;  1MPD A;  2VOZ A;  3LBS A;  4DXU A;  3QUJ A;  4F3G A;  1N04 A;  3V5A A;  4PE5 B;  2R6G E;  1AOV A;  3LSF B;  1JVY A;  1NH8 A;  1QKA A;  3OSR A;  4X48 A;  4RK2 A;  3IO4 A;  1Y3P A;  4ZDM A;  3CG1 A;  3C32 A;  4GWO A;  4TQU Q;  4XIG Q;  2P1S A;  2FNC A;  3H06 B;  3C34 A;  3PUW E;  4ZS9 A;  4ZZA A;  2Y7K A;  2M8C A;  2RCA A;  1B7H A;  4Q0C A;  2Q9T A;  1IXC A;  3BBR A;  1FW0 A;  3ILU B;  3E13 X;  3K1M A;  4IGR A;  4XXU A;  4F3S A;  4RK9 A;  2XHD A;  4OFL A;  1Q35 A;  3OEN A;  3MAM A;  1FTL A;  1DTG A;  3MP1 A;  4QSD A;  5ICT A;  4F3P A;  5BUU A;  4LZ5 A;  1B4Z A;  2DXY A;  1Y1Z A;  1A55 A;  1MG1 A;  4TOZ A;  4WXJ A;  3ODB A;  1D9Y A;  3DEL B;  3FVG A;  1MDQ A;  1OVT A;  5FHN A;  4DZ1 A;  5HM4 B;  1MPC A;  2ZYK A;  3P7I A;  3RT8 A;  2IA4 A;  1DPE A;  3RUM A;  1FTO A;  3G3J A;  2Q8J A;  3IL1 B;  4WED A;  2LAO A;  1ELJ A;  4NE4 A;  3SEU A;  5J1D A;  3FV1 A;  1B9J A;  2OLB A;  1MH3 A;  2DYX A;  2VHA A;  4X9T A;  5DVI A;  3TTR A;  1ZBM A;  3IOU A;  2F8D A;  4M1V A;  3TDJ A;  3TCH A;  1SI0 A;  3UP9 A;  1MPB A;  2Y7I A;  2Y84 A;  3SEY A;  4DE8 A;  2I48 A;  1D3K A;  1URD A;  4O3B A;  4U23 A;  3TTL A;  2G29 A;  2XXX A;  4FJP A;  3R7X A;  2VD2 A;  5H8N A;  3ZKL A;  3T66 A;  4FAJ A;  2ANJ A;  4OXV A;  1IZ1 A;  4JWY A;  1ATG A;  2O7U A;  3EF7 A;  1GGG A;  1LAF E;  1B5I A;  1OQG A;  1URG A;  2I3V A;  1MY2 A;  1A7L A;  3C35 A;  4ZEB A;  1YAE A;  2XXW A;  3BFT A;  4PFT A;  3MBP A;  1US5 A;  4FE8 A;  3TCF A;  1A40 A;  3T22 A;  1SDX A;  3K6U A;  2O68 A;  3H7M A;  4GF8 A;  2V3T A;  3LC8 A;  3DP6 A;  4GL8 A;  1UTB B;  1B0H A;  5I57 B;  4YKJ A;  3KEI A;  4KCC A;  1B05 A;  2V84 A;  1B4H A;  3KJ7 A;  2XXH A;  3KSX A;  3N6T A;  4U22 A;  4U4X A;  4Z7E A;  2Q2A A;  3MWB A;  3I5O A;  2P2A A;  2XXP A;  3RLF E;  1SI1 A;  2NXO A;  3I3V A;  4YB5 A;  2ONR A;  5AA2 A;  1ZIU A;  4AB6 A;  3RN8 A;  4BDN A;  1NL5 A;  2Y7W A;  4MH5 A;  5EYF A;  3VDF A;  3O6G A;  2IEE A;  2CMO A;  5H8H B;  4MF3 A;  1EZO A;  4OQO A;  4ZEI A;  3OO6 A;  1FCK A;  2THI A;  3MVZ A;  4OEN A;  3MW0 A;  1FQF A;  2Q2C A;  3EHT A;  1P99 A;  4ELQ A;  3S9E A;  1BIY A;  4ELP A;  4JWO A;  1LAX A;  1Y4T A;  3RGY A;  1MY0 A;  3G3F A;  4WEP A;  4Q5T A;  3RTW B;  4LQ2 A;  4FEC A;  5I57 A;  1B3E A;  4EQB A;  1OVB A;  1XC1 A;  2B65 A;  1M5F A;  2XD3 A;  2YPN A;  1I6Q A;  4GLI A;  4N07 A;  5H8Q B;  1XOC A;  3H3G A;  1B46 A;  1QUJ A;  1YTV A;  4F2O A;  4R6H A;  1N3W A;  1M5B A;  3JV9 A;  3KG2 A;  1FTJ A;  3VE1 B;  1MQH A;  3G3H A;  5DVJ A;  2YJP A;  1B1X A;  4P11 A;  4AQ4 A;  3T9U A;  2UYF A;  1IIW A;  2Q88 A;  3N6U A;  4NTL A;  2NUV A;  4HS7 A;  1FTM A;  3LSW A;  4BLA A;  4E0W A;  3OSQ A;  1P1N A;  3TEL A;  5JK4 A;  1H45 A;  1LST A;  3EHS A;  1MQI A;  3SET A;  2DXR A;  1USY H;  1B52 A;  3CSG A;  1LAG E;  2QS4 A;  2XXQ A;  3IOR A;  4K3F A;  4O3C A;  4OFJ A;  5CRY A;  3MPK A;  3V8X B;  5KZT A;  4FAT A;  1TFD A;  4IO7 A;  3G7W A;  3OO8 A;  4ELR A;  4Q8R A;  3U72 A;  2NWJ A;  2F36 A;  3KGC A;  3O29 A;  4R75 A;  3VLU A;  2XXT A;  1SYI A;  2D3I A;  1IXG A;  2G93 A;  1QW0 A;  1WOD A;  2H98 A;  2I0C A;  4G2Z A;  5I59 A;  1ZJL A;  5DVF A;  2ZNU A;  1BTJ A;  2QMW A;  4ZE9 A;  5AE4 A;  3CSB A;  3OEL A;  3TZA A;  3IOV A;  3B6W A;  3LR1 A;  5CMC A;  3TOD A;  1PDA A;  1TT1 A;  2F35 A;  4LZ7 A;  4LON B;  4U1O A;  1FQD A;  4EQ7 A;  4F22 A;  1OLA A;  2A5T A;  4M4G A;  3QIM A;  2AL4 A;  1HSL A;  1JVX A;  2OJT A;  2UVJ A;  1B5J A;  4LVQ A;  2PT1 A;  1SW1 A;  1M5D A;  1BP5 A;  2Q89 A;  3MC2 A;  5H8Q A;  4ZEC A;  1UQW A;  3FJM A;  1YPN A;  4IB2 A;  4LUB A;  4DXC A;  4R9F A;  4R2B A;  2GFE A;  1NMU A;  3I6V A;  1N0T A;  4FOR A;  3FAS A;  3WAE A;  3RY3 A;  1UTH A;  4ECF A;  1PB7 A;  2OBG A;  5JTY B;  1SQY A;  1O7T A;  3O66 A;  3Q29 A;  1H43 A;  4QF9 A;  5H8H A;  4F29 A;  5A5X B;  1Y3N A;  2X26 A;  1VFE A;  3Q28 A;  2QS2 A;  2GHB A;  4OZ9 A;  1IIT A;  3C31 A;  1TWY A;  1Y3Q A;  2F97 A;  1MDP 1;  3PPP A;  3KZG A;  1H3D A;  2DVC A;  2PT2 A;  5DEX A;  1B32 A;  3S2V A;  1D4N A;  3UA8 A;  4GXA A;  1GTK A;  2Z8D A;  1JEU A;  3K0V A;  4TLM B;  5TP9 A;  5ISU A;  4NED A;  4JXI A;  3SER A;  3S4U A;  4F19 A;  3C33 A;  1NKX A;  3FV2 A;  3K1P A;  4IY5 A;  3SEX A;  3EHU A;  1VFD A;  4GQO A;  4UAC A;  3VV5 A;  4F18 A;  3FXQ A;  4HCW A;  3LSL A;  4G8M A;  1ZTY A;  1LGB C;  1IXI A;  1TFA A;  1H44 A;  2RC7 A;  1AL3 A;  4GFR A;  2CZL A;  4GRK A;  2RF1 A;  4HCY A;  3CRB A;  1NNK A;  3M3L A;  2X7Q A;  1VE4 A;  1MXX A;  2HCA A;  3GBA A;  1EU8 A;  3SDF A;  3EN3 A;  2F78 A;  3PGF A;  1I6A A;  3FVO A;  3LUY A;  1I6B A;  3R26 A;  2DE4 A;  1LBC A;  4JDF A;  4DLD A;  4ESX A;  3ZKK A;  4KYE A;  2I4B A;  2A5T B;  4ND9 A;  4F1Y A;  2ONK E;  4IGT A;  2FYI A;  4H1X A;  4QFK A;  3TPA A;  2OZZ A;  3V89 B;  2QMX A;  3GXA A;  3HST A;  1NH7 A;  1QKB A;  4EDP A;  