2UVYA

Structure of pka-pkb chimera complexed with methyl-(4-(9h-purin-6-yl)- benzyl)-amine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
333
Chain Sequence
b'VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Rapid Evolution of 6-Phenylpurine Inhibitors of Protein Kinase B Through Structure-Based Design
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 108
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uvyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uvyA02
1XJDA 4Y73A 5EK7A 4HZRA 4K33A 4QMPA 4I5MA 5AWMA 4HNFA 4YJNA 4BWPA 4FSMA 4WBOA 4MBJA 3EZRA 2BFYA 4EBVA 1IAJA 4MH7A 3O8PA 1G5SA 4I4EA 2PMLX 5BVNA 4FKLA 3ATTA 3VUTA 3DAEA 4KAOA 4MD8E 4NK9A 4U81A 5DR9A 3QTQA 4DH3A 4EH4A 4YTFA 5HTIA 4XG6A 4I5PA 4CVAA 2ZM4A 2X6DA 4QMUA 4P5QA 4J7BA 4B99A 5HGIA 3I7BA 5I3RA 1OPJA 3G0FA 2HIWA 5L2TA 2UZNA 3EJ1A 4C3FA 1UWJA 4DN5A 5HORA 2GS6A 3F5PA 4ACMA 4DCAA 3LZBA 5C4KA 3FWQA 2FA2A 4FTCA 5HLPA 4DGNA 4O7LA 2P33A 2QONA 2CLQA 5AUVA 2WB8A 5HQ0A 2ZDUA 3LCTA 3Q3BA 2GNIA 4TYJA 4V01A 4OTFA 2YIXA 4D9TA 4DEAA 4X2KA 4CZTA 4EKLA 1KUTA 1H28A 1ZWSA 4DBXA 1JWHA 1YXTA 3TDVA 4GV1A 4TRLA 5BQ0A 4LGDA 5AAGA 2WFYA 3Q2JA 3DNEA 3Q60A 5FLFA 3VS0A 4O6EA 5T6KA 4DLJA 1YHWA 4W4XA 1W98A 4G2FA 4GFOA 5AJQA 1GAGA 4FI1A 1IAHA 4P4CA 3O96A 2BTSA 3M11A 4L67A 2C6LA 1Z5MA 1KE8A 2FVDA 2A27A 4KUJA 3GU7A 2VAGA 4IM3A 3OFMA 3S3IA 3SD0A 3VQUA 2PL0A 5A4TA 4CFUA 2EVAA 4JDJA 2WQNA 3AT2A 4E6QA 1Y91A 2XK9A 4KINA 3B2WA 5L2SA 1V0BA 4YC6A 4OUCA 3L8PA 2A4LA 4X3FB 4I1ZA 4YZCA 4AN2A 4F99A 4H1JA 5CYIA 5M57A 4H05A 4QP7A 1IG1A 1Z57A 3QQFA 1AQ1A 4XLIA 2QOIA 3KMWA 4RIOA 5CENA 1M2RA 4XG7A 5JMSA 5AFVA 1R0EA 3W32A 4O0XA 3KXZA 4U79A 2Z2WA 3EQDA 3SKCA 3LQ3A 5HE0A 2OKRA 3MA3A 5G1XA 3LFEA 3V8TA 3MPAA 5AP6A 3LFBA 1GIHA 3W8QA 5HBHA 2WMQA 5GZAA 1XBCA 4Q9SA 3FLNC 3ETAA 4XJ0A 4JR7A 4PL5A 2Z7LA 4FTTA 4QOXA 4ZTHA 4Y46A 3BYMA 3EQHA 5AUZA 2ITTA 3QRJA 3REPA 3QTRA 3HGKA 4RC3A 3VN9A 2R3MA 5LMKA 2CLXA 3I60A 3JR1A 4Z16A 4AT5A 2XK7A 1M52A 4ZTSA 3KA0A 4FV4A 3EN4A 4PDOA 3SGCA 2NNWB 2OGVA 3POOA 1G3NA 1DI9A 2DQ7X 3IONA 4MF0A 4ZTRA 3TZ7A 4F7JA 3A8WA 4D5KA 1XH9A 3ZUUA 4GYIA 3ENHA 3R00A 3HMNA 5K3YA 3UO5A 2XIKA 4NM7A 5HEZA 4L44A 4A7CA 4K1BA 5FD2A 1Q99A 5E9EA 2YAAA 5AV3A 3WF5A 2W4JA 3CPBA 4GMYA 3TL8A 4BGQA 2CNQA 2Z02A 4FNYA 3HLLA 4EHVA 5CEMA 3M2WA 3NDMA 4KBCA 5KUPA 3UVQA 2IG7A 2PY3A 5C01A 2E9VA 3AG9A 3EQRA 3HV6A 3ZFXA 1UKIA 5A4LA 3ZOSA 4WSYA 4O0TA 2PVNA 2C6MA 5AIKA 2HCKA 4RZWA 5E8TA 3DQXA 3PJ2A 5DLSA 3MH0A 3QQJA 1R0PA 2KULA 4BCPA 4EOIA 4XG3A 3PIYA 5EQPA 3IW6A 3D5XA 4TW9A 2A0CX 4TWOA 3ZS5A 2DS1A 4F6WA 3D5WA 3F61A 3QKKA 5TR6A 4AA4A 2X1NA 3VBYA 3FPMA 4AGUA 4FA2A 4RFYA 1REKA 4KKEA 2QURA 2BRNA 3LXKA 3PVGA 4BZDA 3KULB 4FKQA 4B8MA 1VYZA 4NU1A 4CTCA 5J9YA 4O7ZA 2CGVA 3PPKA 3WE8A 1WBSA 4FKVA 1HOWA 3BI6A 2UZBA 3PY0A 3P78A 5CSWA 3W16A 4V05A 4YNOA 5K0KA 4M14A 1BI7A 1OL5A 2W1GA 4APCA 2YDIA 1APME 3AXWA 3QD2B 1IA9A 3TCPA 1UU9A 4U9AA 1ZMUA 4J8NA 5JRSA 2YM8A 4JNWA 3LMGA 2Z8CA 5TF9A 2WTCA 5I4NA 4G5PA 5EW9A 3IGGA 3W1FA 2R3NA 3L9NA 4YHFA 2XYNA 4YTCA 4MBIA 4LL5A 1OI9A 4KRCA 4ZJIA 1XHAA 3ANRA 4AW1A 2XCHA 2XIRA 2ZV2A 3C4FA 3I5NA 2VO7A 3PE2A 4O91A 4RIXA 4MXOA 3P4KA 4YC8A 1PXJA 3R8PA 4S31A 3S0OA 3CQEA 3E93A 5L2IA 2QKWB 2J5FA 3BPRA 3OXTA 4ITJA 5F20A 4K8AA 1H1RA 2NRYA 4II5A 3NW6A 4QYFA 4YJVA 4ZSEA 4ANSA 3QCXA 5C26A 4E73A 5JGAA 1S9IA 2PE0A 5LVNA 5FEEA 2F57A 1VZOA 2BPMA 2W99B 2VTAA 1BI8A 4L45A 3E62A 5HKMA 3A61A 4HOKA 4P90A 4TYGA 3VS7A 3WZUA 4FC0A 5AM6A 5E4HA 5F94A 3UP7A 4IAZA 1S9JA 1ATPE 2UW8A 5EQYA 4FODA 4CD0A 4DGLC 4EH6A 4EC8A 3HNGA 2BAQA 2BALA 5CAPA 3HUCA 4LM5A 3EKNA 4D1ZA 4RFMA 4CQEA 3VS5A 4IJPA 5CXZA 1LR4A 2UW3A 3PJCA 3PY1A 5FP6A 3TXOA 1OZ1A 3PY3A 3RKBA 3IO7A 3EQCA 1NT2A 2ITNA 3O8TA 4CSVA 5JK3A 4Y72A 3FMJA 3VBTA 3SXFA 4OTQA 3QHRA 4Z9LA 4GH2A 1OMWA 4F9YA 4F1TA 5DT3A 3TUBA 1BUHA 2X6EA 2B4SB 1UNLA 2I6LA 2J0KA 2J7TA 2JIUA 3MYGA 5CANA 4O7WA 4MNEB 5H8GA 4ZS0A 3S00A 4N57A 3OCSA 4ANBA 3EFWA 4UV0A 1J1CA 4C3RA 4M69B 5LCJA 2YJSA 3MDYA 3HMMA 3F88A 1W84A 4BWXA 5BVOA 2XMYA 2R3IA 5IPJA 2Y0AA 4M68A 4DE4A 3AGLA 3IOPA 3KC3A 4W8DA 3BWFA 4A06A 2BZIB 3DK3A 3WZEA 3MY5A 3F5UA 4EK3A 1OL1A 5LVOA 3A99A 4PPBA 3V5JA 1Y6AA 5CU0A 2YFXA 3RPVA 4E6DA 4OGRA 3R7OA 1HCLA 4U8ZA 4G9CA 2CCHA 1LEWA 1Z9XA 2BVAA 3AC2A 3QQHA 3F3WA 4EWHA 2X39A 2WTKB 1WBOA 3UZPA 5KHXA 2J0IA 3COMA 3H9FA 3C4CA 3RPRA 1H27A 2ETMA 5A6OA 1U46A 2WU7A 1BKXA 4BDJA 3F66A 5HO8A 4ERWA 3BV3A 3ORZA 2CPKE 2FB8A 4I20A 3D2KA 4AX8A 2GFSA 4EI4A 5D7AA 5FDXA 5H9BA 3RPOA 1H4LA 3K3JA 3LJ2A 2WXVA 2YCQA 5TO8A 2WD1A 4QT1A 3TNPC 1QMZA 3KRWA 3N9XA 3NNXA 1TKIA 3S1HA 1E1XA 2Y7JA 5AV1A 1FBNA 2V22A 1P2AA 4HVIA 5DGZA 4FTQA 5GJDA 3R2BA 1P5EA 3MBLA 5DRBA 4J1RA 3QC4A 5DVRA 3LXPA 3HEGA 2W1HA 3W8LA 3DK7A 1E9HA 2BZHB 2B9FA 4FKSA 1QPCA 2V7AA 4AG8A 4I6QA 4AP7A 1UNGA 4MX9A 4FSWA 1HCKA 3CS9A 4DHFA 4D1XA 4EZ7A 3EQFA 5J9LA 2QKRA 2W1IA 2W1ZA 2X2LA 4YPDA 2ERKA 3E8NA 4LMUA 4U43A 2XJ1A 5JGDA 1JAMA 2YIYA 3UBDA 2CNUA 5B2LA 3IW4A 4WT6A 5CLPA 2ZM3A 3DBCA 3VRYA 3DTCA 4FG9A 5DEYA 1T46A 2I1MA 3C0IA 3D15A 4RFZA 2OSCA 5ICPA 4LYNA 3ZHPC 2C6TA 4FSNA 