2UWBA

Crystal structure of the nasturtium seedling mutant xyloglucanase isoform nxg1-delta-yniig
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
267
structure length
267
Chain Sequence
VQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evidence for the Evolution of Xyloglucanase Activity from Xyloglucan Endo-Transglycosylases: Biological Implications for Cell Wall Metabolism.
pubmed doi rcsb
source organism Tropaeolum majus
molecule tags Hydrolase
molecule keywords CELLULASE
total genus 67
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
A PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2uwbA00
4I30A 4NO4A 3O0WA 3FUQA 1GNHA 4FPKA 4Y1XA 5CNAA 2FMDA 4YW4A 1W0OA 4C1WA 5DZGA 2VY0A 3LSEA 2I2SA 3IPVB 2ZABA 1LGNA 3SH3A 3VKNA 3SLIA 4AGGA 1G9CA 3VKFC 3RMXA 5JDBA 2A5ZA 2SLIA 1HKDA 4YZ3A 3V0AB 4R9DA 5T52A 3USUA 2D6LX 2ZGMA 3AX4A 2LALA 2CNAA 2P37A 3V0BA 4DPNA 1DYPA 2W39A 2YMZA 5GM0A 2UWBA 5GLTA 4YZ1A 1I3HA 4LBQB 2A6VA 1IS6A 1FATA 1W6PA 1J1TA 3NV3A 4WVVA 4UW3A 3TB0A 3PVOA 1UN1A 2W52A 1LCLA 1LOAA 4BQ1A 2NN8A 1W6MA 2ZGLA 5JOYA 1LGCA 2NMOA 3APBA 2GNTA 3POWA 3AFKA 3AYEA 1S0JA 2B7YA 1JYIA 2AUYA 1ZA4A 4K1ZA 1VLNA 2DYCA 4Y22A 1WD3A 1SLTA 1ULFA 1S0FA 1MS9A 4RA0A 1YIFA 3AZZA 5T54A 3AXEA 5DXDA 4BMBA 2DVAA 3R4UA 3WDYA 5T55A 1UL9A 4P9YA 2JDZA 1Q56A 2A7AA 2PELA 2D7FA 4BLJA 1MS3A 2ZZJA 3VKMA 1MZ6A 3N7KA 4XE9A 4GWMA 1GSLA 1CPNA 2JKBA 1MVEA 2DUQA 4FPLA 3DUIA 2D3SA 3O0XA 4AGVA 1IOAA 1SCSA 3CNAA 2GDFA 4GKXA 4KBBA 1IS4A 1CQ9A 1BZWA 4ATEA 3M3OA 1HLCA 2A6WA 3UJQA 4FP3A 5GJ6A 5GLZA 3WCSA 3LSDA 3OBRA 4YG3A 5GLVA 2GMEA 3D5OA 1DGLA 1YRZA 5IK4A 1AJKA 2A71A 3FLTA 4YW2A 3WG2A 2EF6A 2E7TA 2BQPA 4Q27A 1ENQA 2DVFA 1WLWA 1IKQA 4XJ9A 1FV3A 1LOGA 5FREA 1DYKA 1D0HA 4XXPA 1FAYA 1R1ZA 3ZXFA 1KDMA 4OZXA 1YI7A 1N3QA 1QOTA 3B69A 2D6NA 3OYWB 2ARXA 3FBYA 2PHRA 2WNEA 2ZGRA 4YW5A 5JVVA 3OY8A 2P3JA 3SH5A 3FLRA 1CN1A 3KQRA 5DUXA 2OUHA 2YROA 4M01A 1DFQA 1GANA 2A70A 4CTEA 3AJZA 5EWSA 3VKLA 1G9BA 4TZDA 3ZXLA 3WDUA 5GALA 2VW2A 5H9QA 1WW4A 1N3OA 3FLPA 3D4KA 1OKQA 2VW0A 3Q9OA 1AVBA 1MS8A 1XQNA 1F9KA 1TEIA 3WHTA 1S0CA 2GN7A 1KRIA 1LOCA 1N1YA 2SBAA 2UWAA 3ASIA 3N7MA 2JE9A 1UZYA 1SCRA 2GNDA 5GLWA 2A6XA 1W6OB 3IM0A 2HYKA 4M3CA 2D3PA 2EXJA 2GMMA 1G9FA 2AREA 2UWCA 1WUVA 4XBQA 3PVEA 1Q8OA 4FQ4A 2DURA 2ZKNA 1G8WA 3M2MA 2OUJA 3ZYRA 2GN3A 1G7YA 2D6KA 3TAYA 4Q8LA 1W6PB 4Y24A 2R1BA 3AP4A 3N7JA 1HQLA 1N47A 5IK7A 2AH2A 2AGSA 1DQ0A 1G9DA 1AF9A 1SLLA 4R9AA 1FV2A 4YFZA 5DUWA 1KQRA 3NV1A 1DHKB 1C57A 3AZWA 2R1DA 4YG6A 3V64A 4MYEA 3ATGA 4YLZA 2PHUA 2AR6A 4XIKA 1Q8PA 1GZWA 1LULA 3WVJA 1MS4A 3ZXJA 1YXWA 1QNYA 5T5JA 3M3EA 2A3XA 4LBKA 1MZ5A 2WKKA 5E8AA 2DUPA 4ASMB 2JECA 2KM2A 3ZSMA 4DS0A 5JLVA 1BJQA 5L73A 4H55A 3BOPA 4FOVA 3IPVA 2ES3A 1FNZA 1HQWA 3SITA 5T50A 2ZMNA 4YZ4A 1IS3A 3IN9A 1W6NB 2XB6C 1DQ6A 1LESA 4CZSA 1V6MA 2W68A 4Y1YA 1ULDA 1GZ9A 1ONAA 1KDKA 4YZ2A 2P3IA 2A75A 1CESA 2NYYA 3ZSKA 1QDCA 1FNYA 5IUQA 1LU1A 1WW5A 1VAVA 3T2TA 1A8DA 2PHWA 1O4ZA 5CA6A 1QOSA 2CYFA 2RHPA 1C4RA 1AXKA 2JJ6A 1GZWB 3OJBA 1QF3A 3NWKA 1I1EA 1V6IA 1WD4A 1GICA 3ILRA 1RITA 1SLIA 3C2UA 5KXCA 3ILFA 4Q2FA 1V00A 4W65A 4XIOA 5E89A 2JE7A 1O4YA 1LOBA 2DVGA 4XOGA 4XBNA 1JBCA 4DRRA 4XJAA 2EXIA 5JMCA 1UPSA 2NZ9A 4ISQA 2GNMA 1Z0HA 3GALA 2ZAAA 2D6PA 4BMEA 2DTWA 1JXNA 1GV9A 2EALA 1DZQA 3O0VA 1KITA 1OFSA 2WT2A 4FPJA 5HCAA 2GALA 5EYYA 3ZSLA 1X50A 1QKQA 3O12A 2UU8A 4Y1UA 5LK5A 2AENA 1Q8QA 3SNMA 2DU0A 3ILNA 2D44A 1C1FA 1CONA 4Q1PA 3ZPYA 3N7LA 1V6KA 4XJZA 4FOQA 4YGEA 1FX5A 1LEMA 5F9TA 2A3WA 4BLIA 4D69A 2A6YA 3RSJA 4JRAA 2P3KA 1N3PA 4HANA 3R4SA 1ENSA 4YGDA 3AP5A 1LJ7A 1F5FA 3B00A 5T5LA 5HCFA 4XJWA 2R0HA 1ENRA 1UZZA 2ZGOA 1VAMA 2NM1A 4XHBA 3WDXA 2Z42A 3M3QA 5FRAA 1DLLA 1JHNA 5GZGA 1CJPA 3V0AA 3AP6A 4UW4A 2C9AA 4XTMA 2W08A 2R16A 5CB7A 4YGBA 3AYDA 3UJOA 1UAIA 2EAKA 2LTNA 5DG1A 1S0DA 4PQ9A 3OY8B 1HDKA 1URXA 3BIWE 1KJLA 4YM3A 1WBFA 2V5YA 3JUUA 2ZGNA 3O5SA 1DQ2A 1S1AA 2EIGA 4FVVA 1GZCA 4Y20B 4HL0A 5JOWA 4FPHA 4LBMA 1DQ4A 4SLIA 2ZMLA 3ENRA 4LBQD 1MVQA 2Q5TA 1S0EA 3H0OA 4DQAA 3POSA 4R9CA 1A3KA 5F5QA 5IK5A 1IS5A 2ZHNA 3KM5A 4AVSA 1LHWA 4PBOA 3PMEA 1JUIA 4Y22B 2DVDA 1CR7A 1MR5A 2OVUA 3V0BB 3W59A 1JOJA 5IT6A 1C1LA 4LBQA 3M1HA 4RL7A 1AXYA 1B09A 4YG0A 3WOGA 5GZFA 1V6JA 2A3YA 3ZXKA 2E53A 2D6MA 3OPZA 4AVVA 4LBLA 1DBNA 1ZM1A 1LOEA 1Y7BA 4ITCA 2VXRA 4Y20A 4YZ5A 3VV1A 5IK8A 1N1SA 3MW4A 3N3HA 4XZPA 3RMYA 4JCKA 4AVTA 4Y1ZA 1JW6A 1MS0A 4ISRA 2VUAA 2ZA9A 1JYCA 4WVWA 4XTPA 2ZHLA 3T1LA 2WT0A 2YXSA 3DGTA 2CY6A 4PBPA 3WUCA 4Y26A 1UX6A 2ZGKA 3A0NA 2AYHA 3NV4A 1PZ8A 5AVAA 1SACA 4XBLA 4YGCA 1OQ1A 1GNZA 1IKPA 2ZGSA 1QU0A 2WJSA 3ZSJA 3ZXEA 3BTAA 3HN1A 2ZHMA 3QCWA 5HCBA 2GNBA 1BXHA 1GKBA 1H9WA 2R49A 3AP9A 4BPZA 5EYXA 1W6NA 4DFSA 4IQPA 1VALA 3RRDA 2C5DA 3OGGA 1BYHA 2FHRA 1AX0A 4M3CE 2R0FA 4FOWA 4Z8BA 2WLQA 2DV9A 5CAZA 5KXEA 5GLUA 1MS5A 3WCRA 2DWRA 4LBOA 4PF5A 4U36A 2XG3A 1S0BA 4YM0A 5DUVA 2ZBJA 4FQZA 2GMPA 2ZGUA 2ARBA 3MPPG 4Q26A 4FPGA 4P9XA 3SISA 3L2YA 2VU9A 3ZVXA 1SBEA 3WZ1A 1G9AA 2CL2A 1GLHA 3FFZA 2ZGTA 3OYWA 2P34A 4L8QA 4YM2A 4LBNA 1UMZA 5H9PA 1RINA 3OBTA 5JOXA 1W6OA 2YV8A 4BM8A 