4PFY A;  2UVI A;  4OYV A;  3TQW A;  2F7A A;  3ZSF A;  2XXY A;  1DPP A;  3PU5 A;  1L5T A;  3JZJ A;  5CBS A;  5H8N B;  3A09 A;  5KCJ B;  3TFL A;  3TCG A;  2DE3 A;  2ZXT A;  4XTC Q;  1O63 A;  1MRP A;  3TTK A;  1XVX A;  2HXW A;  3DLN A;  1MQD A;  2BJJ X;  5ELV A;  4ZZE A;  3H03 A;  4YMB A;  2Z8E A;  4DIG A;  1LAH E;  3L6G A;  1QVS A;  4KYS A;  4RJZ A;  4XKN A;  3C4M A;  4NF4 A;  4NF4 B;  3SES A;  2Y7R A;  3W15 C;  2PMS A;  1JET A;  4QHQ A;  5CM6 A;  3E3K A;  1MM6 A;  2DQV A;  2PX1 A;  5DYH A;  3KN8 A;  3DM0 A;  3O2A A;  4RA1 A;  5CMK A;  4H5G A;  4GIZ A;  2OWT A;  4H6D A;  2F5X A;  3K2D A;  4YKK A;  1A8E A;  4XKP A;  4FEB A;  3UOR A;  1URS A;  1HSJ A;  5M2V A;  4OTE A;  3IX1 A;  1FTK A;  4KR5 A;  5I58 B;  2Z22 A;  1MXV A;  3K4U A;  4R6K A;  3FAT A;  2XX9 A;  4NWC A;  5I56 A;  4ZEF A;  3SEV A;  5AA3 A;  5IAI A;  3OOA A;  4IO2 A;  4QRZ A;  4BDM A;  2DWJ A;  4NF6 B;  4YU0 A;  5TU0 A;  1SW5 A;  1JW1 A;  1H76 A;  5DEX B;  1SVX B;  3LSX A;  2I6E A;  2ABH A;  3D4G A;  3TTM A;  4OMB A;  3PUX E;  3RNN A;  1B3F A;  4JBZ A;  3QYT A;  5AA2 B;  1ANF A;  3IOW A;  3KBR A;  2RCB A;  1D9V A;  1SW4 A;  3KOS A;  2I49 A;  3VVE A;  1FQA A;  3OO9 A;  1MY3 A;  1LB9 A;  1P1O A;  1USY E;  4GOT A;  2H5Y A;  1WVJ A;  3VLV A;  4IO6 A;  4QFL A;  4UA8 A;  4OES A;  1YCJ A;  1AIV A;  3KFM A;  3OD7 A;  1M5C A;  3FD3 A;  5K2X A;  3T93 B;  3W9V A;  3G3I A;  1JQF A;  3B6Q A;  4NF6 A;  1LFI A;  3VXC A;  3IB2 A;  5CBR A;  2GH9 A;  2WKY A;  1CE2 A;  3QXM A;  4U21 A;  1ZU0 A;  3FVN A;  4OWD A;  4R73 A;  3TYH A;  1Z7N E;  3PMW A;  4NF5 A;  3T9H B;  1T0K A;  1MM7 A;  4HW8 A;  3PMX A;  3S9M C;  3FJG A;  1HSE A;  1B7Z A;  3FUZ A;  3ONM A;  4N13 A;  2ALU A;  2ESN A;  2GHA A;  1FQB A;  3HHF A;  3UIF A;  3FXR A;  4EF1 A;  2H99 A;  4GD5 A;  5A5X A;  1IEJ A;  1P1U A;  4R74 A;  3RPW A;  5JTY A;  2DS9 A;  2B3F A;  3H6V A;  3O9P A;  3HN0 A;  1LBB A;  4KHZ E;  4OEU A;  2I0B A;  1QUK A;  4JSO A;  4U2R A;  3T9V A;  4POW A;  2F7C A;  2Y7P A;  3FVK A;  3MPL A;  3QUF A;  1S50 A;  2DWI A;  4GL0 A;  3IB0 A;  1MY4 A;  4KFQ A;  4MBP A;  1MXU A;  5TPA B;  4IO5 A;  2DWA A;  1B6H A;  2Z8F A;  2F34 A;  3CVG A;  4H5F A;  1B1H A;  2H25 A;  1B51 A;  3KN7 A;  4IY6 A;  2ZNT A;  1N7W A;  4ELO A;  4C0R A;  3C36 A;  4LAT A;  4C1U A;  5CC2 A;  4RPO A;  1OMP A;  3CFZ A;  1TXF A;  2VD3 A;  3PUY E;  1JW5 A;  3K6V A;  4EUO A;  4HTG A;  4KQP A;  3RQT A;  4EXL A;  3BFU A;  4F2Q A;  2QSX A;  1WDN A;  2O51 A;  3FXU A;  5EHM A;  3M3K A;  1FQE A;  3WAF A;  5I59 B;  2O6A A;  5I58 A;  2RC9 A;  3MQ9 A;  1B3H A;  1UTH B;  2RKM A;  4ZED A;  1MXY A;  5KDT A;  3IJO B;  1MH4 A;  1XS5 A;  4P0I A;  1US4 A;  3CR9 A;  3S9L C;  4F31 B;  1BLF A;  3TKD A;  3OO7 A;  3H6U A;  1JEV A;  5AA4 A;  5I2K B;  1MXZ A;  1QUI A;  3DP4 A;  1QUL A;  2FA7 A;  4G68 A;  4TLL B;  4POX A;  3PD8 A;  2DSF A;  4OET A;  1PBP A;  1MQG A;  3TTN A;  5B70 A;  5BWJ A;  5HPQ A;  5K2Y A;  4BDO A;  2HZL A;  4BDR A;  1O64 A;  5L9O A;  2GRV A;  3CFL A;  3FGS A;  1ZMG A;  4H65 A;  2REG A;  4LZ8 A;  4NMY A;  5CMM A;  4YZZ A;  1GV8 A;  3THI A;  4DCY A;  4NF8 A;  5F7V A;  4EF2 A;  5I84 A;  3USD A;  3G3G A;  4BDL A;  4GXS B;  5B7D A;  5FHO A;  1EH3 A;  3GZG A;  1DOT A;  4YKI A;  2XXR A;  3AXF A;  4YB6 A;  4PFW A;  4I8C A;  3PPN A;  5FTH A;  1UTB A;  4RNS A;  1LFH A;  3F11 A;  4R2F A;  5L8D A;  1B5H A;  1S9T A;  1Y20 A;  2ZYN A;  3A3U A;  3B7D A;  4QSE A;  1UIV A;  4Z0I A;  4KYD A;  5HBC A;  1SYH A;  3HPI A;  3PPO A;  4X1D A;  3IAZ A;  2UVH A;  4YAH X;  3ECR A;  5FHM A;  1PBQ A;  2H4I A;  4NF5 B;  1FQC A;  2A5S A;  3PMV A;  3SEW A;  2YLN A;  2O1M A;  2V3Q A;  3A3C A;  3IO6 A;  3O97 A;  1JNF A;  2V3U A;  3PUZ E;  4BDQ A;  1P1Q A;  2ZNS A;  1LCT A;  1A8F A;  1AMF A;  3PPQ A;  5H8S A;  3M3F A;  2DP8 A;  3TQL A;  3VVF A;  3GLB A;  3TAJ A;  2VGQ A;  2P0S A;  4ZE8 A;  5L9S A;  2I58 A;  2UVG A;  4NWD A;  4DDD A;  3DP8 A;  1KWH A;  4YMA A;  1A54 A;  2X7P A;  4G8H A;  5AA1 A;  4RXL A;  2XXV A;  1B3G A;  5TP9 B;  4N6P A;  3U92 A;  3CG3 A;  1B7U A;  1P1W A;  4O3A A;  4F1V A;  1Y4C A;  3U8Q A;  3OXN A;  5H8F B;  4YB7 A;  1VR5 A;  3ILT B;  2I3W A;  3MZ9 A;  2I4C A;  5CI5 A;  4PP0 A;  3VFJ A;  1ZLQ A;  3VXB A;  3CFX A;  3N5L A;  2R71 A;  2NOO A;  5JEI A;  1LCF A;  3U1O A;  1GR2 A;  4PQJ A;  3FJ7 A;  4R9G A;  3FZV A;  4IO4 A;  4G8N A;  4ISU A;  1Q1K A;  4H8J A;  1OIB A;  3RT6 B;  4LP2 B;  2NVU B;  4KD5 A;  1IUD A;  3IB1 A;  2QPQ A;  1Y1M A;  1MQJ A;  1IXH A;  3MZB A;  3PPR A;  2HQ0 A;  1RKM A;  1RYO A;  4AB5 A;  1MXW A;  3N94 A;  1CB6 A;  2XD2 A;  4E0X A;  3IR1 A;  3VLW A;  3K00 A;  3CI8 A;  2KLF A;  1II5 A;  2OK2 A;  4IO3 A;  5AA4 B;  3H6W A;  5AA2 D;  3JYR A;  3MVY A;  2QS1 A;  3E9X A;  1S7Y A;  4G68 B;  3OMB A;  4OEV A;  3T9X B;  3K01 A;  3L6H A;  2V93 A;  2ZYO A;  3O6H A;  4ZEK A;  