2UWCA

Crystal structure of nasturtium xyloglucan hydrolase isoform nxg2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
269
structure length
266
Chain Sequence
PPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGRELRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPMWVYGSVWDASSWATKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evidence for the Evolution of Xyloglucanase Activity from Xyloglucan Endo-Transglycosylases: Biological Implications for Cell Wall Metabolism.
pubmed doi rcsb
source organism Tropaeolum majus
molecule tags Hydrolase
molecule keywords CELLULASE
total genus 64
structure length 266
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
A PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2uwcA00
2FMDA 4YZ3A 1VAVA 3BTAA 1FNYA 1Y7BA 4WV8A 4XILA 1AXZA 3M3OA 1NXD1 2G4IA 3B69A 2JECA 2D7FA 2ZGQA 4XBLA 4ZKTB 1ZM1A 2BQPA 3ZXLA 4DRVA 1G9FA 4ISRA 2GNTA 1H9WA 2GMPA 4K20A 2A71A 3APBA 2DUOA 4ATFA 4AYUA 1RITA 4BPZA 3WCRA 1GZ9A 1N1SA 3ZXKA 4H55A 2A6WA 2ZHLA 3C2UA 4BQ1A 3IN9A 5JDBA 2WNEA 3RMYA 3UJQA 2A5ZA 3WG1A 1IS5A 1LULA 1R1ZA 2LTNA 3OYWB 3OGGA 1UX6A 1YO8A 3AP9A 1W6OA 1S0CA 3OBTA 1HKDA 3O0XA 3IMNA 1JN2P 1LGCA 3O12A 2E7TA 2C5DA 2ZZJA 3VUOA 2NP0A 1LU1A 1MACA 2V5YA 3O0WA 3NWKA 3POYA 1V6OA 3WDYA 1CONA 4YZ5A 5E8AA 2UWBA 1G8WA 3I8TA 2Z42A 3IPVB 1LEDA 1ONAA 1Q56A 3WV6A 4YZ2A 5IK5A 2CWMA 4M00A 1SCSA 1W6PA 2CWSA 4CRQA 2ZGSA 4Y1ZA 3T2TA 3B01A 1JBCA 4M3CE 5JOYA 2DUPA 5F9TA 2D6KA 1DQ4A 1N1VA 3D5OA 5DUUA 2WKKA 4GKYA 2A7AA 4FQ4A 3HR9A 1QU0A 3N7LA 2NM1A 4FOWA 1SLIA 2A3YA 5DUXA 2SLIA 4XHBA 3AZYA 3V65A 1U0AA 1WUVA 1WLDA 1SBDA 3MW3A 4R9BA 2PHUA 3NV4A 5EYYA 2P34A 5H9SA 1UL9A 2P3KA 1KDKA 3AXDA 4YG0A 3LSDA 1DQ5A 3WG3A 4XTMA 1LHUA 1FV3A 3VKOA 4Y1YA 4FPGA 3B00A 3ILNA 5JOWA 4YG3A 4P14A 4ASMB 4P9XA 1N1YA 4BOWA 1H30A 4DRRA 1AJKA 3ZSKA 