2JD4A 3AJYA 1DQ5A 4AGRA 1LGBA 4ATFA 3U4XA 3AP7A 2P2KA 1QGLA 3HR9A 4P9WA 1SLAA 1AZDA 1SLBA 4K21A 1LEDA 1LOFA 3MW2A 5GZCA 1W6QA 1W0PA 4WZFA 5BYNA 2TEPA 5CBLA 5T5OA 2WSVA 2CTVA 2DUOA 4Q8KA 4ZKTB 2ENRA 3PVNA 1WBLA 4K1YA 4GXLA 1G86A 4M3CB 5JOZA 1BKZA 1NXD1 2A6ZA 4XMAA 4XJ8A 5SV8A 4YW1A 3ZYPA 3AYAA 3HMYA 3I8TA 2EXKA 1CPMA 1D2SA 3IMNA 3SH4A 1SBFA 2ZHKA 4XJUA 3RG0A 3INAA 1N1TA 3AXDA 4XYXA 1CVNA 3B01A 1ULCA 3GNEA 4FPFA 5KXBA 4M3CF 1LU2A 3FUOA 3RS6A 4YM1A 4U2AA 2VW1A 3BODA 4XXAA 5DZEA 4FPCA 1LTEA 5DZFA 1DQ1A 1NLSA 2DU1A 1QMJA 1VIWB 3D6EA 3WDTA 5H9SA 1WLCA 2DTYA 1Q8VA 2V73A 1APNA 3PJQA 1QNWA 1YYNA 3N36A 4FP2A 4R9BA 4P14A 4YW3A 1LHUA 2WQZC 5DG2A 5DUUA 1PZ7A 1U0AA 1W6MB 1KJRA 4C1XA 3WLUA 1GBGA 4TYSA 3V65A 2UURA 1F31A 1LHOA 2ZGQA 4GWNA 2ERFA 2E7QA 1RIRA 2G4IA 2PHTA 4K20A 4GKYA 5KXDA 2ZACA 5H9RA 2ZMKA 3W58A 4LBJA 4UW6A 1SBDA 4FOYA 4GA9A 2NP0A 1SFYA 3T1MA 3VUOA 3R05A 4WV8A 4XDQA 1QOOA 3MEPA 4Y1VA 1A78A 4AWDA 2EXHA 1H9PA 2NMNA 1WCSA 3B3QE 3QLQA 2D43A 1Q8SA 4FPEA 4FPYA 4GALA 2E51A 2PHFA 1LECA 3WUDA 1FYUA 2D3RA 3UK9A 1N1VA 2PHXA 3AZVA 3POYA 3NV2A 1GYKA 3A0KA 3WHUA 4JC1A 5GZEA 1LODA 5GZDA 1AX1A 1AXZA 3WDVA 1WW7A 1PZ9A 2YZ4A 4ZXKA 1V6OA 2WT1A 2D6OX 3VKOA 4DRVA 1MS1A 3JU9A 1SLCA 1Z78A 3IKWA 1V6LA 3M3CA 1LOFC 2YY1A 4Q1RA 4XMIA 4BOWA 3UL2A 4PCRA 1JN2P 4UW5A 1S0GA 1LENA 1CIWA 2CWSA 2DVBA 2H0BA 2E6VA 1EPWA 1DIWA 3WNXA 1S0IA 1YO8A 2WSUA 1ULEA 2CWMA 3MW3A 3WG4A 3USUB 5T5PA 4M00A 4AYUA 3AYCA 1WLDA 1AJOA 1AX2A 1UKGA 2ZGPA 3AZYA 4XILA 3WG1A 1V6NA 5E88A 4CRQA 4F83A 1LHVA 2VH9A 3LCPA 1LHNA 1MACA 4NOTA 3RQ0A 4YFWA 3N35A 3I4IA 5EXOA 4FPOB 3AK0A 3WDWA 1ULGA 2OW4A 1W6QB 3AZXA 1QDOA 3B9CA 1BQPA 1WW6A 3WG3A 3WV6A 1H30A 3A4UA 4XHXA
chains in the Genus database with same CATH superfamily
3JD71 3TWIA 1CAUB 1GNHA 1AR92 3PIJA 3FHIB 2FMDA 2BNOA 2Y0IA 3E5UA 4FPKA 4YW7A 5FZBA 5A80A 5FO7B 4OI1A 3WD5A 5DZGA 3LSEA 3IPVB 4AGGA 4CDUC 3PL0A 4Q4V2 5CKNA 2A5ZA 3KV5A 4RFT0 1UOGA 3V0AB 4OVEA 2Y34A 2B45X 5FYCA 2HH9A 2B46X 4UYBA 5F3CA 3JB4C 1VB4A 2ORXA 3HPNA 2RJKA 2YMZA 4IV1C 5GM0A 1RXGA 5GLTA 4C91A 3LFMA 5FUNA 1FATA 3ZKUA 3NV3A 4PIZA 5FR3A 2W52A 1PGSA 1H2MA 4A3ZA 2VUJA 3PUQA 1LGCA 3POWA 4RQPB 4QDSA 3UKNA 1FOD1 2AUYA 4K1ZA 1LKNA 3Q8CA 1VLNA 1MQTB 2DYCA 3L9JT 3FC0A 2VMCA 2JG9A 4R8HA 4URTA 1MS9A 4EROA 4D7TA 1VBC1 2VMIA 4XUPA 3AZZA 4AFBA 4QX2A 1JYWA 1JYTA 2DVAA 3WW4A 1PMIA 3ZDSA 1F8VA 3IBMA 3THDA 1XYPA 3CO2A 3VKMA 2ZAHA 4CDXC 3MV01 4GWMA 1RUD3 2J22A 5FLHA 5FYVA 5C3QA 1MVEA 2RR11 4FPLA 2ZX0A 3CDZB 3DUIA 4IESA 4UF0B 4AGVA 4LK7A 3N4MA 3UGHA 4RHV1 5J3UA 2QQWA 1IS4A 2YFUA 1BZWA 3DECA 4FP3A 5GLZA 1W8TA 3WCSA 1PGW2 2YC2A 4B1LA 5F7UA 4YG3A 1TE1B 1YQ6A 2R7EB 4MGYE 5J37A 3I59A 4OI2A 4RGGA 3E1F1 4YW2A 2EF6A 2E7TA 2BQPA 4MHRA 1ENQA 4GQ7A 1IKQA 5CADA 1RB8G 4CYDA 1FAYA 1R1ZA 3ZXFA 4OZXA 1YI7A 3FBYA 2WNEA 2X05A 5F5IA 4JDOA 3SCHA 1CN1A 1OOPB 5DUXA 2OUHA 2YROA 3KB5A 2ET1A 2A70A 1ASJ3 5EWSA 2Y6KA 2YGMA 4V2VA 5KWRA 3ZXLA 2HWD3 2VCCA 4W4ZA 5GALA 1DZRA 2XJVA 4XF9A 3MV11 3FLPA 5FYHA 2BJSA 4QGNA 1BBT1 2VW0A 3Q9OA 1MS8A 5I8TA 1XQNA 1F9KA 3I3DA 4HPKB 1JYXA 3OGJA 1CD3G 2VNGA 3O1MA 3MIGA 4ZZ5A 2W9XA 2WNOA 4CCDA 1EAH1 1LOCA 3ASIA 1QJFA 1SDWA 2SBAA 5FY4A 3GBWA 1SCRA 2GNDA 2RS33 3H42B 4BQ2A 3J8F3 1W6OB 3DXTA 4TXWA 2GMMA 4LPLA 2VQUA 1G9FA 2AREA 4ZXEA 1DGRN 1YJKA 4LE3A 4QQOA 5ANQA 1RGSA 3JBG2 5BNNA 2DURA 3M2MA 2UY8A 1S55A 1UU4A 2WNUC 4IETA 3U1XA 2D6KA 1FMD1 1WA6X 2XL7A 1UQXA 1WMEA 1DU3D 4BWOA 4DEVA 5FZFA 2VXJA 1JZ6A 1N47A 3GYDA 1RVF2 1NQDA 2AH2A 3LEMA 3J26N 1G9DA 1VBB3 1ND3B 2WABA 4YFZA 2QZ3A 2XDVA 5DUWA 4CUGA 3T0DA 5F8PA 1QJX2 3AZWA 4YG6A 4XQDA 4AI2A 4YLZA 1W8OA 2PHUA 4Z2AA 1O5LA 2VZ3A 4XIKA 1WMXA 1Q8PA 2BBAA 4A7YA 4BQ5A 3O1SA 2DCKA 4HN1A 5A6ZA 2P17A 1EY2A 4E9KA 4IGQA 3AKQA 3CIHA 1MS4A 3P5BA 1Y3TA 4QPGA 3ZXJA 2QQPA 2Q1ZB 1RHI3 2WKKA 4ASMB 2OQ6A 4DS0A 2EA7A 5L73A 5LA9A 4CCNA 3T0AA 5FJHA 2IZWA 3KZ4C 1FNZA 5JWPA 2ZMNA 2HWD1 2K9ZA 1RUF3 4BQYA 2HWD2 1E5IA 1VRBA 5FYYA 3ALQA 5JI7A 1QXPA 4KBZA 3UKVA 4L97A 1KDKA 4BE3A 1D4VB 2HWB1 3C8XA 1CESA 3VDBA 1FNYA 5IUQA 5C4WA 1LU1A 4CU8A 5F5AA 3TN91 3KV6A 1JOPA 1VAVA 4MGKE 1A8DA 1H8TC 5CA6A 1O4ZA 5C8CB 2RHPA 4UFJA 4B4QA 3RDIA 2X29A 1PVXA 1BK1A 2VTXA 3WF0A 5FPUA 3TNPB 1GICA 3GCXA 1BVP1 3KVAA 5EP9A 3H3LA 4XCAA 2RJ2A 2JICA 4KU8A 4BHPA 1CZVA 4PJYA 4Q4W1 4ONUA 1VBD2 5F2WA 1H1MA 3HT2A 1AL0G 4W65A 4XIOA 5BNPA 3U0ZA 2JE7A 3UGFA 4F3JA 1P8JA 4OI0A 4XBNA 1LRHA 1W2TA 4XJAA 2EXIA 4ZPIA 4QHZA 2NZ9A 2Z5WA 5FUPA 3D3AA 2ZEWA 2GNMA 3U07A 1PMHX 1Z0HA 2VMFA 2ZAAA 3GALA 4GWJA 1GV9A 4PIYA 5FZCA 5F32A 5HCAA 4QPGC 2GALA 1VE0A 4HN0A 4M4PA 3WNLA 1ZZBA 1YWKA 3I2IA 1C8M3 1V0AA 2UU8A 4KWUA 1H6XA 4PT6A 4DO0A 4ZZ8A 4JX0A 4JGYA 2D44A 1WMDA 3Q8FA 1CONA 1Y4WA 2R043 1V6KA 2VZRA 4RGKA 3UETA 1LEMA 4A44A 2QQOA 1VBC3 5FBZA 4D69A 5F9TA 3RSJA 1TMF3 5LA2A 1LAJA 4AAXA 1N3PA 2JG8B 4YGDA 3BPZA 3VBFB 4W8JA 3H8XA 3D8CA 1D2QA 3OEAA 1LJ7A 5HXVA 5FO8B 1K5MB 2DBIA 1GQHA 2R0HA 3J7MA 4XJWA 5HCFA 5C3RA 2Y6HA 2XJUA 1W9SA 1YNAA 2NM1A 3IWZA 4QQPA 4CXWA 4NR1A 4AVAA 1AL22 1OH4A 5FRAA 1NCQC 1SG3A 2ZZQA 3GZUC 3V0AA 4XF4A 4PDWB 2VUCA 2VECA 4CDUA 1EV11 1VBB1 3MDPA 