4F4PA 4QYEA 4AOJA 5JEBA 3D94A 3VUHA 2JEDA 3ZO1A 4DEEA 3R63A 4QP9A 1K9AA 4D1SA 3HMIA 1JBPE 5CSPA 5J7BA 3OWKA 1H0VA 3PG1A 2JLDA 4X21A 2PUUA 2XCKA 3P23A 4YJQA 4YTHA 1Q62A 3A7JA 4FZFB 1DS5A 2WPAA 3R9HA 4IX5A 1WZYA 4QMWA 2SRCA 4BFMA 2UW7A 1OPLA 1JKLA 3R6XA 4EH2A 3LFCA 3V5TA 1XR1A 2QO2A 3ZLYA 5IISA 3UQFA 2A1AB 3OXIA 3QTZA 3BLQA 3QBNA 2OW3A 4B6LA 1YI6A 5CF5A 5KMNA 1WCCA 3TNHA 4LMNA 3HVCA 3ZEPA 3C7QA 4IVCA 4QMMA 4C33A 2JD5A 2XNMA 4NCTC 3U4WA 2I0YA 3MS9A 4CT1A 2HXLA 5FM3A 1R1WA 3OWPA 4NUSA 1ZOGA 4N70A 3MSSA 2Y9QA 4O0YA 1GJOA 4ORKA 4IWOA 4EUUA 3LQ5A 4G1WA 2W1DA 5IF1A 1ZOHA 3FLZA 3TNIA 4DG2E 4BDFA 4OLIA 1J7IA 4DTKA 4AN9A 3O8UA 1JKTA 4CFFA 3UPZA 2QNJA 4XOZA 5CU2A 4WG5A 5DWRA 4F7NA 4I94A 4ZZNA 4Y5QA 4M97A 4IB5A 3DKGA 4DF3A 1NY3A 4X6RA 2XJ0A 4BDDA 4CGAA 4V0GB 4AU8A 2QLUA 4KIPA 4GT4A 2CMWA 5GJFA 4RSSA 5HESA 4JBPA 3CTQA 4O96A 5AEPA 2XP2A 1BLXA 2YABA 3LOKA 4IZ5A 2W4KA 4Q9ZA 4CEGA 4IFGA 3FI2A 3GC7A 3RWQA 4DH1A 5KMMA 3RPYA 4BGHA 4YNEA 2ITPA 4RG0A 2P2IA 4FV9A 3DGKA 4FL3A 5DOSA 4IEBA 5CTPA 2F49A 3UVRA 4FTKA 2E2BA 4O7TA 3GEQA 3ENMA 4FNZA 3Q5ZA 4XH6A 4XOYA 5HD7A 4AW0A 3IK3A 4M8TA 2WTVA 3E87A 3EFJA 4CFMA 3OXZA 4RRVA 4QMYA 4WO5A 4BY9E 5AMNA 4QP3A 4TL0A 5CF6A 5FUTA 4JDHA 5EG3A 5K5NA 3G51A 3OF0A 4F9BA 4NZWB 1QPDA 3IOKA 3F2RA 4R7BA 3TJCA 4KKHA 4ZTMA 1CMKE 4F6UA 3QZGA 5C1QB 3PVBA 2AYPA 2G01A 3U8WA 2R3QA 2VO6A 4FK3A 4W4WA 1ND4A 4M66A 5E8XA 3QD0A 3A7FA 3BLHA 3OEZA 3DXPA 3OWLA 2G15A 4YHJA 1OBDA 2EB3A 3PXKA 2ITZA 4QMZA 2VTJA 3R7VA 4JAJA 3DJ6A 5KMIA 2W5BA 2CGXA 3F82A 4YMJA 4Z7HA 4DH7A 2BAKA 3I7CA 4V04A 2QCSA 3UNJA 3UODA 5HNGA 1H1QA 5CAVA 1V0OA 3PJ3A 1UVRA 3RCJA 3QWJA 4ZMEA 3W2OA 3V3VA 5HCYA 3QQGA 4WUAA 4R77A 2GSFA 1RJBA 2QOFA 4RWKA 5AADA 4F0FA 1KV2A 3BGQA 3AMBA 4FTOA 4J96A 1P4OA 4FSYA 2GMXA 3AT3A 3FI4A 5JT2A 3QD3A 4FL1A 4H3BA 4EQCA 2P4IA 4J52A 2IZSA 4BVUA 4RMZA 2EXCX 3F2NA 4F1MA 3KN6A 3B8QA 5IQBA 5AAFA 3FY2A 2YISA 3MB6A 5ITAA 1IEPA 4QO9A 2EWAA 4J8MA 3DLSA 3NUNA 4JR3A 4GYGA 3UG2A 4EK8A 4EK5A 3Q4UA 3HL7A 5KZIA 1PXMA 3EWHA 3F3ZA 5EI8A 2ITQA 4FSUA 3DAJA 4J99A 3PIXA 5FP5A 4QTCA 3UE4A 4IZ7A 4BCJA 2YM3A 2J4ZA 2YITA 5A54A 2R3GA 4D4YA 3PE1A 3QU0A 5CS6A 3SVVA 2UW6A 3TZMA 4O0WA 4CNHA 5M4CA 5IQCA 2PE1A 4CFWA 1R39A 2F7EE 4MXZA 4AGWA 4D55A 3DB6A 5IG1A 1QPEA 2OIDA 4WOVA 4YJRA 2X9EA 4NTSA 3S95A 3IDPA 4C37A 4EORA 5AA9A 4NM3A 3TNWA 4QPSA 3FZ1A 2ZVAA 2BRBA 4UN0C 2VNWA 3PA5A 3LW0A 3GP0A 4GU9A 4QQTA 4B7TA 5E8VA 1GZNA 2YM6A 2XKDA 4UZDA 3KN5A 3QL8A 4I92A 3NPCA 3TZ8A 1EH4A 2XIYA 4JDKA 5FEQA 1VJYA 3FDNA 4MXCA 3C5IA 4RPVA 3CBLA 3LLTA 5BVDA 3UIXA 3OG7A 3FXWA 5AUXA 4U44A 4ZMFA 4IE9A 2B9IA 3PSDA 2XUUA 3H0ZA 4ZLYA 4IMYA 4N6ZA 2C30A 4Y95A 5EYDA 4ASXA 3CR0A 5A46A 3QAME 1R78A 2JKKA 3HECA 4HGTA 1J91A 4L8MA 4LUEA 3OBGA 4RBLA 4YJOA 5L6WL 3QXOA 4UX9A 3MI9A 5IDPA 1OECA 4DAWA 4OTWA 4U80A 4C0TA 4UB7A 3PTGA 4MK0A 4RX5A 1H1SA 3UOHA 3UC4A 2ETRA 3VULA 4AOTA 5CASA 4WNMA 4FZ7A 3QRKA 2UVYA 5JFXA 1H0WA 3CCNA 3H30A 2BZJA 4NCTA 3DXNA 4IM2A 1OPKA 4CXAA 2UZWE 5EKOA 4BCGA 2CGWA 2GNJA 2OF4A 3TV6A 2IPXA 1XH6A 2GPHA 2Y8OA 4ASZA 3R22A 4USFA 4IADA 4PV0A 3Q5IA 2RIOA 2H34A 3OUKA 4JQEA 4OBQA 5DIAA 3VJOA 4AZTA 3FZSA 4Z55A 3PP0A 3OUNB 4F70A 3CSVA 1SVEA 3NYNA 4IAKA 5CNOA 4EC9A 3P9JA 3T3VA 3Q9ZA 4GG7A 2NP8A 4A9SA 5C8KA 5HD4A 3UJGA 2V7OA 4FTIA 4IBMA 4FL2A 4O0RA 2C6EA 1XO2B 4AT4A 3GXLA 1WAKA 2C0IA 3F7ZA 1AGWA 5BVWA 5CSVA 4BDBA 5EYCA 4NWMA 2JKQA 3BCEA 2E9OA 3EB0A 3GC8A 3D5UA 2RFEA 2O0UA 5CU6A 3VWAA 5AP1A 3WF9A 3UGCA 4IC8A 5KMOA 5CF8A 5IQGA 4UWYA 3RAIA 3BYVA 5CEOA 2YM4A 3UC3A 4USEA 4AZFA 5FTQA 3GU6A 3IW8A 1YHSA 3D83A 2VGOA 1Q97A 3Q9XA 4ZTQA 3QF9A 4JQ8A 3PXQA 4CKJA 4FG7A 2BDFA 4ZJJA 3NEWA 5AP2A 2WMWA 3QKMA 3FLWA 1U5QA 2BIKB 3HRBA 2UW4A 3WIGA 3DZQA 3AD6A 3C4ZA 3GOKA 4K11A 3AMAA 1WMKA 3LJ1A 5HO6A 5JQ8A 5A4QA 3DS6A 2XF0A 3BX5A 3VS4A 4ANQA 5F9EA 2Z60A 4X2JA 3F3TA 3FZOA 4IAYA 2PK9A 2VD5A 4ACGA 3RINA 2O65A 3FJQE 4FZAB 4WBBB 4G34A 4E8AA 2CN8A 4MXYA 2R3FA 3Q4ZA 4CFNA 3BBWA 1YOJA 3G33A 3MTFA 3KKVA 3NS9A 5HBEA 2XK4A 4PNKA 2WOTA 2XRWA 4PX6A 3ZDUA 3EL8A 4FMQA 5E1EA 3ZM4A 4DFLA 4ZSAA 1JLUE 3WARA 5HO7A 4FKUA 2WKMA 3Q4CA 4OAUC 2C1BA 3GCUA 5BUJA 3QCQA 4UXQA 4ZSLA 4E4LA 4AACA 4ITIA 3DQWA 5K4JA 1FOTA 4TWPA 3AGMA 2GQSA 3TIYA 3CY2A 5B2MA 2QHMA 4UYNA 2OZAB 4MBLA 3EFLA 3C1XA 4G9RA 4R7IA 5AX9A 3WOWA 2CKPA 3ZSIA 5C4LA 1DI8A 4L3PA 1U54B 1JKSA 2VX0A 4R78A 3PFQA 4AZVA 4DFBA 5EDQA 1H24A 1QCFA 5KE0A 2PZ5A 3O0GA 3HYHA 4XBRA 2UZTA 1OUYA 2RG5A 3OHTA 4XG2A 3SOCA 3BHUA 4N0SA 4KIKA 1YOLA 4MF1A 4X2GA 3ZO2A 2GQRA 2R3OA 2XEZA 2VWIA 5KBRA 2H96A 4F63A 3R8UA 3MW1A 4NFMA 3CQUA 4BDEA 4L53A 4XRLA 4FKIA 3JPVA 3FE3A 3PZHA 1WBPA 3ZU7A 3UYSA 4GJ3A 4BDKA 1YXVA 4TYEA 3QXPA 3TV4A 3VAPA 4ANOA 2IVUA 4JVGA 5M51A 5CX9A 3H4JA 1SNXA 5GZ8A 4FNWA 3WZJA 3QHWA 4FEWA 5FWKK 1M17A 2JIVA 1PKDA 5AUYA 3VQHA 5I9YA 3TDWA 5A4CA 5KMKA 3QA8A 2YIRA 4WKQA 4XV3A 5J1WA 3OTUA 3KRLA 3BE9A 4IIRA 2GQGA 3SHEA 3PYYA 3OOGA 5A6NA 4LV5A 4HPUE 4CMUA 3TKIA 1SM2A 2UV2A 3BYOA 4MKCA 4TNBA 4ENYA 4ZSGA 3FKNA 4IX3A 3UQCA 3RALA 1YVJA 5M44A 4DC2A 4IVDA 3GU5A 3MVJA 4RJ7A 4RLLA 2PVKA 3ORIA 4OBPA 5IU2A 3OW4A 2OFVA 