4QFO A;  3V83 A;  1MS7 A;  2ZMB A;  3IK6 B;  1DTZ A;  1XT8 A;  4KPT A;  4QSC A;  3N26 A;  3CIJ A;  4I9D A;  2DVZ A;  1NFT A;  1OQH A;  3D4C A;  1A99 A;  3B6T A;  3M8U A;  2XXI A;  3MVX A;  3O6I A;  2HEU A;  2E0S A;  3HO7 A;  3MP8 A;  1IQ7 A;  1LB8 A;  4U4S A;  1ZKB A;  1POT A;  2QRY A;  2DE2 A;  4NF8 B;  3IOT A;  1N84 A;  4MFI A;  2DOJ A;  3Q25 A;  4F39 A;  2E1S A;  2OWS A;  2QJE A;  2F6G A;  2QS3 A;  2XXU A;  4I1D A;  4RPN A;  3W9W A;  5CMB A;  2O69 A;  4H0W A;  2V25 A;  2D21 A;  4PFU A;  3EQ1 A;  4YIC A;  4FIM A;  5TPA A;  1DMB A;  1M5E A;  1B3L A;  2UYE A;  3PUV E;  4KI0 E;  2D5W A;  4ESW A;  3BKI B;  4RY1 A;  2HZK A;  3TMG A;  3UK4 A;  2PYY A;  4F1U A;  3R6U A;  4FED A;  2RC8 A;  4Q30 B;  2O1L A;  3G3K A;  1BKA A;  4L17 A;  3GBB A;  4PET A;  3PD9 A;  4RYA A;  1MY1 A;  4P0G A;  2O84 X;  4OFO A;  1SBP A;  4JWX A;  3UN6 A;  4EQ9 A;  4C1T A;  1NNP A;  2REJ A;  2PVU A;  4THI A;  5FTI A;  5KDT B;  1B2H A;  3KJT A;  1B0L A;  4KCD A;  2B3B A;  4MLV A;  1SD3 A;  2RIN A;  3MP6 A;  3QK6 A;  3H6T A;  4WKM A;  3S9N C;  2VP1 A;  3Q27 A;  3VVD A;  4OVJ A;  1N3X A;  4QFP A;  2AL5 A;  3EPE A;  4H8I A;  2ONS A;  3KN3 A;  4G68 C;  4XKQ A;  4OER A;  3SKP A;  2XX7 A;  2UXA A;  5I2N A;  3E4R A;  4JSD A;  2DWH A;  2R9J A;  3MZ1 A;  1EZ9 A;  2XX8 A;  3PV0 E;  3O28 A;  4LA9 A;  1Z7M E;  3H4Z A;  5LOM A;  3K6X A;  5ICQ A;  1NNT A;  3TEP A;  3K1N A;  5H8F A;  4MLQ A;  5L9M A;  4R72 A;  3Q26 A;  1LLS A;  1LFG A;  2W7Y A;  5KCJ A;  1DSN A;  3HHG A;  1PB9 A;  1R6Z A;  4XKR A;  1I69 A;  3OEK A;  4I62 A;  3TUS A;  3K6W A;  3KSJ A;  3QAX A;  1POY 1;  3C9H A;  2HFB A;  1R1N A;  3UGW A;  1NNF A;  2HAV A;  3HCQ A;  4H67 A;  4LQ5 A;  4OHN A;  2AIX A;  3OEM A;  2F7B A;  1N7X A;  5DT6 A;  2AYS A;  5ITO A;  3MJN A;  3ZS6 A; 
#chains in the Genus database with same CATH topology
 1Y9U A;  4DCX A;  3EKI A;  3U94 A;  1B58 A;  4NAP A;  4ONY A;  2HAU A;  3IJX B;  4F3B A;  1VSO A;  5I2N B;  3MST A;  2VOZ A;  3QUJ A;  1AOV A;  4FBP A;  4X48 A;  3IO4 A;  1Y3P A;  1K9Z A;  4ZS9 A;  4GWS A;  2RCA A;  3ILU B;  3BBR A;  3K1M A;  4I40 A;  1IMA A;  3MP1 A;  4QSD A;  5ICT A;  4F3P A;  4LZ5 A;  1B4Z A;  3KC1 A;  4WXJ A;  3ODB A;  5FHN A;  2IA4 A;  3IL1 B;  2LAO A;  4NE4 A;  5J1D A;  1B9J A;  2DYX A;  3UK4 A;  4M1V A;  3TDJ A;  3TCH A;  1SI0 A;  4DE8 A;  1URD A;  4U23 A;  3TTL A;  2F3B A;  2F3D A;  4JWY A;  1OQG A;  3C35 A;  1YAE A;  3MBP A;  1FPD A;  4LN5 A;  4GL8 A;  1B0H A;  5I57 B;  1DCU A;  2XXH A;  4U22 A;  4NX1 A;  3I5O A;  1YZ0 A;  4AB6 A;  3RN8 A;  4BDN A;  3O6G A;  2CMO A;  5H8H B;  3E78 A;  1FCK A;  3MVZ A;  4NF0 A;  3EHT A;  1Y4T A;  3RGY A;  1MY0 A;  2WBD A;  3G3F A;  4Q5T A;  4WEP A;  3RTW B;  4LQ2 A;  1B3E A;  4N07 A;  1I6Q A;  3H3G A;  1B46 A;  2KQZ A;  4F2O A;  5ESY A;  2QVU A;  2XXK A;  4AQ4 A;  2UYF A;  3OSQ A;  1P1N A;  5JK4 A;  1H45 A;  1MQI A;  1RDY A;  2ZZV A;  4K3F A;  1LAG E;  3IOR A;  3OO8 A;  2F36 A;  3KGC A;  2XXT A;  1SYI A;  2G93 A;  1QW0 A;  2I0C A;  2BJI A;  2ZNU A;  4PFR A;  4ZE9 A;  1G0I A;  3LR1 A;  3RYD A;  1FQD A;  2A5T A;  4M4G A;  1IMD A;  1CNQ A;  1SW1 A;  5H8Q A;  1UQW A;  1YPN A;  4LUB A;  1UTH A;  1PB7 A;  2OBG A;  1SQY A;  1O7T A;  4QF9 A;  5H8H A;  2GHB A;  1KA1 A;  3PPP A;  3KZG A;  5DEX A;  3S2V A;  1GTK A;  5ISU A;  4JXI A;  1NKX A;  3RPL B;  4UAC A;  4F18 A;  3VV5 A;  4HCW A;  3LSL A;  2QVR A;  1TFA A;  4HCY A;  2RF1 A;  2VPO A;  1I6A A;  3R26 A;  1LBC A;  4DLD A;  4ND9 A;  4IGT A;  2OZZ A;  3V89 B;  1FPK A;  1LBX A;  1NH7 A;  4EDP A;  5I7I A;  3TQW A;  2F7A A;  2XXY A;  3PU5 A;  1L5T A;  5CBS A;  3TFL A;  2DE3 A;  3TTK A;  3DLN A;  4I3E A;  1AWB A;  3L6G A;  2CZK A;  2Y7R A;  5CM6 A;  5DYH A;  3O2A A;  1DK4 A;  2FHY A;  4H5G A;  1LEV A;  2OWT A;  5I3S A;  4YKK A;  2Z22 A;  4NWC A;  4ZEF A;  4IO2 A;  4YU0 A;  5TU0 A;  5DEX B;  2I6E A;  3RNN A;  4JBZ A;  5AA2 B;  1D9V A;  1SW4 A;  2Y5L A;  3VVE A;  1FQA A;  3OO9 A;  1LB9 A;  1VDW A;  4NQ8 A;  2H5Y A;  4QFL A;  1AIV A;  3KFM A;  3OD7 A;  3FD3 A;  3T93 B;  4NF6 A;  5CBR A;  2GH9 A;  1CE2 A;  1Z7N E;  4NF5 A;  3S9M C;  1HSE A;  4N13 A;  2GHA A;  3FXR A;  4EF1 A;  2H99 A;  4GD5 A;  1IEJ A;  3RPW A;  3O9P A;  3HN0 A;  4OEU A;  4I3Y A;  4H45 A;  4KCC A;  4KFQ A;  4MBP A;  2DWI A;  1MY4 A;  5TPA B;  3CVG A;  2H25 A;  1B51 A;  4GX6 A;  1NV7 A;  1OMP A;  3CFZ A;  4EUO A;  4HTG A;  3M3K A;  1FQE A;  3WAF A;  2RKM A;  1MXY A;  3IJO B;  4NG7 A;  1US4 A;  3CR9 A;  2FIX A;  3OO7 A;  3H6U A;  1JEV A;  1PBP A;  5BWJ A;  4KXP A;  2HZL A;  4H65 A;  3FGS A;  1ZMG A;  4YZZ A;  4LZ8 A;  4OAN A;  1LBY A;  1LFH A;  4R2F A;  1B5H A;  1S9T A;  3A3U A;  4QSE A;  4HXV A;  5T3J A;  5HBC A;  3HPI A;  4YAH X;  1PBQ A;  1NUY A;  4NF5 B;  3PMV A;  3O97 A;  5LDZ A;  2DP8 A;  3TQL A;  3GLB A;  2XWI A;  2ZZX A;  5L9S