3I49A 3HNMA 4NIHA 3MFCA 1VBB2 5EJ3A 1ND3A 2PHDA 4N7UA 3UJOA 1PGL1 5DG1A 4PQ9A 3N9PA 4ES8A 5BUVA 1RMU2 5FMCA 3AKPA 1ZREA 4BXFA 2V5YA 5JZGB 4IEXA 3WX5A 2XHNA 3LAGA 5A1FA 4FVVA 2ZJCA 3POJA 2VZQA 1DQ4A 4LBMA 2XLAA 4ZHNA 2OZJA 2ZMLA 4LBQD 1PK6B 2Q5TA 2RV9A 2VOWA 3VHPA 2JG8A 2OKXA 3T08A 3DV8A 4H14A 3S7EA 4QXHA 2GH2A 4E2SA 3C7OA 2ZHNA 1OD5A 1R1A2 1LHWA 4AVSA 3AMQA 1O3TA 1JUIA 2WS91 2VG9A 3ZYIB 3BCWA 4Y5TA 2WS92 2WZR1 1T6GC 1VBE2 4O9EA 2VTXJ 3GGLA 3M1HA 3VDAA 1UPIA 1TQ5A 3NAPA 4I3GA 4WM7A 5GZFA 1PO23 5K0UC 2E53A 3GM8A 3OPZA 4AVVA 3U14A 4W50A 3O1RA 1GQPA 2IXHA 3LQCA 1LOEA 2QFEA 2EVXA 4YZ5A 2JXAA 4N43C 1N1SA 2WINB 4QKBA 2VZVA 4XW3A 1XPWA 2RS13 5ANNA 4JCKA 5FZKA 1WMFA 5IVFA 1JW6A 1MS0A 4ISRA 1VRH2 4JHTA 4ES9A 2ZA9A 2WYSA 1AR82 2QKDA 1W8UA 4QB1A 4YWAA 1VBD3 1UW8A 5F5CA 3DGTA 3I59B 1AR81 4AFAA 1ZBA3 5FP8A 3AKSA 4KWJA 4DXZA 3A0NA 1NKGA 2AYHA 5A33B 2RS11 3IIAA 5C9AC 5A7PA 1EYBA 1PZ8A 2OS2A 2W1QA 2W5FA 4B4RA 1RUD2 1NOVA 2ZGSA 1PVC1 1PK6C 3GZEA 1QU0A 2LROA 2WJSA 4PLMA 2P4EA 5CKMA 3HQUA 5EHDA 5LBEA 4F8AA 5FWJA 4HK8A 4KU7A 1TNRA 3KV4A 4BPZA 2WIIB 4DFSA 2J7MA 3RRDA 1TNFA 4UI9L 2C5DA 3OGGA 5A3TA 2P6HA 2BOIA 4IE6A 4AK3A 3POEA 3HWJA 3VZOA 2DV9A 1S2BA 3H1MA 2DWRA 4B8EA 5FTTC 3EXUA 3MUZ1 4QDQA 4YM0A 1EUUA 3NAPC 4WM7C 4A42A 2FDHA 3KCXA 4XUNA 5JMOA 5KHIA 5K0UA 5LASA 1W39A 3K2OA 4BQ4A 4DUVA 3L2YA 1RHI2 1SBEA 1U12A 1ENXA 1AR71 3FFZA 2ZGTA 3S0MA 3N9OA 2V5DA 3OBTA 2VMGA 3AM2A 1W6OA 4BXSV 2JD4A 4HT1T 1WLTA 2VZPA 1ZBE3 5CFCA 1YFWA 4IGPA 3BTXA 4HMZA 5C3OA 1QIQA 2Q30A 3KS7A 1HJGA 2UYAA 3HR9A 2Z69A 3NNMA 4GMP0 1W2AX 2ZEYA 4R4ZA 5FYZA 1LEDA 2GAUA 1AR83 3MW2A 3AVRA 5LA1A 1FPN2 3AFGA 1QXJA 1V9U2 5T5OA 3FHAA 2VNVA 4LKEA 2F17A 4LKSA 1NAEA 4MADA 1ZYBA 2DUOA 2E9QA 3PDQA 3M8LA 2QCSB 2IXCA 2ENRA 4L9BA 1K12A 4M0NA 4Z1VA 3MZHA 1W9WA 1NXD1 4XMAA 2HWF2 3I2GA 1R1A3 3ZYPA 5SV8A 3RYPA 2R063 1RUC1 2E63A 2EXKA 1D2SA 4UOJA 1OXCA 1ND2C 2ZHKA 4G3YC 2A1XA 3INAA 3E97A 4E4SA 2XKOA 1CVNA 1D0GA 2OXBA 4B7EA 1LU2A 1AR61 3OBAA 4EN7B 1UWWA 2FZ1A 3NAPB 4WM7B 2VW1A 5LATA 3BODA 3OSDA 1FT9A 4QXBA 4FPCA 4KWLA 4XXAA 5DZFA 1Q43A 4CCOA 1JZ7A 3UNPA 5FPBA 1QMJA 2JE8A 1BLZA 3BGAA 5H9SA 1CWPA 4YARA 4G4FA 1YLLA 4AHWA 3N36A 3LA3A 4FP2A 3VBRC 2WQZC 5K7PA 3K77A 1PZ7A 2D5HA 4NWWA 4C0HA 4URAA 2IC1A 2Q8DA 3S5QA 1GBGA 2C0ZA 2QZ2A 1F31A 2WWSA 3ZYBA 5E6HA 3PU8A 3VD5A 4BYYA 2G4IA 1W3XA 4LE4A 4K20A 3BTYA 1CX1A 3HT1A 2Q0AA 3DPRC 4GKYA 5KXDA 2ZACA 3A23A 5A7WA 5D8AC 2XLFA 2X5IB 3KT1A 3K4DA 4OCTA 2E26A 1SFPA 1WZXA 2D5FA 3K75B 1O3QA 2F4LA 4NHMA 5HXMA 5KC5A 5JXJA 4XDQA 4XDOA 4AWDA 1A78A 2EXHA 2WO2A 1COV3 3R4DB 2EIDA 3O7OA 2YGLA 3E6CC 2XWJB 1Q8SA 3U10A 4FPYA 4BIOA 2E51A 4JGZC 4XAAA 1LECA 2BYVE 3WUDA 3POBA 1ND2B 1X33A 2VVDA 2VQTA 3CJIA 3UK9A 4E8DA 2PHXA 1HQNA 1OUSA 1GYKA 3A0KA 4QQHA 2HBUA 5IWFA 2AEZA 3TNQA 1LODA 4PF1A 3WDVA 1GOGA 4I0WB 2BBVA 5F6LB 1GWKA 2Q4SA 2WT1A 4ARYA 2D6OX 2ID4A 3VKOA 4AAPA 3MLLA 3RI8A 4CVUA 2BU9A 3NNLA 4MSVA 4J1WA 3UL2A 1R091 2JDYA 3VBRB 5CYYA 2CWSA 1QWRA 1B35C 3FL7A 3MPBA 2CWMA 2WO7A 3THTA 1W8NA 5D1IA 3USUB 5JPNB 2VNOA 1W8FA 2ZEZA 2JD9A 5E88A 1RUF1 4GB32 4KMQA 5EZWA 4CRQA 3ZDVA 1ZZ6A 4R4XA 2VH9A 1F2NA 5FY9A 1YQ5A 4YVWC 2XBO2 3WF1A 3AB0A 2V4AA 3WDWA 4A6OA 4FPOB 1GU3A 1W6QB 2AEYA 4NHXA 1RUI2 4AFCA 4NHKA 1QDOA 3B9CA 5A3MA 3NQHA 3KT4A 4CA9A 3UT0A 2UYBA 3NJZA 2KR2A 4NO4A 1OA2A 3O0WA 3BB6A 1KS5A 2WFPA 1Z7S3 2X10A 1W0OA 2C1FA 3NSTA 2P1BA 1RUI3 4NJ4A 2E32A 3OUIA 4C1WA 4IL7A 5EV7A 5FZHA 3SH3A 4YVWB 3C7FA 3S5AA 3SCGA 2OYZA 3RMXA 5ABJA 2SLIA 3B94A 3ZR6A 4BQ3A 4DZGA 2WR9A 3N9MA 4R9DA 1FMD2 2D6LX 5T52A 3USUA 3I3BA 3HNBM 4RGAA 2OZ6A 2P37A 1AUYA 5L19A 2W39A 3U37A 1QJX1 2WFF1 4HKWA 4IEQA 4LBQB 2C4XA 2W1WA 4ZU4A 2A6VA 2ADEA 3NRUA 1W6PA 2HJIA 4UW3A 4QXCA 3SEPA 3PVOA 4GWIA 4Q4Y3 2XONA 1LCLA 3OF1A 3KQ4B 2RS31 4EN6B 3EB7A 1W6MA 5JOYA 4P5YA 3AFKA 3AYEA 1HXS3 1YFYA 4KI5M 4DY3A 5DAQA 1OLME 3E6DA 3ACHA 4QU2A 1JH5A 2RVAA 1UOJA 1ZA4A 3PJYA 4Q4X1 4CCCA 3TEXA 3M4FA 4Q4X2 3RZLA 1W9FA 4K8FA 1S0FA 4YVWA 5A7WB 1HIXA 2PXJA 2XBO3 4RA0A 2QQMA 5EJZB 5FXZA 1YIFA 2W0XA 3AKRA 3WR0A 5FCCA 4JV4A 3W21A 4GB33 4D3WA 1QJU3 3J7LA 2RJLA 4CEYB 1UL9A 4Q4X3 4OULA 2A7AA 5L7OA 4E27A 5BY5A 4W6WA 1HRI3 4A3XA 2VM9A 4DOUA 2D40A 3VD3A 1GSLA 4HOOA 5D8AA 3UESA 2JKBA 4N7IA 1Q5OA 2DUQA 3RJRA 2JDHA 1G6NA 2D3SA 4MXWB 3THPA 5ABJC 4IE7A 5FZ9A 1UIKA 2J1SA 3M3OA 2A6WA 4QPYA 4MGQA 4XUQA 5FP7A 3UJQA 3OB8A 2JG9C 4EE2A 2QJVA 1JOBA 1W8HA 2H6CA 3O1TA 3RVHA 1R081 1DGLA 3LDKA 4Q4W2 5IK4A 1HN0A 5C6CA 2PQSA 4HPKA 3CBNA 3NL1A 3PU3A 1MZFA 4CP9B 4E2GA 1CZTA 5FXXA 1KS4A 4XJ9A 1FV3A 1LOGA 3CJXA 1DYKA 1NA1A 4GD4A 4AZZA 2FDKA 4Z2WA 1BBT2 1KDMA 3IDAA 5JIUA 1N3QA 2R073 4XACA 2YHJA 1XXNA 3LWCA 2D6NA 3VD7A 2ARXA 2PHRA 1HV0A 2ZGRA 3ZFFA 3OY8A 1NY72 2VQ0A 3WW1A 3KMHA 4CXXA 4TLFA 5LBFA 4K9SA 4M01A 1SDDB 4FFIA 3SCFA 1G9BA 1OPMA 4Y5Z0 5H9QA 2L9LA 2ZPXA 3ZN6A 5JPMB 5FZEA 4A6SA 5LRSA 3A7QA 3U78A 4HK9A 3WP5A 2X53S 3DCQA 3DKWA 3LA2A 3BKZA 4N43A 2GN7A 4UFHA 1N1YA 2QTWB 3N7MA 2W46A 4F7ZA 1NA1B 1TME2 2EAAA 5GLWA 4AFMA 2AC1A 2Y6GA 2YPJA 5DMYA 1X82A 2D3PA 2B8MA 2WA3A 3VBSA 3PVEA 1ULOA 5ACA3 4DXRA 3H7JA 1ZBE1 2VOXA 