4Z8BA 1C1FA 1JHNA 2VU9A 1IKQA 1BYHA 1V6NA 4YGDA 3TAYA 4GWMA 3SISA 2SBAA 1JW6A 1SLCA 2D44A 4LBJA 2GNBA 3WCSA 1D2SA 1URXA 2A6YA 1LHNA 2WJSA 2ZGNA 1OQ1A 2P3JA 3NV1A 3KQRA 3USUB 3VKMA 1DQ6A 4AVVA 5KXCA 4FPHA 2A3XA 5T54A 3HN1A 2WT2A 2VW2A 2ZGTA 4C1WA 1AJOA 1FAYA 1LEMA 4LBQB 4R9AA 5GLWA 1DHKB 5IT6A 1QDOA 1WLCA 1GZWA 2A6ZA 4Y20B 1CN1A 4YW3A 4BLJA 4YZ4A 1WW6A 3WDTA 4DS0A 2P2KA 4FPYA 1CQ9A 4UW4A 1CIWA 3ZYPA 1UZYA 2JKBA 4XMIA 2V73A 1DZQA 4OZXA 4AVTA 1S0IA 2D6NA 2ZHMA 1V6IA 5H9QA 2NYYA 1NLSA 3FFZA 4Q8LA 1O4YA 2TEPA 1C57A 1AX0A 4UW5A 2JJ6A 1QOSA 3UJOA 3USUA 1ULCA 4FP3A 2ZKNA 3AX4A 4SLIA 5GLUA 1IS4A 1CVNA 1JOJA 2EF6A 5JOXA 2KM2A 2NN8A 1CESA 4XE9A 4FPJA 4AVSA 1Z0HA 1DYPA 2AREA 3WUDA 1KRIA 3AK0A 1S0EA 4Y1VA 4FPFA 5HCFA 3WHTA 5JMCA 1VALA 1X50A 4TYSA 3WOGA 2I2SA 3WUCA 3A0KA 1C4RA 1WLWA 2EALA 1LGBA 1QNYA 2W52A 3RMXA 5HCBA 3INAA 4XJ8A 4AWDA 3AJYA 5DZEA 1G9AA 1QDCA 4K1ZA 3AFKA 4YW1A 1JXNA 1MR5A 3M2MA 3FLTA 2A6XA 4YM2A 3MPPG 1V6MA 5KXBA 4GXLA 4UW3A 4W65A 1I1EA 3GALA 2PHFA 4XZPA 2GMMA 2ARXA 4P9YA 4YZ1A 4XJWA 1DGLA 1TEIA 2D3RA 4M3CB 2ZGKA 3WVJA 1AXYA 1SBEA 1V6JA 3SH5A 3ZPYA 2GNMA 3OYWA 2YMZA 3PVNA 1YXWA 3A4UA 4XJAA 4HL0A 3ILFA 2UU8A 3ATGA 1AX2A 1MZ6A 3ZSJA 2W08A 2PHTA 1V00A 4P9WA 3FLRA 3R4UA 1PZ8A 3RQ0A 4GA9A 5GZCA 4XYXA 3OPZA 3A0NA 3T1LA 1AZDA 4LBKA 3QCWA 5DG1A 1SLAA 2DU1A 4XJ9A 2JD4A 1CJPA 2R49A 3N7KA 4FP2A 5GZDA 2JDZA 2WT1A 1UPSA 2A75A 3M1HA 2CYFA 4YGCA 4PCRA 1YI7A 1BKZA 3SH4A 3JU9A 3Q9OA 4I30A 4Q27A 4GWNA 1GNHA 1J1TA 3IPVA 3ENRA 3ZYRA 1W6NA 3V0BB 2XG3A 3FBYA 4YW5A 4ZXKA 1N3QA 1LENA 1G7YA 4L8QA 1ENSA 4ISQA 4YFWA 5IUQA 1S0DA 3IKWA 2WT0A 2EXIA 4WVVA 2ZMKA 2P37A 5CA6A 4TZDA 4XMAA 1KJLA 1LOFC 3R05A 5DG2A 4Q1RA 1SCRA 2WQZC 2WSVA 1CR7A 2R0HA 5L73A 5JLVA 5GLZA 2R1DA 3ZSLA 3V0AA 1SLBA 1QKQA 4Q8KA 1V6KA 5H9RA 1WD3A 1ZA4A 4XOGA 1GBGA 2ZGMA 2GDFA 5IK8A 5DZGA 4D69A 