A;  2UVG A;  1KWH A;  4YMA A;  1FBF A;  1YXI A;  4G8H A;  5TP9 B;  1B7U A;  4YB7 A;  5CI5 A;  2I4C A;  1ZLQ A;  4P8B A;  4GBV A;  2R71 A;  1GR2 A;  4IO4 A;  4ISU A;  1Q1K A;  1OIB A;  4MAG A;  1MQJ A;  3PPR A;  4F1Y A;  4AB5 A;  2XD2 A;  3K00 A;  4MX6 A;  3MVY A;  4N17 A;  3E9X A;  3T9X B;  4OEV A;  5IM2 A;  2QVV A;  3O6H A;  4ZEK A;  3V83 A;  2ZMB A;  4KPT A;  1DTZ A;  1A99 A;  3B6T A;  3MP8 A;  1POT A;  4O94 A;  4NHB A;  2E1S A;  2OWS A;  2QJE A;  2F6G A;  1Q9D A;  3W9W A;  2O69 A;  2V25 A;  5TPA A;  4ESW A;  2PYY A;  2RC8 A;  2O1L A;  3G3K A;  1KA0 A;  2O84 X;  4JWX A;  4C1T A;  5KDT B;  3KJT A;  1B0L A;  3D1R A;  3MP6 A;  3QK6 A;  3Q27 A;  3VVD A;  2AL5 A;  2ONS A;  4G68 C;  4XKQ A;  5I2N A;  3MZ1 A;  4XEQ A;  3K1N A;  5H8F A;  3Q26 A;  1NI9 A;  3K6W A;  3QAX A;  4LQ5 A;  1EYK A;  2VPN A;  5EQ7 A;  5M2V A;  3MJN A;  3RTF B;  4HE2 A;  3MUQ A;  4QFN A;  1XHY A;  4X1B A;  4G4P A;  2OCU A;  1JW4 A;  4U1Z A;  1OLC A;  2PBW A;  2CEX A;  3U93 A;  2Y5K A;  2QL3 A;  3FIR A;  1UIU A;  5DTB A;  5I2K A;  4GWW A;  2H9B A;  4DXU A;  4F3G A;  3OSR A;  1NH8 A;  3CG1 A;  4ZZA A;  3H06 B;  2FNC A;  2M8C A;  1B7H A;  2XHD A;  4DI4 B;  3OEN A;  3MAM A;  1Y1Z A;  1MG1 A;  4DZ1 A;  3DEL B;  4MIJ A;  3P7I A;  4PTK A;  1FTO A;  2Q8J A;  4WED A;  2OLB A;  1MH3 A;  5DVI A;  1ZBM A;  3IOU A;  2Y7I A;  3SEY A;  3QMF A;  1D3K A;  2Q74 A;  2XXX A;  3T0J A;  3ISP A;  3T66 A;  2ANJ A;  4OXV A;  1ATG A;  3EF7 A;  1GGG A;  1URG A;  4P9K A;  3BFT A;  4FE8 A;  1US5 A;  3TCF A;  3T22 A;  2V3T A;  3KSX A;  3N6T A;  4U4X A;  2B4L A;  2Q2A A;  3MWB A;  1BK4 A;  2NXO A;  3I3V A;  4YB5 A;  5AA2 A;  3VDF A;  1EZO A;  4PFB A;  4OQO A;  4X04 A;  2THI A;  3GYY A;  3S9E A;  1P99 A;  1LAX A;  4FEC A;  5I57 A;  2YPN A;  1M5F A;  5H8Q B;  3U65 A;  3KG2 A;  1FTJ A;  3G3H A;  2WBB A;  5DVJ A;  1B1X A;  4P11 A;  2Q88 A;  3N6U A;  1FTM A;  4NN3 A;  1B52 A;  2XXQ A;  1FJ9 A;  3MPK A;  3PTY A;  3KC0 A;  1TFD A;  3G7W A;  3U72 A;  4R75 A;  3O29 A;  1IXG A;  4G2Z A;  4DI3 D;  5DVF A;  1QGX A;  2QMW A;  5AE4 A;  3TZA A;  3B6W A;  3TOD A;  1PDA A;  4LZ7 A;  4LON B;  4U1O A;  2AL4 A;  2UVJ A;  1B5J A;  4LVQ A;  2PT1 A;  2Q89 A;  4N8G A;  3FJM A;  4IB2 A;  4GWU A;  2R8T A;  4FOR A;  4AS5 A;  4ECF A;  5A5X B;  1H43 A;  2X26 A;  4QRZ A;  2QS2 A;  1TWY A;  1Y3Q A;  1MDP 1;  2PT2 A;  3UA8 A;  4NED A;  4F19 A;  4OVS A;  3IFC A;  3FXQ A;  4GRK A;  1IXI A;  1H44 A;  4GFR A;  1AL3 A;  3GBA A;  2HCA A;  3LUY A;  1I6B A;  4ESX A;  4KYE A;  4H1X A;  3HST A;  4OYV A;  3ZSF A;  5H8N B;  2FVZ A;  3TCG A;  2ZXT A;  4XTC Q;  2BJJ X;  4ZZE A;  4YMB A;  2WX9 A;  4KYS A;  3SES A;  1NV6 A;  2PMS A;  3E3K A;  2QFL A;  1LBZ A;  3T1B A;  4FEB A;  3UOR A;  1URS A;  1HSJ A;  4OTE A;  5I56 A;  5IAI A;  4X8R A;  4BDM A;  1FBG A;  4HE1 A;  3KOS A;  1MY3 A;  2WEF A;  4UA8 A;  1YCJ A;  2DDK A;  3W9V A;  1JQF A;  3B6Q A;  1LFI A;  4U21 A;  3QXM A;  3T9H B;  2FIE A;  5EQA A;  3PMX A;  4HW8 A;  3ONM A;  2ALU A;  2ESN A;  1FQB A;  1LBW A;  3UIF A;  1P1U A;  4JSO A;  2F7C A;  3MPL A;  4IO5 A;  2DWA A;  4IY6 A;  2ZNT A;  4ELO A;  4C0R A;  5CC2 A;  1JW5 A;  4KQP A;  4EXL A;  1WDN A;  4P1E A;  5I59 B;  1NV0 A;  4OVT A;  4ZED A;  1XS5 A;  5I2K B;  4TLL B;  2FA7 A;  4G68 A;  4PE3 A;  3TTN A;  5B70 A;  1DBZ A;  5K2Y A;  3CFL A;  2XWV A;  5I84 A;  4NF8 A;  5F7V A;  5B7D A;  4MNC A;  4MMP A;  1UTB A;  5L8D A;  3B7D A;  4OVP A;  1SYH A;  2H4I A;  1FQC A;  2YLN A;  2O1M A;  2V3Q A;  4BDQ A;  1P1Q A;  3PPQ A;  5H8S A;  3M3F A;  2I58 A;  4NWD A;  4PGP A;  2X7P A;  5AA1 A;  5LTC A;  3CG3 A;  1P1W A;  4O3A A;  3U8Q A;  2V4C A;  1VR5 A;  3ILT B;  1NUW A;  3VXB A;  4PP0 A;  1LCF A;  4PQJ A;  4R9G A;  4H8J A;  1IXH A;  3MZB A;  4E0X A;  3H6W A;  2QS1 A;  1S7Y A;  4G68 B;  3OMB A;  2V93 A;  4QFO A;  1MS7 A;  4PAK A;  3N26 A;  4I9D A;  1NFT A;  3D4C A;  4U4S A;  2HEU A;  3UN6 A;  1ZKB A;  1N84 A;  3Q25 A;  4IR8 A;  4F39 A;  4PFU A;  1DMB A;  1B3L A;  4KI0 E;  4F1U A;  3R6U A;  4FED A;  4Q30 B;  4PET A;  3PD9 A;  4RYA A;  1MY1 A;  1NNP A;  1FPE A;  1B2H A;  4KCD A;  4MLV A;  1SD3 A;  4MJO A;  3H6T A;  3S9N C;  1FPI A;  1N3X A;  4QFP A;  2KR0 A;  4H8I A;  3SKP A;  2XX7 A;  4G61 A;  2XX8 A;  3O28 A;  5LOM A;  3H4Z A;  1NNT A;  4MLQ A;  1LLS A;  1LFG A;  5IZ3 B;  1R6Z A;  1I69 A;  3KSJ A;  2HFB A;  1NNF A;  3BIG A;  4H67 A;  1IME A;  4OHN A;  2AIX A;  2B4M A;  3OEM A;  2F7B A;  1INP A;  4OVR A;  4O7I A;  2AYS A;  3T96 B;  4DXB A;  1R9Q A;  1RYX A;  3KOT A;  1XVY A;  5F1Q A;  3QSL A;  5I56 B;  5IKB A;  2WYP A;  3K02 A;  1PEB A;  4JB7 A;  3MVW A;  2O7I A;  1AH5 A;  4R6Y A;  3HV1 A;  1MPD A;  3LBS A;  1N04 A;  1IMB A;  1QKA A;  4GWO A;  3PUW E;  3C34 A;  2Y7K A;  4Q0C A;  1EYI A;  1IXC A;  2Q9T A;  4IGR A;  4F3S A;  4XXU A;  4RK9 A;  1FTL A;  