2GN3A 4ZS2A 1DF0A 1XRUA 1CGPA 3RWNA 4Y24A 1QH6A 5K8SA 3AP4A 3KCCA 5IK7A 2XOMA 1HX6A 2AGSA 1DQ0A 3CHXA 3OUJA 4Z82A 2NLRA 4MVTA 3H8RA 4NRPA 1KQRA 2ZOEB 1HXS2 1RJ7A 4MYEA 1COV2 1A6CA 4GJYA 1MQTA 3WP6A 5FZ1A 1OOPC 2PAEA 1LULA 3WVJA 1EPZA 1PGL2 4BB3A 2OIIA 4LT5A 3ZM8A 4LBKA 2GC0A 1H1IA 5E8AA 2JECA 3ZSMA 2JIJA 4IEUA 2VZOA 2W47A 5C8CC 1XU1A 4IEVA 3SITA 1AYN3 3QBQA 4LEJA 2CU5A 2XB6C 3I2OA 1W28A 3OOXA 1ULDA 2BVBA 2LW8A 1W90A 5A7NA 1PO13 4QKNA 1RL3A 2PLV2 2B4KA 1K5MC 1WW5A 3P3NA 2HBTA 3A21A 2BNMA 2WZR3 2CYFA 1C4RA 1UY1A 2JJ6A 3K46A 2RS12 1GZWB 4JGZA 3WQ0A 4CDWC 4QPGB 5ACA2 1F4HA 5HV4A 4QX1A 1SLIA 2GC1A 4Q29A 3DYMA 2E33A 2IFRA 2R062 1H4HA 4Q2FA 5DAVA 2WZPP 4QMAA 1VBA3 2PAKA 1LOBA 2DVGA 1O6UA 2FQPA 2W87A 4HKLA 1ZZ8A 5TSWA 3ZOIA 3ZYJB 3WF2A 1LR5A 1OSGA 2IUWA 5JMCA 1AYM1 1ZRDA 5HV0A 1J1LA 5T3NA 1DCSA 1GR3A 4ZS3A 1ND2A 2CSGA 5B4XA 4BMEA 2DTWA 3UV9A 1UO9A 4JHZA 4WM8A 4AI8A 2WT2A 1SFNA 4K6BA 1R64A 5CG8A 4HSJA 3QD6A 2BVVA 5CFDA 3E5QA 1QKQA 3DPRB 4Y1UA 4WZCA 5KC6A 2JIGA 3SNMA 4O7XA 1ODMA 1XNCA 2DU0A 1Y43B 4RD7A 5FPLA 4CU9A 5C8CA 1XSQA 4Q1PA 3ZPYA 4DB5A 1XNDA 3NKGA 4UAPA 4FOQA 4YGEA 4FAHA 1X8EA 2WAAA 2NPIA 2WWUA 1GWMA 4BLIA 2A6YA 4LHNA 4JRAA 2P3KA 4HANA 2XH6A 3R4SA 4FO9A 4NRMA 1JS9A 2OPKA 5I0UA 1F5FA 2QDNA 1ENRA 1UZZA 5FYMA 4QB2A 3NNGA 4X8NA 2R041 4QM8A 2R042 4XHBA 1VBE3 2V09A 2D98A 1DLLA 1JHNA 3IB3A 4CE8A 1OFNA 1VAKA 3NJXA 1SPPA 2Y6FA 1KFUL 3AP6A 3LA7A 4IV3A 2C9AA 1ZZ7A 2JDPA 2R32A 3PUHA 2R16A 4XTMA 1NYWA 3RZJA 2ZXQA 4DMIA 1VB2A 3AYDA 3RYRA 2EAKA 4UFLA 3VBFC 2ZKLA 3OY8B 1HDKA 2YUEA 5I0DA 4Q0UA 4OYUA 1H4GA 4H7LA 3JUUA 3T2QA 4HXCA 3UGGA 5FZOB 4I0AA 2JB8A 3MYXA 1A34A 1DQ2A 2EIGA 2J1UA 1GZCA 4HL0A 1H2LA 1OI6A 2HWF1 3AMHA 4L0PA 5CKQA 3ENRA 1MVQA 4OFGA 1RMU3 1QQP3 1QH7A 2CAVA 1HB4A 1A3KA 1FOD3 1TG7A 1IS5A 4COZA 5IK5A 4RS5A 2DFBA 4E4HA 1O3RA 4LO6B 1OH3A 1GP5A 1BHGA 3ZXGA 5JAXA 4Y22B 2WL1A 4QAWA 2OX0A 4AQ2A 1JOJA 2CAUA 4LUKA 5A33A 4I3PA 4MOAA 1C1LA 4LBQA 4Z07A 1AR93 5ISLA 4Q4V1 5HCHA 1GFF2 1YUDA 5J36A 4AOCA 3WOGA 2VZSA 2W1UA 3LPGA 4RYDA 4CUBA 1LB2A 4YRDA 2QQNA 1HW5A 3ZSEA 4P9GA 1DBNA 1VBC2 5FXVA 5J09A 1RUNA 2B9UA 1POQA 2VCMA 4LOTA 5AVPA 5IK8A 1DGWX 3DYOA 4LOSA 4OHVA 3RMYA 1FXZA 2BOJA 5C3SA 4I02A 4IV3C 1E5SA 2DF7A 1ACCA 4QB6A 3WP4A 3POGA 3LDRA 2CY6A 4E2QA 4AFDA 2JEMA 5JUVA 2RM22 2FCTA 3VHOA 1QJY2 1O8PA 1WWYA 3H7YA 1OF3A 4RHV2 3LKJA 2Z79A 1OLMA 4XBLA 4YGCA 1FMD3 5FMDA 2FD8A 1OQ1A 1GNZA 3C7GA 4BCUA 3ZSJA 3HBZA 3BTAA 1UU5A 4UBHA 4OQ9A 3QCWA 2XXZA 4I0BA 3ZKYA 1BXHA 1GKBA 1RUE2 4TTGA 3OD0A 5EYXA 4IQPA 1VALA 3FN9A 4Y5SA 1WGPA 4IEWA 4A7ZA 4Q4W3 4Z8BA 4FOWA 2WLQA 5CAZA 3PTYA 4CEWC 4INDA 2WZEA 5GLUA 2XVLA 3HOBA 4WM8C 1YIPA 3B9IA 4J6GA 5DUVA 3ZLIA 4D8MA 2ZGUA 3ZN6B 2YBKA 1I5PA 3V56A 4GH4C 3URFA 2BWAA 2WNVB 1OURA 4P9XA 3VN4A 2BWCA 5IJRA 1G9AA 3ZYGA 2TNFA 2HEWF 3OYWA 3VBOA 4YM2A 4XZUG 3ZFFB 1UMZA 3ACFA 1RINA 4DXSA 5JOXA 3UYJA 3POFA 4M4RA 4KNCA 4XF1A 5F1RA 4AGRA 1LGBA 5FKCA 2NQYA 4X8PA 1UYPA 5BNNB 3MIEA 1QGLA 4CU6A 1F4AA 4P9WA 1SLAA 4LIUA 4NVPA 4PHZA 3VBSC 2BP6A 4QQLA 4Y4RA 2WAOA 5LBBA 1D7PM 3K4ZA 4MGIE 3H8OA 5A32B 1R093 3CLPA 4NUBA 1H8VA 5IW0A 4FSJA 4AQ6A 2CTVA 4L99A 4Q8KA 5FXWA 2TUNA 3PVNA 1HV1A 4K1YA 5FYTA 4GXLA 1G86A 4LHKA 4RS5B 3RZMA 2A6ZA 4PI0A 3MHZA 4DNYA 2H6BA 1BCXA 5F2SA 3HMYA 4COVA 4ZU7A 1CPMA 2WFF2 1PNFA 1RUI1 4L92A 3I3EA 4XJUA 5KHGA 4FTBA 4V1PA 3VBUC 4XYXA 3B01A 4XFAA 4QGMA 4M3CF 1TVGA 1V9U3 4AEMA 4CEWA 1IPSA 3FUOA 3ACGA 2YU2A 4YM1A 3RS6A 3ME2A 1HB3A 1WCKA 2RS32 4CUCA 2D97A 5KHHA 3E6BA 1CZSA 2DTYA 2V73A 2VULA 3MIFA 4TLGA 2Y26A 4BJ0A 1QNWA 1C5HA 1YYNA 4R9BA 5LCWL 2MPFA 1LHUA 1B35B 2BFUL 2QQJA 3BALA 4AQSA 4D0QA 3V65A 4YVSB 1DDLA 1POV1 1UXZA 4M0HA 3WSOA 2WNUB 1LHOA 4IV1A 4GWNA 1O3SA 2I74A 4BISA 2PHTA 2IWGB 3I3QA 5LY2A 2O8QA 1XYNA 4LBJA 2BV4A 4UW6A 3TEWA 2R6QA 3MICA 4FOYA 5L9BA 3T1MA 2ZX4A 4ARXA 2WUHA 2J1RA 3R05A 4WV8A 5FZ6A 5J7MA 4Y1VA 3KF5A 1T2XA 2NMNA 4N90A 5EFUA 1R092 3QLQA 2D43A 1VMJA 3CF6E 5A6QA 4FT8A 2CGNA 2D3RA 5IATA 3PURA 4B7KA 1S2EA 4AG4A 1J83A 1VBD1 5IAVA 3WHUA 1I6XA 4C90A 1RUF2 4GB31 4Q0VA 4RN5A 5GZEA 2BEOA 2XHKA 4W6YA 3ETQA 1PNGA 1WW7A 3F95A 4Q0QA 4ZXKA 3BUCA 4CCEA 5FK7A 1V6OA 5FPZA 1JZ2A 3MFAA 1XB9A 1NCQA 3IDBB 3USSA 4LKDA 1SLCA 4AEDA 2OT7A 4BOWA 4CDXA 1LOFC 4HETA 5JZGC 5FDBA 1JN2P 3WXPA 3GJAA 2H0BA 2XJRA 5F3IA 1S0IA 1YO8A 1NY71 4HONA 1ULEA 3MW3A 4WM8B 4YVSC 1R082 5LW9A 4NAOA 5FZLA 2R072 1AX2A 2MEV2 2ZGPA 4XILA 5JR7B 1SQ4A 2R071 1XNBA 5FJKA 3RJ2X 4F83A 1C8NA 1LHVA 4LMFA 2G19A 1MACA 3NW4A 1JYNA 4AQTA 3I4IA 4J1XA 1ULGA 2OW4A 4E4ZA 4N53C 5D8AB 3AZXA 2RS51 1W2OA 1WW6A 4D6QA 1TMF2 4OHZA 4WVMB 1H30A 2VBBA 1PMJX 1SMVA 4I30A 4BK5A 4MZUA 4QT6A 2VL4A 4Y1XA 1DGRA 5FPVA 5CNAA 3RWKX 4YW4A 3U11A 3CZJA 2ET7A 4CDXB 2OQ7A 2VY0A 5BNOA 2I2SA 1YFUA 2ZABA 4CCLA 1LGNA 3VKNA 4DINB 2CDPA 3OEBA 3VKFC 1G9CA 5JDBA 1F15A 2WNVA 2FDIA 1HKDA 4YZ3A 4GMP1 1KD7A 4RQPC 4HBNA 4P5HA 2VBDA 3CMGA 3ZN4A 4R52A 5IFTA 3AX4A 1UYXA 1BMV1 2LUWA 2VUDA 3ZIXA 4DPNA 3V0BA 1DYPA 3L2HA 4YZ1A 1ASJ2 1RUG1 2HWC1 1COV1 1AL21 2DBNA 1IS6A 2YPDA 2RM23 1J1TA 4AEDC 4WVVA 1VRH3 3VBUA 4B4PA 4YSFA 3TB0A 3LOBA 2VOKA 5IAXA 