4ANLA 5GZ9A 4BTFA 5BUEA 5HG7A 5I0BA 2R3JA 3DT1A 5DA3A 3UZTA 3IQ7A 4PTCA 4X3JA 4BKZA 3QX2A 1M7QA 1ZY4A 5D10A 2GTNA 2XBJA 1V0PA 3D9VA 5HX8A 2QG5A 4IHPA 5EOLA 1NVSA 1VEBA 4BI2A 4EQMA 4E4NA 4D0WA 4AS0A 1RDQE 3AT4A 5H8EA 5FEDA 1FMKA 4IAAA 1YWNA 3L9PA 4X7QA 4E93A 4FVPA 5HG8A 3JS2A 4IVBA 2VWZA 2HK5A 2ZM1A 1OVEA 5BVFA 2R3LA 3DB8A 3GBZA 4RZVA 2VU3A 2YCFA 4QPMA 3QZFA 2BHHA 4YJPA 4FZDB 3H9OA 3BQCA 1JPAA 1Q8UA 4TZRA 4DLIA 4GIIA 1ZOEA 3RNIA 2OXDA 4KBKA 3LXLA 4TKSA 3TKUA 1ZAOA 3F6XA 4YSMA 3C0HA 1K2PA 4MD7E 5CT0A 2VWXA 2VWYA 5AR5A 4R1VA 4O0UA 3E64A 5CEKA 4LL0A 4FV1A 2GHLA 4BBMA 5CT7A 4A07A 4E4XA 4PMMA 4YUQA 3NAYA 2C3IB 3I79A 4RX8A 5LARA 3NSZA 2HZ0A 3I1AA 3KXMA 4GK3A 4GS6A 2YN8A 2QR8A 3NYOA 5AP5A 1V1KA 4EHZA 4K2RA 3LM0A 4RIWB 3RCDA 3QYZA 1FPUA 3AC3A 4D2WA 1F5QA 1UA2A 1PXIA 3IGOA 3IW5A 2C4GA 3K2LA 3UMXA 4BBEA 3HZTA 4QPAA 4B9DA 4OTIA 3KMMA 3QGWA 3OP5A 3DJ7A 1GIJA 2V5QA 3GVUA 3E8DA 1UV5A 4FTLA 3R9NA 3RZBA 4RLKA 5AA8A 5AAEA 2F2UA 4CCBA 5HTBA 4I93A 3G6GA 1KE5A 4D2RA 4RIYB 3LVPA 5H8BA 2BILB 4EH5A 4MYGA 3PPJA 2ITOA 4PF4A 4AZSA 3SQQA 1H08A 2J50A 2V0DA 3FV8A 5IQFA 4O7VA 3EN7A 4XS2A 3AC1A 5HU9A 4GUEA 5HE3A 3SG9A 1BX6A 3V01A 2JKMA 1PXLA 3FAAA 2QQ7A 4YHTA 3SOAA 4AF3A 3Q96A 3V6RA 2J0JA 2UZVA 4BWKA 4ZZMA 3R1SA 3ZC6A 4GVAA 2Y6OA 4BTKA 5I9ZA 3R28A 3BHHA 3GFWA 4O7YA 5I9WA 3O71A 4OT5A 4EH3A 5DNRA 3GOPA 4U45A 1UU3A 4XLVA 2WTKC 5E92A 4O6LA 2UZDA 3KVXA 1JOWB 4C7TA 2WQBA 5EHLA 3POZA 4LQMA 2X8IA 4JDIA 1H26A 4D4RA 3A4PA 5DG5A 3AD4A 4ZIMA 4YJTA 1FVTA 3RPSA 2OO8X 2VTPA 3I81A 1NVRA 4LOPA 5BVKA 3COKA 1SNUA 4X3FA 4JT3A 5AR8A 4I0SA 5HVKA 4QNYA 5IZFA 3KB7A 2EB2A 4QTAA 3W2SA 4ZLZA 3CP9A 3JVSA 3M42A 4S2ZA 3UG1A 3FUPA 2VTHA 4R5SA 2HXQA 2JAMA 1KOBA 3QA0A 4ACDA 4W9WA 1A06A 1XBAA 3ORPA 3W2CA 5LVMA 5GIOE 4PP7A 4MXXA 4ID7A 2ONLC 4L9IA 2WTDA 3DCVA 2R3PA 3KL8A 1B6CB 4RC4A 3SV0A 4J95A 3PXFA 5B7VA 4CCUA 4BI0A 1WVYA 2I7QA 4YLLA 4ZTNA 1Y57A 1ZLTA 3EMGA 4UBAA 2J5EA 4EEVA 4UXLA 3SLSA 2YCSA 4E1ZA 3EQBA 1URCA 1W0XC 3O51A 5E8SA 1PXOA 4LRKA 2IWIA 3ZTXA 4F7LA 2R5TA 3KK8A 2QR7A 1ZYCA 3ZFYA 1ZARA 5EHOA 4BICA 5I9VA 3CD8A 3LE6A 2PZYA 1VR2A 3COHA 5L6PA 4EOMA 4AGDA 2OIBA 5EM5A 2J90A 2RFNA 3JUHA 4FVQA 3RK9A 3Q04A 4P5ZA 4JG6A 3Q9YA 2ZV7A 3PVWA 3NUPA 4HVHA 4DEHA 4MHAA 4U40A 3NUYA 4BBFA 4HVGA 2QOKA 3NZ0A 3VNTA 5H3QA 3PRIA 2RSVA 4MCVA 5CQUA 4DGMA 2QOQA 1CDKA 4PDSA 2EXEA 4JIKA 4DEGA 3ZO4A 1TQMA 4TWNA 1WFCA 4I6BA 4PWNA 4OTDA 1KE6A 3CQWA 3AMYA 3ZSGA 2OXXA 4EBWA 5A3XA 4LRJA 3Q2MA 4IVAA 4I6HA 4WA9A 2OH0E 2CCIA 3R1YA 3BU5A 2IW6A 4HGEA 2A19B 2O8YA 4FGBA 2V62A 3ROCA 3NUXA 3WILA 1X8BA 5J8IA 2HWOA 2WMRA 5HHWA 4F0IA 3OVVA 2B9JA 2OG8A 3GC9A 2VTSA 2QU5A 3KULA 5AUTA 1K3AA 4M3QA 3DDPA 2UZEA 3KREA 2ITUA 2H9VA 4QQ5A 4FT7A 2WOUA 2GDOA 3PSCA 1JVPP 1ZYJA 3ITZA 1B38A 2WEIA 4AT3A 1F0QA 5JQ5A 3F9NA 3ZSHA 2FYSA 4HGSA 4LFIA 4BCQA 1Q41A 4U0IA 3T3UA 2JBOA 2YLEA 4A4OA 2CKEA 4NIFB 5ANIA 1JSTA 3LHJA 4FSZA 4XMOA 4Y85A 4BDAA 1IASA 3DA6A 5BMSA 2C0OA 1O6KA 3P1AA 2ZOQA 3MIYA 3PVUA 2WMSA 5E1SA 5BX0A 2XNNA 2QHNA 4QP1A 4P7EA 5IEXA 2X4FA 4RJ5A 4EH9A 1OL2A 1T45A 4BCKA 5L3AA 3UIMA 4JL9A 5IA5A 3MVLA 3OT3A 4TN6A 3R2YA 3BYSA 4GVJA 5L2QA 5IQAA 5CF4A 5LMBA 5EW8A 4WRGA 3F5GA 2UW9A 3DNDA 2HZIA 4FIIA 3WZDA 1JQHA 3FQSA 5JRQA 1UKHA 3KCKA 4M0ZA 4DBNA 5IMEA 4YLKA 4O7SA 3QWKA 3P86A 3OY1A 4EOLA 1AD5A 5ANDA 4DFUA 5GNKA 2B1PA 4XEYA 5ACKA 4EOSA 3R7EA 3BE2A 3R73A 2OIQA 2G2HA 3V5WA 1J7UA 5DR6A 3O17A 4QMXA 1GZKA 4L42A 2A2AA 4O2ZA 3UQGA 3OCGA 4E26A 1L3RE 4XX9A 3CGOA 2YACA 5AR4A 1J3HA 2F4JA 3DBFA 4IZAA 4QRCA 4HCTA 4FOCA 5HBJA 2YZLA 3GB2A 3OOMA 4GCJA 4GEOA 2WMUA 4L7SA 3HV5A 3MWUA 3PXYA 4G3FA 2GHGA 4FZ6A 2PVJA 1LPUA 4MNEA 3HDNA 5E8UA 5M56A 3EN6A 3NUUA 3ORXA 3KQ7A 3TKHA 5IMXA 4M69A 2QOCA 3WBLA 3KU2A 2C5OA 4DTAA 3IECA 2FSLX 3QTUA 2IZUA 2YLFA 4PDYA 5IQIA 2IW8A 3COIA 4PPCA 5ETIA 4GFMA 2ESMA 3ET7A 3IDCA 4UALA 4FYNA 1PJKA 3F5XA 4JG8A 5BPYA 4FR4A 3DLZA 4RQVA 4C4IA 3QD4A 2B55A 1YWVA 5EYKA 3P0MA 4E6CA 1KE7A 3NGAA 4JS8A 3RWPA 1H1WA 4CT2A 1OITA 4ZOGA 2C0TA 3QKLA 4HJOA 4JOAA 5F1ZA 2ZYBA 4O0VA 4EZ5A 2IVVA 3EZVA 3MA6A 2YAKA 4CKRA 4D2PA 4AFJA 5M4UA 3L8VA 3R02A 3ACKA 3BHVA 4U42A 3LFQA 3R7YA 5HTCA 4O21A 5LQFA 4IDTA 3RBWA 4DGOA 5HLWA 4HYUA 4QTBA 3MB7A 5IEVA 5J9ZA 2PVMA 3FZTA 3ZMMA 3C4XA 3S4QA 3PJ1A 1JSVA 4KD1A 2G9XA 3BV2A 4RJ3A 3NWWA 4HW7A 4YURA 5C8NA 2QO9A 2YHVA 5CI7A 3ZBFA 4M84A 3D14A 5CU4A 3V04A 2C47A 2Y6MA 3EQGA 1UWHA 4HYSA 3HAVA 1YW2A 3MN3A 3ZDIA 5AX3A 2XKFA 4O82A 5JSMA 4FVRA 2VX3A 3RAWA 3VUDA 2UW5A 4PL3A 2LGCA 1FGKA 4O86A 4TPTA 4EH7A 1SYKA 5DYJA 3DKFA 3VVHA 3WYYA 3ID6C 4FIEA 4YP8A 4IWPA 2I0EA 3BGPA 1OBGA 4A9TA 2J51A 4E3CA 4U7ZA 1PKGA 3P7AA 4FUYA 4AZWA 3ZUTA 4BCMA 1CKJA 3ELJA 3FI3A 1FQ1B 1OB3A 2J0MB 2R3KA 2W9FB 1STCE 3AC4A 3JVRA 3LCKA 4W4VA 4XRJA 4BTJA 4D4SA 4EKKA 2PU8A 4GG5A 3D0EA 4ZK5A 3VBXA 4NL0A 3FPQA 1H07A 3A8XA 5E8WA 2GU8A 3LQ8A 4IQ6A 5LWMA 3O23A 5CXHA 4JBOA 4YZNA 3SDJA 3G9LX 4AW2A 3UVPA 4CKIA 3E92A 4ZEGA 4CYJA 4H3QA 5ANJA 1KE9A 2XNBA 3T8OA 3KXNA 4Y5HA 2BFXA 2PHKA 4U41A 3QUEA 3EOCA 2J0LA 3I6WA 3DK6A 3U6HA 5EM6A 3G15A 1CM8A 2VNYA 1OUKA 3F69A 2QODA 3ORTA 5I3OA 4BGGA 