2UVYA

Structure of pka-pkb chimera complexed with methyl-(4-(9h-purin-6-yl)- benzyl)-amine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B Through Structure-Based Design
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 108
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uvyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uvyA02
4QP7A 3HGKA 3C0HA 4V01A 4RJ5A 5IA1A 5GIPE 4FZFB 4FZ7A 4W9XA 3VQUA 1YXVA 4QTAA 5AA9A 3AD4A 5CVHA 4EH3A 2CNQA 3QAME 2ETKA 4A4OA 4PDYA 5AR3A 3ELJA 2GHLA 1WBSA 3EQPA 4NM5A 2PK9A 3HRBA 3OEFX 3DBEA 4XCUA 3D94A 3WF5A 1OBDA 2GTNA 3R7UA 4O6EA 3BU6A 2PTKA 2W4KA 3QRJA 4K0YA 5JRQA 3NS9A 4WSQA 3QZHA 2HENA 4AF3A 5EI8A 4CV8A 3UVRA 2GNIA 3O71A 3ETAA 1YI3A 3IS5A 3QCQA 4NL0A 4MXOA 3KCKA 1ZMUA 3DU8A 4ITIA 3E93A 2UW5A 3FMEA 2ZVAA 5AR8A 4UMPA 3O23A 4EKLA 1CSNA 2GNFA 4RGJA 4QQ5A 5E9EA 3CGFA 2X0GA 5A4CA 2VZ6A 4HVIA 2XH5A 3GOKA 3HMOA 3MH0A 4L00A 5EFQA 3SRVB 4MHAA 3JVRA 1GIIA 2V22A 4JR3A 2CPKE 3UO4A 2YM8A 4FX3A 1ZMVA 4MBIA 4CMUA 2YERA 1RW8A 4YGAA 2C5XA 3ZUUA 4PMSA 4E4NA 2RIOA 2A4LA 2JKMA 1WFCA 2JEDA 3AC2A 3ACKA 4FKSA 3RGFA 4FTNA 1OL5A 3DGKA 3BHYA 4UB7A 1XH7A 3O51A 2Q0BA 3RHKA 3VC4A 4GK2A 1NXKA 5IEXA 2BZKB 3MPTA 4YZDA 3PZEA 4ACGA 2BALA 3R8PA 3WZEA 3QLFA 4TW9A 3KULA 3O7LB 4LQMA 2C68A 5CX9A 4EK3A 2O8YA 5F4NA 1GIJA 3TEIA 2WO6A 4G1WA 1XBBA 3CSVA 4ONAA 4OBOA 4APCA 2HWOA 2PULA 3O0GA 3VN9A 3QYWA 2CGUA 2QR7A 2XEZA 4RIXB 2ZB1A 1SNUA 3IDPA 4C62A 5DEYA 4AA5A 5EQPA 4E6AA 3QTXA 4NM7A 3PY3A 4HZRA 4ID7A 1M52A 3JXWA 3NUPA 3ATSA 1AD5A 3HMNA 3F2AA 1K3AA 1GZNA 4WIHA 2WEVA 5E90A 5IH5A 2YAAA 5KBRA 1YDRE 2XIKA 3NUSA 2OLCA 3HA8A 3E88A 3NNVA 4EOLA 5BX0A 2OH4A 4UXLA 4CKIA 4BF2A 1Q8TA 4W9WA 4YTIA 1A48A 4AZFA 1FVRA 4Y46A 4FOCA 5HO8A 5C8NA 3FI3A 3A2CA 1OUKA 3UNKA 4CFWA 4X2GA 3Q96A 5BPYA 4WD5A 5KE0A 3NUYA 3A60A 4JS8A 1KOAA 2OJ9A 2VO0A 4M0YA 3RPVA 5LJJA 3BYOA 3SV0A 5J1WA 5C4LA 3LFAA 1FVTA 4IADA 2OIQA 4F1MA 4XHKB 5I9XA 4J71A 1BUHA 4K6ZA 3RPYA 4MVFA 4FTLA 4DA5A 4RJ3A 1M2RA 2VTMA 3FLZA 1QCFA 3ORLA 4OTPA 5AADA 5LVPA 3R9DA 2ITWA 4KIKA 4TYHA 2ZYBA 4ALWA 3LKMA 3SG8A 4L3JA 3EFKA 5HKMA 2VTSA 2J0JA 3ZZWA 3QALE 2O65A 3MY5A 4KSQA 4LI5A 4NM0A 3O8TA 5HBEA 1E9HA 2IVTA 2J0MB 3GENA 5ETIA 3MW1A 5AR5A 1TKIA 4AAAA 3OHTA 3H0ZA 1LP4A 2VNWA 4DBNA 2QODA 3KXMA 4JQEA 3PP1A 1U54B 5TF9A 1SMHA 2BVAA 4AA0A 3F3VA 3GB2A 1WBOA 2GHGA 3HNGA 3DK7A 3QQHA 4XG6A 4EYMA 1M14A 4C4IA 4FSRA 4BDIA 2WU6A 2EXCX 4FV3A 5J7HA 3LCTA 5HE1A 2QU6A 3EIDA 5JRSA 4G31A 5EHLA 2QI8A 4IWOA 2YLFA 5E7RA 2HXLA 3JYAA 5AP0A 2R3IA 2YACA 3U54A 2WEIA 3GCQA 3HL7A 3R71A 4LGDA 2ERZE 3ZFYA 1OB3A 4XV9A 4DEHA 5AUTA 3DXQA 5C26A 2Z2WA 3I60A 3DB6A 4FTMA 4QPAA 2VX0A 3G6HA 3OCBA 5A4QA 3HV3A 1VZOA 4TWNA 5CI7A 2WMBA 3GOPA 4G9CA 5AUZA 3WF7A 2PWLA 3B2TA 4KBCA 2XNPA 4CQGA 5BMSA 4LOQA 4NJDA 2OFVA 3F5XA 4ZTLA 4EUTA 3MTLA 4IAYA 1BI7A 1JPAA 3HDNA 4IZYA 4ZEGA 2E9PA 1GJOA 2G2HA 4JR7A 3ROYA 1J3HA 2ITVA 2I40A 5CY3A 3LFQA 4NT4A 3NNXA 4ASEA 4C0TA 4WUNA 4DITA 4IANA 2VTTA 2Z7QA 4WOVA 3G0FA 3H9OA 3EWHA 3LFBA 1FPUA 4Y5QA 2REIA 2QOFA 4K2RA 5FTGA 5L4QA 4BGQA 4XUFA 3QF9A 4PWNA 3OF0A 4L3LA 4C4FA 3RVGA 1YDSE 3GQIA 2XM8A 3OVVA 3KRWA 5DR6A 4BDEA 4RLKA 1OL1A 3FI2A 4USEA 3L9MA 2PZYA 3F7WA 4UYAA 2G2FA 3QQLA 5KMNA 3GCSA 2BAQA 2LAVA 1AGWA 3UBDA 4DF3A 1QPJA 3UG2A 2H9VA 3QHRA 4Y95A 3D15A 1XH6A 4EH5A 2VGOA 2FSTX 3L9NA 3HMMA 4FVRA 3V6RA 3D7TB 2BKKA 3LFDA 4FZ6A 3TG1A 2RFSA 2WD1A 3NW7A 1UU7A 4LMNA 3UIXA 2F49A 1HCLA 4U6RA 3MVHA 5AJQA 3F2NA 4EK4A 3QD4A 3NWWA 3OBGA 2ZV2A 3P23A 4GEOA 2OXYA 5CAQA 2XYUA 1Z57A 4O22A 4IM2A 4PL3A 2NO3A 2XNNA 3OWLA 1GOLA 3I6WA 2E9VA 3GCVA 3K5UA 2PUNA 1K2PA 4FNXA 3KXXA 1Q3WA 4R1YA 1YI4A 5KO1A 3AMAA 3F66A 3FYJX 3E8CA 3NEWA 2WTKC 1MRYA 4FTQA 1IAHA 5DT3A 3N51A 1H1QA 4RVKA 1ZYDA 4UWCA 3RK5A 2OH0E 2JBPA 1ZWSA 3G9NA 5GJFA 3RI1A 2XEYA 2KULA 5DBXA 4QMOA 2XIZA 5J9YA 4YZNA 3U4WA 5K5XA 3FL5A 3RPSA 3ZYAA 3PVBA 1SNXA 2UZUE 4J1RA 5IQGA 2XKFA 3QKKA 2F2UA 2BFXA 3UOJA 5CNNA 2XK7A 4PPBA 3KKVA 4YZMA 5EW3A 3VNTA 3VS4A 4IB1A 1UU8A 4O0VA 3TNWA 3ORZA 2BDJA 5EW8A 3TIZA 3LCKA 5IG1A 4YJUA 4JAJA 4IFCA 3ORPA 4R7HA 5TT7A 4IB5A 4MNEA 3GUBA 4IAFA 4UXQA 4E8AA 1E1XA 3IW6A 4MXCA 3MVJA 5EYDA 4PV0A 4WO5A 5EYMA 4BC6A 2OF2A 2JDVA 2ZMCA 4B9DA 3TNPC 2BR1A 5IKWA 4LGGA 3WOWA 4DLJA 2R0UA 2QVSE 1ZLTA 2YM5A 4X7QA 4ZP5A 4N4SA 4ITHA 4DEAA 4Z55A 2V7OA 4E1ZA 2C5YA 1JSVA 3FKNA 4S2ZA 3KMUA 3R2YA 2P3GX 4M69A 5AV0A 2J0LA 4H3QA 3IW8A 5KNJA 4QMVA 2ZB0A 1MRVA 4KIQA 2XBAA 4WBBB 4ZTNA 4HGEA 4E6CA 3D5VA 4EORA 2WTDA 2X8EA 3FZRA 5ANDA 3SXRA 1Q8WA 3EQFA 4D55A 3PIYA 5HLPA 2ZV7A 4F65A 4XG4A 3QGWA 3VBVA 4ZLOA 4B8LA 4F9WA 4DCEA 3FWQA 2J5FA 3BI6A 5JGDA 4Z3VA 3ATTA 3IDBA 3R28A 4G17A 4L42A 5IMEA 4L3PA 3V5WA 1J1CA 3ZC6A 2XCHA 4FG7A 4LL0A 1OPKA 2A2AA 3HRFA 3R7YA 4DTKA 3BHVA 4RWIA 2C69A 3ULIA 4HGTA 4NIFB 3EYGA 3I4BA 4S31A 4C3FA 5CF6A 4EJ7A 3PLAE 4KKEA 3VHKA 3PSBA 3TKUA 4O1PA 2XK6A 4R1VA 2J9MA 4EEVA 4IIRA 4GYGA 4AW2A 2RFDA 2WKMA 5LWMA 4DLIA 1OMWA 3BE2A 3ZLYA 3ZBFA 5BVDA 5CS6A 3ZM4A 2GNLA 3V51A 2C5VA 3U6HA 1R3CA 5LVOA 4QPSA 4IQ6A 4MXXA 3C7QA 2X81A 3OCSA 3OTVA 2CLQA 5HG8A 3PPKA 