1NCRB 2VAUA 4COUA 4BQ1A 1UY3A 3GXUA 4XFGA 5A7QA 2NMOA 3APBA 2GNTA 3KWVA 4YVSA 3U75A 3K3NA 3IT8A 4CPBD 5K9YA 3EQEA 2ZX1A 4OLLA 3T0BA 3MGUA 5FY0A 4Y22A 2BTVC 1X36A 2RMU2 3MO4A 4QHOA 3DKQA 4Q4Y1 4MV2A 2BUKA 3AXEA 5DXDA 5D21A 1HXS1 2VVFA 4AI0A 4BMBA 5LZ6A 4LO7A 5CIRA 5I8SA 2DCTA 3NJVA 4KG0A 3WDYA 5FPXA 2K0GA 2JDZA 1Q56A 3THCA 1AYN2 2D7FA 1JU4A 2DDUA 1MS3A 2ZZJA 3PIGA 1ZVFA 3N7KA 3NMBA 5FZ3A 2J42A 1CPNA 1PVC3 1JU3A 2CDOA 3WNNA 4DIQA 4P9IA 5BNOC 1EV13 3OUHA 1L3JA 3O0XA 3VDCA 1NCRA 1SCSA 4AVBA 3CNAA 5C3PA 2GDFA 4GKXA 4ASKA 1HRI1 1CQ9A 1HLCA 2RDQA 4I09A 4Y33A 3OBRA 4SBVA 5GLVA 3ITQA 4MG2A 1AJKA 2HWE3 3O1VA 3TRSB 4D7YA 3B7MA 2VGDA 1WCDJ 2EIEA 1H6YA 5CFCC 2DVFA 2PAMA 3LZZA 1QEXA 2Y60A 5A3NA 5FOJB 4BQXA 1QOTA 3U4SA 1BEV2 1D4M2 5FP3A 3OBZA 3WY6A 1OF4A 2RR13 4YW5A 1TME1 5JVVA 3SH5A 2P3JA 4XAEA 3KQRA 4MXWA 5F6KA 2XPJA 3KD4A 5I0TA 2VTFA 5FYSA 3HBKA 1U5IA 1GANA 5J98B 4CTEA 2GZWA 3VKLA 3J8F2 5BNPC 1AR72 5B4NA 1OKOA 2JDAA 2VR4A 3WDUA 1W8WA 1WW4A 4NRQA 1N3OA 4ET7A 1MEC1 3D4KA 1RC6A 1JTZX 1OKQA 5FP4A 1U5XA 3M70A 3SMHA 5FMOS 1WCQA 1TEIA 3LEKA 3WHTA 3HD8B 3K51A 4AW7A 5C70A 2VE1A 5FZ8A 2B5HA 2UWAA 2JE9A 1SEFA 4FTEA 2A6XA 2VQAA 2PHLA 2HYKA 3IM0A 3S30A 3T4HB 3W5NA 4TSVA 5CG9A 1PX4A 2XKPA 4UT5A 1FPN1 1XU2A 2WZR2 2ZKNA 4TN7A 3VBRA 2OUJA 3ZYRA 2YG0A 4EZ4A 2WN3A 1G7YA 1AL23 4MH0E 1UY4A 4Q8LA 3ROUA 3ZR5A 1OC1A 1UNBA 1W6PB 3N7JA 3BPSA 4CDUB 1HQLA 1UY2A 2WNVC 3KGLA 3BIEA 1JYVA 4MUVA 3T09A 4R9AA 1JUHA 4NIDA 4KQ7A 3KCYA 4COYA 3NV1A 3DXUA 1DHKB 1C57A 1UYYA 1QHDA 1PM4A 4HG6B 3JBG3 2QQLA 2AR6A 2GP3A 2XVGA 5FUIA 2RDSA 1H1AA 1GZWA 4JGZB 1POV3 2JDUA 1GOHA 2K2SA 1O59A 1YXWA 2O8OA 5T5JA 1NQJA 2QQKA 1C28A 1CAUA 3OD4A 3PTRB 1OLRA 3ZYFA 5A6XA 2KM2A 5JLVA 1BJQA 2RS53 3KLSA 5FWEA 1ND3C 3HAGA 2PN5A 1OVSA 3BOPA 4FOVA 5GKAC 3VDDC 5A3UA 3S6PA 1RUC2 5FOBB 1IG3A 2P5BA 3QH7A 4XFHA 3FX3A 5T50A 2MEV3 5HI0A 4YZ4A 3MIDA 1IS3A 4BDVB 2JWPA 1W6NB 2MNGA 1IPJA 1LESA 1BK0A 3WINE 4CZSA 1V6MA 2QBXA 1CIYA 1GZ9A 2ZTNA 3R6SA 1ONAA 4EZHA 4AR2A 4DY5A 2P3IA 4RR3A 2NYYA 3ZSKA 2K46A 1QDCA 1YQ8A 4FXKB 4P9LA 4FFHA 1QY4A 1ZNPA 2PYTA 1AR63 4P9JA 1RUJ1 1M06G 4NHLA 3D0SA 3T2TA 1RYYA 2RMU3 3VBUB 5HBAA 4Q0SA 1QOSA 4CDQB 3KSCA 1QJY1 4HVOA 1QF3A 1W06A 3Q8AA 1YQ2A 2WO1A 1I1EA 1UYZA 5FY1A 1HB2A 1RUH2 4YPJA 4LHSA 3ILRA 4A41A 4Z92B 1PO12 2WS93 3C2UA 1UU6A 3J7HA 5J96B 4AHXA 3ILFA 5E89A 1V00A 3LIGA 3ZX7A 2JG9B 3SEEA 2W3JA 1YHFA 4COWA 5LEJA 3B93A 4XOGA 1JBCA 5I0SA 1UPSA 1RJ8A 3LFIA 4LKFA 3WNOA 4UFIA 4I2OA 2W94A 4ISQA 3TOJA 2D6PA 5A1AA 1JXNA 1ZRIA 2B39A 1GZTA 4RSUA 2VO5A 3DN7A 4BZ4A 1OFSA 3O1UA 5B2GB 3VZNA 2J1EA 1QXRA 1UY0A 1NG0A 3BU7A 1X50A 3N9QA 3O12A 3ORJA 4JTNA 4XQ4A 5LK5A 2AENA 4A45A 4AEKA 3RYKA 3VDDB 1Y9QA 3ILNA 4P02B 1AR91 2VOVA 1C1FA 3H1WA 4QU1A 3N7LA 1CAWA 4XJZA 3BTZA 4B29A 3ON7A 1OVPA 5DDJ1 1PK6A 4E4DX 2BGOA 1BVVA 2W92A 3AP5A 1QQP1 5HPOA 1UOFA 3PNAA 3VBSB 2ZGOA 1VAMA 2I45A 5JIAA 5I91A 4S2GA 3WDXA 4D94A 5CFDC 4J25A 3M3QA 2XMLA 3TEZA 1OPOA 3O1OA 4IUGA 1AR62 2WBKA 4CSWA 2PMWB 4UW4A 2W08A 1ZA7A 1IGOA 4YGBA 1RUG3 2HWC3 5KR7A 2LTNA 5FLJA 1S0DA 2HEYF 3BIWE 1KJLA 4IW3A 1ZX5A 2WN2A 1REFA 4OZOA 2ZGNA 4A2UA 5BXXA 1RUOA 4Y20B 3H3UA 3LF7A 4XETA 3N9LA 4OHXA 1VP6A 5EIYB 3J7NA 1S0EA 1CAVB 3I7DA 3H0OA 3Q8EA 4DQAA 3ECQA 4PQQA 4R9CA 2FCVA 5L9VA 4MGTA 3OTFA 5CU1A 1JZ3A 4L2NA 4PBOA 1X7NA 3PMEA 2DVDA 1CR7A 1OT5A 2OVUA 3V0BB 3B5LB 3W59A 2VC9A 4N53B 1IHMA 5IT6A 4NWVA 2PA7A 2VZ1A 4LJHA 4NPMA 4AEJA 3FMGA 5EPAA 5L36A 2RR12 3H50A 1AXYA 1OLQA 1B09A 4YG0A 4C8DA 1UZVA 2RM21 1V6JA 1YCIA 2ZCWA 4GH4B 1ZRFA 4QX0A 2D6MA 5LWBA 2R30A 2YB7A 2Y33A 4UFKA 4ORFA 5LK7B 4UF0A 5EQUA 2QQUA 1XNKA 2KD7A 3FWEA 1VMFA 1HN1A 4META 5FAXA 1CAVA 4AVTA 1OA4A 2YU1A 4QWNA 1REDA 4C0BA 2AZ5A 5JI9A 1JYCA 1RUC3 4WVWA 2ZHLA 3T1LA 5A3PA 2F6BA 2WT0A 3QOPA 5K0UB 1XE8A 5EJ1B 5BNPB 3WUCA 4Y26A 3G7DA 3OGRA 5ERLA 3NV4A 3VL9A 1GQGA 4LULA 2E31A 3BYWA 3HEIA 1W9TA 4CP2A 5JSOA 4V2WA 4KGQA 4WBBA 4K3UA 5HCBA 4RHV3 4XCBA 2B9VA 2XJSA 3AP9A 3DPRA 1W6NA 4LUMA 5IYYA 4LXLA 2W91A 3SKVA 3ES1A 3GZTB 3M3IA 3WF3A 4QXKA 2FDFA 3DEMA 1ODNA 1AX0A 1RUH3 2R0FA 4M3CE 3VD9A 1CAWB 1Z7S2 3H3ZA 4XF0A 4AI3A 4PF5A 2MHFA 1EAH2 2XG3A 1S0BA 2G9FA 4HVRA 4QD2A 2ARBA 4QQ2A 1ZBA1 4FFFA 4Q26A 1K3IA 1SHWB 1US3A 4QPWA 1BBT3 3SISA 1ZBA2 2VU9A 3JQXA 3AL6A 4Y4YA 1OHFA 2CL2A 4L11A 1OMIA 4I01A 5FBJA 2W1SA 3BN6A 2TBVA 2P34A 3WF4A 4AVCA 3CJIC 3LIHA 4KWKA 4LBNA 4ZY9A 5H9PA 1JI6A 2N7GA 2CGPA 1A8MA 5FZDA 3ABZA 3ZMOA 1UZ0A 4MXVA 1UCXA 4QKFA 2GC2A 1DQ5A 4CEWB 3T3YA 3GHNA 1RVF1 2QNKA 1X9PA 4ATFA 1KFXL 1YI9A 2JG8C 4JQRA 5LRRA 4GULA 2RS52 1PO21 2YDEA 1REEA 5DN2A 5FZAA 2WDBA 1GP6A 1PO22 3JCIA 4K21A 5J1XA 1K5JA 2FDGA 1W6QA 1W0PA 3I2FA 3QH6A 2TEPA 1B35A 2Y64A 3I3MA 4JKKA 1UOBA 3VBOC 2Y6LA 1J59A 1W9YA 1CAXB 1WBLA 3TEYA 2IXLA 3HVDA 5A70A 3I8TA 3IMNA 4G9SB 2BGPA 5L7OB 1SBFA 3PVBB 4AL9A 1DG6A 4P00B 1I5ZA 5FLIA 3GNEA 3VZLA 5LA0A 4FPFA 4KL1A 2QQVA 1K5MA 2YC4A 5C5TA 4FXGB 4QX3A 1NXMA 3H9AA 1YC61 4U2AA 4XF3A 2P6CA 1W8ZA 2HKXA 1YQCA 1DQ1A 1TME3 4BA6A 5FV3A 2XVKA 1QJU1 4CDWA 1WLCA 4PDWA 4QX7A 3ZN5A 5C9AA 1APNA 1RUE3 3PJQA 4BH9A 1UKRA 4MGZE 4P14A 3WW3A 3VHNA 