1DTG A;  3KBZ A;  5ET8 A;  5BUU A;  1A55 A;  1FBD A;  2XWK A;  3FVG A;  1OVT A;  1FPF A;  3RUM A;  3G3J A;  1ELJ A;  1FPJ A;  2VHA A;  4EQ7 A;  3TTR A;  2F8D A;  3UP9 A;  1FBC A;  2Y84 A;  2I48 A;  4O3B A;  4FJP A;  4UAB A;  2VD2 A;  5H8N A;  1FJ6 A;  3ZKL A;  4FAJ A;  3O66 A;  2O7U A;  4ZEB A;  2XXW A;  4PFT A;  2O68 A;  3B50 A;  3DP6 A;  1NV4 A;  1B05 A;  2V84 A;  1B4H A;  4Z7E A;  4XF5 A;  2XA5 A;  2P2A A;  2XXP A;  1FPG A;  3RLF E;  1SI1 A;  2ONR A;  1ZIU A;  3RPL A;  1NL5 A;  2Y7W A;  2IEE A;  4MF3 A;  3OO6 A;  4OEN A;  4MHF A;  2Q2C A;  4ELQ A;  4ELP A;  4JWO A;  4EQB A;  1OVB A;  1XC1 A;  4GLI A;  2XD3 A;  1M5B A;  3VE1 B;  1MQH A;  2YJP A;  1IIW A;  4HS7 A;  3FXB A;  3LSW A;  4BLA A;  4N4U A;  4AS4 A;  3EHS A;  2DXR A;  1USY H;  4O3C A;  4OFJ A;  4FAT A;  4Q8R A;  1WOD A;  3OEL A;  3IOV A;  5CMC A;  1TT1 A;  4F22 A;  1HSL A;  1JVX A;  2OJT A;  3MC2 A;  3MYU A;  4DXC A;  4R2B A;  3I6V A;  4F29 A;  1Y3N A;  5ET6 A;  4OZ9 A;  5I5P A;  1IIT A;  5ET7 A;  4GXA A;  3K0V A;  4TLM B;  5DW8 A;  3S4U A;  4O7M A;  3C33 A;  3K1P A;  3EHU A;  1VFD A;  2P3V A;  2CZL A;  2X7Q A;  1VE4 A;  1MXX A;  2F78 A;  2DE4 A;  2I4B A;  4GWY A;  2FYI A;  4QFK A;  3TPA A;  2QMX A;  3GXA A;  4PAF A;  1QKB A;  2UVI A;  1DPP A;  3JZJ A;  5IZ3 A;  3A09 A;  1MRP A;  5ELV A;  1MQD A;  3H03 A;  4DIG A;  1QVS A;  4RJZ A;  4XKN A;  3C4M A;  4NF4 A;  2HPG A;  3W15 C;  2DQV A;  1FBE A;  3KN8 A;  4RA1 A;  4GIZ A;  2F5X A;  3K2D A;  5I58 B;  2XX9 A;  3SEV A;  4P56 A;  3OOA A;  2DWJ A;  1SW5 A;  1H76 A;  4PFI A;  1SVX B;  3LSX A;  3D4G A;  4OMB A;  3QYT A;  3IOW A;  3KBR A;  2I49 A;  4MEV A;  1KZ8 A;  1P1O A;  3VLV A;  4IO6 A;  3VXC A;  3IB2 A;  5IGA A;  2WKY A;  1ZU0 A;  5F24 A;  4OWD A;  4R73 A;  3PMW A;  1MM7 A;  3FJG A;  1NV2 A;  1B7Z A;  5A5X A;  1LBB A;  4KHZ E;  1QUK A;  4U2R A;  4POW A;  2Y7P A;  3FVK A;  3QUF A;  4GL0 A;  3IB0 A;  1MXU A;  1B6H A;  2Z8F A;  2F34 A;  4H5F A;  3KN7 A;  4PGN A;  3CHG A;  4LAT A;  4C1U A;  2VD3 A;  3BFU A;  2QSX A;  2O51 A;  2PCR A;  2O6A A;  5I58 A;  2RC9 A;  3MQ9 A;  1MH4 A;  4F31 B;  3DP4 A;  4POX A;  4OET A;  2OX3 A;  5HPQ A;  4BDR A;  5L9O A;  5CMM A;  4NMY A;  3LV0 A;  4DCY A;  3USD A;  4GXS B;  1DOT A;  2XXR A;  4YB6 A;  4PFW A;  4I8C A;  2ZZW A;  4RNS A;  4N15 A;  1Y20 A;  4KYD A;  4X1D A;  5FHM A;  3IAZ A;  3ECR A;  2A5S A;  3SEW A;  3IO6 A;  1JNF A;  2V3U A;  1FBH A;  3VVF A;  3TAJ A;  2VGQ A;  3DP8 A;  1A54 A;  4RXL A;  2XXV A;  1B3G A;  4N6P A;  3U92 A;  4F1V A;  3LUZ A;  5H8F B;  2I3W A;  3VFJ A;  1FTA A;  3CFX A;  3N5L A;  5JEI A;  2NOO A;  3FJ7 A;  4LP2 B;  2NVU B;  4KD5 A;  3IB1 A;  1RDX A;  1Y1M A;  2HQ0 A;  1RKM A;  3N94 A;  2KLF A;  2OK2 A;  5AA2 D;  3JYR A;  4JVI A;  2ZYO A;  3IK6 B;  4O8M A;  2XXI A;  2E0S A;  1IQ7 A;  3IOT A;  4MFI A;  4I1D A;  2QS3 A;  4RPN A;  5EQ9 A;  4XFE A;  4H0W A;  4YIC A;  3EQ1 A;  3B8B A;  3PUV E;  2D5W A;  3BKI B;  4RY1 A;  2HZK A;  4P3L A;  1RDZ A;  3GBB A;  4EQ9 A;  1SBP A;  2REJ A;  2PVU A;  2GQ1 A;  5FTI A;  4PCD A;  2VP1 A;  4OVJ A;  3EPE A;  3KN3 A;  1EZ9 A;  1Z7M E;  2CZH A;  1YYZ A;  4R72 A;  4QXD A;  5KCJ A;  2W7Y A;  1FSA A;  3HHG A;  1PB9 A;  4XKR A;  4I62 A;  3OEK A;  1POY 1;  3UGW A;  4GX4 A;  4GWX A;  3ZS6 A;  4GVO A;  4G77 A;  4OA4 A;  2F6P A;  2Z23 A;  1QJM A;  1R9L A;  4YKP A;  1EZP A;  1GVC A;  1PB8 A;  2ZYM A;  4N91 A;  1J1N A;  1SW2 A;  1PC3 A;  1F9B A;  3A29 A;  4EXK A;  2FBP A;  5ITP A;  1B40 A;  5EHS A;  3FBP A;  1N76 A;  3V5A A;  4PF6 A;  4PE5 B;  2R6G E;  3LSF B;  1JVY A;  5FBP A;  4RK2 A;  4ZDM A;  4TQU Q;  3C32 A;  2P1S A;  5EYH A;  1FW0 A;  3E13 X;  4OFL A;  1Q35 A;  2DXY A;  4TOZ A;  1D9Y A;  5HM4 B;  1MDQ A;  3IFA A;  4GWZ A;  1MPC A;  2ZYK A;  3RT8 A;  1DPE A;  3SEU A;  3FV1 A;  4N81 A;  4X9T A;  1MPB A;  4PC9 A;  1IMF A;  2G29 A;  3R7X A;  1IZ1 A;  1LAF E;  1B5I A;  3ROJ A;  1EYJ A;  2I3V A;  1MY2 A;  1A7L A;  1A40 A;  1SDX A;  3K6U A;  4HE0 A;  3H7M A;  4GF8 A;  3LC8 A;  1UTB B;  4YKJ A;  3KEI A;  3KJ7 A;  2PFY A;  1JP4 A;  1FRP A;  2VT5 A;  4MH5 A;  5EYF A;  4ZEI A;  4PBQ A;  3MW0 A;  1FQF A;  4PBH A;  1BIY A;  2OWZ A;  2B65 A;  4N6D A;  1XOC A;  1QUJ A;  1YTV A;  4R6H A;  1N3W A;  2Q8M A;  3JV9 A;  4MCO A;  4GX3 A;  1NUX A;  3T9U A;  4JVC A;  4NTL A;  2NUV A;  4E0W A;  3TEL A;  4OVQ A;  1LST A;  3SET A;  3CSG A;  2QS4 A;  3V8X B;  5A5L A;  4N6K A;  5CRY A;  5KZT A;  4IO7 A;  4ELR A;  2NWJ A;  3VLU A;  2D3I A;  1IMC A;  5I59 A;  2H98 A;  1ZJL A;  1BTJ A;  3CSB A;  3E79 A;  4MNI A;  2F35 A;  1OLA A;  3QIM A;  1M5D A;  1BP5 A;  4QBA A;  4ZEC A;  4R9F A;  2GFE A;  1NMU A;  1N0T A;  3FAS A;  3RY3 A;  5JTY B;  3Q29 A;  1VFE A;  3Q28 A;  3C31 A;  2F97 A;  4MNP A;  1H3D A;  2DVC A;  1B32 A;  1D4N A;  2JJK A;  2Z8D A;  1JEU A;  5TP9 A;  2CEY A;  4PDH