2VUWA 4DH7A 4F63A 3F2RA 3AC8A 4X3FB 1JBPE 4YHJA 3FPQA 1L8TA 4M8TA 3OT8A 4P90A 3QYZA 2AC3A 3R73A 4JRVA 3PA4A 4BCPA 2O3PA 4OTHA 4WNOA 5EW9A 4TN6A 1BMKA 3PYYA 5HORA 1CKPA 4MQ1A 3FMHA 4FV5A 3WZDA 3CJFA 3OCGA 4H3PA 3E63A 2YDIA 3BU5A 4PQNA 4QYGA 4S34A 4QMWA 4FT7A 4FYOA 2A0CX 3GU4A 4L01A 5IUHA 5AP3A 3QZGA 1MQBA 4IWQA 4KIKB 4G6NA 4PTGA 4R5YA 3R30A 4ZZMA 3HV4A 5FGKA 2XKCA 4ZAUA 3U55A 4U9AA 2OIBA 1FOTA 4ALVA 4E4MA 4EOIA 3C5IA 2R3GA 4MD8E 3OS3A 4F0GA 1H24A 3EQRA 2Z7LA 4JNWA 4PDOA 4Q5EA 5CU3A 2UUEA 4GT4A 5HESA 5LXMA 4GG5A 3B8RA 2XNOA 3SGCA 4LOPA 5AP6A 2QOOA 2HOGA 4ENYA 4EH8A 4O7YA 5CT0A 2FO0A 5CU2A 1URWA 3ITZA 3UYTA 2ZDUA 4E26A 2WMQA 3B2WA 4QD6A 3II5A 5ACKA 1OITA 2JDRA 5AIKA 4D28A 4PPAA 1H08A 4BZDA 4ZTRA 2CLXA 1WVXA 2Y6MA 3NR9A 4ANMA 5CU0A 3GVUA 2PU8A 4EWHA 4BDBA 5FEQA 3F3ZA 4PPCA 2Z60A 1ZARA 4O7WA 4DT8A 1ZOGA 1V1KA 4D0XA 1OIRA 4EZ5A 3QTQA 1KV1A 1S9IA 4NM3A 2J50A 4AFJA 3CPCA 3PVWA 4YR8A 2O63A 4KKGA 3P86A 5CWZA 3R6XA 3EQIA 2RF9A 3FBVA 5HG7A 3TV6A 5LVMA 2WTVA 2VWYA 5E8VA 2R3HA 3DOGA 3CP9A 5A54A 4O0RA 3ZM9A 3QUPA 1GZOA 4D2RA 4WHZA 2WOTA 1KE7A 3QFVA 1H26A 4YNOA 3BIZA 2O64A 3DK3A 3HVCA 1NA7A 3S0OA 4D1SA 1IAJA 2ZAZA 2YFXA 4NEUA 5IA0A 5ANOA 4OT5A 4XG3A 2GPHA 4FV8A 5FBOA 1OKVA 2W1FA 2H96A 3MVMA 2HZ4A 4W4YA 2XK4A 4ZTHA 3Q9WA 4NKSA 4AW0A 3DTWA 4EHEA 4BY9E 3A4PA 5L3AA 5A9UA 4UZHA 5AX9A 1PXLA 3GU7A 3QTSA 4O0YA 5IMXA 3CY2A 3KXNA 3OOGA 4QP3A 5H8EA 3RAKA 1H00A 4BI1A 4F7SA 5M4FA 2XKEA 2YIRA 1ZZLA 2GS6A 3Q32A 2RL5A 5GJDA 3U51A 3C50A 3VS2A 5BVKA 3E92A 4EH2A 4YLJA 3SQQA 4ACCA 4AX8A 4II5A 4IDVA 1BKXA 2B9HA 3BHHA 3IONA 5AIRA 1IASA 1VYWA 4YMJA 1RDQE 4RA5A 4DH3A 3D7ZA 4I20A 5E8ZA 4CFXA 4EOOA 5CSVA 3W1FA 2JKQA 4M84A 4QT1A 5JFSA 3EQHA 4FKWA 2Y4IB 4QOXA 2UZOA 4AUAA 4XOZA 4D1XA 2WGJA 4QYFA 5HD4A 3M1SA 1JKTA 2PMNX 4Z9LA 2B52A 5FQDC 1OGUA 5AUUA 4ZMEA 3I0QA 3HLLA 1YW2A 3BGZA 3P7CA 4NWMA 4RIXA 4V0GB 4WRSA 3U9NA 4F6SA 4QNYA 3K3JA 1Y6AA 3R7EA 2PYWA 2XM9A 4A9RA 4O2ZA 3DZQA 4QPMA 5CLPA 4W8DA 5AP5A 4ENXA 1F3MC 5GHVA 5FDPA 3G51A 5AV3A 3V5PA 4RJ7A 2BZJA 3NRMA 2PZIA 3PSCA 3VAPA 3BBWA 3M11A 3UOKA 4KUJA 3OWJA 2WU7A 3TV7A 4X21A 3CLYA 4HVDA 3ZC5A 5FWKK 5J5SA 4ANNA 4EZ3A 3ZDUA 3IKAA 5E8SA 1OKZA 1PHKA 4IAKA 4Q9SA 5HQ0A 2DQ7X 2GS7A 3LFFA 4EQCA 3WBLA 4GS6A 4O7LA 4FVQA 4N6ZA 4BDAA 2HZNA 4OW8A 5LCKA 3CR0A 4WG4A 5HVJA 2IZRA 4MF0A 5E1EA 3UE4A 2PHKA 5L6OA 3FE3A 2PMOX 3BYUA 4EK6A 3ANQA 4E5AX 4OAUC 1ZZ2A 2O2UA 1UNGA 2F7XE 3K2LA 1QMZA 5G6VA 5ANIA 2R4BA 1R1WA 3GI3A 4O91A 3QXOA 2X7FA 3NYNA 3HX4A 2QHMA 3JUHA 4DBXA 3IGOA 5I9ZA 3IOKA 2OI4X 4M14A 1S9JA 2HIWA 3CS9A 4F1TA 3VUIA 4CT2A 4DFUA 3OXIA 4BGGA 3R9HA 4S33A 4BVUA 5CEOA 4IC7A 2WXVA 3R8MA 3Q5ZA 5T6KA 5JQ8A 1U54A 3AGMA 3PXFA 4O83A 1H1PA 2R3FA 2R3LA 3MH3A 4JBQA 3HP2A 4U41A 1SVGA 4F9AA 3ZH8A 3DA6A 5IA5A 3ZO1A 3A7IA 5HNIX 4X2JA 2JLDA 3ANRA 4J95A 3FLQA 3L8VA 4F6WA 2UW9A 4QMSA 4OLIA 3AOXA 1G8AA 4DFXE 5IDPA 4LG4A 1YOJA 2OZOA 5HG9A 4GL9A 1LPUA 1Q62A 3NVKI 3V3VA 1KOBA 2ETMA 5BVOA 3DBDA 3PY1A 1X8BA 5AP4A 2WQOA 3A8WA 1OZ1A 4CFUA 5L8KA 5IDNA 4D2VA 2O0UA 4YC8A 3LCDA 1LR4A 4O81A 1FVVA 4F09A 4JX7A 1XBCA 4GVAA 3UNJA 5BVNA 4R77A 3TT0A 5LVNA 4RSSA 1ZOHA 2UZVA 4F7JA 3G15A 2JIVA 2P55A 1DI9A 2X1NA 2XBJA 3OBJA 1PXIA 4GJ3A 2VN9A 3U4UA 5I9VA 3MPAA 3KRLA 3MV5A 5GJGA 3RPRA 3QRTA 4CG9A 2OJJA 4TYIA 3UNZA 4CNHA 2VWUA 2DYLA 4QMYA 3DKCA 4MD7E 5M08A 2W99B 3EFJA 2F9GA 5CQUA 3F69A 3D2KA 3LM0A 2WNTA 5KKRB 4YPDA 3U87A 4RLLA 3GC9A 4HNIA 4X3FC 2ITTA 4AE9A 3FZOA 3DJ5A 4MTAA 3QL8A 3WF9A 4OBQA 3ZOSA 4EOKA 5L2TA 2HW7A 3VBQA 3WIKA 4N70A 2X2KA 3KQ7A 4J53A 4XMOA 5FEDA 3LMIA 4GCJA 5EI6A 1RE8A 4K18A 3LLTA 4TYGA 3RHXA 2GQGA 4ZY6A 1CDKA 1YXTA 4YSJA 4LGHA 4FG8A 2ETRA 1FGKA 3U8WA 5CZHA 3UPXA 2A27A 3FMKA 3MIYA 4MBLA 2XJ0A 5HCXA 4KWPA 3MGYA 3CD8A 3D7TA 4IFGA 3HEGA 4ANBA 5D10A 1GAGA 2QO9A 4DEEA 2EU9A 2AUHA 3RWPA 5JGBA 3DXNA 2QURA 5C03A 3ZLXA 1VJYA 2FSLX 4FTRA 3ORTA 4I0SA 3NUXA 4RJ6A 1M2QA 1OKYA 4HYIA 1U4DA 2RFEA 4EH4A 2QOCA 5HD7A 2W06A 4BICA 4OTQA 4G2FA 1WCCA 4ZSEA 4AN9A 4AFEA 4EONA 4AOIA 4DG0E 3PJ8A 3BKBA 3C4CA 2FH9A 2PVHA 4KS8A 3EFLA 3O17A 4V05A 2GSFA 5CEPA 1MUOA 3D2IA 3OY3A 2C0TA 3WI6A 1JNKA 3POZA 3AT3A 4X2NA 4BYIA 4C4HA 3UMXA 4TKSA 4O7TA 3AC3A 1CTPE 2OBJA 2W1DA 3QGYA 3VVHA 2XF0A 5H8GA 4I21A 3T8OA 2PUUA 4UMRA 4L52A 4O21A 1WBVA 4FV9A 5CSXA 5ETAA 3W32A 2UW6A 2FGIA 5AWMA 5DH3A 5HOAA 4GSBA 4E5BA 4C7TA 3WF6A 4D1ZA 3ZSGA 4D2WA 4FR4A 2H34A 3LOKA 3Q4UA 4QMQA 2C0IA 3DB8A 3FPMA 4ZTQA 4XBUA 2EWAA 2JDOA 2CGWA 3CQWA 1H01A 3F3WA 3HMPA 4J7BA 4YTHA 5H3QA 5KZIA 1OL7A 4DFNA 3I7CA 3SDJA 1YVJA 3MTFA 3WZKA 4ZZOA 3OC1A 4CLIA 3PJ3A 3U6IA 2HELA 4IZ5A 2IVUA 3AT4A 3QWKA 3R63A 4FKGA 4IDTA 4QMZA 5L2QA 5HTCA 4ZZNA 2E9OA 3IW4A 3FMLA 4OTGA 4OAVB 5HICA 3OWPA 1W0XC 1XH4A 4AGWA 3NGAA 3W2OA 5ANEA 2IWIA 5E8TA 2XCKA 4BIBA 3DT1A 3ZZEA 2PVRA 2XNEA 1R78A 2WAJA 4M97A 3E64A 5CI6A 3P7AA 5BNJA 4OR5A 4KRCA 3W8LA 3U6JA 5M4UA 2CNUA 3PIZA 2PUIA 3Q52A 3FLYA 1LUFA 1YWRA 2QR8A 3ZEPA 2VWVA 1BYGA 2YM4A 5I9WA 5KMMA 5F20A 4R3PA 3FQHA 4RMZA 3RJCA 4A4LA 2GNJA 3LJ1A 4FOBA 3DKGA 2C3IB 2YJSA 4DFYA 4I3ZA 3RCJA 4BDFA 1WMKA 3MH2A 