2IXKA 5DG2A 2VMDA 5FYUA 1U0AA 4C1XA 1KJRA 3SKJE 5DDJ3 5C4WB 3WLUA 1YJLA 4TYSA 5L9RA 2XQXA 4EWAA 5FFOC 2IXIA 5AFBA 1VJ2A 3PMSA 4RR3C 1RIRA 2UY9A 3VZJA 2VNRA 3EHKA 2ZMKA 1NLRA 4IEYA 1JZ5A 1SBDA 4GA9A 5IVBA 3VBHC 5BNQA 3VUOA 4E8CA 2WRAA 3LDBA 2CGOA 4LA2A 1QJX3 1QOOA 3WQ7A 1HRI2 3EBRA 3B3QE 4UWDA 2Q8OA 1PX3A 3VB9A 2HWB3 2W2IA 4W6XA 2XL9A 4FPEA 4JKLA 4Q4Y2 2PHFA 2BDRA 1FYUA 1EP0A 1NX9A 1HJFA 1MPXA 1ZRRA 3AMMA 1HRV1 4CCMA 3AZVA 1DYOA 3NV2A 2VJXA 4GMP3 3UKTA 2O0OA 2MEV1 2VBPA 3AKTA 3WEZA 4JC1A 5AFEA 1VR3A 3TBDA 2WO3A 4H3WA 3LEIA 3NO8A 4NPRA 2QDRA 1TZOA 1PZ9A 5FZ4A 4OQ8A 4K8RB 3AVSA 4LLFA 5FP9A 4DRVA 1F35A 4OMCA 1MS1A 2B42B 1KEXA 1Z78A 3JU9A 1V6LA 3KF3A 1RUJ3 3M3CA 3O14A 4GJZA 4JTOA 4Q1RA 3FFQA 4RFRB 1TMF1 3LPFA 1GWLA 4XMIA 5FZ0A 1K42A 5JXGA 3OGSA 1LENA 4NROA 1WA4A 2FCUA 1DIWA 5F39A 3WNXA 3C7EA 2E7AA 2WSUA 4EJRA 1OQEA 3WG4A 4AYUA 4M00A 1BEV3 1D4M3 3AYCA 1WLDA 1AJOA 1UKGA 2XWBB 3AZYA 4LR4A 4XC9A 5FZMA 5LB6A 3WG1A 4CPBA 3OG2A 2ETEA 3GF6A 3VDDA 4EQVA 2WZ8A 4NOTA 4YNIA 3GZAA 5A3OA 3RQ0A 4YFWA 5A32A 2CV6A 1J84A 5FQ0A 5AC93 1NA1C 4N8MA 3GDBA 3FBMA 1BQPA 3H8UA 4AHZA 3WV6A 5JZGA 1OA3A 5FZOA 3FUQA 3OPWA 5J48A 3AMPA 2C6SA 1L7QA 2IVIB 2LS6A 4Q0PA 4OUEA 1RMU1 4JGYC 3SLIA 1PIV1 4NIIA 3CEWA 3VZMA 2YBSA 2ARAA 4EN9B 2DFCA 1MEC2 1J3PA 2ZGMA 3D0JA 4CEYA 3FE5A 3WQBA 2LALA 2CNAA 2RMU1 3IAQA 4PLNA 3P1IA 5IVCA 3TYJA 3WNKA 1XSRA 2D93A 4N53A 2UWBA 1I3HA 3W9AA 2VVEA 3MF9A 4HSLA 5C9AB 4B1MA 1DGWA 1UN1A 1XC6A 3ZFGB 3ES4A 3O1PA 1AYN1 1LOAA 3I54A 2NN8A 1VBE1 2ZGLA 2WLPA 1WCUA 3AC0A 5IHRA 1JZ4A 2QVSB 4QKDA 5BPXA 1S0JA 4A7KA 2B7YA 4YYOA 1JYIA 4IDZA 1Y9MA 5DPNA 3MLJA 5BNOB 1WD3A 1SLTA 1ULFA 1VBA2 2RE9A 3SXWA 4EN0A 1E5HA 1L7LA 2HWE1 4B3NA 1IQDC 5F3GA 5ABJB 1X9TA 5T54A 1T6BX 4XDPA 3PUSA 1MZEA 3R4UA 2HWF3 5A3WA 5T55A 2VMHA 4P9YA 2PELA 5DAPA 1MZ6A 4AI9A 1AYM2 5IVYA 4XE9A 4OMDA 1HRV3 3JB8A 1MQTC 5FIXA 1XYOA 2BNNA 3DF0A 4JGYB 1OOPA 2Y0OA 4QHBA 1IOAA 5FZ7A 4KBBA 3VBHB 1AYM3 2XUEA 1PIV3 1Q3EA 5SV5A 4ATEA 4FTSA 1J58A 1GUIA 1PVC2 5GJ6A 3VL8A 3LSDA 2GMEA 4OUSA 4K7JA 3D5OA 4JVAA 2JB4A 4KGGA 1YRZA 2GU9A 5JR2A 3HNYM 2A71A 3KVBA 1MEC3 3FLTA 1M4WA 4AEDB 3WG2A 1E5RA 1QJY3 4ZONA 2GP5A 4IE5A 4Q27A 2FDJA 2XJPA 1RUE1 1WLWA 4BIFA 5FREA 1D0HA 4XXPA 4PLOA 3PLQA 1J3QA 2LM3A 4UFMA 2FZ2A 5APAA 4GIQA 2VCBA 3B69A 3OYWB 3VBOB 3W5MA 4NMIA 3IIIA 1O5UA 5KBFA 1NZCA 1RXFA 1PO11 3FLRA 3RZKA 3I2KA 4IERA 2J1VA 3GCWA 4O9GA 2Q8CA 5AC91 2XGXA 4QPIA 5AC92 2G9ZA 1DFQA 5CFCB 3AJZA 4TZDA 2C26A 3WNPA 2VW2A 2W95A 4LQRA 1W3VA 4XFFA 1W2NA 4MGSA 5DDJ2 1QQP2 3M7AA 2YYOA 3RNSA 3C7HA 2ZEXA 4CU7A 1AVBA 3GHMA 3FJSA 4FI9A 1AR73 4NN0A 2CHHA 3RFRA 5F37A 5CVRA 4CP9A 5KHJA 1NE4A 1STMA 1VMHA 1S0CA 4D6RA 3JD72 4DXTA 3F2ZA 1KRIA 4ZU5A 1W99A 1UZYA 2FMYA 4M3CA 5IFPA 2EXJA 3MF6A 4D7SA 2UWCA 1WUVA 2VD7A 4XBQA 4LK6A 1PHMA 1Q8OA 1RTVA 4FQ4A 1G8WA 1NT0A 3ZFEC 3I2DA 3TAYA 4XFCA 3MLKA 4BU2A 2WQ4A 4CUAA 4H2AA 2JKXA 2R1BA 3WQ1A 1OQDA 1FI2A 3POIA 4AXOA 2X5IC 3IZOA 3JZVA 2P3YA 3IDCB 1AF9A 1SLLA 1FV2A 2I07B 2PLV3 5M0TA 5F3EA 2R1DA 3J9SA 5FMBA 3V64A 3ATGA 5JCTA 4BQWA 4UXAA 3R0RA 3JXSA 3T4VA 1U5YA 4CDQA 1H8TA 3GBFA 1RUJ2 4JRLA 1QNYA 1FOD2 3M3EA 4EWDA 3LGRA 2A3XA 2IFWA 1MZ5A 5E16A 4CCKA 2DUPA 1KXGA 4JDNA 4H55A 4NE9A 1NUKA 4DEQA 3IPVA 2ES3A 4FCAA 1HQWA 3TN93 3E5XA 1RUH1 2Y6JA 3IN9A 3N9NA 4XEZA 5FK8A 1DQ6A 2W68A 4Y1YA 1ST8A 2WFF3 3LB9A 4YZ2A 5C7GA 3VBHA 4DUWA 3WP3A 2A75A 3NNFA 4X6QB 2BRTA 3OGVA 1UMHA 4WVZA 5I0RA 3VD4A 2JDMA 4JZRA 3BU0A 3B02A 2PHWA 3GJBA 1POV0 3ZFEB 1AXKA 1NLQA 2FBEA 3OJBA 2EICA 1UF2C 2GSYA 2X09A 3NWKA 1BMV2 1V6IA 1XOYA 5E1RA 1UXXX 1WD4A 1RITA 4EYUA 2V72A 2JENA 3T2OA 1PGW1 2C24A 2O1QA 5BV6A 5KXCA 5K4LA 3CL1A 3BVCA 4S2FA 1O4YA 4S2DA 4DRRA 2HWB2 2A73B 3I97A 2GC3A 4EN8B 3EO6A 3PUAA 4AHYA 4CDQC 1YEWA 3AMNA 4QM9A 5C33A 4P08A 1VPHA 2EALA 1DZQA 2C9KA 1KITA 2DCJA 2Z4FA 3O0VA 3NNJA 1JHJA 1W03A 4FPJA 2V4VA 5KHKA 5EYYA 3KV9A 3ACIA 1QJEA 5FZGA 3ZSLA 1AHSA 1ZRCA 4EV0A 1E57A 2ZS6B 1Q8QA 4A4AA 4Q5OA 2XQRA 1S2KA 2ARCA 1NE6A 1NCQB 4HZFA 3JBG1 4PDWC 1FX5A 1EAH3 1IZ3A 4OHYA 2A3WA 4QPIC 3NJYA 3P6BA 2XBO1 3RI9A 3GBGA 5I8YA 5DAXA 1OD3A 1C5IA 1ENSA 5FY8A 2Y8KA 4GZ9A 2Q8EA 5A3LA 5C71A 1XE7A 4LHLA 3B00A 3OPTA 5T5LA 1U5ZA 4MLOA 3SQOA 3EJKA 2ADDA 2Z42A 2IXJA 5GZGA 4IEOA 3C3VA 1CJPA 3EYPA 3VLBB 4CDWB 4JDMA 1XE0A 4HFSA 1C8M1 5FY5A 5CB7A 1C8M2 1UIJA 1UAIA 4GH4A 4QGLA 1URXA 3I2JA 5FPAA 4WVMA 5FYBA 4CEYC 4KG8A 4CP0A 3IAPA 1WBFA 4YM3A 2H0VA 5D2AA 3ZXDA 3O5SA 1S1AA 3WNMA 2KXLA 5JOWA 4FPHA 4LITA 2BFUS 4SLIA 4XUTA 5DABA 4IGOA 2Q1MA 3RZGA 4Y3OA 2X5IA 5IVJA 3AL5A 3POSA 1SZBA 5F5QA 5G05L 4O65A 1ASJ1 1RUG2 2HWC2 3VGIA 4D6SA 5DQ0A 3KM5A 1I9RA 4X6RB 2QE3A 1PM7A 2WYFA 1EV12 2HEVF 2X8KA 4GAZA 5LBCA 1MR5A 2OA2A 4N43B 4QX8A 1IG0A 4HLTA 2VOTA 3T2PA 1ZBE2 2BGCA 3A22A 3I2HA 3MUY1 4QDRA 3HN3A 1SPPB 4IV3B 4RL7A 1QJU2 3RPQA 3W20A 4XFBA 4ASLA 2XLGA 3PUIA 2A3YA 4RR3B 3ZXKA 1YFXA 4XPVA 2Q1FA 1C3HA 1J3RA 4LBLA 4IXLA 1ZM1A 3NKTA 2VMEA 1O8SA 1OBNA 1Y7BA 2BERA 1EUTA 2VXRA 3P3PA 1CJDA 4ITCA 4NHYA 4Y20A 3Q8BA 3VHRA 3VV1A 5FO9B 3MW4A 3K3OA 3J4UH 3N3HA 3KHCA 2VZTA 4XZPA 3K48A 3KT7A 3T30A 1XNAA 4Y1ZA 2VUAA 