4PPAA 2Q83A 4QMOA 3FI8A 1IR3A 4HYHA 2YIWA 3BU6A 4F0GA 3EN5A 5GHVA 3ZXZA 4AZEA 3BU3A 2WIHA 2EUFB 4W9XA 1OIYA 3AD5A 4AW5A 3CTJA 5KX8A 4BC6A 3TG1A 2CKQA 3GCQA 1Q24A 5ANEA 4EWQA 4JIAA 2PMIA 5J1VA 2C1AA 4RVKA 3DXQA 4NFNA 4GKHA 3IPHA 2XNEA 5EDRA 3A7IA 4KABA 3EQIA 3FKOA 4PTEA 5EH0A 4PQNA 4EOPA 3MVHA 3ERKA 4G3GA 4XP3A 3G0EA 3RVGA 5HOAA 5CVHA 3P7CA 4CTBA 4KRDA 3BZ3A 4F64A 3C0GA 4FTAA 2R64A 2OJFE 3TZ9A 3HA8A 4S33A 4OBOA 3R9RA 4L52A 4ERKA 1W82A 5EI6A 4V0GA 1UNHA 3I5ZA 2H8HA 4I5HA 4MVFA 3FMLA 3TI1A 5BVEA 4TNDA 3Q4TA 4KBAA 2HELA 3OZ6A 5E8ZA 4ZTLA 4QYGA 5CAQA 3OWJA 4HZSA 4DA5A 1PMVA 2IZTA 4OR5A 4G5JA 4XHKB 3ORMA 4R7HA 2BUJA 1QPJA 2VGPA 4ONAA 5KHWA 4C38A 4BIBA 1MP8A 3F2AA 4G3CA 1LP4A 3ZRKA 2QVSE 4KB8A 5EFQA 3SC1A 4I21A 2X8EA 4F09A 4EOOA 4O1OA 2W05A 4JX3A 3D5VA 4YR8A 2F2CB 2CN5A 3KXGA 3VS1A 1OIRA 4ZY5A 4FKGA 4YGAA 5M09A 3B2TA 3UPXA 4C4HA 5KCVA 1BL6A 4JRNA 4IM0A 4MEDA 4RX9A 5KMLA 5CY3A 3VF9A 4C57A 2XA4A 5DI1A 5IQHA 3NYVA 3QQLA 5FXSA 3FZPA 1Q3DA 1PMEA 5C8MA 4ALUA 4IB1A 4YBJA 3G5DA 5H2UA 1SZMA 2B54A 1OIQA 2WMBA 3VJNA 4D58A 1YWRA 2I0VA 3R1NA 4ZP5A 4TWCA 3DDQA 2OH4A 2BMCA 2X0GA 4UYAA 3RI1A 2JBPA 4AFEA 1KWPA 5AP4A 2OI4X 3FMNA 5FBOA 3NNWA 1NXKA 2WEVA 3H3CA 3Q6WA 3QTSA 2IZRA 4ITHA 5HG9A 4PTGA 3UOJA 3VHKA 1IA8A 2XM9A 4ALWA 3OBJA 3EKKA 4WIHA 3CPCA 4EOKA 4UMUA 4BCFA 2PZRA 3CKWA 3LFFA 4L3JA 4MQ2A 3M1SA 3MTLA 4NJDA 3D7TB 2AC5A 3LCOA 4FK6A 5KMJA 2WAJA 4QP6A 4RJ4A 2QC6A 4FKPA 4S32A 2OXYA 4EK4A 4G6OA 3VS6A 3ODYX 4A9RA 4JI9A 1P14A 3GCPA 4NEUA 2OJ9A 2HW6A 4JXFA 5AR2A 1YI3A 2W0JA 4M7IA 2JDRA 4CFVA 4S34A 2C68A 2B53A 2C6DA 2JDTA 4QMSA 1OKYA 4YPSA 5EDPA 5TE0A 3RK7A 3CGFA 2Z7SA 4KS8A 4DEDA 4GIHA 2JFLA 3V5LA 2VO3A 4R5YA 1M14A 3R8MA 3VBWA 4R1YA 5LMKC 3ORKA 3R83A 2JDSA 5M55A 3R71A 4IJ9A 3NYXA 4O7NA 3LFAA 1NVQA 5HVJA 4QNAA 3PJ8A 4L6QA 1U4DA 1XKKA 3UDBA 2CJMA 4E5AX 3SRVA 3ZRMA 2X8DA 4GT3A 3JYAA 3LFDA 3PIZA 1PF8A 1ZRZA 2R4BA 5LMAA 4HNIA 2UVZA 4R3CA 3DBQA 3IKAA 4TYIA 5HVYA 2VWVA 5HLNA 2VWBA 3VBQA 3VRZA 3BBTB 2IO6A 4IAIA 2W06A 4A4LA 4GW8A 3A60A 3IS5A 4PP9A 2GNGA 5JN2A 2FSMX 3ZLSA 3ZEWA 5ANKA 5CEQA 2GCDA 4RVMA 3NCGA 2XVDA 2QOLA 1OIUA 3DFCB 5HCZA 1Y8YA 3LCDA 2HW7A 2JGZA 4FSTA 4EH8A 4D5HA 2QG7A 2REIA 2QOHA 2BDWA 2VV9A 3F3VA 5HI2A 3FSFA 3FKLA 4EOQA 5LOHA 3MJ2A 3QCYA 4J71A 4FGRA 4IH8A 4L43A 3LFNA 5CSXA 3UIUA 4Z3VA 3QRUA 4BRXA 1PYXA 5HU3A 4QP2A 4E4MA 4BCIA 4OTGA 1YXXA 2IN6A 4U3YA 5E91A 4DGGA 1BL7A 4I6FA 3EL7A 4EK6A 4GKIA 3HRFA 5D7VA 4DT9A 4HVSA 4PMSA 3LM5A 2XEYA 2HY0A 5LVLA 3HX4A 3PDTA 4C4JA 1I44A 5HCXA 3GQLA 3SA0A 2J2IB 3KMUA 1YOMA 2GS2A 4FNXA 5CI6A 3RTPA 3ZYAA 5AUWA 4C4FA 1SVHA 4ARKA 4K6ZA 4YZBA 2EU9A 2VTOA 3CIKA 4FBXA 3HV4A 1XWSA 3NIEA 5CVGA 4QP4A 3MFUA 3T9TA 4CG8A 4RJ6A 2WTJA 4YBKA 3W18A 4A4XA 2CKOA 4FOBA 4KS7A 4BTMA 4NKAA 5JFWA 3MH3A 2JITA 3CEKA 3R7UA 4PMPA 4OTRA 3ZC5A 3KRXA 4WSQA 5EM7A 4YJUA 2R9SA 4DFYA 2RGPA 2HZ4A 4RVLA 5ETFA 2WMTA 3DOGA 3ZFMA 4LOOA 5DRDA 4XBUA 5LWNA 4CV8A 4H39A 4LGHA 3R21A 3HV7A 5JKGA 4D0XA 1ZY5A 3A4OX 3GI3A 4TYHA 5KKRB 3RM6A 2PVLA 3NX8A 3RAHA 4CZUA 3I0QA 5AR3A 3FZRA 1OKZA 4YC3A 4BDIA 4CZYB 3FLYA 5DH3A 2H6DA 1PMNA 2C3KA 3DBDA 4L00A 3BKBA 2C3LA 4K0YA 5ANOA 2W1FA 3UNZA 1P4FA 3NRMA 5CZHA 5AIRA 3LXNA 3N4UA 2YDJA 2XNPA 4KNBA 3A7HA 2WTIA 3KXHA 4BDGA 1PXPA 2W5AA 3FLSA 5TKDA 5B2KA 5B0XA 4BF2A 3MV5A 3BQRA 2ETKA 3KF4A 3FXZA 1XH8A 2VTRA 4AN3A 1YQJA 1ZZLA 3IW7A 4M13A 3ZZEA 4DFZE 3CXWA 2OJIA 3E88A 3UO4A 4O1PA 2NO3A 4XCUA 4QMQA 2VWWA 3QCSA 3QRTA 4C2WA 4WHZA 2CNVA 4QYYA 3FQHA 3GT8A 4MWIA 5JZJA 3LPBA 3HUBA 3RHXA 3ZO3A 5M4FA 2W1CA 2GTMA 4LUDA 3FMKA 1W8CA 2WIPA 1MUOA 4BYIA 4YU2A 3FEGA 4P2KA 1XH5A 2WO6A 4LRMA 5EM8A 3T9IA 1RW8A 3FHRA 5BMMA 3U87A 1YDTE 4USDA 4C36A 4FF8A 2YWPA 3U6JA 3NMUF 4CV9A 2VTLA 3Q52A 4UMRA 2PVRA 3P5KA 1GNGA 5AP0A 5KNJA 2JC6A 4ANNA 4K77A 2OFUA 4D9UA 2VWUA 3UP2A 2C3JA 4WNPA 3TM0A 2QOBA 4I0TA 1PRYA 4OTPA 3ZBXA 4WNKA 2HENA 3K5UA 2WU6A 3QLFA 3AC5A 4AGCA 1H25A 4H1MA 3TNQB 3MH2A 3V6SA 2W4OA 1GZOA 4KIOA 2X7OA 2LAVA 5A14A 4ENXA 3KF7A 1E1VA 3QUPA 3MGYA 4CYIA 2JDVA 1M2QA 3JY0A 5FGKA 4O83A 5HIBA 5HNBA 4BL1A 2OZAA 3K3IA 2GFCA 4M12A 3Q9WA 4PDPA 3OCBA 4C3PA 3RAKA 5L4QA 3EHAA 1GIIA 2PUIA 4R3RA 2C5YA 4F9CA 4OT6A 3DKOA 1U54A 1MRVA 4FTNA 4FV5A 1TQPA 4RIXB 3UO6A 4E7WA 5KO1A 2JKOA 1PY5A 3GC0A 4HPTE 2JIIA 2IVTA 4XG9A 4CFXA 1WBWA 2VTIA 2PUPA 4D2SA 3CKXA 3DPKA 3SX9A 5CAUA 3RMFA 4XP2A 2P55A 3DKCA 4FEQA 1VYWA 1OKVA 2BROA 3FY0A 4M67A 3V51A 3NUSA 1OKWA 2FSOX 5TOZA 3VS3A 3R9DA 5EYMA 3W2RA 4DEBA 4AE9A 3QZIA 3V8SA 5JGBA 4CMOA 3ATSA 3I0OA 3A2CA 4IC7A 3EH9A 4NT4A 4FIGA 4IZYA 2YEXA 4DCEA 3DJ5A 2ZV8A 2I40A 2YM7A 1PHKA 2ZDTA 3EFKA 4XNEA 3ODZX 4KSPA 3VS2A 2Q0BA 4TXCA 2YERA 3QALE 4ALVA 1A48A 4BDHA 4NM0A 5JFSA 3DBEA 4WD5A 4QQCA 3NW5A 4QD6A 1Q4LA 5J5TA 4C35A 3RP9A 3LMIA 3GCSA 2XBAA 3KCFA 2X9FA 4MAOA 2B7AA 3U9CA 4C8BA 2W7XA 4RJ8A 4TY1A 2J6MA 5AP3A 3VW8A 3WI6A 3VBVA 2IVSA 4KWPA 1NA7A 4QMTA 5IEYA 3ALOA 5EOBA 1G8SA 3W2QA 2IJMA 4FTUA 1CKIA 2PVHA 4UZHA 3SXRA 5DPVA 2X4ZA 1DAYA 2P0CA 4L01A 2ITYA 3WYXA 3R30A 4C2VA 4FV0A 3PLAE 2XB7A 3RK5A 3HMPA 5C9CA 2YCRA 2ZB0A 3C4WA 4DEIA 2CDZA 1U59A 4G3EA 2NRUA 