4Q2FA 4FOQA 3AZWA 5GZFA 3SLIA 3MW2A 1DYKA 5SV8A 4M01A 1WW7A 1GLHA 3DUIA 1ULDA 4MYEA 4LBOA 4Q1PA 2GMEA 4YM1A 1AVBA 1DQ0A 1LU2A 3ILRA 2W68A 4YW4A 5GLVA 1G9BA 1MZ5A 1MVQA 1KJRA 1OKQA 4AGGA 3WG2A 2D6MA 4ITCA 2ZMNA 3D4KA 1A8DA 2DVFA 4PBPA 1SLTA 2YROA 1Q8PA 1ULFA 1N1TA 2PHXA 3DGTA 3OJBA 1KDMA 2GN7A 4KBBA 5DUWA 3WLUA 4PQ9A 1GZWB 3KM5A 1WW5A 3WZ1A 1W6MB 4CZSA 2ZHKA 4HANA 1A3KA 1RIRA 4Y1XA 1HQLA 3LSEA 5DZFA 1MS3A 3VKNA 3ZSMA 4XJZA 1AX1A 5T55A 4Y22A 4YLZA 3WG4A 4FQZA 4GALA 3O0VA 2ZGUA 4WVWA 3PJQA 3V64A 2AH2A 4Y20A 4PBOA 2Q5TA 2ZAAA 1MS8A 1V6LA 4XIKA 1GV9A 4M3CF 1JYIA 2NZ9A 1MS0A 1BJQA 1APNA 1LOEA 1XQNA 2E7QA 2DTYA 4XXPA 1DIWA 5H9PA 3WNXA 1RINA 1SLLA 2ZABA 1SACA 2B7YA 2D6OX 2NMNA 3IM0A 2D43A 4JRAA 1BXHA 1H9PA 1QOOA 1GKBA 3M3CA 3OBRA 1S0GA 5T5PA 3D6EA 2DV9A 4XJUA 3VKFC 1MS1A 1QF3A 3FUOA 1FNZA 4FPEA 4CTEA 4NO4A 1W6OB 2VH9A 3MEPA 3POWA 4XDQA 2ZGRA 1N47A 3N3HA 1O4ZA 1BZWA 1G9CA 1VAMA 2AUYA 4BM8A 2AYHA 3SITA 2VY0A 1G9DA 4R9CA 2XB6C 3AP4A 1GICA 3MW4A 1N3PA 2C9AA 2R16A 2ZBJA 3RS6A 5T5JA 3RG0A 1LOCA 1W6QA 1W6PB 3SH3A 4DPNA 2D3SA 4LBMA 4PF5A 4YGBA 2HYKA 2FHRA 1OFSA 1DQ2A 3O5SA 4C1XA 1DFQA 2UURA 1DLLA 4IQPA 2A6VA 1Q8SA 1EPWA 1Z78A 1LOBA 2GN3A 4XTPA 1SFYA 3AYEA 5FREA 3HMYA 2WSUA 4FOVA 2DTWA 2UWAA 2EXHA 4LBQD 4K1YA 3NV3A 2P3IA 1ULGA 3VKLA 1YYNA 3OY8A 4U36A 3N35A 4DFSA 1MVEA 1WCSA 3T1MA 1UMZA 3AXEA 4FVVA 1S0BA 1IOAA 3NV2A 4XXAA 1WBFA 3WHUA 1VLNA 1C1LA 4YG6A 5EXOA 1LECA 3U4XA 1LESA 1LODA 3CNAA 3WDXA 3WDUA 3M3EA 4F83A 1LOAA 3AP5A 2EXKA 3V0BA 4FPLA 1W6QB 5GZGA 5KXDA 1FV2A 2OW4A 1QMJA 1GYKA 1SBFA 1G86A 2ZGLA 4JCKA 3PVOA 4FPKA 1I3HA 1HDKA 1AXKA 1F31A 4JC1A 1KQRA 3B9CA 5KXEA 1FX5A 1ENQA 1W6NB 1QNWA 1F5FA 2VW0A 1GNZA 1IS6A 4FPOB 1UZZA 2DVDA 2OUJA 3N36A 2OVUA 2YXSA 5AVAA 5CBLA 1HLCA 3OY8B 3TB0A 4RL7A 4YM3A 3BODA 1YIFA 5IK7A 1UN1A 1LHOA 5FRAA 1Q8VA 1MS9A 4R9DA 3V0AB 5T50A 