4YC6A 5JGAA 1APME 3R8UA 4RA4A 4U79A 3ORXA 3RTPA 3FJQE 3W2QA 3LIJA 4A06A 3COKA 3Q4TA 3DBFA 4IW0A 1XH5A 1UKHA 3T3UA 5D7AA 4U80A 3S4QA 4X3JA 1ZAOA 4ACMA 4ACDA 1YRPA 4ASXA 3IG7A 4BTMA 2WOUA 4JAIA 4FV1A 1SVHA 5J9LA 4ACHA 2EXEA 2P33A 1TVOA 1ZMWA 2I6LA 4NIFA 3VF9A 2W9FB 4C61A 4BI2A 4YUQA 3DLSA 2PSQA 2VTIA 5BQ0A 4WG3A 1YI6A 4G3EA 1XHAA 5I3RA 3PTGA 2Y4IC 3CEKA 4A9UA 1KE9A 2QNJA 2X9EA 3VUKA 4FIIA 4C8BA 4FKUA 3MFUA 2BHHA 5TOZA 4D0WA 2X4ZA 4PP7A 3KL8A 2HZIA 3FI8A 5FP5A 4MEDA 2BIKB 2WMUA 3SOCA 3NNWA 3D9VA 3ZU7A 4ERKA 1IA8A 5IA4A 4L68A 3A7HA 3NIEA 4JOAA 2IZUA 2XVDA 3N9XA 5HLNA 1RJBA 4RJ8A 3R04A 4RIWB 4X3FA 3QA8A 3KXZA 4RIOA 4G3GA 2UZBA 3BELA 3CXWA 4OTRA 2W1CA 4RZWA 5CNOA 5CEQA 4F9BA 5L2WA 1J1BA 3G2FA 4CXAA 2GNGA 3WILA 4KB8A 4FTKA 2OFUA 2XZSA 4F7NA 4ZXTA 4AGCA 2BUJA 1PYXA 5ETCA 2UZWE 5D41A 4C3PA 3KCFA 5H9BA 4BWKA 3VHEA 4A9TA 5K0XA 1DAYA 5KMLA 4CVAA 2OZAB 2YHVA 3JY0A 4M66A 1SYKA 3KRJA 2YM7A 4MXAA 2ZM1A 5CXHA 4XG2A 3R7IA 4U44A 1L3RE 5BUJA 4YBKA 3LPBA 4ZS4A 1U46A 4FK3A 3E3BX 3NW5A 4E6DA 1REJA 4Y72A 1P4OA 1GZKA 1A9UA 4R78A 2G1TA 3A4OX 3OMVA 2VX3A 2NPQA 3ENHA 3HV7A 2FUMA 2X2MA 2DWBA 3NIZA 5AA8A 5HIEA 4RQKA 1Q5KA 1ND4A 3MB7A 4FV4A 4CT1A 4IB3A 3QD0A 4DGOA 5EM7A 5C01A 4C33A 4S32A 4FSNA 1W82A 2UV2A 3W18A 4RZVA 5IQCA 3PE2A 4IZAA 4KABA 4DFZE 5A6OA 5JN2A 4O7ZA 2B9IA 5F94A 2E2BA 4FKOA 4GK3A 3SHEA 2B54A 4BTKA 3QCSA 3Q5IA 4QP1A 4PP9A 4JQ8A 3VRYA 3OP5A 4O7RA 1FQ1B 1PMNA 1LEZA 5AP2A 5HNGA 4ORKA 4D9TA 5CANA 4EH7A 2B7AA 3NUAA 3IGGA 4FEUA 2C30A 1PYEA 2YABA 2PVLA 1Q8ZA 4IX5A 3A7GA 1O6LA 2CN5A 3PZHA 5AX3A 3FC2A 4L53A 5BVWA 5K4IA 4M3QA 3C51A 3PJCA 2DUVA 3NNUA 1H8FA 4U8ZA 2J6MA 4MAOA 4GFMA 3TZ7A 4E7WA 4EBVA 5K5NA 1LEWA 3OW3A 4TYEA 3KY2A 3BYVA 3OUNB 2VTPA 3Q6WA 5D7VA 5L2SA 3NUNA 5DVRA 2B4SB 1YOMA 4YTFA 4YJSA 3AXWA 3E87A 3KK9A 3V6SA 3VO3A 4C3RA 3TN8A 4IC8A 2FA2A 3CTQA 4OUCA 3UGCA 2R3JA 2JAMA 4R7BA 5DI1A 3FLSA 4K33A 3OEZA 1BL6A 2W5AA 2W1EA 5JT2A 2PZPA 3COIA 4AQCA 3QUEA 4JQ7A 5KUPA 3B8QA 4Q9ZA 1UU3A 3EQBA 5A6NA 4U0IA 4FT0A 3R01A 2ESMA 4H36A 4YP8A 5K0KA 3BWFA 3TJDA 1K9AA 1OIYA 2C6IA 3SOAA 4R8QA 2YAKA 4AOJA 5KKRC 4ZSGA 2ZV8A 4BRXA 1P2AA 2RG6A 2WFYA 3NYXA 2JD5A 3NMUF 2JDTA 4FKQA 4XG9A 5EDRA 5AAGA 4ZMFA 5C4KA 4K1BA 2OXXA 4DH8A 2C6EA 2ITNA 4GV1A 5EM5A 1EH4A 1UNLA 4GYIA 2ITOA 3NW6A 5EI2A 3OROA 1KV2A 3EZVA 3QQGA 4FTIA 4ZTMA 3DXPA 3KVXA 3PXQA 5E92A 3R9RA 4C37A 3PY0A 3DBQA 1PKGA 4O0SA 4WNMA 3VS7A 2GTMA 1O6KA 4I6HA 5AR2A 3RNIA 4YPSA 3Q9YA 1SVEA 4FIFA 4I0RA 4C59A 1PRYA 1KE5A 5J95A 5GZ9A 4UN0C 3O2MA 4EL9A 4P2KA 2C5NA 4GT3A 2OU7A 4FC0A 1YXSA 4DEBA 2QKRA 4V0GA 3HUBA 4LRMA 4YJQA 3TKIA 3UQCA 1B6CB 4RVMA 3JY9A 4ASDA 5C9CA 2B0QA 5GINE 4Y8DA 3KXHA 1PMVA 4RC4A 4F0IA 1Y8YA 3C4ZA 3R21A 2UVYA 2BDWA 5FLFA 3GU8A 4X6QC 2XKDA 3UP2A 1ZY4A 4DH1A 4O7SA 2OJFE 3SA0A 4TWPA 5HE0A 3KGAA 3MWUA 5M56A 3DKFA 1H0WA 3F61A 5B0XA 4JBOA 4ZOGA 3NYOA 4RX5A 4HNFA 1Y6BA 4JG8A 1OIQA 4YHTA 5DR2A 5FXSA 5DLSA 5HTIA 3ROCA 5BYYA 2JFLA 4ARKA 3TZMA 3V8TA 4FKPA 5CSHA 4D2TA 3CBLA 3Q04A 2VRXA 2V0DA 3QC4A 3R8LA 2EVAA 4XLIA 2ITUA 3R7GA 2YA9A 4Q5HA 4I5MA 4F6UA 2ONLA 3FHIA 2NRUA 2OJGA 3QTRA 3Q60A 4FG9A 4UALA 4YZBA 5AAEA 5F95A 3TUDA 3QD3A 4BDGA 2ZOQA 4I1ZA 3ET7A 5GNKA 1J7UA 1PW2A 5FEEA 5ACBC 2PPQA 3CIKA 4YO4A 5TE0A 4L44A 1Q41A 1YXXA 4G16A 4ERWA 4DN5A 3DDPA 3MA6A 4B4LA 5HX8A 3PJ2A 3GGFA 3F88A 3QUDA 2C0OA 3G9LX 4K11A 5BVFA 3PA3A 3TL8A 4LYNA 1P14A 4J8NA 4GH2A 2UW0A 3QRIA 3LXNA 3TV4A 4PRJA 4FF8A 4R6VA 2G01A 2XNBA 5I9YA 2KTYA 3W2SA 4C2WA 4L8MA 2CGVA 4MH7A 1XR1A 4AT3A 3TDVA 2YN8A 4KBKA 4KS7A 4WNPA 2YZLA 4GKIA 2W17A 4IVCA 1UU9A 3JR1A 4BIDA 1R39A 4PUZA 4Z7HA 3DQXA 4FIHA 3ODYX 2FSOX 3I1AA 3QC9A 4EQMA 4EOSA 4TRLA 2UZTA 4P7EA 5CVFA 5M55A 4AZSA 5JFVA 2WTJA 3KXGA 5EM6A 1OI9A 5IQHA 5LVLA 4AW5A 1B38A 2QOIA 2PE2A 1U5RA 2R0IA 1U5QA 3QTIA 2VTQA 4AT5A 4NYEA 4C58A 2Z02A 4WG5A 4AS0A 3GCPA 3R1SA 4ZJIA 1BX6A 3V01A 4JVGA 5L6PA 3FV8A 3LAUA 4QYHA 4FZDB 2R3OA 5CEMA 1I44A 4UMQA 4DE4A 3HP5A 4B99A 5BUEA 3M42A 2WTIA 1PXNA 4FL3A 2YDJA 1IG1A 5C1QB 2YIYA 4RX7A 1PXOA 4H1MA 3A8XA 3ZRMA 2IZTA 4JIAA 3SKCA 3VBTA 4NK9A 4R7IA 4P4CA 4ZLYA 4FGBA 3V8SA 2XJ1A 4BKYA 1G8SA 4LUDA 5B2MA 4ANSA 2ZM4A 3OFMA 1WBPA 2P2HA 3W16A 3DAEA 3IW5A 5TO8A 5KMJA 3PG1A 5CASA 2I0YA 4GIHA 2HWPA 5FRIA 3ZSHA 3DKOA 4XRJA 3UIBA 4NTSA 4XG7A 5CXZA 4TZRA 2UZLA 2JKKA 5FP6A 3ZLWA 4FSTA 1PMEA 5K9IA 5HGIA 2GS2A 4GRBA 2YIWA 3RCDA 4DG2E 2VTNA 3D14A 5AAFA 5IQEA 2FB8A 2C6OA 4OGRA 1ZRZA 5JZNA 1J7IA 5DRBA 4CYJA 4Y85A 4J8MA 2G2IA 3R0TA 2WELA 2PVYA 5BYZA 3H10A 1YQJA 3COHA 3HUCA 3O50A 4RX9A 4PL5A 4KNBA 3HA6A 5K3YA 3SX9A 4QMPA 4GKHA 1KWPA 1KUTA 3ZONA 1YXUA 1MP8A 2CHLA 1ZY5A 4FUXA 2HXQA 2QOKA 2Y7JA 4IAAA 3CE3A 3DJ6A 1OL6A 3ORIA 4E5WA 4L43A 3IDCA 5AUWA 5C8KA 2XIXA 3LHJA 2QKWB 1O9UA 3DBCA 4HVSA 5HU9A 2EUFB 2VTAA 5LOHA 5AM6A 3C13A 3EQCA 3IK3A 4L7SA 5KBQA 1CM8A 2XIRA 5E1SA 4IJPA 2WQBA 3VUTA 3VULA 4DEGA 4JG6A 4CLJA 4AGDA 3ERKA 5JFXA 4BKZA 4D4YA 3L1SA 1QPDA 4RPVA 4UWBA 3P0MA 3BRBA 3F7ZA 4O7NA 3NVMB 1M2PA 5ANKA 3DZOA 2VU3A 1W8CA 4LFIA 3MFTA 3FXWA 3O96A 5DMZA 5I4NA 5IISA 5IU2A 4FICA 4YJRA 1VYZA 4IH8A 3D83A 