1O9UA 3I6UA 4G31A 4L68A 1H01A 4O2PA 4IW0A 4EJNA 2PTKA 2BCJA 3A7GA 2YZAA 3DZOA 4R3PA 1TQIA 5FM2A 4GRBA 3HP5A 2RG6A 3JXWA 4CLIA 4RWIA 4NTTA 2UZOA 5IUGA 3U54A 2Q0NA 3FC2A 3GU8A 3QZHA 3OROA 5IUIA 4CMTA 4FIFA 4FV7A 3UZRA 4UMPA 1F3MC 3QC9A 5IQEA 4G17A 4UWBA 4YO6A 3NCZA 4FV2A 5IKWA 2QOOA 4BZNA 2DWBA 3AOXA 3PA4A 3FMMA 4E5BA 2XZSA 3PA3A 4XP0A 2GS7A 4R6VA 2R2PA 4N4SA 3PXZA 5G6VA 4G3DA 1YKRA 4U5JA 4ASDA 3EYHA 4UEUA 4AAAA 4WG3A 4EQUA 4FEVA 4Y83A 5BYYA 3UOLA 4AUAA 3MFTA 3MVMA 2P2HA 2G2FA 4W8EA 4BCOA 5DE2A 3H9RA 4CQGA 4CRLA 3BLRA 5M08A 3NLBA 4O38A 2BRGA 5HNIX 3FSKA 4FT3A 3NIZA 1J1BA 4C58A 3G90X 2E9PA 1GOLA 4XV1A 3VO3A 1CSNA 4BCHA 2F7XE 4BDCA 3BWJA 4MXAA 3CY3A 1OGUA 1U5RA 3CE3A 3R1QA 5D9HA 3PWYA 4RIWA 2F7ZE 4IFCA 4XUFA 5ETCA 4AXAA 3CJGA 4C4GA 5I9XA 3JY9A 5FXRA 2XRUA 2JAVA 5DMZA 4NYEA 4Y8DA 4IANA 3E8CA 4FICA 2X81A 4NW6A 4RT7A 5T3QA 4WNOA 5F4NA 5LVPA 2VTNA 5CWZA 4UMTA 2BAJA 3BEGA 4RQKA 4I5CA 5ACBC 1RQQA 4IWDA 4NKSA 5L8JA 2OBJA 4YSJA 4JRVA 3Q53A 2PMOX 2VTTA 4RIYA 1MQBA 4XV2A 3C4EA 4J97A 4F9AA 2FUMA 3E3BX 2RF9A 3U6IA 1Y6BA 1FINA 4X2FA 5HICA 2ZV9A 3OTVA 5J7HA 5EW3A 4RA5A 3L9LA 3VC4A 3ROYA 4JBQA 4FEXA 5GJGA 4LI5A 3NNVA 3EIDA 3P08A 3PRFA 4TTHB 2OJGA 5K9IA 3MY0A 4I0RA 3NVKI 3MY1A 3TT0A 1ZXEA 5L2WA 2B52A 3FMHA 5CVFA 5E7RA 5EQEA 4QTEA 3OEFX 5DHJA 5A4EA 4LGGA 5FTGA 5FXQA 3PLSA 3BYUA 4QMLA 1Q8YA 4FT0A 4QP8A 4EUTA 1M7NA 1ZYLA 1Q8ZA 4YZ9A 2XM8A 4E6AA 1O6LA 2UUEA 2YA9A 3AC8A 2VZ6A 1W7HA 3F7WA 3RZFA 1H8FA 5IH5A 4PL4A 3GGFA 2O64A 3R7GA 4RC2A 5K0XA 2P3GX 5IH4A 3I4BA 3VUGA 4F9WA 3KK9A 4OTHA 3V5PA 2X7FA 3TEIA 5JZNA 3GENA 3ZONA 4UWCA 4BHZA 3BHYA 3CLYA 3MIAA 3P79A 2J9MA 4AWIA 3VW6A 4HCUA 2XKCA 5CNNA 4QQJA 4IX4A 3II5A 1PW2A 5IQDA 2BIYA 1I09A 2WQEA 3ALNA 4H36A 5FQDC 3NR9A 4XG4A 2BZKB 3N4VA 4JLCA 4JQ7A 4O84A 3R01A 3A62A 4XG8A 3ZLWA 1SMHA 4H3PA 1CKPA 3VUKA 4D28A 4EHGA 2I0HA 1LEZA 3OW3A 2FGIA 3E7OA 4AA0A 4FT5A 4G16A 4FSRA 2ITVA 3R9OA 2DUVA 3OMVA 3GCVA 3ANQA 5C03A 4C62A 2C6OA 5M07A 1H00A 2RFSA 1UU7A 3DV3A 3Q32A 3HMOA 3ZXTA 4BKJA 5M06A 1GZ8A 4EONA 2VTQA 3R8LA 4BHNA 3QLGA 4TT7A 5EKNA 1JKKA 4CLJA 3E7VA 1URWA 1RE8A 3QX4A 4IX6A 2C5NA 4A9YA 2PZIA 2PPQA 2Z7RA 4EL9A 3VHEA 3MPMA 2E9UA 2RFDA 1WVXA 4B0GA 4FG8A 4FTRA 3UOKA 1Q8WA 4D2VA 4BN1A 4FYOA 5BUIA 5K5XA 3QTWA 3IDBA 2OU7A 3NVMB 2AUHA 3ZLXA 2O63A 2JDOA 3HP2A 5LXMA 2IW9A 5CEPA 2W5HA 5DN3A 5HIDA 4S30A 4A9UA 4RVTA 3W10A 3BHTA 3LLAA 4C34A 5CEIA 4FTMA 4DFXE 2UVXA 3OC1A 5HE2A 4I4FA 5HG5A 3R04A 1L8TA 4UMQA 4L46A 4Q5EA 3Q6UA 4BIEA 3C51A 3E63A 4EYMA 4I23A 4GUBA 2VTMA 1XQZA 2F9GA 4W4YA 4O22A 3VF8A 2E9NA 4C4EA 4F6SA 4O0SA 3HRCA 2YM5A 4FSQA 5FTOA 5HE1A 3UTOA 4IDVA 4XYFA 2OWBA 4LV8A 2BKKA 5GIPE 2ZB1A 3K5VA 5CALA 3FBVA 3FL4A 3UIBA 5DEWA 1IRKA 3QUDA 2WQMA 2PMNX 4NM5A 4MWHA 3L1SA 3DTWA 2FO0A 4Z7GA 4NIFA 4IAFA 3CC6A 3BIZA 1CTPE 2GNHA 3DU8A 4X6QC 5ANGA 5AP7A 4QYHA 4I41A 4G6LA 4FKJA 4GJ2A 2ERZE 4ZXTA 3PP1A 4ZAUA 3FQEA 1G8AA 4FUXA 3RHKA 4DG0E 4EYJA 4F1OA 3KRRA 2CSNA 4ZY6A 4HCVA 1FGIA 3MJ1A 5I9UA 3R8VA 4HVDA 3DAKA 2ONLA 4XV9A 5EHYA 5FBNC 4ASEA 2PULA 4PUZA 4DITA 1SVGA 4KA3A 3D7ZA 3G6HA 3GUBA 3HDMA 5DFPA 3QRIA 3ULZA 3HA6A 1ZYSA 4DH8A 2C69A 4YO4A 4YZMA 4I3ZA 2Y4IC 3O7LD 3QGYA 5AV0A 3TWJA 1WBTA 1XH4A 2W9ZB 4ZY4A 4KKGA 5IH6A 5M4IA 1GY3A 4OAVB 3MESA 3QTIA 1OM1A 5AM7A 5D1JA 3AQVA 5D11A 3ULIA 3W2PA 4AA5A 3O2MA 5IA3A 3PZEA 4QTDA 5CSHA 4BIDA 5IA4A 4DYMA 4LG4A 2BHEA 4JX7A 3RNYA 2BRMA 2YIQA 4GSBA 2KTYA 3PSBA 1PYEA 2PSQA 4JBVA 3FXXA 4FV8A 3GFEA 3ZUVA 5HZNA 3N4TA 3RJCA 4PNIA 4E5WA 4U6RA 4EHEA 4BB4A 5JFVA 5D12A 1Q61A 1DAWA 4G6NA 5CU3A 3FLQA 5AV4A 4GT5A 2OK1A 1YXUA 4OW8A 4HYIA 4LOQA 4E20A 4O27B 3F3UA 2HWPA 3LIJA 2ITXA 5L8LA 5CAOA 1Q8TA 2Z7QA 4RWJA 4ZZOA 2HYYA 3PUPA 3ZCLA 4ACHA 2PUNA 3UYTA 2WTWA 3NNUA 3TN8A 1UU8A 4X0MA 2UZUE 1XH7A 3N51A 3WF7A 5BYZA 3LMHA 4CG9A 1KOAA 2FH9A 2WELA 1YRPA 5DT4A 2BR1A 5D41A 5DT0A 4FKRA 2WGJA 4O7RA 1OL6A 3KVWA 3LCSA 4DINA 5F95A 1PXKA 3BGZA 4GU6A 4HGLA 4FEUA 4FV6A 4QMVA 2GHMA 5TT7A 4KSQA 3RM7A 4B4LA 5DR2A 4FTJA 4CRSA 2XIZA 3KGAA 5BNJA 2HAKA 2O5KA 3KFAA 4IB0A 3L8XA 5HIEA 1PMUA 3QQUA 3MPTA 5HX6A 5K4IA 3L9MA 1WBVA 1ZMWA 2JFMA 3SG8A 4EZ3A 3QYWA 2OLCA 4F65A 2R7IA 4YJSA 1WVWA 3BRBA 4WUNA 4AE6A 1W83A 1YXSA 3E3PA 3FMDA 3PPZA 5CZIA 2C5VA 2PVFA 4BI1A 3OS3A 4KIQA 4N6YA 4O81A 4ZS4A 1YDRE 4FIHA 2G1TA 3WF6A 1QL6A 4H58A 3ZM9A 3CD3A 4NW5A 4YTIA 3TUDA 4FX3A 3SRVB 2XIXA 5IA2A 3W33A 4U97A 2Y4IB 1O6YA 2VN9A 4UY9A 3V8WA 3MFSA 3CTHA 3H0YA 3SW4A 2C6KA 4EJ7A 3QQKA 2VRXA 3E8EA 5LCKA 3KEXA 4MQ1A 2PVYA 4BR3A 4QMNA 3THBA 4FKWA 3V5QA 4GL9A 4L3LA 3EYGA 3DY7A 1FMOE 4I24A 3U4UA 2X2KA 4FKOA 3OCTA 2PYWA 2UZLA 1R3CA 3P7BA 4NH1A 2R3RA 4FKTA 5FDPA 4C59A 3PWDA 3HKOA 3EN9A 4ZSJA 3L8SA 1XBBA 3UNKA 4D4VA 2WZJA 2XS0A 3SAYA 2G2IA 3OT8A 4APPA 2OJJA 2R0UA 5EI2A 2C5XA 2R3HA 1JNKA 1MRYA 2XJ2A 1FVRA 1PXNA 3LFSA 5KZ0A 3SW7A 2OF2A 1WBNA 4BYJA 3VUIA 4GFGA 3OD6X 3MFRA 5E8YA 3WZKA 2GNLA 1TVOA 5FG8A 4C61A 1LUFA 3MH1A 2BKZA 4PRJA 1OL7A 1ZZ2A 4NSTA 2VX1A 3ORLA 3C50A 3R7IA 3KXXA 2WHBA 3W55A 1YHVA 5JH6A 2Y4PA 2PWLA 3FMEA 2QD9A 2ZAZA 1BYGA 3GQIA 2BRHA 2HOGA 2XNOA 3D4QA 4MNFA 3C9WA 3TUCA 