1MS5A 4Y26A 3UL2A 3W59A 4FPCA 4FOYA 1W0OA 2DYCA 5LK5A 1WW4A 3ZXEA 2VUAA 2R0FA 1D0HA 1S0JA 2ZGPA 3AP6A 3PVEA 1CPNA 1BQPA 4YW2A 1CPMA 1QOTA 2CNAA 4M3CA 2ENRA 4AGVA 2CY6A 5CNAA 2YV8A 1Q8QA 5DUVA 1FATA 1GANA 1F9KA 4YGEA 5T5OA 2D3PA 4U2AA 2AGSA 1JYCA 1WD4A 2E6VA 3BIWE 3M3QA 4NOTA 3ZXJA 3ZVXA 4K21A 2H0BA 4YM0A 4BLIA 2LALA 1ULEA 3B3QE 4XIOA 5JVVA 3WDWA 5CAZA 5HCAA 3AJZA 3JUUA 2CL2A 4LBLA 1LHVA 2D6LX 1JUIA 1LOGA 3AYCA 4LBNA 2DWRA 3PMEA 2RHPA 3RRDA 2DUQA 2PHWA 3AYDA 1KITA 1LTEA 2EIGA 2VW1A 1B09A 1UAIA 5EYXA 3GNEA 2A70A 1PZ9A 1PZ7A 1ENRA 1MS4A 4BMEA 4BMBA 1DQ1A 3QLQA 1LJ7A 3BOPA 2W39A 1IKPA 1VIWB 1UKGA 3H0OA 4XBQA 5T52A 3L2YA 2JE9A 3FUQA 3I4IA 3POSA 5E88A 3ZXFA 2R1BA 5GJ6A 2DVGA 1FYUA 2DURA 2YZ4A 1WBLA 2ARBA 4GKXA 3VV1A 4DQAA 3N7JA 2JE7A 2WLQA 3LCPA 2VXRA 4ATEA 2DVAA 5DXDA 2PELA 2YY1A 2EAKA 4Q26A 2GALA 4AGRA 2OUHA 2AR6A 3SNMA 2UWCA 1HQWA 2E53A 2DU0A 4UW6A 2PHRA 2ZGOA 1AF9A 1YRZA 1W0PA 5GALA 2ZACA 1IS3A 4LBQA 2A3WA 3W58A 2D6PA 2NMOA 5GLTA 3UK9A 1GSLA 5T5LA 2AENA 4XBNA 4Y24A 1N3OA 3AP7A 2E51A 5JOZA 2ES3A 2ZHNA 3AZVA 5GZEA 3RSJA 1LGNA 1LOFA 2ZMLA 1LHWA 5IK4A 1Q8OA 4XHXA 1QGLA 1S1AA 5F5QA 1S0FA 2CTVA 3N7MA 4YFZA 2EXJA 3WDVA 1A78A 4WZFA 5E89A 3R4SA 1LCLA 5EWSA 4RA0A 2GNDA 4Y1UA 5CB7A 3AYAA 1DBNA 3AZZA 1W6MA 2DVBA 3ASIA 1GZCA 2ERFA 2ZA9A 3AZXA 3FLPA 5BYNA 4Y22B 5GM0A
chains in the Genus database with same CATH superfamily
3D0SA 1W04A 3LKJA 2GU9A 2WQ4A 2Q0AA 1CAWB 2Y6LA 4H2AA 4JRLA 4XILA 4K6BA 4BISA 4CP9B 3LB9A 3TEZA 4JGZC 3WQ7A 1VRH3 3B69A 1OHFA 3LIHA 2W2IA 2BUKA 4CU7A 4GB32 1J3PA 4QPGB 3ZXLA 1VBC2 2WN2A 1RJ7A 2W92A 4QX1A 1H9WA 2GMPA 3IIAA 4GQ7A 3VDDA 2BGCA 3APBA 2DUOA 3E5UA 4PIYA 4AYUA 2D98A 4CCCA 2OPWA 1N1SA 1HRI3 1WCQA 2YUEA 4Q0QA 2C6SA 2HWD2 4H55A 2A6WA 3LEKA 5JXJA 3KV5A 3PIGA 4AI1A 4W8JA 2FDFA 2WNEA 3E6DA 3H1MA 4AVCA 4XURA 2A5ZA 5F6LB 5FDBA 1V9U1 