3L9PA 2YCSA 2IW9A 3GFWA 3FZPA 1XQZA 3C5UA 1PMUA 4FBXA 4QQCA 2F2CB 2X6DA 4BB4A 4FGRA 3BGPA 4QTCA 4YJTA 3TCPA 1CKIA 2G15A 3IECA 4O82A 3UZRA 5B2KA 2YITA 3P7BA 4FTJA 3D0EA 4Y73A 4DYMA 2XK3A 2WQNA 1CKJA 4BCKA 5KCVA 1REKA 4MX9A 4YO6A 3Q9XA 3VS3A 2CSNA 2O5KA 2AYPA 3BLQA 1WBNA 4MK0A 1YOLA 3BPRA 2R5TA 2BHEA 2QC6A 3EB0A 3KEXA 3PVUA 2HAKA 1FMKA 1NVSA 3CC6A 4YLLA 2R3NA 1JSTA 2BRBA 4UY9A 3NX8A 4PY1A 3MYGA 3LCOA 4GK4A 4UV0A 4EKKA 4CGAA 2B53A 1J7LA 5DE2A 2UW4A 4KSPA 4QMTA 4NUSA 4N0SA 3ORKA 4CRLA 1FMOE 2BZIB 3ALNA 4FNYA 3PJ1A 5HE2A 1H07A 1R0PA 5CENA 5CEKA 4JDKA 4DEDA 3E8DA 3GQLA 3R8VA 4CQEA 5HX6A 2JKOA 4USDA 5EDPA 1W84A 5F1ZA 3TXOA 2GFCA 4A9YA 2OW3A 4L45A 3H9FA 4FIJA 4BBEA 2BTSA 2QOHA 3HV5A 3NCZA 4C57A 3PVGA 3QRUA 3KRXA 4N6YA 4EC9A 1JKSA 2VNYA 3UVQA 3F6XA 4I6FA 3KA0A 5E8WA 4RIWA 2UW3A 2BROA 3I6UA 1OL2A 4U3YA 3FXZA 3F5PA 4BHNA 5I5ZA 4U45A 2XJ2A 4NW6A 5D11A 3UG1A 2CMWA 2GFSA 4FTUA 5JZJA 3VUGA 2ITYA 5DT4A 1OM1A 1DS5A 5GIOE 1NVRA 2WTWA 4C36A 3SXFA 2W0JA 3HV6A 2J2IB 3LVPA 3OOMA 4XEYA 2QG7A 2QO7A 4LRKA 4MXZA 1UVRA 4EOJA 2XK8A 2XK9A 3OT3A 4IHPA 1YDTE 4RIYB 3LW0A 3FLNC 2OZAA 4X2FA 5CF4A 3ZXZA 4HVGA 3KRRA 4C4JA 2W5HA 3ZHPC 5DT0A 3V8WA 3FXXA 4FSUA 4BCFA 3DFCB 3RBWA 3FAAA 3I0OA 4L6QA 3TZ9A 1Z9XA 1F0QA 5LMBA 4JRNA 5DHJA 3VBWA 3V5TA 4FT5A 2BMCA 2XRUA 2WMAA 5GZAA 4QP4A 2W7XA 5IH4A 1G3NA 3PXRA 4KKHA 4G5PA 4QP8A 3UPZA 4YJOA 5C8MA 4CTBA 5M53A 2R2PA 5HHWA 4FEQA 2R3PA 5BUIA 4UMTA 4FT3A 4RC3A 2JC6A 2OSCA 3RNYA 4BWXA 1U59A 2BRMA 2HK5A 5CVGA 4ZSLA 4BCMA 3SVVA 3EQDA 5AUYA 4D2PA 3EH9A 3R7VA 3E7OA 4IX3A 2W4OA 5M4IA 2WMRA 3OWKA 2PL0A 4UBAA 1JKKA 4JG7A 4YJNA 3PE1A 3EL8A 1DI8A 3AG9A 3MBLA 4KD1A 5JH6A 4XX9A 2QOLA 1IA9A 3EOCA 5BYLA 4O0WA 4U3ZA 1H25A 4FTTA 4JXFA 3Q2MA 4IX4A 3V5LA 3ALOA 3FMDA 3FMNA 4V04A 1VR2A 3OZ6A 3KREA 3F5GA 1Y57A 4UYNA 3EN9A 3NAXA 4FSZA 3UVPA 3GEQA 3WF8A 3S95A 2JDSA 4FI1A 4I5CA 4NH1A 4CCUA 5IUGA 3GNIB 3QCXA 4GG7A 3F82A 3NDMA 4K77A 2C6MA 4XP0A 4XV3A 4AOTA 4QTEA 4FKTA 4IVDA 3PP0A 5LCJA 2XRWA 3QX2A 2PUPA 3F9NA 4JT3A 4BCIA 2UZNA 4XJ0A 3CD3A 4BR3A 4EJNA 2VWXA 5FM2A 2V62A 4NKAA 3UTOA 4UX9A 3QZFA 3HMIA 3QKLA 5I3OA 1Q99A 4EH6A 2F57A 4QMXA 4FMQA 4CFNA 4QYEA 4D4SA 2CCHA 2P4IA 4BZNA 4GFGA 4XH6A 2J51A 3S2PA 2W9ZB 4U5JA 1XH9A 3G33A 1Y8GA 3UDBA 4B8MA 4QQJA 3SG9A 1OBGA 5EHOA 4O1OA 3PPJA 3FEGA 2QG5A 5FBNC 2W5BA 2Z8CA 4O38A 5FTQA 3PXYA 5IUIA 3L8PA 1WVYA 5JKGA 4FTOA 2G9XA 3C4EA 4JI9A 3ZEWA 3BV2A 3L9LA 3FQSA 1Q4LA 3FKOA 4QQTA 4G9RA 2XIYA 5J87A 5FTOA 3CGOA 4RFMA 2JAVA 5M09A 3AD6A 1WBWA 5EH0A 2UZEA 3WARA 4BBFA 4TNBA 4TYJA 3CTHA 4BDKA 5E8XA 3RAHA 1E1VA 3NZ0A 4DGLC 4ANQA 3UJGA 4E6QA 4E4XA 4O0UA 3T9TA 4BCNA 4FK6A 4I4EA 5IEYA 4CZTA 3FHRA 4G5JA 4YU2A 4CTCA 2QCSA 2XUUA 3ULZA 2X9FA 4YLKA 1TQIA 4CD0A 4C4EA 3MESA 4XLVA 3UQFA 3FDNA 3H4JA 3LXKA 4IE9A 4JLCA 3TTJA 5FXRA 3BYSA 5EK7A 3SC1A 1KE6A 2QLQA 5IPJA 5J9ZA 3V5JA 3WZUA 1NVQA 2W96B 4D4VA 3NSZA 5E4HA 4XP3A 4UMUA 1YHSA 3IOPA 4FKJA 4PNKA 2IG7A 5HTBA 2UW8A 2WQMA 3VBXA 2QOBA 2HW6A 2ZV9A 3OTUA 3ZCLA 4JBPA 3QKMA 5DPVA 1PJKA 2BPMA 3MY0A 3OUKA 5CZIA 4CCBA 3LFEA 3JS2A 5B2LA 5CF8A 4L67A 2ERKA 2CKEA 4QRCA 4QTBA 3CQEA 4NSTA 4BZOA 4HCUA 4MWIA 4QMLA 4YJVA 3ZS5A 2EB3A 2HCKA 2W1HA 3GU6A 4CG8A 2J4ZA 4XNEA 4FNZA 4XP2A 2BRHA 3CTJA 4I6QA 3BE9A 5AP7A 3VF8A 3F5UA 3RK7A 2QO2A 4RFYA 5AV1A 2V7AA 1ERKA 3EN6A 1WAKA 1F5QA 4RWKA 2FSMX 3QTZA 2Z7SA 5E8UA 2HY0A 3VS0A 4DFLA 4BDJA 4ZJJA 3AC5A 3RAWA 4BGHA 4EHGA 1YWVA 5AV2A 4I4FA 4JBVA 4XV1A 3EN5A 5F9EA 2F7ZE 2WMTA 3AT2A 4JDHA 4LL5A 4PTEA 5CT7A 3TUBA 1M17A 2J7TA 4E73A 4XOYA 3C4FA 3FKLA 3MPMA 3QQKA 3R02A 3UZTA 1UWHA 4NW5A 2P0CA 3E8EA 4PMMA 2X8IA 3OXZA 3A7FA 4BDDA 5KMOA 2IVSA 2X7OA 5TR6A 3O8UA 3ZBXA 2RFNA 4F9CA 4IMYA 2ITXA 2I1MA 4MNFA 2C5OA 3UO6A 4DC2A 3QD2B 2QQ7A 3QLGA 2WMVA 3JVSA 2W1IA 5DGZA 4HPTE 4WNKA 2I0EA 2JFMA 1QL6A 3LXLA 5EHYA 3FI4A 3VS6A 3TNIA 3A62A 3PFQA 4WSYA 3O8PA 1B39A 4NTTA 4DH5A 1TQMA 3PWYA 4FV7A 2GU8A 5KZ0A 2BKZA 4EUUA 1M7NA 2GQRA 4O84A 4CKJA 4AU8A 3WYXA 4FIEA 4APPA 4CMTA 2XA4A 3BLRA 4HJOA 4IWPA 3AD5A 1ZYJA 4KA3A 3ZUVA 4BTJA 3VWAA 4DTAA 1Q61A 4BHZA 2GMXA 2RG5A 3BQCA 4EOPA 4E3CA 2PY3A 3BLHA 3ACJA 3G6GA 3OW4A 3TTIA 4QMMA 3LXPA 5CAVA 3LJ0A 4L9IA 3MS9A 2AC5A 2PVKA 3QQFA 3KFAA 3HDMA 3KMMA 5D12A 3C0IA 1XJDA 5DYJA 1P5EA 3R8ZA 2YWPA 4EQUA 3AMYA 4J96A 2VV9A 3VIDA 4FTCA 4CZYB 3N4VA 3C0GA 4G3CA 2VO3A 2UW7A 3CCNA 3MFRA 3I79A 2XMYA 3PXKA 4FVPA 5A4LA 3T3VA 5AUVA 2JITA 3P08A 2PE0A 2LGCA 2ONLC 3BEAA 3U9CA 1H28A 4WRGA 5KX8A 3SW7A 4BCJA 3S00A 2QU5A 3TKHA 5HO7A 4BCGA 2YM3A 4JL9A 5M07A 1UA2A 3PIXA 5EYCA 5HI2A 3GXLA 3MY1A 3BX5A 3K5VA 4MQ2A 5LARA 1FGIA 4AGUA 4ANLA 5L8LA 3S1HA 1XBAA 2ACXA 4GT5A 3KN5A 3LE6A 4FYNA 3I5NA 4CFFA 1FINA 4TWCA 4OTIA 4F99A 4YZCA 2VO6A 5DEWA 4DAWA 2X39A 4EOQA 5HBHA 2ITZA 3P5KA 3R1YA 3RALA 2R3MA 4O96A 5AFVA 3LFNA 4XBRA 5AR7A 3TNQB 3BBTB 3NUUA 4QP9A 3SAYA 4EI4A 4I23A 5EKOA 3TJCA 3Q4ZA 2VWIA 4KAOA 4M68A 5IA3A 3LFSA 4NZWB 4D9UA 3W2RA 4H05A 1G5SA 2WMWA 3EYHA 5DA3A 3GP0A 1PXKA 3FMJA 4RBLA 3S3IA 4C38A 2OWBA 3MB6A 1UNHA 2YWVA 1KE8A 4FEXA 1Q24A 3UP7A 2QHNA 3UOHA 2VX1A 1IEPA 3C9WA 5LQFA 