1BMKA 3FYJX 5IA0A 5KKRC 3PXRA 4MTAA 2ZJWA 4D2TA 4Q5HA 4C02A 2XNGA 4L7FA 4Q2AA 1Q5KA 4GK4A 4RX7A 1A9UA 4AQCA 5IDNA 4WRSA 1J7LA 5KBQA 2R7BA 3NUAA 3PG3A 2PE2A 4PY1A 4JAIA 4PMTA 5AR7A 4IXPA 5AUUA 4IWQA 1MRUA 4JJRA 2BDJA 3VUMA 2WNTA 2X7GA 2RL5A 3FL5A 2OZOA 4FIJA 4X2NA 3FYKX 5I5ZA 3U55A 2CGUA 3C5UA 4KIKB 4MD9E 2RKUA 2VO0A 3TACA 4J53A 3U9NA 3C13A 3DFAA 3GU4A 3O50A 2W17A 1Q3WA 3K54A 4K9YA 1REJA 5E90A 3FC1X 2O3PA 2XYUA 4TYHB 1MQ4A 3TTJA 5M53A 5LJJA 5FRIA 3TIZA 5J79A 2GNFA 2PZPA 2UW0A 4NJ3A 4ZLOA 3TJDA 2XK6A 4EOJA 1KV1A 3WE4A 1KSWA 2VUWA 3NW7A 3TTIA 1Y8GA 5ETAA 2QU6A 3QFVA 5J95A 3R0TA 3ZH8A 5IA1A 5L6OA 3HV3A 4FV3A 5AV2A 4F08A 2B9HA 3LJ0A 2CHLA 2WMXA 4F7SA 4ANMA 1DM2A 4M15A 4DG3E 3LKMA 3BEAA 2ZMDA 3G9NA 2BTRA 5L8KA 4I22A 5DBXA 5A9UA 2XKEA 4K18A 3U51A 4DTBA 3G2FA 2AC3A 2YDKA 4B8LA 2YWVA 2XK8A 3H10A 2XH5A 3SXSA 4RWLA 3WIKA 3ORNA 4M0YA 2B0QA 4FE2A 2EXMA 2ACXA 3KRJA 3KY2A 3OY3A 2YJRA 4IACA 3R8ZA 3FHIA 4WG4A 2ZMCA 3ZZWA 2V55A 2QO7A 3ZRLA 4DH5A 2R0IA 2OICA 2QLQA 5J87A 2QI8A 5BYLA 4U3ZA 1M2PA 2HZNA 4BCNA 3QTXA 1YDSE 5IUHA 3ACJA 3S2PA 2C6IA 2DYLA 3GNIB 4GK2A 5CQWA 3O7LB 2XK3A 4FT9A 3E5AA 1ERKA 3VIDA 3WF8A 2W96B 4DFNA 3UMWA 2ITWA 4X3FC 2WQOA 4JG7A 2HY81 3D7TA 4YZDA 3D2IA 1NW1A 3LAUA 1B39A 4J98A 5C27A 5T68A 4AOIA 4BZOA 2W1EA 4R8QA 2NPQA 4RA4A 2WMVA 5GINE 3CJFA 1YI4A 3B8RA 3HAMA 3IG7A 2X2MA 4ZJVA 3NAXA 2O2UA 3BELA 3EQPA 3RGFA 5J5SA 4DT8A 4BKYA 4RGJA 1FVVA 4ACCA 2WMAA 1ZYDA 4IB3A 1JSUA 3TV7A 1ZMVA 2FSTX 1H1PA 4YLJA
chains in the Genus database with same CATH superfamily
1XJDA 4Y73A 5EK7A 4HZRA 4K33A 4QMPA 4I5MA 5AWMA 4HNFA 4YJNA 4BWPA 4FSMA 4WBOA 4MBJA 3EZRA 2BFYA 4EBVA 1IAJA 4MH7A 3O8PA 1G5SA 4I4EA 2PMLX 5BVNA 4FKLA 3ATTA 3VUTA 3DAEA 4KAOA 4MD8E 4NK9A 4U81A 5DR9A 3QTQA 4DH3A 4EH4A 4YTFA 5HTIA 4XG6A 4I5PA 4CVAA 2ZM4A 2X6DA 4QMUA 4P5QA 4J7BA 4B99A 5HGIA 3I7BA 5I3RA 1OPJA 3G0FA 2HIWA 5L2TA 2UZNA 3EJ1A 4C3FA 3TYKA 1UWJA 4DN5A 5HORA 2GS6A 3F5PA 4ACMA 1W2DA 4DCAA 3LZBA 5C4KA 3FWQA 2FA2A 4FTCA 5HLPA 4DGNA 4O7LA 2P33A 2QONA 2CLQA 5AUVA 2WB8A 5HQ0A 2ZDUA 3LCTA 3Q3BA 2GNIA 4TYJA 4V01A 4OTFA 2YIXA 4D9TA 4DEAA 4X2KA 4CZTA 4EKLA 1KUTA 1H28A 1ZWSA 4DBXA 1JWHA 1YXTA 3TDVA 4GV1A 4TRLA 5BQ0A 4LGDA 5AAGA 2WFYA 3Q2JA 3DNEA 3Q60A 5FLFA 3VS0A 4O6EA 5T6KA 4DLJA 1YHWA 4W4XA 1W98A 4G2FA 4GFOA 5AJQA 1GAGA 4FI1A 1IAHA 4P4CA 3O96A 1W2CA 2BTSA 3M11A 4L67A 2C6LA 1Z5MA 1KE8A 2FVDA 2A27A 4KUJA 3GU7A 2VAGA 4IM3A 3OFMA 3S3IA 3SD0A 3VQUA 2PL0A 5A4TA 4CFUA 2EVAA 2IEWA 2WQNA 3AT2A 4JDJA 4E6QA 1Y91A 2XK9A 4KINA 3B2WA 5L2SA 1V0BA 4YC6A 4OUCA 3L8PA 2A4LA 4X3FB 4I1ZA 4YZCA 4AN2A 4F99A 4H1JA 5CYIA 5M57A 2XARA 4QP7A 1IG1A 1Z57A 3QQFA 1AQ1A 4XLIA 2QOIA 3KMWA 4RIOA 5CENA 1M2RA 4XG7A 5JMSA 5AFVA 1R0EA 3W32A 4O0XA 3KXZA 4U79A 2Z2WA 3EQDA 3SKCA 3LQ3A 5HE0A 2OKRA 3MA3A 5G1XA 3LFEA 3V8TA 3MPAA 5AP6A 3LFBA 1GIHA 3W8QA 5HBHA 2WMQA 5GZAA 1XBCA 4Q9SA 3FLNC 3ETAA 4XJ0A 4JR7A 4PL5A 2Z7LA 4FTTA 4QOXA 4ZTHA 4Y46A 3BYMA 3EQHA 5AUZA 2ITTA 3QRJA 3REPA 3QTRA 3HGKA 4RC3A 3VN9A 2R3MA 5LMKA 2CLXA 3I60A 3JR1A 4Z16A 4AT5A 2XK7A 1M52A 4ZTSA 3KA0A 4FV4A 3EN4A 4PDOA 3NFFB 3SGCA 2NNWB 2OGVA 3POOA 1G3NA 1DI9A 2DQ7X 3IONA 4MF0A 4ZTRA 3TZ7A 4F7JA 3A8WA 4D5KA 1XH9A 3ZUUA 4GYIA 3ENHA 3R00A 3HMNA 5K3YA 3UO5A 2XIKA 4NM7A 5HEZA 4L44A 4A7CA 4K1BA 5FD2A 1Q99A 5E9EA 2YAAA 5AV3A 3WF5A 2W4JA 3CPBA 4GMYA 3TL8A 4BGQA 2CNQA 3UDSA 2Z02A 4FNYA 3HLLA 4EHVA 5CEMA 3M2WA 3NDMA 4KBCA 5KUPA 3UVQA 2IG7A 2PY3A 5C01A 2E9VA 3AG9A 3EQRA 3HV6A 3ZFXA 1UKIA 5A4LA 3ZOSA 4WSYA 4O0TA 2PVNA 2C6MA 5AIKA 2HCKA 4RZWA 5E8TA 3DQXA 3PJ2A 5DLSA 3MH0A 3QQJA 1R0PA 2KULA 4BCPA 4EOIA 4XG3A 3PIYA 5EQPA 3IW6A 3D5XA 4TW9A 2A0CX 4TWOA 3ZS5A 2DS1A 4F6WA 3D5WA 3F61A 3QKKA 5TR6A 4AA4A 2X1NA 3VBYA 3FPMA 4AGUA 4FA2A 4RFYA 1REKA 4KKEA 2QURA 2BRNA 3LXKA 3PVGA 4BZDA 3KULB 4FKQA 4B8MA 1VYZA 4NU1A 4CTCA 5J9YA 4O7ZA 2CGVA 3PPKA 3WE8A 1WBSA 4FKVA 1HOWA 3BI6A 2UZBA 3PY0A 3P78A 5CSWA 3W16A 4V05A 4YNOA 5K0KA 4M14A 1BI7A 1OL5A 2W1GA 4APCA 2YDIA 1APME 3AXWA 3QD2B 1IA9A 3TCPA 1UU9A 4U9AA 1ZMUA 4J8NA 5JRSA 2YM8A 4JNWA 3LMGA 2Z8CA 5TF9A 2WTCA 5I4NA 4G5PA 5EW9A 3IGGA 3W1FA 2R3NA 3L9NA 4YHFA 2XYNA 4YTCA 4MBIA 4LL5A 1OI9A 4KRCA 4ZJIA 1XHAA 3ANRA 4AW1A 2XCHA 2XIRA 2ZV2A 3C4FA 3I5NA 2VO7A 3PE2A 4O91A 4RIXA 4MXOA 3P4KA 4YC8A 1PXJA 3R8PA 4S31A 3S0OA 3CQEA 3E93A 5L2IA 2QKWB 2J5FA 3BPRA 3OXTA 4ITJA 5F20A 4K8AA 1H1RA 2NRYA 4II5A 3NW6A 4QYFA 4YJVA 4ZSEA 4ANSA 3QCXA 5C26A 4E73A 5JGAA 1S9IA 2PE0A 5LVNA 5FEEA 2F57A 1VZOA 2BPMA 2W99B 2VTAA 1BI8A 4L45A 3E62A 5HKMA 3A61A 4HOKA 4P90A 4TYGA 3VS7A 3WZUA 4FC0A 5AM6A 5E4HA 5F94A 3UP7A 4IAZA 1S9JA 1ATPE 2UW8A 5EQYA 4FODA 4CD0A 4DGLC 4EH6A 4EC8A 3HNGA 2BAQA 2BALA 5CAPA 3HUCA 4LM5A 3EKNA 4D1ZA 4RFMA 4CQEA 3VS5A 4IJPA 5CXZA 1LR4A 2UW3A 3PJCA 3PY1A 5FP6A 3TXOA 1OZ1A 3PY3A 3RKBA 3IO7A 3EQCA 1NT2A 2ITNA 3O8TA 4CSVA 5JK3A 4Y72A 3FMJA 3VBTA 3SXFA 4OTQA 3QHRA 4Z9LA 4GH2A 1OMWA 4F9YA 4F1TA 5DT3A 3TUBA 1BUHA 2X6EA 2B4SB 1UNLA 2I6LA 2J0KA 2J7TA 2JIUA 3MYGA 5CANA 4O7WA 4MNEB 5H8GA 4ZS0A 3S00A 4N57A 3OCSA 4ANBA 3EFWA 4UV0A 1J1CA 4C3RA 4M69B 5LCJA 2YJSA 3MDYA 3HMMA 