4QQ2A 1HXS2 1K3IA 2LTNA 4CDQB 1K12A 3OGGA 1BK0A 1IQDC 1YO8A 1OF4A 2IVIB 4FCAA 4MHUA 3NO8A 1NOVA 2VZ3A 2Y6KA 4AFMA 2IFWA 1D0GA 3MF9A 5FPXA 2XJRA 2ZZJA 2X8KA 2BPA2 2V5YA 1V6OA 3IAPA 1XC6A 5C4WB 1VBD2 1UMIA 2XDVA 1WMDA 2Z5WA 3CF6E 3IPVB 3NQHA 1CZVA 1VBE1 2CAUA 2WFF3 5DDJ3 4C8DA 2ZGSA 5FP9A 3KQ4B 5FYYA 1M06G 4LR4A 4YVSA 1H8TB 3K75B 1IG0A 1N1VA 1VBD1 4LLOA 1PMJX 4I01A 5DUUA 3BPSA 2V4VA 1ULOA 3H3ZA 1QU0A 1U5YA 2HBTA 2VR4A 3GBGA 2NM1A 4FOWA 4HVOA 4K3UA 2FMYA 1REEA 1PIV3 5A3OA 1A34A 3AZYA 4CCOA 4GH4C 4AEDB 5EIYB 5ACA1 3CMGA 5EYYA 3TEXA 1CAXB 1ZZ7A 2RS52 3AM2A 3FHQA 4K9SA 4NN0A 4BXFA 5FOJB 1ND2A 1RMU1 4EWDA 1LHUA 2G1MA 1LAJA 4OZOA 2HWF1 3VKOA 1H2LA 4FPGA 4Y1YA 1XNBA 1JZ3A 1TVGA 2W1SA 2WLPA 2BEOA 4YG3A 5FQ0A 4P9XA 3RYRA 3ZSKA 1X7NA 1C1FA 1PNFA 3VBSC 4DXZA 4ZY9A 2YG0A 1V6NA 3H1WA 3IT8A 4IE7A 2SBAA 3KCCA 1RMU3 1PMIA 4N43B 1SLCA 3SC7X 5A7PA 3QD6A 3VHRA 4B29A 2ET1A 3NJZA 2A6YA 2ZGNA 3ZFGB 2P3JA 2ZAHA 3KQRA 2HBUA 4AVVA 1F4AA 2WUHA 4JHTA 3NRUA 2RVAA 4DXRA 1FMD1 1SG3A 2WT2A 4C1WA 5LK7B 2ZX4A 1FAYA 4LBQB 2GC2A 1OA2A 2EIDA 5GLWA 1QDOA 1WLCA 3H9AA 4C91A 5JI9A 3T0BA 1Y3TA 1X36A 3JB8A 2ORZA 1ZYBA 3IBMA 4Y20B 1OOPA 3T30A 3KT1A 4DS0A 2YBSA 1CQ9A 4UW4A 1C5HA 1OA4A 5C3RA 3KCYA 4AVTA 2XBO2 2D6NA 4XQ4A 1O7FA 4Y4YA 3TNPB 4AOCA 2X53S 1Y43B 2X10A 4HN1A 1QJY3 2VL4A 2XJUA 1O4YA 1MEC3 2PA7A 1MPXA 1W0NA 2PMWB 3MIHA 4UWDA 3WF0A 3USUA 4CXWA 1ULCA 2ZKNA 2VZPA 4SLIA 1HB2A 2XL9A 1JOJA 2EF6A 5BV6A 3KV9A 5K7PA 3O1VA 3ZMOA 3I3DA 3PMSA 2NN8A 2G9GA 5CISA 1KRIA 4DUVA 3AK0A 5IJRA 1AL21 4CDXA 5JMCA 1PO12 1VALA 1O5LA 2X29A 4TYSA 5BNPB 3RI9A 1NCRA 1W9WA 1MEC1 5J37A 1BEV2 5FPLA 1OUXA 4DUXA 2IXIA 3RMXA 3LZZA 3INAA 4OYUA 1G9AA 5DZEA 1NCQC 3ZYFA 5I8TA 2X5IC 3OBAA 2VJXA 5IAVA 1QDCA 4YW1A 1UD1A 1O3TA 2QDNA 2WC2A 4NRMA 4CEWA 4CXXA 4YM2A 3MPPG 3A21A 2VGDA 3ZFFC 2R073 1W39A 1I1EA 1RUC2 4Y33A 