2BRGA 4ZK5A 4GVJA 3L8SA 1UV5A 4FSYA 3Q53A 3ZTXA 2IPXA 1NY3A 3GCUA 4IVBA 3BWJA 3TWJA 4CSVA 1Q8UA 3RK9A 4ALUA 1H1SA 1JQHA 2QONA 4UEUA 3PPZA 3R1QA 5J7BA 1Q3DA 4G3FA 4B6LA 3R7OA 1V0OA 4EK8A 4O0XA 3ZXTA 2PZRA 5C27A 4M12A 2DS1A 1V0BA 4XG8A 3R00A 2XYNA 3RKBA 4EHZA 3P4KA 4U40A 1PY5A 4WA9A 3PSDA 1XWSA 3QZIA 4EWQA 4D5HA 2C6KA 3WE4A 2R9SA 3EL7A 2QLUA 5DWRA 3ZUTA 4A4XA 4BBMA 2YEXA 4GIIA 1BLXA 4TL0A 2CN8A 2GCDA 4AWIA 1YWNA 1QPEA 4UZDA 4I92A 5AV4A 4BDCA 4FE2A 4IX6A 3BYMA 5A4EA 4FL2A 4M7IA 4PDSA 5J5TA 4G6LA 2J0KA 5T68A 4E20A 4D2SA 3VW6A 3QCYA 4YZ9A 4EBWA 3RMFA 1UWJA 1W98A 2R3RA 4W4XA 4Q2AA 2VTRA 4U43A 4BN1A 1YHWA 3QBNA 1GNGA 1RQQA 2VTHA 1DAWA 4I93A 4OTDA 4WKQA 4D58A 4WUAA 5CSWA 3DY7A 4TXCA 3MDYA 2BIYA 3AGLA 1Q97A 4RX8A 1TQPA 2FVDA 4YNEA 5HCZA 4EK5A 1ZYSA 3FUPA 5J1VA 3VJOA 3QRKA 4PMPA 4GMYA 1ZYLA 2CCIA 1V0PA 1WVWA 2RSVA 4FKVA 5DIAA 4D5KA 4N57A 2GNHA 2X7GA 3P1AA 4IJ9A 2OK1A 3C4WA 3ZO3A 3DNDA 2NP8A 4FV6A 5A4TA 4DGGA 4Z7GA 3EQGA 2YDKA 2C1AA 3D5UA 3NLBA 5IEVA 3OXTA 3EFWA 3IO7A 3DQWA 1OVEA 2QOQA 3LCSA 2CJMA 1M7QA 2JIUA 2C3JA 4FKIA 1BL7A 3MA3A 5T3QA 2GDOA 4I41A 2XP2A 5DFPA 5HNBA 5J8IA 3W8QA 5IA2A 3BU3A 3KU2A 3R2BA 5IQAA 4LMUA 3DFAA 4EHVA 4C35A 1P4FA 3BZ3A 3CKXA 3PRFA 4I24A 4U97A 5DR9A 5HU3A 2RGPA 4PNIA 4PMTA 4L46A 4R3RA 5A46A 5IH6A 4GU6A 4GU9A 2VTJA 4IZ7A 3BV3A 2BAJA 4EH9A 3R83A 4I6BA 3EZRA 4RIYA 1HOWA 2VTOA 4O2PA 3HZTA 3E62A 4FZAB 3WYYA 4AA4A 4QYYA 4FIGA 3V04A 3H9RA 4ZLZA 2J0IA 3IW7A 5HLWA 4KIOA 3LZBA 3MSSA 3A99A 5D9HA 1OIUA 4ITJA 3NAYA 4AXAA 2OO8X 4OTWA 1AQ1A 2PZ5A 3GU5A 5L2IA 2IW8A 2BRNA 2WTCA 2WHBA 4L7FA 1IR3A 4YTCA 4NCTC 5JEBA 3LQ5A 3EN7A 4ZJVA 3CQUA 3GC7A 5A14A 1GZ8A 3HKOA 4BCQA 4GFOA 5BMMA 2WIHA 3PA5A 4I94A 4P5ZA 2Q83A 4JJRA 4PX6A 3TNHA 4KIPA 2W1ZA 2RKUA 1HCKA 4I5HA 3H0YA 3ZO2A 3DAKA 5JK3A 4F0FA 5H8BA 5JQ5A 3PLSA 4W4VA 5FXQA 5LMKC 2JIIA 1JKLA 2Y0AA 3MI9A 2GQSA 3W33A 1I09A 4B0GA 5HIDA 2YJRA 5HCYA 3KULB 5HZNA 3NCGA 4TY1A 3ENMA 2J5EA 3DLZA 3LM5A 4M0ZA 4RC2A 3D5XA 4FSQA 4AP7A 5I9UA 4CKRA 3O7LD 4QTDA 2WIPA 4FL1A 3C1XA 2YIXA 2VD5A 4FSWA 4H58A 3RWQA 3ZO4A 3QX4A 1O6YA 3MIAA 3R9NA 5ITAA 3FSKA 3T9IA 2WPAA 3I81A 3QTUA 5LWNA 3E7VA 1T45A 2R3KA 3OY1A 5A3XA 1JAMA 3OD6X 3VUHA 4H1JA 4IAZA 2F7EE 2BTRA 2P2IA 2WQEA 5M51A 4MKCA 3ORNA 3TACA 4AW1A 2CKPA 4YSMA 1YKRA 4QP6A 2VTLA 1Y91A 3FZ1A 4LV5A 4RFZA 5DOSA 1Z5MA 3P9JA 2VWZA 3ZRKA 1CMKE 4RRVA 4G3DA 4HGLA 4FSMA 3GC8A 3PDTA 2YCFA 3FSFA 3MN3A 2C47A 3Q2JA 4IBMA 2JBOA 5AUXA 3RZBA 4HVHA 3VUDA 4HZSA 5HVYA 3EJ1A 4R3CA 2Y9QA 3KC3A 5ANGA 1XKKA 1GIHA 4KRDA 3DDQA 4IM0A 2HZ0A 4NJ3A 4RT7A 4FA2A 1PF8A 3AC4A 5B7VA 2ITQA 2YM6A 4CRSA 5CF5A 1JVPP 4AZTA 3FZTA 4OBPA 4H3BA 1DM2A 4U81A 2OGVA 2YZAA 2XNMA 3ZFXA 3DTCA 2EB2A 3RPOA 1BI8A 2PE1A 4FV2A 5KHWA 3E5AA 1R0EA 3FLWA 4TYHB 3LFCA 4M13A 3C4XA 4EZ7A 2PMLX 2IN6A 3FY0A 3COMA 4O86A 1JSUA 2Q0NA 4XS2A 2Z7RA 2XS0A 4G6OA 2I0HA 2ZM3A 5EKNA 1ZYCA 4OT6A 4MD9E 2IJMA 2Y4PA 4HYHA 5CYIA 3QXPA 5BVEA 1MQ4A 3VW8A 1UKIA 2X8DA 3IPHA 3KB7A 4BYJA 5HG5A 2WZJA 3E8NA 3GBZA 3GC0A 2FYSA 1ATPE 4DINA 2CNVA 1ZOEA 3CJGA 3H3CA 4X6RA 3K3IA 4USFA 1PXPA 4X2KA 4AZEA 4HPUE 4LOOA 5DNRA 2R3QA 1VEBA 4PDPA 2R7IA 1PXJA 4RVTA 2W05A 4NFNA 4ZIMA 2ZMDA 4IVAA 2UVXA 3MFSA 4A7CA 2C3KA 4I22A 4UWYA 2WB8A 3AMBA 3UC3A 3TM0A 1PKDA 3QU0A 4K9YA 5IQBA 3TDWA 3RP9A 3RAIA 1H1RA 4HYUA 4G34A 3DCVA 3FZSA 4C2VA 4J97A 5H2UA 4AG8A 4B7TA 2OJIA 4O7VA 4BCHA 1YHVA 4F70A 2H8HA 3DV3A 4LV8A 2VGPA 4MXYA 3IQ7A 5EOBA 4YC3A 3ZMMA 4CMOA 4HOKA 3W55A 4DGNA 2I7QA 3VQHA 4FEVA 3D5WA 2H6DA 3EKNA 3HYHA 3W2PA 2HYYA 3UOLA 1WBTA 3SW4A 2PVNA 3QHWA 5AR4A 3QA0A 4JIKA 4YJPA 3ZFMA 4AT4A 4ZSAA 4E93A 5M44A 2F4JA 5HEZA 4IB0A 3RM7A 4NCTA 5CAOA 2OKRA 3RINA 1JOWB 3OG7A 4GUEA 3LJ2A 3VS1A 3LQ8A 3Q3BA 4D4RA 3PG3A 4BCOA 3Q4CA 3FL4A 1SZMA 3FC1X 3TUCA 2VAGA 3SRVA 3HAMA 4XYFA 1ZXEA 4CEGA 5IQIA 2VO7A 1KSWA 3CKWA 1A06A 2GHMA 4GJ2A 3TI1A 2IW6A 2HY81 3UIUA 5LMKA 3MJ1A 3ID6C 2CGXA 2CDZA 2IVVA 4ZY5A 5HO6A 4EYJA 4Y83A 2SRCA 3KMWA 3ZRLA 5AEPA 5G1XA 3G0EA 3ZSIA 3D4QA 4MWHA 3DAJA 4LUEA 2PVJA 4U7ZA 4KBAA 4P5QA 4Y5HA 2A1AB 3I7BA 1FBNA 3N4TA 2X2LA 1STCE 2X6EA 2Y8OA 4QMUA 4HGSA 1OPLA 2YCQA 2OICA 5M4CA 4CYIA 4FODA 4F9YA 4F7LA 3HAVA 3DPKA 2E9NA 4LRJA 4IEBA 4C02A 1JLUE 4FTAA 4TWOA 4I0TA 3LQ3A 1WZYA 2IO6A 3N4UA 2V55A 2BFYA 2UZDA 3BEGA 4LM5A 4M67A 3PRIA 3REPA 4DG3E 3QWJA 5CTPA 4YHFA 5M57A 4AN3A 1T46A 3Q9ZA 1H0VA 4ZS0A 2NNWB 5M06A 4M15A 4K8AA 3KF7A 1H4LA 3VRZA 2BZHB 4J52A 2W1GA 3G5DA 5AP1A 4BWPA 1NT2A 4DTBA 3UIMA 4DHFA 2YISA 3BGQA 3W10A 4IAIA 1XO2B 4AACA 5HE3A 2B1PA 3I5ZA 3R1NA 4EOMA 2VWBA 4DGMA 3LLAA 1W83A 1OPJA 4MBJA 4S30A 3BHTA 4U42A 5J79A 2EXMA 4A07A 4JDJA 2CKQA 4DCAA 5KHXA 4CFMA 4RG0A 2X4FA 4NFMA 5KMIA 3GT8A 4ANOA 2XB7A 3LMHA 3DS6A 4HCTA 3QQUA 2QD9A 4ZSJA 4TTHB 2BAKA 2B55A 5CSPA 3UODA 3F3TA 4C34A 3HRCA 4MNEB 3RM6A 4GUBA 2C6LA 3BQRA 5EDQA 4R5SA 5CAPA 5AMNA 4PF4A 1Q8YA 3EKKA 4QP2A 3UYSA 2ZDTA 4BFMA 2BILB 4BI0A 2UVZA 4FV0A 1OUYA 5AM7A 3EHAA 3QQJA 4EC8A 4KINA 4WBOA 2C4GA 3JPVA 4E4LA 2A19B 3MJ2A 1H1WA 4OTFA 5EQYA 4M69B 2PVFA 1IRKA 3PXZA 5HIBA 4ASZA 4CV9A 5ETFA 3E3PA 3QTWA 2CKOA 2E9UA 3WIGA 