A;  3SER A;  3FV2 A;  3SEX A;  4IY5 A;  4GQO A;  4G8M A;  1ZTY A;  1LGB C;  2RC7 A;  3CRB A;  1NNK A;  3M3L A;  3SDF A;  1EU8 A;  3EN3 A;  3PGF A;  3FVO A;  4JDF A;  3ZKK A;  2A5T B;  2ONK E;  2CZI A;  4PFY A;  1FPB A;  2HHM A;  5KCJ B;  4JVD A;  1O63 A;  2HXR A;  1XVX A;  2HXW A;  1G0H A;  2Z8E A;  1LAH E;  1SPI A;  4NF4 B;  4QHQ A;  1JET A;  1MM6 A;  2PX1 A;  3DM0 A;  5CMK A;  4H6D A;  1NUZ A;  1A8E A;  5EYG A;  4XKP A;  3IX1 A;  1FTK A;  4KR5 A;  1MXV A;  3K4U A;  4R6K A;  3FAT A;  5AA3 A;  4NF6 B;  1JW1 A;  2P3N A;  1NV3 A;  2ABH A;  3TTM A;  3PUX E;  1B3F A;  1ANF A;  2XWO A;  2RCB A;  4N8Y A;  1USY E;  4GOT A;  1WVJ A;  4OES A;  1M5C A;  5K2X A;  3G3I A;  2WYK A;  3FVN A;  3TYH A;  1T0K A;  5J16 A;  3FUZ A;  3HHF A;  4R74 A;  5JTY A;  2DS9 A;  2B3F A;  3H6V A;  2I0B A;  3T9V A;  1S50 A;  4PDD A;  3HFU A;  4XIG Q;  1B1H A;  1N7W A;  3C36 A;  4RPO A;  3PUY E;  1TXF A;  3K6V A;  4F2Q A;  3SZP A;  3RQT A;  2L5V A;  3FXU A;  5EHM A;  1B3H A;  1UTH B;  5KDT A;  1D9Q A;  4P0I A;  3S9L C;  1BLF A;  3TKD A;  5AA4 A;  1MXZ A;  1QUI A;  1QUL A;  3PD8 A;  2DSF A;  1MQG A;  4BDO A;  4PAI A;  1O64 A;  4P47 A;  2GRV A;  1GV8 A;  2REG A;  3THI A;  1FPL A;  4EF2 A;  3G3G A;  4BDL A;  5FHO A;  1EH3 A;  3GZG A;  4YKI A;  3AXF A;  5FTH A;  3PPN A;  3F11 A;  2ZYN A;  1UIV A;  4Z0I A;  3PPO A;  2UVH A;  5ET5 A;  5IZ1 A;  3A3C A;  3PUZ E;  2ZNS A;  1LCT A;  1A8F A;  1AMF A;  1K9Y A;  5IZZ A;  2P0S A;  4ZE8 A;  4NGU A;  4DDD A;  4GBW A;  1Y4C A;  3OXN A;  3MZ9 A;  1LBV A;  3U1O A;  1XI6 A;  3FZV A;  4G8N A;  3RT6 B;  4H46 A;  1IUD A;  2QPQ A;  2PFZ A;  1RYO A;  1MXW A;  1CB6 A;  3IR1 A;  3VLW A;  3CI8 A;  1II5 A;  4IO3 A;  5AA4 B;  3K01 A;  3L6H A;  3BIH A;  1XT8 A;  4QSC A;  3CIJ A;  2DVZ A;  1OQH A;  3M8U A;  3MVX A;  5EQ8 A;  3O6I A;  3HO7 A;  3WAE A;  1LB8 A;  2QRY A;  4NF8 B;  2DE2 A;  2DOJ A;  2XXU A;  5CMB A;  2D21 A;  2MKZ A;  4FIM A;  1M5E A;  2UYE A;  1NV5 A;  3TMG A;  1BKA A;  4L17 A;  4P0G A;  4OFO A;  4PF8 A;  4THI A;  2B3B A;  2RIN A;  1FBP A;  4WKM A;  4P1L A;  3NOH A;  4OER A;  1NV1 A;  2UXA A;  3E4R A;  4JSD A;  2DWH A;  2R9J A;  3PV0 E;  4LA9 A;  3K6X A;  5ICQ A;  3TEP A;  5L9M A;  1DSN A;  3TUS A;  3C9H A;  1R1N A;  3HCQ A;  1N7X A;  5DT6 A;  2HAV A;  5ITO A; 
#chains in the Genus database with same CATH homology
 1Y9U A;  4GVO A;  3RTF B;  3MUQ A;  4G77 A;  3T96 B;  4DCX A;  4DXB A;  4QFN A;  1R9Q A;  1RYX A;  1XHY A;  3KOT A;  4X1B A;  2F6P A;  1XVY A;  2Z23 A;  4G4P A;  5F1Q A;  1QJM A;  1R9L A;  3QSL A;  3U94 A;  1B58 A;  2OCU A;  4YKP A;  1GVC A;  1EZP A;  1PB8 A;  5I56 B;  5IKB A;  2ZYM A;  1JW4 A;  3K02 A;  1PEB A;  4U1Z A;  4ONY A;  4JB7 A;  1J1N A;  1OLC A;  2HAU A;  2PBW A;  3IJX B;  3MVW A;  1SW2 A;  3U93 A;  4F3B A;  2O7I A;  1PC3 A;  1F9B A;  2QL3 A;  4EXK A;  1AH5 A;  3FIR A;  1UIU A;  1VSO A;  5DTB A;  5I2K A;  2H9B A;  5I2N B;  5ITP A;  1B40 A;  4R6Y A;  5EHS A;  1N76 A;  3HV1 A;  1MPD A;  2VOZ A;  3LBS A;  4DXU A;  3QUJ A;  4F3G A;  1N04 A;  3V5A A;  4PE5 B;  2R6G E;  1AOV A;  3LSF B;  1JVY A;  1NH8 A;  1QKA A;  3OSR A;  4X48 A;  4RK2 A;  3IO4 A;  1Y3P A;  4ZDM A;  3CG1 A;  3C32 A;  4GWO A;  4TQU Q;  4XIG Q;  2P1S A;  2FNC A;  3H06 B;  3C34 A;  3PUW E;  4ZS9 A;  4ZZA A;  2Y7K A;  2M8C A;  2RCA A;  1B7H A;  4Q0C A;  2Q9T A;  1IXC A;  3BBR A;  1FW0 A;  3ILU B;  3E13 X;  3K1M A;  4IGR A;  4XXU A;  4F3S A;  4RK9 A;  2XHD A;  4OFL A;  1Q35 A;  3OEN A;  3MAM A;  1FTL A;  1DTG A;  3MP1 A;  4QSD A;  5ICT A;  4F3P A;  5BUU A;  4LZ5 A;  1B4Z A;  2DXY A;  1Y1Z A;  1A55 A;  1MG1 A;  4TOZ A;  4WXJ A;  3ODB A;  1D9Y A;  3DEL B;  3FVG A;  1MDQ A;  1OVT A;  5FHN A;  4DZ1 A;  5HM4 B;  1MPC A;  2ZYK A;  3P7I A;  3RT8 A;  2IA4 A;  1DPE A;  3RUM A;  1FTO A;  3G3J A;  2Q8J A;  3IL1 B;  4WED A;  2LAO A;  1ELJ A;  4NE4 A;  3SEU A;  5J1D A;  3FV1 A;  1B9J A;  2OLB A;  1MH3 A;  2DYX A;  2VHA A;  4X9T A;  5DVI A;  3TTR A;  1ZBM A;  3IOU A;  2F8D A;  4M1V A;  3TDJ A;  3TCH A;  1SI0 A;  3UP9 A;  1MPB A;  2Y7I A;  2Y84 A;  3SEY A;  4DE8 A;  2I48 A;  1D3K A;  1URD A;  4O3B A;  4U23 A;  3TTL A;  2G29 A;  2XXX A;  4FJP A;  3R7X A;  2VD2 A;  5H8N A;  3ZKL A;  3T66 A;  4FAJ A;  2ANJ A;  4OXV A;  1IZ1 A;  4JWY A;  1ATG A;  2O7U A;  3EF7 A;  1GGG A;  1LAF E;  1B5I A;  1OQG A;  1URG A;  2I3V A;  1MY2 A;  1A7L A;  3C35 A;  4ZEB A;  1YAE A;  2XXW A;  3BFT A;  4PFT A;  3MBP A;  1US5 A;  4FE8 A;  3TCF A;  1A40 A;  3T22 A;  1SDX A;  3K6U A;  2O68 A;  3H7M A;  4GF8 A;  2V3T A;  3LC8 A;  3DP6 A;  4GL8 A;  1UTB B;  1B0H A;  5I57 B;  4YKJ A;  3KEI A;  4KCC A;  1B05 A;  2V84 A;  1B4H A;  3KJ7 A;  2XXH A;  3KSX A;  3N6T A;  4U22 A;  4U4X A;  4Z7E A;  2Q2A A;  3MWB A;  3I5O A;  2P2A A;  2XXP A;  3RLF E;  1SI1 A;  2NXO A;  3I3V A;  4YB5 A;  2ONR A;  5AA2 A;  