3BGAA 3ETPA 3T09A 4CE8A 2JDNA 4A7KA 1PNGA 4NHXA 1H8VA 2DBNA 4AI8A 1AYN3 5FAXA 2D3RA 1YFWA 4CSWA 5A6QA 4N53A 1EAH3 2GNMA 2IXLA 4R52A 3ZPYA 1BMV1 3AMQA 4A3ZA 5G05L 5FY9A 4NRPA 2GH8A 2KXLA 2QQKA 4XJAA 3P3PA 1AR72 2UU8A 5FY5A 3BTXA 3ZSJA 2VTXA 1LNSA 5JIUA 1IZ3A 4RQPC 5LBFA 5GZCA 3OUJA 4XYXA 3MUZ1 3OPZA 3Q8BA 4AQSA 1OPOA 3KMHA 4LBKA 3QCWA 1LKNA 1JZ7A 2VMHA 4XJ9A 3TRSB 3W5NA 3ABZA 2PAMA 1TMF2 4GH4B 4TN7A 4LNVA 1ST8A 2R49A 3KVBA 4J25A 5FBJA 5FP3A 2WT1A 3ZOIA 3O1SA 4RGKA 4W6YA 2CYFA 4XF4A 2RMU3 2HWB1 3HPNA 1PHMA 2R062 3JU9A 3Q9OA 4ZZ8A 2W94A 1UNBA 1O3RA 4IEXA 5FO7B 1ALYA 5LW9A 3ZO0B 3R4DB 1TZOA 4ZXKA 4EN7B 4P00B 4AVSA 2R7EB 4Q0VA 1ENSA 2FDHA 4XPVA 1RUD2 4YVWC 3IKWA 3BIEA 2Z2SB 1WKYA 4WVVA 1W3XA 4PDWA 1US3A 2X5IB 4MO3M 3GZUC 4EWEA 2VCBA 4XMAA 3R05A 5CA6A 4TZDA 5DG2A 1SCRA 2WSVA 1MQTB 3HBZA 1CR7A 1Q3EA 2WA3A 5L73A 1QJFA 2QKDA 1POV0 4KU7A 5GLZA 5FPAA 3U4SA 1SLBA 3EBRA 4BA6A 2RDQA 2ADDA 5FIXA 3MF6A 2XJVA 1V6KA 4F8AA 5DZGA 4R4ZA 4Q2FA 4UFLA 4AZZA 5IFPA 4NJ4A 2JIJA 1DYKA 2WWSA 5SV8A 3M7AA 1OF3A 2OT7A 4AQ2A 3KGLA 1ND2B 2VQTA 4MYEA 1POV3 2J1TA 1R081 4YM1A 5FP4A 1NCQB 4YW4A 3ILRA 4BQWA 1T2XA 4PJYA 2F6BA 1G9BA 1MZ5A 4JV4A 2QJVA 1QJX2 1KJRA 1RVF2 3VZJA 2GH2A 4COVA 2CDPA 1O91A 2D6MA 1RUI2 1Z7S3 2FCTA 2ZMNA 1RUG1 2P3YA 2H0VA 4N43A 1A8DA 2OQ7A 3AL5A 2DVFA 1RUF3 3AVRA 3WSOA 3SKJE 2XOMA 3VZNA 1KDMA 2Y60A 4KBBA 4OLLA 1GZWB 4AEKA 1QJX1 3LOIA 2ZHKA 1VBB1 1RIRA 3JD72 3IZOA 2D5FA 4JVAA 3VBFA 5FK8A 3NJXA 1EP0A 1NA1C 2VZSA 3T2OA 4COWA 4GALA 5CFDA 3O0VA 1Y9MA 5C4WA 2EIEA 1ZBE2 5LASA 2HWD1 2E7AA 4PBOA 5FY8A 4EN8B 1GV9A 3MIBA 4M3CF 1BJQA 3WINE 4CU8A 1SDDB 3PDQA 1XQNA 2DTYA 1OOPC 4A45A 4Q4W2 4RFT0 4RQPB 3VB9A 1H8TA 2EVXA 2J1SA 3FBMA 3QOPA 1K5MA 2ZABA 2ET7A 2PN5A 2R042 1NE6A 2D97A 4HKWA 2IWGB 1TE1B 1GKBA 3AKSA 5FKBA 1PO23 3J4UH 3ACHA 1OLMA 4GB31 3D6EA 5EFUA 4AEDC 4XJUA 2GC0A 