3FQEA 5DRDA 3GFEA 5E8YA 5CU4A 3UMWA 3VS5A 4BKJA 5LMAA 3R9OA 5FG8A 2WMSA 1SM2A 4F08A 5ICPA 2VWWA 3A7JA 1PXMA 2WMXA 5EQEA 5KMKA 3SXSA 4YURA 3NPCA 3DK6A 3FMMA 4O6LA 2C6DA 3WZJA 2C6TA 4C4GA 3EN4A 5K4JA 4IXPA 5IZFA 2JGZA 3MH1A 4XRLA 1GY3A 2I0VA 3BCEA 3M2WA 3NYVA 3R22A 4F4PA 5JSMA 3G90X 2C3LA 4F64A 5CQWA 1OKWA 4I5PA 4QNAA 1JWHA 3UZPA 4AZVA 3Q6UA 1H27A 3V5QA 4RQVA 3WE8A 4RVLA 4MCVA 4AE6A 4MYGA 3P79A 5DN3A 5FM3A 4RWLA 5E91A 4W4WA 1OECA 4A9SA 2ZJWA 5EG3A 4BTFA 4WT6A 4ZTSA 4FT9A 4XV2A 5EYKA 4FKRA 3W2CA 4F1OA 3UO5A 2W4JA 1URCA 3VBYA 2PVMA 5I0BA 1QPCA 3THBA 2C1BA 5ANJA 4NU1A 1XH8A 4IWDA 4JX3A 2OIDA 3CY3A 5EOLA 4RWJA 3FY2A 5IQFA 4BL1A 5JFWA 3HECA 3DNEA 3CPBA 3K54A 3BHUA 3AC1A 5JMSA 1NW1A 3VUMA 3OCTA 5IF1A 3KK8A 4HYSA 5CU6A 4AZWA 3MVLA 4X0MA 4HCVA 4AN2A 4DEIA 4QO9A 4BIEA 3PWDA 1MRUA 4RJ4A 3PUPA 1J91A 5FUTA 2IZSA 4TPTA 5HBJA 3ODZX 4IACA 4O27B 3SD0A 5CEIA 4FNWA 4FUYA 2PMIA 4J99A 3FYKX 5D1JA 4JDIA 3P78A 3UQGA 2OXDA 2B9FA 4Z16A 3RZFA 3VJNA 4ZY4A 4CFVA 3ZLSA 2NRYA 5CAUA 4DFBA 3KF4A 4IM3A 2OF4A 3F3UA 2BCJA 3POOA 2OG8A 3ZDIA 4DT9A 4GW8A 4J98A 4H39A 4W8EA 2ITPA 3KN6A 4PTCA 4BDHA 2YCRA 3SLSA 2R64A 5IQDA 1W7HA 3KVWA 2R7BA 2YLEA 5L6WL 5TKDA 3TIYA 3L8XA 3UC4A 5HVKA 2B9JA 2YIQA 2J90A 3LMGA 4FKLA 4MF1A 5FD2A 3AQVA 4YBJA 3ORMA 5CALA 5EM8A 2WTKB 5DG5A 3DJ7A 2Y6OA 2XNGA 5L8JA 4PL4A 3EMGA 3A61A 4O0TA 4TNDA 3TZ8A 4FEWA 4CZUA 2V5QA 4HW7A 4TT7A 5GZ8A 5FDXA 2BDFA 3H30A 4QMNA
chains in the Genus database with same CATH superfamily
2X0QA 4QP7A 3HGKA 3C0HA 4V01A 4RJ5A 5IA1A 5GIPE 4FZFB 4FZ7A 4W9XA 3VQUA 1YXVA 4QTAA 5AA9A 3AD4A 5CVHA 4EH3A 2CNQA 3QAME 2ETKA 4A4OA 4PDYA 5AR3A 3ELJA 2GHLA 1WBSA 3EQPA 4NM5A 2PK9A 3HRBA 3OEFX 3DBEA 4XCUA 3D94A 3WF5A 1OBDA 2GTNA 3R7UA 4O6EA 3BU6A 2PTKA 2W4KA 3QRJA 4K0YA 5JRQA 3NS9A 4WSQA 3QZHA 2HENA 4AF3A 5EI8A 4CV8A 3UVRA 2GNIA 3O71A 2XANA 3ETAA 1YI3A 3IS5A 3QCQA 4NL0A 4MXOA 3KCKA 1ZMUA 3DU8A 4ITIA 3E93A 2UW5A 3FMEA 2ZVAA 5AR8A 4UMPA 3W0NA 3O23A 4EKLA 1CSNA 2GNFA 4QDVA 4RGJA 4QQ5A 5E9EA 3CGFA 2X0GA 5A4CA 2VZ6A 4HVIA 2XH5A 3GOKA 3HMOA 3MH0A 4L00A 5EFQA 3SRVB 4MHAA 3JVRA 1GIIA 2V22A 4JR3A 2CPKE 3UO4A 2YM8A 4FX3A 3BL9A 1ZMVA 4MBIA 4CMUA 2YERA 1RW8A 4YGAA 2C5XA 3ZUUA 4PMSA 4E4NA 2RIOA 3TMOA 2A4LA 2JKMA 1WFCA 2JEDA 3AC2A 3ACKA 4FKSA 3RGFA 4FTNA 1OL5A 3DGKA 3BHYA 4UB7A 1XH7A 3O51A 2Q0BA 3RHKA 3VC4A 4GK2A 1NXKA 5IEXA 2BZKB 3MPTA 4YZDA 3PZEA 4ACGA 2BALA 3R8PA 3WZEA 3QLFA 4TW9A 3KULA 3O7LB 4LQMA 2C68A 5CX9A 4EK3A 2O8YA 5F4NA 1GIJA 3TEIA 2WO6A 4G1WA 1XBBA 3CSVA 4ONAA 4OBOA 4APCA 2HWOA 2PULA 3O0GA 3VN9A 3QYWA 2CGUA 2QR7A 2XEZA 4RIXB 2ZB1A 1SNUA 3IDPA 4C62A 5DEYA 4AA5A 5EQPA 4E6AA 3QTXA 4NM7A 3PY3A 4HZRA 4ID7A 1M52A 3JXWA 3NUPA 3ATSA 1AD5A 3HMNA 3F2AA 1K3AA 1GZNA 4WIHA 2WEVA 5E90A 5IH5A 2YAAA 5KBRA 1YDRE 2XIKA 3NUSA 2OLCA 3HA8A 3E88A 3NNVA 4EOLA 5BX0A 2OH4A 4UXLA 4CKIA 4BF2A 1Q8TA 4W9WA 4YTIA 1A48A 4AZFA 1FVRA 4Y46A 4FOCA 5HO8A 5C8NA 4FJVA 3FI3A 3A2CA 1OUKA 3UNKA 4CFWA 4X2GA 3Q96A 5BPYA 1TZDA 4WD5A 5KE0A 3NUYA 3A60A 4JS8A 1KOAA 2OJ9A 2VO0A 4M0YA 3RPVA 5LJJA 3BYOA 3SV0A 5J1WA 5C4LA 3LFAA 1FVTA 4IADA 2OIQA 4F1MA 4XHKB 5I9XA 4J71A 1BUHA 4K6ZA 3RPYA 4MVFA 4FTLA 4DA5A 4RJ3A 1M2RA 2VTMA 3FLZA 1QCFA 3ORLA 4OTPA 5AADA 5LVPA 3R9DA 2ITWA 4KIKA 4TYHA 2ZYBA 4ALWA 3LKMA 3SG8A 4L3JA 3EFKA 5HKMA 2VTSA 2J0JA 3ZZWA 3QALE 2O65A 3MY5A 4KSQA 4LI5A 4NM0A 4O4CA 3O8TA 5HBEA 1E9HA 2IVTA 2J0MB 3GENA 5ETIA 3MW1A 5AR5A 1TKIA 4AAAA 3OHTA 3H0ZA 1LP4A 2VNWA 4DBNA 2QODA 3KXMA 4JQEA 3PP1A 1U54B 5TF9A 1SMHA 2BVAA 4AA0A 3F3VA 4AXDA 3GB2A 1WBOA 2GHGA 3HNGA 3DK7A 3QQHA 4XG6A 4EYMA 1M14A 4C4IA 4FSRA 4BDIA 2WU6A 2EXCX 4FV3A 5J7HA 3LCTA 5HE1A 2QU6A 3EIDA 5JRSA 4G31A 5EHLA 2QI8A 4IWOA 2YLFA 5E7RA 2HXLA 3JYAA 5AP0A 2R3IA 2YACA 3U54A 3O5AA 2WEIA 3GCQA 1G8KA 3HL7A 3R71A 4LGDA 2ERZE 3ZFYA 1OB3A 4XV9A 4DEHA 5AUTA 3DXQA 5C26A 2Z2WA 3I60A 3DB6A 4FTMA 4QPAA 2VX0A 3G6HA 3OCBA 5A4QA 3HV3A 1VZOA 4TWNA 5CI7A 2WMBA 3GOPA 4G9CA 5AUZA 3WF7A 2PWLA 3B2TA 4KBCA 2XNPA 4CQGA 5BMSA 4LOQA 4NJDA 2OFVA 3F5XA 2AEGA 4ZTLA 4EUTA 3MTLA 4IAYA 1BI7A 1JPAA 3HDNA 4IZYA 4ZEGA 2E9PA 1GJOA 2G2HA 4JR7A 3ROYA 1J3HA 2ITVA 2I40A 5CY3A 3LFQA 4NT4A 3NNXA 4ASEA 4C0TA 4WUNA 4DITA 4IANA 2VTTA 2Z7QA 4WOVA 3G0FA 3H9OA 3EWHA 3LFBA 1FPUA 4Y5QA 2REIA 2QOFA 4K2RA 5FTGA 5L4QA 4BGQA 4XUFA 3QF9A 4PWNA 3OF0A 4L3LA 4C4FA 3RVGA 1YDSE 3GQIA 2XM8A 3OVVA 3KRWA 5DR6A 4BDEA 4RLKA 1OL1A 3FI2A 4USEA 3L9MA 2PZYA 3F7WA 4UYAA 2G2FA 3QQLA 5KMNA 3GCSA 2BAQA 2LAVA 1AGWA 3UBDA 4DF3A 1QPJA 3UG2A 2H9VA 3QHRA 4Y95A 3D15A 1XH6A 4EH5A 2VGOA 2FSTX 3L9NA 3HMMA 4FVRA 3V6RA 3D7TB 2BKKA 3LFDA 4FZ6A 3TG1A 2RFSA 2WD1A 3NW7A 1UU7A 4LMNA 3UIXA 2F49A 1HCLA 4U6RA 3MVHA 5AJQA 3F2NA 4EK4A 3QD4A 3NWWA 3OBGA 2ZV2A 3P23A 4GEOA 2OXYA 5CAQA 2XYUA 1Z57A 4O22A 4IM2A 4PL3A 2NO3A 2XNNA 3OWLA 1GOLA 3I6WA 2E9VA 3GCVA 3K5UA 2PUNA 1K2PA 4FNXA 3KXXA 3BL7A 1Q3WA 4R1YA 1YI4A 5KO1A 3AMAA 3F66A 3FYJX 3E8CA 3NEWA 2WTKC 1MRYA 4FTQA 1IAHA 5DT3A 3N51A 1H1QA 4RVKA 1ZYDA 4UWCA 3RK5A 2OH0E 2JBPA 1ZWSA 3G9NA 5GJFA 3RI1A 2XEYA 2KULA 5DBXA 4QMOA 2XIZA 5J9YA 4YZNA 3U4WA 5K5XA 