1X8MA 1GOFA 3JD73 4XTPA 3TN92 3S7IA 4CCJA 5BNNC 2LRPA 2YXSA 2YBPA 4PBPA 2F4PA 1Z7S1 3HJRA 1UX6A 2ZGKA 2JDKA 2Y38A 4LA3A 2AACA 4AF9A 5AVAA 3WW2A 4AE2A 1SACA 1HRV2 2WQ8A 3G6JB 1IKPA 1H0BA 2WWJA 3LE0A 5FZIA 3ZXEA 1DLCA 4FAGA 3HN1A 2ZHMA 2XJTA 2XUMA 2ZX3A 3CQOA 1W05A 2GNBA 3ZO0B 3QACA 2PLV1 1H9WA 1RVF3 2R49A 3MIBA 5I93A 5A7SA 3HQXA 1K45A 1H2NA 1BYHA 5L7OC 4PIXA 2FHRA 3BI3A 2DCZA 1W04A 3ZIWA 5KXEA 1MS5A 3WCRA 4LBOA 4U36A 3DYPA 5FY7A 3WT3A 2ZBJA 4FQZA 2GMPA 4JAAA 4PI2A 5ACA1 5LY1A 3VBFA 1HB1A 4CP1A 3MPPG 1CAXA 4FPGA 3ZVXA 4TWTA 3WZ1A 4IEPA 3IMMA 1GLHA 1CX4A 1XJAA 3ETPA 5JXHA 4JKMA 4OUMA 4L8QA 4HVQA 3ZYHA 4UBGA 3RGBA 1NZIA 2JX9A 2PQQA 1L7RA 2JDNA 2PFWA 2YV8A 4BM8A 2ATFA 3AJYA 5FKBA 5C5UA 4N9IA 5C4WC 4Q4V3 4RS5C 1FPN3 1BEV1 1D4M1 3U4XA 3AP7A 2P2KA 1JODA 3LD8A 1UD1A 1AZDA 4O61A 1SLBA 1ULPA 3SC7X 3NVCA 2WC2A 5JXIA 1R1A1 3VZKA 1LOFA 5JSRA 1RHI1 3EMRA 3MBWA 3JQWA 4OHWA 4WZFA 5CFDB 5BYNA 5GZCA 1O91A 5CBLA 3ZFFC 3ST7A 1GNYA 2WSVA 3ZMNA 4QX5A 3IDEA 4ZKTB 1IQAA 1F5JA 3LEGA 1XNTA 3RZZA 5CEHA 4M3CB 5JOZA 1BKZA 2WNUA 4IV1B 1UZWA 2QUOA 5JSPA 4XJ8A 4YW1A 2HYXA 5CZKA 3AYAA 2G1MA 5A7OA 2RDRA 3SH4A 3PHMA 2RDNA 1O4TA 3RG0A 1H8TB 1N1TA 3AXDA 4LIVA 3MIHA 4AI1A 2VZUA 5KXBA 1ULCA 4K40A 1UX7A 1W2UA 2DCYA 2GH8A 2EIBA 2BZDA 4N9HA 5CISA 5DZEA 4IE0A 1LTEA 1IPKA 1OUXA 1NLSA 2DU1A 1VIWB 1GP4A 3D6EA 3K4AA 1PIV2 3WDTA 2XJQA 1Q8VA 4LNVA 1ALYA 3CJIB 3LOIA 4LORA 1QJZA 3ZFGA 4NPLA 4YW3A 2HWE2 3FHQA 2QQIA 3HIFA 4HKOA 1W6MB 3CZUA 5DUUA 4FBFA 1VBA1 1S4CA 2IVJA 4RQPA 2UURA 4EWEA 5IVVA 2ZGQA 1ZZCA 2ERFA 2R061 2E7QA 1JZ8A 3BOWA 1H2KA 5C8WA 4LTAA 5H9RA 4OI4A 3W58A 2BW8A 3KGZA 1US2A 3DL3A 5IVEA 2J1TA 1VRH1 2ZX2A 2NP0A 1SFYA 1XBFA 2XR4A 3ZPOA 4NIAA 3MEPA 4LLOA 2ORZA 1H9PA 1V70A 1WCSA 2OPWA 4QPIB 4NIGA 3MI8A 1LNSA 2VPVA 2Z2SB 4GALA 2ILMA 3HQRA 4XURA 4LO8A 1N1VA 1RUD1 3POYA 3ZFEA 3X29B 5FQ0B 4JQTA 5G04L 3J8F1 4XFIA 2RG4A 1ZZ9A 3CU7A 2J1AA 3ELNA 1AX1A 5GZDA 1AXZA 3SHRA 2YZ4A 4S2HA 5LEKA 4YW6A 4DUXA 5A6YA 4XVHA 4MO3M 5DAWA 5FMOL 2WA4A 4NAMA 3IKWA 4LO5B 2YY1A 4KH9A 4PCRA 2G9GA 1JMUB 4UW5A 3H1YA 1O7FA 2DVBA 1S0GA 1CIWA 1UMIA 4XABA 3ZFGC 2E6VA 1EPWA 1NCRC 2BPA2 3D82A 3OCPA 3RZHA 2YFZA 3CKHA 5T5PA 3FZ3A 1V9U1 5A1LA 1DZTA 1V6NA 1Y9GA 2O14A 3KHBA 3ZXAC 4CXYA 4XUOA 3S57A 1KGYA 4IE4A 3LCPA 3ACLA 4XQWA 1LHNA 4IEZA 1W0NA 4FFGA 3N35A 4BK4A 5EXOA 3AK0A 1GMMA 4H7MA 2YC0A 4LO4B 4MHUA 4MX3A 5FYIA 2PTMA 2HLEA 2KA3A 3WG3A 1R083 1WKYA 4BLJA 1DP0A 2VCAA 3A4UA 4XHXA
chains in the Genus database with same CATH topology
3JD71 3TWIA 1CAUB 1GNHA 1AR92 4FPKA 3FHIB 2FMDA 2BNOA 2Y0IA 3E5UA 4OI1A 3WD5A 5FO7B 5DZGA 3LSEA 3IPVB 4AGGA 4CDUC 4Q4V2 2A5ZA 4RFT0 3V0AB 4OVEA 2B45X 2B46X 3JB4C 1VB4A 2RJKA 2YMZA 4IV1C 5GM0A 5GLTA 4C91A 1FATA 3NV3A 4PIZA 2W52A 1PGSA 1H2MA 2VUJA 1LGCA 3POWA 4RQPB 3UKNA 1FOD1 2AUYA 4K1ZA 1LKNA 1VLNA 1MQTB 2DYCA 3L9JT 3FC0A 4R8HA 2JG9A 4URTA 4EROA 1MS9A 4D7TA 1VBC1 2VMIA 3AZZA 4AFBA 2DVAA 3WW4A 1PMIA 3ZDSA 1F8VA 3IBMA 1XYPA 3CO2A 3VKMA 2ZAHA 4CDXC 4GWMA 1RUD3 5FLHA 1MVEA 2RR11 4FPLA 2ZX0A 3DUIA 4IESA 4AGVA 3N4MA 4RHV1 5J3UA 1IS4A 1BZWA 4FP3A 5GLZA 3WCSA 1PGW2 4YG3A 1TE1B 4MGYE 5J37A 3I59A 4OI2A 4YW2A 2EF6A 2E7TA 2BQPA 1ENQA 4GQ7A 1IKQA 5CADA 1RB8G 4CYDA 1FAYA 1R1ZA 3ZXFA 4OZXA 1YI7A 3FBYA 2WNEA 4JDOA 3SCHA 1CN1A 1OOPB 5DUXA 2OUHA 2YROA 3KB5A 2ET1A 2A70A 1ASJ3 5EWSA 2YGMA 5KWRA 3ZXLA 2HWD3 5GALA 1DZRA 2XJVA 4XF9A 3FLPA 4QGNA 1BBT1 2VW0A 3Q9OA 1MS8A 5I8TA 1XQNA 1F9KA 4HPKB 3OGJA 1CD3G 2VNGA 3MIGA 1EAH1 1LOCA 3ASIA 2SBAA 1SDWA 3GBWA 1SCRA 2GNDA 2RS33 3J8F3 1W6OB 2GMMA 1G9FA 2AREA 1DGRN 1YJKA 4LE3A 4QQOA 1RGSA 3JBG2 5BNNA 2DURA 3M2MA 2UY8A 1S55A 1UU4A 2WNUC 4IETA 2D6KA 1FMD1 2XL7A 1WMEA 1DU3D 4BWOA 1N47A 3GYDA 1RVF2 1NQDA 2AH2A 3J26N 1G9DA 1VBB3 1ND3B 4YFZA 2QZ3A 5DUWA 1QJX2 3AZWA 4YG6A 4XQDA 4AI2A 4YLZA 2PHUA 1O5LA 4XIKA 1Q8PA 4A7YA 2DCKA 4HN1A 2P17A 1EY2A 4E9KA 3AKQA 1MS4A 3ZXJA 1Y3TA 4QPGA 2QQPA 2Q1ZB 1RHI3 2WKKA 4ASMB 4DS0A 2EA7A 5L73A 2IZWA 3KZ4C 1FNZA 5JWPA 2ZMNA 2HWD1 2K9ZA 1RUF3 2HWD2 5JI7A 3ALQA 1QXPA 3UKVA 4L97A 1KDKA 4BE3A 1D4VB 2HWB1 1CESA 1FNYA 5IUQA 5C4WA 1LU1A 3TN91 1VAVA 4MGKE 1A8DA 1H8TC 5CA6A 1O4ZA 5C8CB 2RHPA 4B4QA 3RDIA 2X29A 1PVXA 1BK1A 3TNPB 1GICA 1BVP1 4KU8A 2JICA 4BHPA 4PJYA 4Q4W1 4ONUA 1VBD2 1H1MA 3HT2A 1AL0G 4W65A 4XIOA 5BNPA 3U0ZA 2JE7A 4F3JA 4OI0A 4XBNA 1LRHA 4XJAA 2EXIA 2NZ9A 2Z5WA 2GNMA 3U07A 1Z0HA 3GALA 2ZAAA 1GV9A 4PIYA 5HCAA 4QPGC 2GALA 4HN0A 1ZZBA 1YWKA 1C8M3 2UU8A 4JGYA 2D44A 1WMDA 1CONA 2R043 1V6KA 1LEMA 5FBZA 1VBC3 5F9TA 4D69A 3RSJA 1TMF3 1N3PA 2JG8B 4YGDA 3BPZA 3VBFB 3D8CA 1D2QA 1LJ7A 5HXVA 5FO8B 1K5MB 4XJWA 1GQHA 2R0HA 5HCFA 2XJUA 1YNAA 2NM1A 3IWZA 4QQPA 4NR1A 4AVAA 1AL22 5FRAA 1NCQC 2ZZQA 3GZUC 3V0AA 4XF4A 4PDWB 2VECA 4CDUA 1EV11 1VBB1 3MDPA 3MFCA 1VBB2 5EJ3A 1ND3A 2PHDA 4N7UA 3UJOA 1PGL1 5DG1A 4PQ9A 5BUVA 4ES8A 1RMU2 1ZREA 3AKPA 5JZGB 2V5YA 4IEXA 3WX5A 3LAGA 4FVVA 2ZJCA 4LBMA 1DQ4A 2XLAA 2OZJA 2ZMLA 4LBQD 1PK6B 2Q5TA 2VOWA 3VHPA 2JG8A 3DV8A 4H14A 3S7EA 2GH2A 4E2SA 2ZHNA 1OD5A 1R1A2 1LHWA 4AVSA 3AMQA 1O3TA 2WS91 1JUIA 2VG9A 3ZYIB 3BCWA 2WS92 2WZR1 1T6GC 1VBE2 4O9EA 