5IHRA 1RUI1 4C90A 1ZRFA 4JZRA 4WVMB 1OI6A 3MEPA 3POWA 4BK4A 4XDQA 2EA7A 1N47A 2WZR1 5L36A 1G9CA 2B8MA 5I8YA 4OMDA 4NVPA 1XU2A 4QDSA 1G9DA 4B1MA 3AP4A 2ZBJA 2R16A 2RS12 3O1TA 1D2QA 2VG9A 4RHV1 2O14A 1S2KA 1W6PB 5FYVA 3SH3A 3CLPA 4DPNA 2LS6A 4XFBA 5FZAA 4AR2A 5ACA2 3FZ3A 3DYMA 1DQ2A 1QXPA 1VP6A 2WABA 2A6VA 2R30A 3WW3A 4MZUA 4Z82A 1Z78A 4XTPA 5J1XA 1SFYA 2WSUA 4FOVA 1HW5A 2FCVA 4SBVA 2BBVA 1QH7A 4X8PA 1ND3B 2P3IA 5CFCC 4N53C 3D3AA 3L9JT 5DDJ1 1W90A 1UYPA 2DDUA 1IOAA 3D8CA 3NV2A 4D7YA 4DO0A 2XWBB 5LA9A 3WHUA 1TME3 2I07B 1C1LA 2VQUA 2UY8A 1WA6X 3M70A 4WM7C 4LKSA 4B4QA 3VD7A 3K2OA 4CUBA 4NWVA 3U4XA 5IVJA 5CU1A 2ZTNA 4GIQA 3RWNA 2FDGA 3OEBA 4I02A 3VBUC 4CCLA 4BHPA 5DDJ2 2WFF2 1FV2A 1KFUL 2JG9B 3C8XA 2JWPA 3QBQA 2GSYA 5IW0A 4DXSA 4YSFA 2WDBA 3PVOA 4LKFA 1I3HA 5J36A 5KXEA 1C28A 1FX5A 3VDDC 2FD8A 4L2NA 5FYTA 5JI7A 1F5FA 5A32B 4LO8A 1GNZA 3TN92 1UZZA 2JD9A 4AFBA 4ARYA 4D8MA 3PTRB 1KD7A 1EV13 2L9LA 3OY8B 3HT2A 4YM3A 5EJ1B 1NA1B 3LQCA 4KWLA 2QQNA 3X29B 5IVBA 1XPWA 5E1RA 1D4VB 4QAWA 3ZN4A 2MEV1 2E31A 4CP0A 3WNKA 2YC0A 4CEWB 3UL2A 5KHIA 4FOYA 3HN3A 3HVDA 3D82A 1JTZX 4K7JA 5FY7A 2ZGPA 2B4KA 4IEPA 1GWLA 2ZKLA 2WZ8A 2WNVB 4IEZA 5FZDA 5A33A 2WNUC 1OQDA 1SPPA 4ZZ5A 1QOTA 5C8CA 1QJY2 2DBIA 1UMHA 2DFCA 3OUIA 3UKVA 5A3LA 1ND3C 2CY6A 2DCZA 2MPFA 4A41A 4EROA 2ZZQA 3Q8AA 4W6WA 2VTXJ 1FATA 1W9TA 3MIEA 4L9BA 2AGSA 4Q4X2 4UFHA 2E6VA 1J84A 4FT8A 3VD3A 2H0BA 1GOFA 1O4TA 3B3QE 1O8SA 5C5TA 1W2AX 1XJAA 3BPZA 4P9GA 1NQDA 3WDWA 4ASKA 4XFAA 5CAZA 1PM4A 3AJZA 3JUUA 2CL2A 4LBLA 5HCAA 4UF0A 2D6LX 1JUIA 1LOGA 3AYCA 3LPFA 2RDNA 4GH4A 4LBNA 4YARA 5L7OC 3J7HA 1POQA 2E63A 3E6CC 5FZIA 2VMIA 4ZS3A 3DF0A 3O1UA 1ND2C 3GNEA 4NR1A 4ZPIA 2P6HA 5FYSA 1HRV1 3C7EA 1FOD2 5LY1A 5FV3A 3ACFA 3LD8A 2FZ1A 3DCQA 3OGJA 4BMBA 3RYPA 1OH4A 2GZWA 5FZMA 5T52A 4MGTA 2JE9A 5LA0A 4PDWB 2TBVA 1FYUA 2DURA 