3FL5A 3RPSA 3ZYAA 3PVBA 1SNXA 2UZUE 4J1RA 5IQGA 2XKFA 3QKKA 2F2UA 2BFXA 3UOJA 5CNNA 2XK7A 4PPBA 3KKVA 4YZMA 5EW3A 3VNTA 3VS4A 4IB1A 1UU8A 4O0VA 3TNWA 3ORZA 2BDJA 5EW8A 3TIZA 3LCKA 5IG1A 4YJUA 4JAJA 4IFCA 3ORPA 4R7HA 5TT7A 4IB5A 4MNEA 1XMMA 3GUBA 4IAFA 4UXQA 4E8AA 1E1XA 3IW6A 4MXCA 3MVJA 5EYDA 4PV0A 4WO5A 5EYMA 4BC6A 2OF2A 2JDVA 2ZMCA 4B9DA 3TNPC 2BR1A 5IKWA 4LGGA 3WOWA 4DLJA 2R0UA 2QVSE 1ZLTA 2YM5A 4X7QA 4ZP5A 4N4SA 4ITHA 4DEAA 4Z55A 2V7OA 4E1ZA 2C5YA 1JSVA 3FKNA 4S2ZA 3KMUA 3R2YA 2P3GX 4M69A 5AV0A 2J0LA 4H3QA 3IW8A 5KNJA 4QMVA 2ZB0A 1MRVA 4KIQA 2XBAA 4WBBB 4ZTNA 4HGEA 4E6CA 3D5VA 4EORA 2WTDA 2X8EA 3FZRA 5ANDA 3SXRA 1Q8WA 3EQFA 4D55A 3PIYA 5HLPA 2ZV7A 4F65A 4XG4A 3NFFB 3QGWA 3VBVA 4ZLOA 4B8LA 4F9WA 4DCEA 3FWQA 2J5FA 3BI6A 5JGDA 4Z3VA 3ATTA 3IDBA 3R28A 4G17A 4L42A 5IMEA 4L3PA 3V5WA 1J1CA 3ZC6A 2XCHA 4FG7A 4LL0A 1OPKA 2A2AA 3HRFA 3R7YA 4DTKA 4DHIB 3BHVA 4RWIA 2C69A 3ULIA 4HGTA 4NIFB 3EYGA 3I4BA 4S31A 4C3FA 5CF6A 4EJ7A 3PLAE 4KKEA 3VHKA 3PSBA 3TKUA 4O1PA 2XK6A 4R1VA 2J9MA 4EEVA 4IIRA 4GYGA 4AW2A 2RFDA 2WKMA 5LWMA 4DLIA 1OMWA 3BE2A 3ZLYA 3ZBFA 5BVDA 5CS6A 3ZM4A 2GNLA 3V51A 2C5VA 3U6HA 1R3CA 5LVOA 4QPSA 4IQ6A 4MXXA 3C7QA 2X81A 3OCSA 3OTVA 2CLQA 5HG8A 3PPKA 2VUWA 4DH7A 4F63A 3F2RA 3AC8A 4X3FB 1JBPE 4YHJA 3FPQA 1L8TA 4M8TA 3OT8A 4P90A 3QYZA 2AC3A 3R73A 4JRVA 3PA4A 4BCPA 2O3PA 4OTHA 4WNOA 5EW9A 4TN6A 1BMKA 3PYYA 5HORA 1CKPA 4MQ1A 3FMHA 4FV5A 3WZDA 3CJFA 3OCGA 4H3PA 3E63A 2YDIA 3BU5A 4PQNA 4QYGA 4S34A 4QMWA 4FT7A 4FYOA 2A0CX 3GU4A 4L01A 5IUHA 5AP3A 3QZGA 1MQBA 4IWQA 4KIKB 4G6NA 4PTGA 4R5YA 3R30A 4ZZMA 3HV4A 5FGKA 2XKCA 4ZAUA 3U55A 4U9AA 2OIBA 1FOTA 4ALVA 4E4MA 4EOIA 3C5IA 2R3GA 4MD8E 3OS3A 4F0GA 1H24A 3EQRA 2Z7LA 4JNWA 4PDOA 4Q5EA 5CU3A 3UDZA 2UUEA 4GT4A 5HESA 5LXMA 4GG5A 3B8RA 2XNOA 3SGCA 4LOPA 5AP6A 2QOOA 2HOGA 4ENYA 4EH8A 4O7YA 5CT0A 2FO0A 5CU2A 1URWA 3ITZA 3UYTA 2ZDUA 4E26A 2WMQA 3B2WA 4QD6A 3II5A 5ACKA 1OITA 2JDRA 5AIKA 4D28A 4PPAA 1H08A 4BZDA 4ZTRA 2CLXA 1WVXA 2Y6MA 3NR9A 4ANMA 5CU0A 3GVUA 2PU8A 4EWHA 4BDBA 5FEQA 4DDGA 3F3ZA 4PPCA 2Z60A 1ZARA 4O7WA 4DT8A 1ZOGA 1V1KA 4D0XA 1OIRA 4EZ5A 3QTQA 1KV1A 1S9IA 4NM3A 2J50A 4AFJA 3CPCA 3PVWA 4YR8A 2O63A 4KKGA 3P86A 5CWZA 3R6XA 3EQIA 2RF9A 3FBVA 5HG7A 3TV6A 5LVMA 2WTVA 2VWYA 5E8VA 2R3HA 3DOGA 3CP9A 5A54A 4O0RA 3ZM9A 3QUPA 1GZOA 4D2RA 4WHZA 2WOTA 1KE7A 3QFVA 1H26A 4YNOA 3BIZA 2O64A 3DK3A 3HVCA 1NA7A 3S0OA 4D1SA 1IAJA 2ZAZA 2YFXA 4NEUA 5IA0A 5ANOA 4OT5A 4XG3A 2GPHA 4FV8A 5FBOA 1OKVA 2W1FA 2H96A 3MVMA 2HZ4A 4W4YA 2XK4A 4ZTHA 3Q9WA 4NKSA 4AW0A 3DTWA 4EHEA 4BY9E 3A4PA 5L3AA 5A9UA 4UZHA 5AX9A 1PXLA 3GU7A 3QTSA 4O0YA 5IMXA 3CY2A 3KXNA 3OOGA 4QP3A 5H8EA 3RAKA 1H00A 4BI1A 4F7SA 5M4FA 2XKEA 2YIRA 1ZZLA 2GS6A 3Q32A 2RL5A 5GJDA 3U51A 3C50A 3VS2A 5BVKA 3W0RA 3E92A 4EH2A 4YLJA 3SQQA 4ACCA 4AX8A 4II5A 4IDVA 1BKXA 2B9HA 3BHHA 3IONA 5AIRA 1IASA 1VYWA 4YMJA 1RDQE 4RA5A 4DH3A 3D7ZA 4I20A 5E8ZA 4CFXA 4EOOA 5CSVA 3W1FA 2JKQA 4M84A 4QT1A 5JFSA 3EQHA 4FKWA 2Y4IB 4QOXA 2UZOA 4AUAA 4XOZA 4D1XA 2WGJA 4QYFA 5HD4A 3M1SA 1JKTA 2PMNX 4Z9LA 2B52A 5FQDC 1OGUA 5AUUA 4ZMEA 3I0QA 3HLLA 1YW2A 3BGZA 3P7CA 4NWMA 4RIXA 4V0GB 4WRSA 3U9NA 4F6SA 4QNYA 3K3JA 1Y6AA 3R7EA 2PYWA 2XM9A 4A9RA 4O2ZA 3DZQA 4QPMA 5CLPA 4W8DA 5AP5A 4ENXA 4AXCA 1F3MC 5GHVA 5FDPA 3G51A 5AV3A 3V5PA 4RJ7A 2BZJA 3NRMA 2PZIA 3PSCA 3VAPA 3BBWA 3M11A 3UOKA 4KUJA 3OWJA 2WU7A 3TV7A 4X21A 3CLYA 4HVDA 3ZC5A 5FWKK 5J5SA 4ANNA 4EZ3A 1VLRA 3ZDUA 3IKAA 5E8SA 1OKZA 1PHKA 4IAKA 4Q9SA 5HQ0A 2DQ7X 2GS7A 3LFFA 4EQCA 3WBLA 4GS6A 4O7LA 4FVQA 4N6ZA 4BDAA 2HZNA 4OW8A 5LCKA 3CR0A 4WG4A 5HVJA 2IZRA 4MF0A 5E1EA 3UE4A 2PHKA 5L6OA 3KIOC 3FE3A 2PMOX 3BYUA 4EK6A 3ANQA 4E5AX 4OAUC 1ZZ2A 2O2UA 1UNGA 2F7XE 3K2LA 1QMZA 5G6VA 5ANIA 2R4BA 1R1WA 3GI3A 4O91A 3QXOA 2X7FA 3NYNA 3HX4A 2QHMA 3JUHA 4DBXA 3IGOA 5I9ZA 3IOKA 2OI4X 4M14A 1S9JA 2HIWA 3CS9A 4F1TA 3VUIA 4CT2A 4DFUA 3OXIA 4BGGA 3R9HA 4S33A 4BVUA 5CEOA 4IC7A 2WXVA 3R8MA 3Q5ZA 5T6KA 5JQ8A 1U54A 3AGMA 3PXFA 4O83A 1H1PA 2R3FA 2R3LA 3MH3A 4JBQA 3HP2A 4U41A 1SVGA 4F9AA 3ZH8A 3DA6A 5IA5A 3ZO1A 3A7IA 5HNIX 4X2JA 2JLDA 3ANRA 4J95A 3FLQA 3L8VA 4F6WA 2UW9A 4QMSA 4OLIA 3AOXA 1G8AA 4DFXE 5IDPA 4LG4A 1YOJA 2OZOA 5HG9A 4GL9A 1LPUA 1Q62A 3NVKI 3V3VA 1KOBA 2ETMA 5BVOA 3DBDA 3PY1A 1X8BA 5AP4A 2WQOA 3A8WA 1OZ1A 4CFUA 5L8KA 5IDNA 4D2VA 2O0UA 4YC8A 3LCDA 1LR4A 4O81A 1FVVA 4F09A 4JX7A 1XBCA 4GVAA 3UNJA 5BVNA 4R77A 3TT0A 5LVNA 4RSSA 1ZOHA 2UZVA 4F7JA 3G15A 2JIVA 2P55A 1DI9A 2X1NA 2XBJA 3OBJA 1PXIA 4GJ3A 2VN9A 3U4UA 5I9VA 3MPAA 3KRLA 3MV5A 5GJGA 3RPRA 3QRTA 4CG9A 2OJJA 4TYIA 3UNZA 4CNHA 2VWUA 2DYLA 4QMYA 3DKCA 4MD7E 5M08A 2W99B 3EFJA 2F9GA 5CQUA 3F69A 3D2KA 3LM0A 2WNTA 5KKRB 4YPDA 3U87A 4RLLA 3GC9A 4HNIA 4X3FC 2ITTA 4AE9A 3FZOA 3DJ5A 4MTAA 3QL8A 3WF9A 4OBQA 3ZOSA 4EOKA 5L2TA 2HW7A 3VBQA 3WIKA 4N70A 2X2KA 3KQ7A 4J53A 4XMOA 5FEDA 3LMIA 4GCJA 5EI6A 1RE8A 4K18A 3LLTA 4TYGA 3RHXA 2GQGA 4ZY6A 1CDKA 1YXTA 4YSJA 4LGHA 4FG8A 2ETRA 1FGKA 3U8WA 5CZHA 3UPXA 4LDTA 2A27A 3FMKA 3MIYA 4MBLA 2XJ0A 5HCXA 4KWPA 3MGYA 3CD8A 3D7TA 4IFGA 3HEGA 4ANBA 5D10A 1GAGA 