3F88A 1W84A 4BWXA 5BVOA 2XMYA 2R3IA 5IPJA 2Y0AA 4M68A 4DE4A 3AGLA 3IOPA 3KC3A 4W8DA 3BWFA 4A06A 2BZIB 3DK3A 3WZEA 3MY5A 3F5UA 4EK3A 1OL1A 5LVOA 3A99A 4PPBA 3V5JA 1Y6AA 5CU0A 2YFXA 3RPVA 4E6DA 4OGRA 3R7OA 1HCLA 4U8ZA 4G9CA 2CCHA 1LEWA 1Z9XA 2BVAA 3AC2A 3QQHA 3F3WA 4EWHA 2X39A 2WTKB 1WBOA 3UZPA 5KHXA 2J0IA 3COMA 3H9FA 3C4CA 3RPRA 1H27A 2ETMA 5A6OA 1U46A 2WU7A 1BKXA 4BDJA 3F66A 5HO8A 4ERWA 3BV3A 3ORZA 2CPKE 2FB8A 4I20A 3D2KA 4AX8A 2GFSA 4EI4A 5D7AA 5FDXA 5H9BA 3RPOA 1H4LA 3K3JA 3LJ2A 2WXVA 2YCQA 4DDIA 5TO8A 2WD1A 4QT1A 3TNPC 1QMZA 3KRWA 3N9XA 3NNXA 1TKIA 3S1HA 1E1XA 2Y7JA 5AV1A 1FBNA 2V22A 1P2AA 4HVIA 5DGZA 4FTQA 5GJDA 3O5AA 3R2BA 1P5EA 3MBLA 5DRBA 4J1RA 3QC4A 5DVRA 3LXPA 3HEGA 2W1HA 3W8LA 1W2FA 1E9HA 2BZHB 3DK7A 2B9FA 4FKSA 1QPCA 2V7AA 4AG8A 4I6QA 4AP7A 1UNGA 4MX9A 4FSWA 1HCKA 3CS9A 4DHFA 4D1XA 4EZ7A 3EQFA 5J9LA 2QKRA 2W1IA 2W1ZA 2X2LA 4YPDA 2ERKA 3E8NA 4LMUA 4U43A 2XJ1A 5JGDA 1JAMA 2YIYA 3UBDA 2CNUA 5B2LA 3IW4A 4WT6A 5CLPA 2ZM3A 3DBCA 3VRYA 3DTCA 4FG9A 5DEYA 1T46A 2I1MA 3C0IA 3D15A 4RFZA 2OSCA 5ICPA 4LYNA 3ZHPC 2C6TA 4FSNA 4F4PA 4QYEA 4AOJA 5JEBA 3D94A 3VUHA 2JEDA 3ZO1A 4DEEA 3R63A 4QP9A 1K9AA 4D1SA 3HMIA 1JBPE 5CSPA 5J7BA 3OWKA 1H0VA 3PG1A 2JLDA 4X21A 2PUUA 2XCKA 3P23A 4YJQA 4YTHA 1Q62A 3A7JA 4FZFB 1DS5A 2WPAA 3R9HA 4IX5A 1WZYA 4QMWA 2SRCA 4BFMA 2UW7A 1OPLA 1JKLA 3R6XA 4EH2A 3LFCA 3V5TA 1XR1A 2QO2A 3ZLYA 5IISA 3UQFA 2A1AB 3OXIA 3QTZA 3BLQA 3QBNA 2OW3A 4B6LA 1YI6A 5CF5A 5KMNA 1WCCA 3TNHA 4LMNA 3HVCA 3ZEPA 3C7QA 4IVCA 4QMMA 4C33A 2JD5A 2XNMA 4NCTC 3U4WA 2I0YA 3MS9A 4CT1A 2HXLA 5FM3A 1R1WA 3OWPA 4NUSA 1ZOGA 4N70A 3MSSA 2Y9QA 4O0YA 1GJOA 4ORKA 4IWOA 4EUUA 3LQ5A 4G1WA 2W1DA 3W0MA 5IF1A 1ZOHA 3FLZA 3TNIA 4DG2E 4BDFA 4OLIA 1J7IA 4DTKA 4AN9A 3O8UA 1JKTA 4CFFA 3UPZA 2QNJA 4XOZA 5CU2A 4WG5A 5DWRA 4F7NA 4I94A 4ZZNA 4Y5QA 4M97A 4IB5A 3DKGA 4DF3A 1NY3A 4X6RA 2XJ0A 4BDDA 4CGAA 4V0GB 4AU8A 2QLUA 4KIPA 4GT4A 2CMWA 5GJFA 4RSSA 5HESA 4JBPA 3CTQA 4O96A 5AEPA 2XP2A 1BLXA 2YABA 3LOKA 4IZ5A 2W4KA 4Q9ZA 4CEGA 4IFGA 3FI2A 3GC7A 3RWQA 4DH1A 5KMMA 3RPYA 4BGHA 4YNEA 2ITPA 4RG0A 2P2IA 4FV9A 3DGKA 4FL3A 5DOSA 4IEBA 5CTPA 2F49A 3UVRA 4FTKA 2E2BA 4O7TA 3GEQA 3ENMA 4FNZA 3Q5ZA 4XH6A 4XOYA 5HD7A 4AW0A 3IK3A 4M8TA 2WTVA 3E87A 3EFJA 4CFMA 3OXZA 3ML1A 4RRVA 4QMYA 4WO5A 4BY9E 5AMNA 4QP3A 4TL0A 5CF6A 5FUTA 4JDHA 5EG3A 5K5NA 3G51A 3OF0A 4F9BA 4NZWB 1QPDA 3IOKA 3F2RA 4R7BA 4AAYA 3TJCA 4KKHA 4ZTMA 1CMKE 4F6UA 3QZGA 5C1QB 3PVBA 2AYPA 2G01A 3U8WA 2R3QA 2VO6A 4FK3A 4W4WA 1ND4A 4M66A 5E8XA 3QD0A 3A7FA 3BLHA 3OEZA 3DXPA 3OWLA 2G15A 4YHJA 1OBDA 2EB3A 3PXKA 2ITZA 4QMZA 2VTJA 3R7VA 4JAJA 3DJ6A 5KMIA 2W5BA 2CGXA 3F82A 4YMJA 4Z7HA 4DH7A 2BAKA 3I7CA 4V04A 2QCSA 3UNJA 3UODA 5HNGA 1H1QA 5CAVA 1V0OA 3PJ3A 1UVRA 3RCJA 3QWJA 4FRFA 3W2OA 4ZMEA 3V3VA 5HCYA 3QQGA 4WUAA 4R77A 2GSFA 1RJBA 2QOFA 4RWKA 5AADA 4F0FA 1KV2A 3BGQA 3AMBA 4FTOA 4J96A 1P4OA 4FSYA 2GMXA 3AT3A 3FI4A 5JT2A 3QD3A 4FL1A 4H3BA 4EQCA 2P4IA 4J52A 2IZSA 4BVUA 4RMZA 2EXCX 3F2NA 4F1MA 3KN6A 3B8QA 5IQBA 5AAFA 3FY2A 2YISA 3MB6A 5ITAA 1IEPA 4QO9A 2EWAA 4J8MA 3DLSA 1G8KA 3NUNA 4JR3A 4GYGA 3UG2A 4EK8A 4EK5A 3Q4UA 3HL7A 5KZIA 1PXMA 3EWHA 3F3ZA 5EI8A 2ITQA 4FSUA 3DAJA 4J99A 3PIXA 5FP5A 4QTCA 3UE4A 4IZ7A 4BCJA 2YM3A 2J4ZA 2YITA 5A54A 2R3GA 4D4YA 2XAMA 3PE1A 3QU0A 5CS6A 3SVVA 2UW6A 3TZMA 4O0WA 4CNHA 5M4CA 5IQCA 2PE1A 4CFWA 1R39A 4O4EA 2F7EE 4MXZA 4AGWA 4D55A 3DB6A 5IG1A 1QPEA 2OIDA 4WOVA 4YJRA 2X9EA 4NTSA 3S95A 3IDPA 4C37A 4EORA 5AA9A 4NM3A 4O4CA 3TNWA 4QPSA 3FZ1A 2ZVAA 2BRBA 4UN0C 2VNWA 3PA5A 3LW0A 3GP0A 4GU9A 4QQTA 4B7TA 5E8VA 1GZNA 2YM6A 2XKDA 4UZDA 3KN5A 3QL8A 4I92A 3NPCA 3TZ8A 1EH4A 2XIYA 4JDKA 5FEQA 1VJYA 3FDNA 4MXCA 3C5IA 4RPVA 3CBLA 3LLTA 5BVDA 3UIXA 3OG7A 3FXWA 5AUXA 4U44A 4ZMFA 4IE9A 4QDEA 2B9IA 3PSDA 2XUUA 3H0ZA 4ZLYA 4IMYA 4N6ZA 2C30A 4Y95A 5EYDA 4ASXA 3CR0A 5A46A 3QAME 1R78A 2JKKA 3HECA 4HGTA 1J91A 4L8MA 4LUEA 3OBGA 4RBLA 4YJOA 5L6WL 3QXOA 4UX9A 3MI9A 5IDPA 1OECA 4DAWA 4FJVA 4OTWA 4JMQA 4U80A 4C0TA 4UB7A 3PTGA 4MK0A 4RX5A 1H1SA 3UOHA 3UDZA 3UC4A 2ETRA 3VULA 4AOTA 5CASA 4WNMA 4FZ7A 3QRKA 3W0OA 2UVYA 5JFXA 1H0WA 3CCNA 3H30A 2BZJA 4NCTA 3DXNA 4IM2A 1OPKA 4CXAA 2UZWE 5EKOA 4BCGA 2CGWA 2GNJA 2OF4A 3TV6A 2IPXA 1XH6A 2GPHA 2Y8OA 4ASZA 3R22A 3W0QA 4USFA 4IADA 4PV0A 3Q5IA 2RIOA 2H34A 3OUKA 4JQEA 4OBQA 5DIAA 3VJOA 4AZTA 3FZSA 4Z55A 3PP0A 3OUNB 4F70A 3CSVA 1SVEA 3NYNA 4IAKA 5CNOA 4EC9A 3P9JA 3T3VA 3Q9ZA 4GG7A 2NP8A 4A9SA 5C8KA 5HD4A 3UJGA 2V7OA 4FTIA 4IBMA 4FL2A 4O0RA 2C6EA 1XO2B 4AT4A 3GXLA 1WAKA 2C0IA 3F7ZA 1AGWA 5BVWA 5CSVA 4BDBA 5EYCA 4NWMA 2JKQA 3BCEA 1TZDA 2E9OA 3EB0A 3GC8A 3D5UA 2RFEA 2O0UA 5CU6A 3VWAA 5AP1A 3WF9A 3UGCA 4IC8A 5KMOA 5CF8A 5IQGA 4UWYA 3RAIA 3BYVA 5CEOA 2YM4A 3UC3A 4USEA 4AZFA 5FTQA 3GU6A 3IW8A 1YHSA 3D83A 2VGOA 1Q97A 3Q9XA 4ZTQA 3QF9A 4JQ8A 3PXQA 4CKJA 4FG7A 2BDFA 4ZJJA 4DHJA 3NEWA 5AP2A 2WMWA 3QKMA 3FLWA 1U5QA 2BIKB 3HRBA 2UW4A 3WIGA 3DZQA 3AD6A 3C4ZA 3GOKA 4K11A 3AMAA 1WMKA 3LJ1A 5HO6A 5JQ8A 5A4QA 3DS6A 2XF0A 3BX5A 3VS4A 4ANQA 5F9EA 2Z60A 4X2JA 3F3TA 3FZOA 4IAYA 2PK9A 2VD5A 4ACGA 3RINA 2O65A 3FJQE 