3M1HA 1UPIA 1TQ5A 3NAPA 4I3GA 4WM7A 5GZFA 1PO23 5K0UC 2E53A 3OPZA 4AVVA 2IXHA 1LOEA 2QFEA 2EVXA 4YZ5A 2JXAA 4N43C 1N1SA 2WINB 4XW3A 2RS13 4JCKA 1WMFA 1JW6A 1MS0A 4ISRA 1VRH2 4ES9A 2ZA9A 1AR82 2QKDA 4AFAA 1VBD3 1UW8A 3DGTA 3I59B 1AR81 1ZBA3 3AKSA 4KWJA 4DXZA 3A0NA 5C9AC 2AYHA 5A33B 2RS11 3IIAA 1EYBA 1PZ8A 4B4RA 1RUD2 1NOVA 2ZGSA 1PVC1 1PK6C 1QU0A 4PLMA 2WJSA 4F8AA 4HK8A 4KU7A 1TNRA 4BPZA 2WIIB 4DFSA 3RRDA 1TNFA 2C5DA 3OGGA 4AK3A 3VZOA 3HWJA 2DV9A 1S2BA 3H1MA 2DWRA 4B8EA 5FTTC 3EXUA 4YM0A 3NAPC 4WM7C 3KCXA 5KHIA 5K0UA 1W39A 3L2YA 1RHI2 1SBEA 1U12A 1ENXA 1AR71 3FFZA 2ZGTA 3S0MA 3OBTA 2VMGA 3AM2A 1W6OA 2JD4A 4HT1T 1WLTA 1ZBE3 5CFCA 1YFWA 4HMZA 2Q30A 3KS7A 2UYAA 3HR9A 4GMP0 2Z69A 4R4ZA 1LEDA 2GAUA 1AR83 3MW2A 1FPN2 3AFGA 1QXJA 1V9U2 5T5OA 4D94A 1ZYBA 2DUOA 2E9QA 4L9BA 3M8LA 2QCSB 2ENRA 2IXCA 4Z1VA 4M0NA 3MZHA 1NXD1 4XMAA 2HWF2 1R1A3 3ZYPA 5SV8A 3RYPA 2R063 1RUC1 2E63A 2EXKA 1D2SA 3VN4A 1ND2C 2ZHKA 4G3YC 3INAA 3E97A 4E4SA 2XKOA 1CVNA 1D0GA 4B7EA 1LU2A 1AR61 4EN7B 2FZ1A 3NAPB 4WM7B 2VW1A 3BODA 4XXAA 1FT9A 4FPCA 4KWLA 5DZFA 1Q43A 1QMJA 5H9SA 4G4FA 1YLLA 4AHWA 3N36A 3LA3A 4FP2A 3VBRC 2WQZC 5K7PA 4C0HA 1PZ7A 2D5HA 4NWWA 2IC1A 1GBGA 2C0ZA 2QZ2A 1F31A 2WWSA 4BYYA 2G4IA 4LE4A 4K20A 3HT1A 2Q0AA 3DPRC 4GKYA 5KXDA 2ZACA 5D8AC 2XLFA 2X5IB 3KT1A 2D5FA 1O3QA 4NHMA 5KC5A 4XDQA 4AWDA 1A78A 2EXHA 1COV3 3R4DB 3O7OA 2YGLA 3E6CC 2XWJB 1Q8SA 3U10A 4FPYA 4BIOA 2E51A 4JGZC 1LECA 2BYVE 3WUDA 1ND2B 1X33A 2VVDA 3CJIA 3UK9A 2PHXA 1HQNA 4QQHA 1GYKA 3A0KA 3TNQA 1LODA 3WDVA 4I0WB 2BBVA 5F6LB 2Q4SA 2WT1A 2D6OX 3VKOA 3MLLA 3RI8A 4MSVA 4J1WA 3UL2A 1R091 3VBRB 2CWSA 1QWRA 1B35C 3MPBA 2CWMA 3THTA 3USUB 5D1IA 5JPNB 2VNOA 5E88A 1RUF1 4GB32 5EZWA 4CRQA 1ZZ6A 4R4XA 2VH9A 1F2NA 4YVWC 2XBO2 3AB0A 3WDWA 4FPOB 1W6QB 1RUI2 4AFCA 4NHKA 1QDOA 3B9CA 5A3MA 3KT4A 2UYBA 3NJZA 4NO4A 1OA2A 3O0WA 3BB6A 1KS5A 2WFPA 1Z7S3 1W0OA 2C1FA 3NSTA 4C1WA 1RUI3 4IL7A 5EV7A 3SH3A 4YVWB 3SCGA 2OYZA 3RMXA 5ABJA 2SLIA 3B94A 4DZGA 4R9DA 5T52A 3USUA 1FMD2 2D6LX 4RGAA 2OZ6A 2P37A 1AUYA 5L19A 2W39A 1QJX1 2WFF1 4HKWA 4IEQA 4LBQB 4ZU4A 2A6VA 1W6PA 2HJIA 4UW3A 3PVOA 4Q4Y3 1LCLA 3OF1A 2RS31 4EN6B 1W6MA 5JOYA 3AFKA 3AYEA 1HXS3 1YFYA 4DY3A 3E6DA 4QU2A 1JH5A 3PJYA 4Q4X1 1ZA4A 3M4FA 4Q4X2 4K8FA 1S0FA 4YVWA 1HIXA 2XBO3 4RA0A 3WR0A 1YIFA 2W0XA 3AKRA 5FCCA 4JV4A 4GB33 4D3WA 1QJU3 2RJLA 4CEYB 1UL9A 4Q4X3 4OULA 2A7AA 5L7OA 4E27A 5BY5A 4W6WA 1HRI3 4A3XA 4DOUA 2D40A 1GSLA 5D8AA 2JKBA 4N7IA 1Q5OA 2DUQA 3RJRA 4MXWB 1G6NA 2D3SA 3THPA 5ABJC 1UIKA 4QPYA 3M3OA 2A6WA 3UJQA 2JG9C 2QJVA 2H6CA 1R081 1DGLA 4Q4W2 5IK4A 5C6CA 4HPKA 3NL1A 1MZFA 4E2GA 1KS4A 4XJ9A 1FV3A 1LOGA 3CJXA 1DYKA 1NA1A 4Z2WA 1BBT2 1KDMA 5JIUA 1N3QA 2R073 2YHJA 1XXNA 3LWCA 2D6NA 2ARXA 2PHRA 1HV0A 2ZGRA 3ZFFA 3OY8A 1NY72 2VQ0A 3WW1A 3KMHA 4TLFA 4K9SA 4M01A 3SCFA 1G9BA 1OPMA 4Y5Z0 5H9QA 2ZPXA 3ZN6A 5JPMB 5LRSA 4HK9A 3WP5A 2X53S 3DKWA 3LA2A 4N43A 2GN7A 1N1YA 4F7ZA 3N7MA 1NA1B 1TME2 2EAAA 5GLWA 4AFMA 2YPJA 1X82A 2D3PA 2B8MA 2WA3A 3VBSA 3PVEA 5ACA3 3H7JA 1ZBE1 2VOXA 2GN3A 1DF0A 1XRUA 1CGPA 3RWNA 4Y24A 1QH6A 5K8SA 3AP4A 3KCCA 5IK7A 1HX6A 2AGSA 1DQ0A 4Z82A 2NLRA 4MVTA 1KQRA 2ZOEB 1HXS2 1RJ7A 4MYEA 1COV2 1A6CA 1MQTA 3WP6A 1OOPC 2PAEA 1LULA 3WVJA 1EPZA 1PGL2 2OIIA 4LT5A 4LBKA 2GC0A 1H1IA 5E8AA 2JECA 3ZSMA 4IEUA 5C8CC 1XU1A 4IEVA 3SITA 1AYN3 3QBQA 4LEJA 2XB6C 1ULDA 2BVBA 1PO13 1RL3A 2PLV2 1K5MC 1WW5A 3P3NA 2BNMA 2WZR3 2CYFA 1C4RA 2JJ6A 2RS12 1GZWB 4JGZA 3WQ0A 4CDWC 4QPGB 5ACA2 1SLIA 2GC1A 4Q29A 2R062 2IFRA 4Q2FA 1H4HA 2WZPP 4QMAA 1VBA3 2PAKA 1LOBA 2DVGA 2FQPA 4HKLA 5TSWA 3ZYJB 1ZZ8A 5JMCA 1ZRDA 1LR5A 1OSGA 1AYM1 1J1LA 5T3NA 1GR3A 1ND2A 4BMEA 2DTWA 3UV9A 4AI8A 4WM8A 2WT2A 1SFNA 4K6BA 5CG8A 4HSJA 3QD6A 2BVVA 5CFDA 3E5QA 1QKQA 3DPRB 4Y1UA 4WZCA 5KC6A 3SNMA 1XNCA 2DU0A 1Y43B 4RD7A 5C8CA 4Q1PA 3ZPYA 4DB5A 1XNDA 3NKGA 4FOQA 4YGEA 4FAHA 1X8EA 2NPIA 4BLIA 2A6YA 4LHNA 4JRAA 2P3KA 4HANA 2XH6A 3R4SA 2OPKA 5I0UA 1F5FA 2QDNA 1ENRA 1UZZA 4X8NA 2R041 4QM8A 2R042 4XHBA 1VBE3 2V09A 1DLLA 1JHNA 2D98A 3LOBA 1OFNA 1VAKA 4IV3A 1KFUL 3AP6A 3LA7A 2C9AA 1ZZ7A 4XTMA 2R32A 2R16A 1NYWA 4DMIA 1VB2A 3AYDA 3RYRA 2EAKA 3VBFC 2ZKLA 3OY8B 1HDKA 2YUEA 4Q0UA 1H4GA 4H7LA 3JUUA 4I0AA 3MYXA 1DQ2A 2EIGA 1GZCA 4HL0A 1H2LA 1OI6A 2HWF1 3AMHA 3ENRA 1MVQA 4OFGA 1RMU3 1QQP3 1QH7A 2CAVA 4COZA 1A3KA 1FOD3 5IK5A 1IS5A 1O3RA 4RS5A 2DFBA 4LO6B 3ZXGA 5JAXA 4Y22B 2WL1A 4AQ2A 1JOJA 2CAUA 4LUKA 5A33A 4I3PA 1C1LA 4LBQA 4Z07A 1AR93 4Q4V1 1GFF2 1YUDA 5J36A 3WOGA 1LB2A 4YRDA 3ZSEA 1HW5A 4P9GA 1DBNA 1VBC2 5J09A 1RUNA 2B9UA 5AVPA 5IK8A 1DGWX 4OHVA 3RMYA 1FXZA 4I02A 4IV3C 2DF7A 3WP4A 2CY6A 4E2QA 4AFDA 2JEMA 2RM22 3VHOA 1QJY2 3H7YA 4RHV2 3LKJA 2Z79A 4XBLA 4YGCA 1FMD3 1OQ1A 1GNZA 4BCUA 3ZSJA 3HBZA 3BTAA 1UU5A 4UBHA 3QCWA 4I0BA 1BXHA 1GKBA 1RUE2 3OD0A 5EYXA 4IQPA 1VALA 1WGPA 4IEWA 4A7ZA 4Q4W3 4Z8BA 4FOWA 2WLQA 5CAZA 3PTYA 4CEWC 4INDA 5GLUA 2XVLA 4WM8C 1YIPA 3B9IA 4J6GA 5DUVA 2ZGUA 3ZN6B 3V56A 4GH4C 3URFA 2BWAA 2WNVB 4P9XA 2BWCA 1G9AA 3ZYGA 2TNFA 2HEWF 3OYWA 3VBOA 4YM2A 3ZFFB 1UMZA 1RINA 5JOXA 4KNCA 4XF1A 5F1RA 4AGRA 1LGBA 2NQYA 4X8PA 5BNNB 3MIEA