1ZIU A;  4AB6 A;  3RN8 A;  4BDN A;  1NL5 A;  2Y7W A;  4MH5 A;  5EYF A;  3VDF A;  3O6G A;  2IEE A;  2CMO A;  5H8H B;  4MF3 A;  1EZO A;  4OQO A;  4ZEI A;  3OO6 A;  1FCK A;  2THI A;  3MVZ A;  4OEN A;  3MW0 A;  1FQF A;  2Q2C A;  3EHT A;  1P99 A;  4ELQ A;  3S9E A;  1BIY A;  4ELP A;  4JWO A;  1LAX A;  1Y4T A;  3RGY A;  1MY0 A;  3G3F A;  4WEP A;  4Q5T A;  3RTW B;  4LQ2 A;  4FEC A;  5I57 A;  1B3E A;  4EQB A;  1OVB A;  1XC1 A;  2B65 A;  1M5F A;  2XD3 A;  2YPN A;  1I6Q A;  4GLI A;  4N07 A;  5H8Q B;  1XOC A;  3H3G A;  1B46 A;  1QUJ A;  1YTV A;  4F2O A;  4R6H A;  1N3W A;  1M5B A;  3JV9 A;  3KG2 A;  1FTJ A;  3VE1 B;  1MQH A;  3G3H A;  5DVJ A;  2YJP A;  1B1X A;  4P11 A;  4AQ4 A;  3T9U A;  2UYF A;  1IIW A;  2Q88 A;  3N6U A;  4NTL A;  2NUV A;  4HS7 A;  1FTM A;  3LSW A;  4BLA A;  4E0W A;  3OSQ A;  1P1N A;  3TEL A;  5JK4 A;  1H45 A;  1LST A;  3EHS A;  1MQI A;  3SET A;  2DXR A;  1USY H;  1B52 A;  3CSG A;  1LAG E;  2QS4 A;  2XXQ A;  3IOR A;  4K3F A;  4O3C A;  4OFJ A;  5CRY A;  3MPK A;  3V8X B;  5KZT A;  4FAT A;  1TFD A;  4IO7 A;  3G7W A;  3OO8 A;  4ELR A;  4Q8R A;  3U72 A;  2NWJ A;  2F36 A;  3KGC A;  3O29 A;  4R75 A;  3VLU A;  2XXT A;  1SYI A;  2D3I A;  1IXG A;  2G93 A;  1QW0 A;  1WOD A;  2H98 A;  2I0C A;  4G2Z A;  5I59 A;  1ZJL A;  5DVF A;  2ZNU A;  1BTJ A;  2QMW A;  4ZE9 A;  5AE4 A;  3CSB A;  3OEL A;  3TZA A;  3IOV A;  3B6W A;  3LR1 A;  5CMC A;  3TOD A;  1PDA A;  1TT1 A;  2F35 A;  4LZ7 A;  4LON B;  4U1O A;  1FQD A;  4EQ7 A;  4F22 A;  1OLA A;  2A5T A;  4M4G A;  3QIM A;  2AL4 A;  1HSL A;  1JVX A;  2OJT A;  2UVJ A;  1B5J A;  4LVQ A;  2PT1 A;  1SW1 A;  1M5D A;  1BP5 A;  2Q89 A;  3MC2 A;  5H8Q A;  4ZEC A;  1UQW A;  3FJM A;  1YPN A;  4IB2 A;  4LUB A;  4DXC A;  4R9F A;  4R2B A;  2GFE A;  1NMU A;  3I6V A;  1N0T A;  4FOR A;  3FAS A;  3WAE A;  3RY3 A;  1UTH A;  4ECF A;  1PB7 A;  2OBG A;  5JTY B;  1SQY A;  1O7T A;  3O66 A;  3Q29 A;  1H43 A;  4QF9 A;  5H8H A;  4F29 A;  5A5X B;  1Y3N A;  2X26 A;  1VFE A;  3Q28 A;  2QS2 A;  2GHB A;  4OZ9 A;  1IIT A;  3C31 A;  1TWY A;  1Y3Q A;  2F97 A;  1MDP 1;  3PPP A;  3KZG A;  1H3D A;  2DVC A;  2PT2 A;  5DEX A;  1B32 A;  3S2V A;  1D4N A;  3UA8 A;  4GXA A;  1GTK A;  2Z8D A;  1JEU A;  3K0V A;  4TLM B;  5TP9 A;  5ISU A;  4NED A;  4JXI A;  3SER A;  3S4U A;  4F19 A;  3C33 A;  1NKX A;  3FV2 A;  3K1P A;  4IY5 A;  3SEX A;  3EHU A;  1VFD A;  4GQO A;  4UAC A;  3VV5 A;  4F18 A;  3FXQ A;  4HCW A;  3LSL A;  4G8M A;  1ZTY A;  1LGB C;  1IXI A;  1TFA A;  1H44 A;  2RC7 A;  1AL3 A;  4GFR A;  2CZL A;  4GRK A;  2RF1 A;  4HCY A;  3CRB A;  1NNK A;  3M3L A;  2X7Q A;  1VE4 A;  1MXX A;  2HCA A;  3GBA A;  1EU8 A;  3SDF A;  3EN3 A;  2F78 A;  3PGF A;  1I6A A;  3FVO A;  3LUY A;  1I6B A;  3R26 A;  2DE4 A;  1LBC A;  4JDF A;  4DLD A;  4ESX A;  3ZKK A;  4KYE A;  2I4B A;  2A5T B;  4ND9 A;  4F1Y A;  2ONK E;  4IGT A;  2FYI A;  4H1X A;  4QFK A;  3TPA A;  2OZZ A;  3V89 B;  2QMX A;  3GXA A;  3HST A;  1NH7 A;  1QKB A;  4EDP A;  4PFY A;  2UVI A;  4OYV A;  3TQW A;  2F7A A;  3ZSF A;  2XXY A;  1DPP A;  3PU5 A;  1L5T A;  3JZJ A;  5CBS A;  5H8N B;  3A09 A;  5KCJ B;  3TFL A;  3TCG A;  2DE3 A;  2ZXT A;  4XTC Q;  1O63 A;  1MRP A;  3TTK A;  1XVX A;  2HXW A;  3DLN A;  1MQD A;  2BJJ X;  5ELV A;  4ZZE A;  3H03 A;  4YMB A;  2Z8E A;  4DIG A;  1LAH E;  3L6G A;  1QVS A;  4KYS A;  4RJZ A;  4XKN A;  3C4M A;  4NF4 A;  4NF4 B;  3SES A;  2Y7R A;  3W15 C;  2PMS A;  1JET A;  4QHQ A;  5CM6 A;  3E3K A;  1MM6 A;  2DQV A;  2PX1 A;  5DYH A;  3KN8 A;  3DM0 A;  3O2A A;  4RA1 A;  5CMK A;  4H5G A;  4GIZ A;  2OWT A;  4H6D A;  2F5X A;  3K2D A;  4YKK A;  1A8E A;  4XKP A;  4FEB A;  3UOR A;  1URS A;  1HSJ A;  5M2V A;  4OTE A;  3IX1 A;  1FTK A;  4KR5 A;  5I58 B;  2Z22 A;  1MXV A;  3K4U A;  4R6K A;  3FAT A;  2XX9 A;  4NWC A;  5I56 A;  4ZEF A;  3SEV A;  5AA3 A;  5IAI A;  3OOA A;  4IO2 A;  4QRZ A;  4BDM A;  2DWJ A;  4NF6 B;  4YU0 A;  5TU0 A;  1SW5 A;  1JW1 A;  1H76 A;  5DEX B;  1SVX B;  3LSX A;  2I6E A;  2ABH A;  3D4G A;  3TTM A;  4OMB A;  3PUX E;  3RNN A;  1B3F A;  4JBZ A;  3QYT A;  5AA2 B;  1ANF A;  3IOW A;  3KBR A;  2RCB A;  1D9V A;  1SW4 A;  3KOS A;  2I49 A;  3VVE A;  1FQA A;  3OO9 A;  1MY3 A;  1LB9 A;  1P1O A;  1USY E;  4GOT A;  2H5Y A;  1WVJ A;  3VLV A;  4IO6 A;  4QFL A;  4UA8 A;  4OES A;  1YCJ A;  1AIV A;  3KFM A;  3OD7 A;  1M5C A;  3FD3 A;  5K2X A;  3T93 B;  3W9V A;  3G3I A;  1JQF A;  3B6Q A;  4NF6 A;  1LFI A;  3VXC A;  3IB2 A;  5CBR A;  2GH9 A;  2WKY A;  1CE2 A;  3QXM A;  4U21 A;  1ZU0 A;  3FVN A;  4OWD A;  4R73 A;  3TYH A;  1Z7N E;  3PMW A;  4NF5 A;  3T9H B;  1T0K A;  1MM7 A;  4HW8 A;  3PMX A;  3S9M C;  3FJG A;  1HSE A;  1B7Z A;  3FUZ A;  3ONM A;  4N13 A;  2ALU A;  2ESN A;  2GHA A;  1FQB A;  3HHF A;  3UIF A;  3FXR A;  4EF1 A;  2H99 A;  4GD5 A;  5A5X A;  1IEJ A;  1P1U A;  4R74 A;  3RPW A;  5JTY