2QO9A 4DEEA 2EU9A 2AUHA 3RWPA 5JGBA 3DXNA 2QURA 5C03A 3ZLXA 1VJYA 2FSLX 4FTRA 3ORTA 4I0SA 3NUXA 4RJ6A 3TYKA 1M2QA 1OKYA 4HYIA 1U4DA 2RFEA 4EH4A 2QOCA 5HD7A 2W06A 4BICA 4F78A 4AXFA 4OTQA 4G2FA 1WCCA 4ZSEA 4AN9A 4AFEA 4EONA 4AOIA 4DG0E 3PJ8A 3AKJA 3BKBA 3C4CA 2FH9A 2PVHA 4KS8A 3EFLA 3O17A 4V05A 2GSFA 5CEPA 1MUOA 3D2IA 3OY3A 2C0TA 2XALA 3WI6A 1JNKA 3POZA 3AT3A 4X2NA 4BYIA 4C4HA 3UMXA 4TKSA 4O7TA 3AC3A 1CTPE 2OBJA 2W1DA 3QGYA 3VVHA 2XF0A 5H8GA 4I21A 3T8OA 2PUUA 4UMRA 4L52A 4O21A 1WBVA 4FV9A 5CSXA 5ETAA 3W32A 2UW6A 2FGIA 5AWMA 5DH3A 5HOAA 1OGYA 4GSBA 4E5BA 4C7TA 3WF6A 4D1ZA 3ZSGA 4D2WA 4FR4A 2H34A 3LOKA 3Q4UA 4QMQA 2C0IA 3DB8A 4O4DA 3FPMA 4ZTQA 4XBUA 2EWAA 2JDOA 2CGWA 3CQWA 1H01A 3F3WA 3HMPA 4J7BA 4YTHA 5H3QA 5KZIA 1OL7A 4DFNA 3I7CA 3SDJA 1YVJA 3MTFA 3WZKA 4ZZOA 3OC1A 4CLIA 3PJ3A 3U6IA 4AXEA 2HELA 4IZ5A 2IVUA 3AT4A 3QWKA 3R63A 4FKGA 4IDTA 4QMZA 5L2QA 5HTCA 4BJJB 4ZZNA 2E9OA 4QDEA 3IW4A 3FMLA 4OTGA 4OAVB 5HICA 3OWPA 1W0XC 1XH4A 4AGWA 3NGAA 3W2OA 5ANEA 2IWIA 5E8TA 2XCKA 4BIBA 3DT1A 3ZZEA 2PVRA 2XNEA 1R78A 2WAJA 4M97A 3E64A 5CI6A 3P7AA 5BNJA 4OR5A 4KRCA 3W8LA 3U6JA 5M4UA 2CNUA 3PIZA 2PUIA 3Q52A 3FLYA 1LUFA 1YWRA 2QR8A 3ZEPA 2VWVA 1BYGA 2YM4A 5I9WA 5KMMA 5F20A 4R3PA 3FQHA 4RMZA 3RJCA 4A4LA 2GNJA 3LJ1A 4FOBA 3DKGA 2C3IB 2YJSA 4DFYA 4I3ZA 3RCJA 4BDFA 1WMKA 3MH2A 4YC6A 5JGAA 1APME 3R8UA 4RA4A 4U79A 3ORXA 3RTPA 3FJQE 3W2QA 3LIJA 4A06A 3COKA 3Q4TA 3DBFA 4IW0A 1XH5A 1UKHA 3T3UA 5D7AA 4U80A 3S4QA 4X3JA 1ZAOA 4ACMA 4ACDA 1YRPA 4ASXA 3IG7A 4BTMA 2WOUA 4JAIA 4FV1A 1SVHA 5J9LA 4ACHA 2EXEA 2P33A 1TVOA 1ZMWA 2I6LA 4NIFA 3VF9A 2W9FB 4C61A 4BI2A 4YUQA 3DLSA 2PSQA 2VTIA 5BQ0A 4WG3A 1YI6A 4G3EA 1XHAA 5I3RA 3PTGA 2Y4IC 3CEKA 4A9UA 1KE9A 2QNJA 2X9EA 3VUKA 4FIIA 4C8BA 4FKUA 3MFUA 2BHHA 5TOZA 4D0WA 2X4ZA 4PP7A 3KL8A 2HZIA 3FI8A 5FP5A 4MEDA 2BIKB 2WMUA 3SOCA 3NNWA 3D9VA 3ZU7A 4ERKA 1IA8A 5IA4A 4L68A 3A7HA 3NIEA 4JOAA 2IZUA 2XVDA 3N9XA 5HLNA 1RJBA 4RJ8A 3R04A 4RIWB 4X3FA 3QA8A 3KXZA 4RIOA 4G3GA 2UZBA 3BELA 3CXWA 4OTRA 2W1CA 4RZWA 5CNOA 5CEQA 4F9BA 5L2WA 1J1BA 3G2FA 4CXAA 2GNGA 3WILA 4KB8A 4FTKA 2OFUA 2XZSA 4F7NA 4ZXTA 4AGCA 2BUJA 1PYXA 5ETCA 2UZWE 5D41A 4C3PA 3KCFA 5H9BA 4BWKA 3VHEA 4A9TA 5K0XA 1DAYA 5KMLA 4CVAA 2OZAB 2YHVA 3JY0A 4M66A 1SYKA 3KRJA 2YM7A 4MXAA 2ZM1A 5CXHA 1ST0A 4XG2A 3R7IA 4U44A 1L3RE 5BUJA 4YBKA 3LPBA 4ZS4A 1U46A 4FK3A 3E3BX 3NW5A 4E6DA 1REJA 4Y72A 1P4OA 1GZKA 1A9UA 4R78A 2G1TA 3A4OX 3OMVA 2VX3A 2NPQA 3ENHA 3HV7A 2FUMA 2X2MA 2DWBA 3NIZA 5AA8A 5HIEA 4RQKA 1Q5KA 1ND4A 3MB7A 4FV4A 4CT1A 4IB3A 3QD0A 4DGOA 5EM7A 5C01A 4C33A 4S32A 4FSNA 1W82A 2UV2A 3W18A 4RZVA 5IQCA 3PE2A 4IZAA 4KABA 4DFZE 5A6OA 5JN2A 4O7ZA 2B9IA 5F94A 2E2BA 4FKOA 4GK3A 3SHEA 2B54A 4BTKA 3QCSA 3Q5IA 4QP1A 3PFYA 4PP9A 4JQ8A 3VRYA 3OP5A 4O7RA 1FQ1B 1PMNA 1LEZA 5AP2A 5HNGA 4ORKA 4D9TA 5CANA 4EH7A 2B7AA 3NUAA 3IGGA 4FEUA 2C30A 1PYEA 2YABA 2PVLA 1Q8ZA 4IX5A 3A7GA 1O6LA 2CN5A 3PZHA 5AX3A 3FC2A 4L53A 5BVWA 5K4IA 4M3QA 3C51A 3PJCA 2DUVA 3NNUA 1H8FA 4U8ZA 2J6MA 4MAOA 4GFMA 3TZ7A 4E7WA 4EBVA 5K5NA 1LEWA 3OW3A 4TYEA 3KY2A 3BYVA 3OUNB 2VTPA 3Q6WA 5D7VA 5L2SA 3NUNA 5DVRA 2B4SB 1YOMA 4YTFA 4YJSA 3AXWA 3E87A 3KK9A 3V6SA 3VO3A 4C3RA 3TN8A 4IC8A 2FA2A 3CTQA 4OUCA 3UGCA 2R3JA 2JAMA 4R7BA 5DI1A 3FLSA 4K33A 3OEZA 1BL6A 2W5AA 2W1EA 5JT2A 2PZPA 3COIA 4AQCA 3QUEA 4JQ7A 5KUPA 3B8QA 4Q9ZA 1UU3A 3EQBA 5A6NA 4U0IA 4FT0A 3R01A 2ESMA 4H36A 4YP8A 5K0KA 3BWFA 3TJDA 1K9AA 1OIYA 2C6IA 3SOAA 4R8QA 2YAKA 4AOJA 5KKRC 4ZSGA 2ZV8A 4O4BB 3AKLA 4BRXA 1P2AA 2RG6A 2WFYA 3NYXA 2JD5A 3NMUF 2JDTA 4FKQA 4XG9A 5EDRA 5AAGA 4ZMFA 5C4KA 4K1BA 2OXXA 4DH8A 2C6EA 2ITNA 4GV1A 5EM5A 1EH4A 1UNLA 4GYIA 2ITOA 3NW6A 5EI2A 3OROA 1KV2A 4AQKA 3EZVA 3QQGA 4FTIA 4ZTMA 3DXPA 3KVXA 3PXQA 5E92A 3R9RA 4C37A 3PY0A 3DBQA 1PKGA 4O0SA 4WNMA 3VS7A 2GTMA 2X0PA 1O6KA 4I6HA 5AR2A 3RNIA 4YPSA 3Q9YA 1SVEA 4FIFA 4I0RA 4C59A 1PRYA 1KE5A 5J95A 5GZ9A 4UN0C 3O2MA 4EL9A 4P2KA 2C5NA 4GT3A 2OU7A 2XARA 4FC0A 1YXSA 4DEBA 2QKRA 4V0GA 3HUBA 4LRMA 4YJQA 3TKIA 3UQCA 1B6CB 4RVMA 3JY9A 4ASDA 5C9CA 2B0QA 5GINE 4Y8DA 3KXHA 1PMVA 4RC4A 4F0IA 1Y8YA 3C4ZA 3R21A 4LV7A 2UVYA 2BDWA 5FLFA 3GU8A 4X6QC 2XKDA 3UP2A 1ZY4A 4DH1A 4O7SA 2OJFE 3SA0A 4TWPA 5HE0A 3KGAA 3MWUA 5M56A 3DKFA 1H0WA 3F61A 5B0XA 4JBOA 4ZOGA 3NYOA 2AQXA 4RX5A 3W0SA 4HNFA 1Y6BA 4JG8A 1OIQA 4YHTA 5DR2A 5FXSA 5DLSA 4O4EA 5HTIA 3ROCA 5BYYA 2JFLA 4ARKA 3TZMA 3V8TA 4FKPA 5CSHA 4D2TA 3CBLA 3Q04A 2VRXA 2V0DA 3QC4A 3R8LA 2EVAA 4XLIA 2ITUA 3R7GA 2YA9A 4Q5HA 4I5MA 4F6UA 2ONLA 3FHIA 2NRUA 2OJGA 3QTRA 3Q60A 4FG9A 4UALA 4YZBA 5AAEA 5F95A 3TUDA 3QD3A 4BDGA 2ZOQA 4I1ZA 3ET7A 5GNKA 1J7UA 1PW2A 5FEEA 5ACBC 2PPQA 3CIKA 4YO4A 5TE0A 4L44A 1Q41A 1YXXA 4G16A 4ERWA 4DN5A 3DDPA 3MA6A 4B4LA 5HX8A 3PJ2A 3GGFA 3F88A 3QUDA 2C0OA 3G9LX 4K11A 5BVFA 3PA3A 3TL8A 4LYNA 1P14A 4J8NA 4GH2A 2UW0A 3QRIA 3LXNA 3TV4A 4PRJA 4FF8A 4R6VA 2G01A 2XNBA 5I9YA 2KTYA 3W2SA 4C2WA 4L8MA 2CGVA 4MH7A 3W0OA 1XR1A 4AT3A 3TDVA 2YN8A 4KBKA 4KS7A 4WNPA 2YZLA 4GKIA 2W17A 4IVCA 1UU9A 3JR1A 4BIDA 1R39A 4PUZA 4Z7HA 3DQXA 4FIHA 3ODYX 2FSOX 3I1AA 3QC9A 4EQMA