4FZAB 4WBBB 4G34A 4E8AA 2CN8A 4MXYA 2R3FA 3KIOC 3Q4ZA 4CFNA 3BBWA 1YOJA 3G33A 3MTFA 3KKVA 3NS9A 5HBEA 2XK4A 4PNKA 2WOTA 2XRWA 4PX6A 3ZDUA 3EL8A 4FMQA 5E1EA 3ZM4A 4DFLA 4ZSAA 1JLUE 3WARA 5HO7A 4FKUA 2WKMA 3Q4CA 4OAUC 2C1BA 3GCUA 5BUJA 3QCQA 4UXQA 4ZSLA 4E4LA 4AACA 4ITIA 3DQWA 5K4JA 1FOTA 4TWPA 3AGMA 2GQSA 3TIYA 3CY2A 5B2MA 2QHMA 4UYNA 5BV3A 2OZAB 4MBLA 3EFLA 3C1XA 4G9RA 4R7IA 5AX9A 3WOWA 2CKPA 3ZSIA 5C4LA 1DI8A 4L3PA 1U54B 1JKSA 2VX0A 4R78A 3PFQA 4AZVA 4DFBA 5EDQA 1H24A 1QCFA 5KE0A 2PZ5A 3O0GA 3HYHA 4XBRA 4LV7A 2UZTA 1OUYA 2RG5A 3OHTA 4XG2A 3SOCA 3BHUA 4N0SA 4KIKA 1YOLA 4MF1A 4X2GA 3ZO2A 2GQRA 2R3OA 2XEZA 2VWIA 5KBRA 2H96A 4F63A 3R8UA 3MW1A 4NFMA 3CQUA 4BDEA 4L53A 4XRLA 4FKIA 3JPVA 3FE3A 4DDGA 3PZHA 1WBPA 3ZU7A 3UYSA 4GJ3A 4BDKA 1YXVA 4TYEA 3QXPA 3TV4A 3VAPA 4ANOA 2IVUA 4JVGA 5M51A 5CX9A 3P5JC 3H4JA 1SNXA 5GZ8A 4FNWA 3WZJA 3QHWA 4FEWA 5FWKK 1M17A 2JIVA 1PKDA 5AUYA 3VQHA 5I9YA 3TDWA 5A4CA 5KMKA 3QA8A 2YIRA 4WKQA 4XV3A 5J1WA 3OTUA 3KRLA 3BE9A 4IIRA 2GQGA 3SHEA 3PYYA 3OOGA 5A6NA 4LV5A 4HPUE 4CMUA 3TKIA 1SM2A 2UV2A 3BYOA 4MKCA 4TNBA 4ENYA 4ZSGA 3FKNA 4IX3A 3UQCA 3RALA 1YVJA 4O4BB 5M44A 4DC2A 4IVDA 3GU5A 3MVJA 4RJ7A 4RLLA 2PVKA 3ORIA 4I6LA 4OBPA 5IU2A 3OW4A 2OFVA 4ANLA 5GZ9A 4H05A 4BTFA 5BUEA 5HG7A 5I0BA 2R3JA 3DT1A 5DA3A 3UZTA 3IQ7A 4PTCA 4X3JA 4BKZA 3QX2A 1M7QA 1ZY4A 5D10A 2GTNA 2XBJA 1V0PA 3D9VA 5HX8A 2QG5A 4IHPA 5EOLA 1NVSA 1VEBA 4BI2A 4EQMA 4E4NA 4D0WA 4AS0A 4O4DA 1RDQE 3AT4A 5H8EA 5FEDA 1FMKA 4IAAA 1YWNA 3L9PA 4X7QA 4E93A 4FVPA 5HG8A 3JS2A 4IVBA 2VWZA 2HK5A 2ZM1A 1OVEA 5BVFA 2R3LA 3DB8A 3GBZA 4RZVA 2VU3A 2YCFA 4QPMA 3QZFA 2BHHA 4YJPA 4FZDB 3H9OA 3BQCA 1JPAA 1Q8UA 4TZRA 4DLIA 4GIIA 1ZOEA 3RNIA 2OXDA 4KBKA 3LXLA 4TKSA 3TKUA 1ZAOA 3F6XA 4YSMA 3C0HA 1K2PA 4MD7E 5CT0A 2VWXA 2VWYA 5AR5A 4R1VA 4O0UA 3E64A 5CEKA 4LL0A 4FV1A 2GHLA 4BBMA 5CT7A 4A07A 4E4XA 4PMMA 4MUQA 4YUQA 3NAYA 2C3IB 3I79A 4RX8A 5LARA 3NSZA 2HZ0A 3I1AA 3KXMA 4GK3A 4GS6A 2YN8A 2QR8A 3NYOA 5AP5A 1V1KA 4EHZA 4K2RA 1XMLA 3LM0A 4RIWB 3RCDA 3QYZA 1FPUA 3AC3A 4D2WA 1F5QA 1UA2A 1PXIA 3IGOA 3IW5A 2C4GA 3K2LA 3UMXA 4BBEA 3HZTA 4QPAA 4B9DA 4OTIA 3KMMA 3QGWA 3OP5A 3DJ7A 1GIJA 2V5QA 3GVUA 3E8DA 1UV5A 4FTLA 3R9NA 3RZBA 4RLKA 5AA8A 5AAEA 2F2UA 4CCBA 5HTBA 4I93A 3G6GA 1KE5A 4D2RA 4RIYB 3LVPA 5H8BA 2BILB 4EH5A 4MYGA 3PPJA 2ITOA 4PF4A 4AZSA 3SQQA 1H08A 2J50A 2V0DA 3FV8A 5IQFA 4O7VA 3EN7A 4XS2A 3AC1A 5HU9A 4GUEA 5HE3A 3SG9A 1BX6A 3V01A 2JKMA 1PXLA 3FAAA 2QQ7A 4YHTA 3SOAA 4AF3A 3Q96A 3V6RA 2J0JA 2UZVA 4BWKA 4ZZMA 3R1SA 3ZC6A 4GVAA 2Y6OA 4BTKA 5I9ZA 3R28A 3BHHA 3GFWA 4O7YA 5I9WA 3O71A 4OT5A 4EH3A 5DNRA 3GOPA 4U45A 1UU3A 4XLVA 2WTKC 5E92A 4O6LA 2UZDA 3KVXA 1JOWB 4C7TA 2WQBA 5EHLA 3POZA 4LQMA 2X8IA 4JDIA 1H26A 4D4RA 3A4PA 5DG5A 3AD4A 4ZIMA 4YJTA 1FVTA 3RPSA 2OO8X 2VTPA 3I81A 1NVRA 4LOPA 5BVKA 4QEBA 3COKA 1SNUA 4X3FA 4JT3A 5AR8A 4I0SA 5HVKA 4QNYA 5IZFA 2XALA 3KB7A 2EB2A 4QTAA 3W2SA 4ZLZA 3CP9A 3JVSA 3M42A 4S2ZA 3UG1A 3FUPA 2VTHA 4R5SA 2HXQA 2JAMA 1KOBA 3QA0A 4ACDA 4W9WA 1A06A 1XBAA 3ORPA 3W2CA 5LVMA 5GIOE 4PP7A 4MXXA 4ID7A 2ONLC 4L9IA 2WTDA 3DCVA 2R3PA 3KL8A 1B6CB 4RC4A 3SV0A 4J95A 3PXFA 5B7VA 4CCUA 4AXEA 4BI0A 1WVYA 2I7QA 4YLLA 4ZTNA 1ST0A 1Y57A 1ZLTA 3EMGA 4UBAA 2J5EA 4EEVA 4UXLA 3SLSA 2YCSA 4E1ZA 3EQBA 1URCA 1W0XC 3O51A 5E8SA 1PXOA 4LRKA 2IWIA 3ZTXA 4F7LA 2R5TA 3AKKA 3KK8A 2QR7A 1ZYCA 3ZFYA 1ZARA 2X0OA 5EHOA 4BICA 5I9VA 3CD8A 3LE6A 2PZYA 1VR2A 3COHA 5L6PA 4EOMA 4AGDA 2OIBA 5EM5A 2J90A 2RFNA 3JUHA 4FVQA 3RK9A 3Q04A 4P5ZA 4JG6A 3Q9YA 2ZV7A 3PVWA 3NUPA 4HVHA 4DEHA 4MHAA 4U40A 3NUYA 4BBFA 4HVGA 2QOKA 3NZ0A 3VNTA 5H3QA 3PRIA 2RSVA 4MCVA 5CQUA 4DGMA 2QOQA 1CDKA 4PDSA 2EXEA 4JIKA 4DEGA 3ZO4A 1OGYA 1TQMA 4TWNA 1WFCA 4I6BA 4PWNA 4OTDA 1KE6A 3AMYA 3CQWA 3ZSGA 2OXXA 4EBWA 5A3XA 4LRJA 3Q2MA 4IVAA 4I6HA 4WA9A 2OH0E 2CCIA 3R1YA 3BU5A 2IW6A 4HGEA 2A19B 2O8YA 4FGBA 2V62A 3ROCA 3NUXA 3WILA 1X8BA 5J8IA 3UDTA 4AXCA 2HWOA 2WMRA 5HHWA 4F0IA 3OVVA 2B9JA 2OG8A 3GC9A 2VTSA 2QU5A 3KULA 5AUTA 2AQXA 1K3AA 4M3QA 3DDPA 2UZEA 3KREA 2ITUA 2H9VA 4QQ5A 4FT7A 2WOUA 2GDOA 3PSCA 1JVPP 1ZYJA 3ITZA 1B38A 2WEIA 3BL7A 4AT3A 1F0QA 5JQ5A 3F9NA 3ZSHA 2FYSA 4HGSA 4LFIA 4BCQA 1Q41A 4U0IA 3T3UA 2JBOA 2YLEA 4A4OA 2CKEA 4NIFB 5ANIA 1JSTA 3LHJA 4FSZA 4XMOA 4Y85A 4BDAA 1IASA 3DA6A 5BMSA 2C0OA 1O6KA 3P1AA 2ZOQA 3MIYA 3PVUA 2WMSA 5E1SA 5BX0A 2XNNA 2QHNA 4QP1A 4P7EA 5IEXA 2X4FA 4RJ5A 4EH9A 1OL2A 1T45A 4BCKA 5L3AA 3UIMA 4JL9A 5IA5A 3MVLA 3OT3A 4TN6A 3R2YA 3BYSA 4GVJA 5L2QA 5IQAA 5CF4A 5LMBA 5EW8A 4WRGA 3W0NA 3F5GA 2UW9A 3DNDA 2HZIA 4FIIA 3PUFC 3WZDA 1JQHA 3FQSA 5JRQA 1UKHA 3KCKA 4M0ZA 4DBNA 5IMEA 4YLKA 4O7SA 3QWKA 3P86A 3OY1A 4EOLA 1AD5A 5ANDA 4DFUA 5GNKA 2B1PA 4XEYA 5ACKA 4EOSA 3R7EA 3BE2A 3R73A 2OIQA 2G2HA 3V5WA 1J7UA 5DR6A 3O17A 4QMXA 1GZKA 4L42A 2A2AA 4O2ZA 3UQGA 3OCGA 4E26A 1L3RE 4XX9A 3CGOA 2YACA 5AR4A 1J3HA 2F4JA 3DBFA 4IZAA 4QRCA 4HCTA 4FOCA 5HBJA 3AKJA 2YZLA 3GB2A 3OOMA 4GCJA 4GEOA 2WMUA 4L7SA 3HV5A 3MWUA 3PXYA 4G3FA 2GHGA 4FZ6A 2PVJA 1LPUA 4MNEA 3HDNA 5E8UA 5M56A 3EN6A 3NUUA 3ORXA 3KQ7A 3TKHA 5IMXA 4M69A 2QOCA 3WBLA 3KU2A 2C5OA