A;  2DS9 A;  2B3F A;  3H6V A;  3O9P A;  3HN0 A;  1LBB A;  4KHZ E;  4OEU A;  2I0B A;  1QUK A;  4JSO A;  4U2R A;  3T9V A;  4POW A;  2F7C A;  2Y7P A;  3FVK A;  3MPL A;  3QUF A;  1S50 A;  2DWI A;  4GL0 A;  3IB0 A;  1MY4 A;  4KFQ A;  4MBP A;  1MXU A;  5TPA B;  4IO5 A;  2DWA A;  1B6H A;  2Z8F A;  2F34 A;  3CVG A;  4H5F A;  1B1H A;  2H25 A;  1B51 A;  3KN7 A;  4IY6 A;  2ZNT A;  1N7W A;  4ELO A;  4C0R A;  3C36 A;  4LAT A;  4C1U A;  5CC2 A;  4RPO A;  1OMP A;  3CFZ A;  1TXF A;  2VD3 A;  3PUY E;  1JW5 A;  3K6V A;  4EUO A;  4HTG A;  4KQP A;  3RQT A;  4EXL A;  3BFU A;  4F2Q A;  2QSX A;  1WDN A;  2O51 A;  3FXU A;  5EHM A;  3M3K A;  1FQE A;  3WAF A;  5I59 B;  2O6A A;  5I58 A;  2RC9 A;  3MQ9 A;  1B3H A;  1UTH B;  2RKM A;  4ZED A;  1MXY A;  5KDT A;  3IJO B;  1MH4 A;  1XS5 A;  4P0I A;  1US4 A;  3CR9 A;  3S9L C;  4F31 B;  1BLF A;  3TKD A;  3OO7 A;  3H6U A;  1JEV A;  5AA4 A;  5I2K B;  1MXZ A;  1QUI A;  3DP4 A;  1QUL A;  2FA7 A;  4G68 A;  4TLL B;  4POX A;  3PD8 A;  2DSF A;  4OET A;  1PBP A;  1MQG A;  3TTN A;  5B70 A;  5BWJ A;  5HPQ A;  5K2Y A;  4BDO A;  2HZL A;  4BDR A;  1O64 A;  5L9O A;  2GRV A;  3CFL A;  3FGS A;  1ZMG A;  4H65 A;  2REG A;  4LZ8 A;  4NMY A;  5CMM A;  4YZZ A;  1GV8 A;  3THI A;  4DCY A;  4NF8 A;  5F7V A;  4EF2 A;  5I84 A;  3USD A;  3G3G A;  4BDL A;  4GXS B;  5B7D A;  5FHO A;  1EH3 A;  3GZG A;  1DOT A;  4YKI A;  2XXR A;  3AXF A;  4YB6 A;  4PFW A;  4I8C A;  3PPN A;  5FTH A;  1UTB A;  4RNS A;  1LFH A;  3F11 A;  4R2F A;  5L8D A;  1B5H A;  1S9T A;  1Y20 A;  2ZYN A;  3A3U A;  3B7D A;  4QSE A;  1UIV A;  4Z0I A;  4KYD A;  5HBC A;  1SYH A;  3HPI A;  3PPO A;  4X1D A;  3IAZ A;  2UVH A;  4YAH X;  3ECR A;  5FHM A;  1PBQ A;  2H4I A;  4NF5 B;  1FQC A;  2A5S A;  3PMV A;  3SEW A;  2YLN A;  2O1M A;  2V3Q A;  3A3C A;  3IO6 A;  3O97 A;  1JNF A;  2V3U A;  3PUZ E;  4BDQ A;  1P1Q A;  2ZNS A;  1LCT A;  1A8F A;  1AMF A;  3PPQ A;  5H8S A;  3M3F A;  2DP8 A;  3TQL A;  3VVF A;  3GLB A;  3TAJ A;  2VGQ A;  2P0S A;  4ZE8 A;  5L9S A;  2I58 A;  2UVG A;  4NWD A;  4DDD A;  3DP8 A;  1KWH A;  4YMA A;  1A54 A;  2X7P A;  4G8H A;  5AA1 A;  4RXL A;  2XXV A;  1B3G A;  5TP9 B;  4N6P A;  3U92 A;  3CG3 A;  1B7U A;  1P1W A;  4O3A A;  4F1V A;  1Y4C A;  3U8Q A;  3OXN A;  5H8F B;  4YB7 A;  1VR5 A;  3ILT B;  2I3W A;  3MZ9 A;  2I4C A;  5CI5 A;  4PP0 A;  3VFJ A;  1ZLQ A;  3VXB A;  3CFX A;  3N5L A;  2R71 A;  2NOO A;  5JEI A;  1LCF A;  3U1O A;  1GR2 A;  4PQJ A;  3FJ7 A;  4R9G A;  3FZV A;  4IO4 A;  4G8N A;  4ISU A;  1Q1K A;  4H8J A;  1OIB A;  3RT6 B;  4LP2 B;  2NVU B;  4KD5 A;  1IUD A;  3IB1 A;  2QPQ A;  1Y1M A;  1MQJ A;  1IXH A;  3MZB A;  3PPR A;  2HQ0 A;  1RKM A;  1RYO A;  4AB5 A;  1MXW A;  3N94 A;  1CB6 A;  2XD2 A;  4E0X A;  3IR1 A;  3VLW A;  3K00 A;  3CI8 A;  2KLF A;  1II5 A;  2OK2 A;  4IO3 A;  5AA4 B;  3H6W A;  5AA2 D;  3JYR A;  3MVY A;  2QS1 A;  3E9X A;  1S7Y A;  4G68 B;  3OMB A;  4OEV A;  3T9X B;  3K01 A;  3L6H A;  2V93 A;  2ZYO A;  3O6H A;  4ZEK A;  4QFO A;  3V83 A;  1MS7 A;  2ZMB A;  3IK6 B;  1DTZ A;  1XT8 A;  4KPT A;  4QSC A;  3N26 A;  3CIJ A;  4I9D A;  2DVZ A;  1NFT A;  1OQH A;  3D4C A;  1A99 A;  3B6T A;  3M8U A;  2XXI A;  3MVX A;  3O6I A;  2HEU A;  2E0S A;  3HO7 A;  3MP8 A;  1IQ7 A;  1LB8 A;  4U4S A;  1ZKB A;  1POT A;  2QRY A;  2DE2 A;  4NF8 B;  3IOT A;  1N84 A;  4MFI A;  2DOJ A;  3Q25 A;  4F39 A;  2E1S A;  2OWS A;  2QJE A;  2F6G A;  2QS3 A;  2XXU A;  4I1D A;  4RPN A;  3W9W A;  5CMB A;  2O69 A;  4H0W A;  2V25 A;  2D21 A;  4PFU A;  3EQ1 A;  4YIC A;  4FIM A;  5TPA A;  1DMB A;  1M5E A;  1B3L A;  2UYE A;  3PUV E;  4KI0 E;  2D5W A;  4ESW A;  3BKI B;  4RY1 A;  2HZK A;  3TMG A;  3UK4 A;  2PYY A;  4F1U A;  3R6U A;  4FED A;  2RC8 A;  4Q30 B;  2O1L A;  3G3K A;  1BKA A;  4L17 A;  3GBB A;  4PET A;  3PD9 A;  4RYA A;  1MY1 A;  4P0G A;  2O84 X;  4OFO A;  1SBP A;  4JWX A;  3UN6 A;  4EQ9 A;  4C1T A;  1NNP A;  2REJ A;  2PVU A;  4THI A;  5FTI A;  5KDT B;  1B2H A;  3KJT A;  1B0L A;  4KCD A;  2B3B A;  4MLV A;  1SD3 A;  2RIN A;  3MP6 A;  3QK6 A;  3H6T A;  4WKM A;  3S9N C;  2VP1 A;  3Q27 A;  3VVD A;  4OVJ A;  1N3X A;  4QFP A;  2AL5 A;  3EPE A;  4H8I A;  2ONS A;  3KN3 A;  4G68 C;  4XKQ A;  4OER A;  3SKP A;  2XX7 A;  2UXA A;  5I2N A;  3E4R A;  4JSD A;  2DWH A;  2R9J A;  3MZ1 A;  1EZ9 A;  2XX8 A;  3PV0 E;  3O28 A;  4LA9 A;  1Z7M E;  3H4Z A;  5LOM A;  3K6X A;  5ICQ A;  1NNT A;  3TEP A;  3K1N A;  5H8F A;  4MLQ A;  5L9M A;  4R72 A;  3Q26 A;  1LLS A;  1LFG A;  2W7Y A;  5KCJ A;  1DSN A;  3HHG A;  1PB9 A;  1R6Z A;  4XKR A;  1I69 A;  3OEK A;  4I62 A;  3TUS A;  3K6W A;  3KSJ A;  3QAX A;  1POY 1;  3C9H A;  2HFB A;  1R1N A;  3UGW A;  1NNF A;  2HAV A;  3HCQ A;  4H67 A;  4LQ5 A;  4OHN A;  2AIX A;  3OEM A;  2F7B A;  1N7X A;  5DT6 A;  2AYS A;  5ITO A;  3MJN A;  3ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...