2YZ4A 4I09A 4ES9A 1S55A 4XF0A 3VBOC 2WLQA 3FN9A 4HZFA 1QHDA 5KR7A 5FXZA 5AVPA 2B46X 2OUHA 3SNMA 2ZX2A 3CO2A 1XNTA 2DU0A 4LORA 1ZZCA 2ZPXA 3HAGA 4Q0UA 5CEHA 1AR63 4UAPA 1IS3A 2A3WA 3MLLA 3J7NA 5GLTA 1GSLA 4JTOA 5T5LA 2H6CA 3S5QA 4XBNA 3I2KA 4Q0PA 3AP7A 1RUC3 2BGOA 3M8LA 1CAUA 2ES3A 2ZHNA 1F2NA 1R1A1 4HK9A 3A23A 3BI3A 3RSJA 5GKAC 3MLKA 5FLIA 2ZMLA 4GAZA 1JYTA 2HJIA 2VMGA 1Q8OA 1HXS1 1QGLA 1S1AA 1I6XA 3JZVA 3HNYM 1WCDJ 5F5QA 1S0FA 3EO6A 4EJRA 4YFZA 5DAPA 5E89A 4E27A 2JX9A 1I5ZA 4Y1UA 4GZ9A 2CGPA 5BXXA 1DBNA 3AZZA 1YQCA 4M4RA 1R1A2 1O6UA 2BVBA 2E26A 1GZCA 3GXUA 3AZXA 4QXKA 1NZCA 4NHKA 2HH9A 4IV3A 4A7YA 1L7RA 5GM0A 5F7UA 5FMDA 4CDQA 1MQTC 3PUIA 1E5RA 1NCRC 2FMDA 1VMHA 1VAVA 4QPYA 3BTAA 3P5BA 4WV8A 4XFFA 1CWPA 2VZ1A 3UKNA 5JXHA 5FY4A 5CFCA 2JECA 3HWJA 3VDBA 2ZGQA 4XBLA 4WM8B 5TSWA 3U1XA 5ERLA 1BVP1 2D93A 1IPSA 4ISRA 4DRVA 1EY2A 3O1OA 4K20A 1UOFA 2G9ZA 4A7ZA 4EN6B 5A3MA 4CDUC 1GZ9A 3CQOA 3VHNA 3C2UA 1J3QA 3OSDA 5L9VA 2XR4A 3POBA 4BK5A 2Z69A 4BB3A 2VMEA 5DN2A 3RMYA 3THCA 5FPBA 3AKQA 1LULA 3EYPA 3KV4A 4COZA 2BU9A 3HQRA 1W2UA 1DU3D 1BEV3 3H1YA 1W6OA 4N9IA 5BNNC 5BNOA 1CAWA 1A8MA 3IMNA 4HBNA 4S2GA 1JN2P 2OQ6A 3AB0A 4D94A 2NP0A 4ARXA 1LU1A 4ZXEA 4Q0SA 2Y34A 3LIGA 2QQMA 1NLQA 3HNBM 4DNYA 1VB2A 4P9IA 3IB3A 5A33B 5FKCA 1LEDA 1Q56A 3K4AA 2PXJA 3B93A 2RS13 3CZUA 4M00A 1W6PA 2CWSA 5JSRA 2VVEA 1VBB3 1JBCA 4HLTA 2DUPA 4XDOA 5ACA3 1AYN2 5JOYA 5F9TA 1QJZA 1TG7A 1FMD2 1GP5A 2D6KA 5FUIA 3VZLA 5C8CB 3N4MA 2HWB2 5I8SA 3JCIA 1W2OA 3N7LA 5C8CC 3BB6A 3WEZA 1H1AA 1UOJA 3ACGA 4IV1B 1ND3A 5FPUA 2YFUA 5LRRA 2SLIA 4XHBA 5C9AA 3V65A 1U0AA 4LHSA 3F95A 4DXTA 3H8XA 1B35B 1WLDA 2LRPA 1SBDA 3MW3A 4LE4A 3OOXA 1QJU1 4AVBA 1YHFA 1PO13 4BCUA 4IGPA 1X9TA 2OZJA 2P3KA 1KDKA 2VUDA 3ZYBA 5FP8A 1DQ5A 4OUEA 4PT6A 3ZFFB 3DN7A 4TTGA 3CL1A 3I97A 3ILNA 5CIRA 4P14A 5I0DA 1N1YA 1H30A 4HOOA 3WXPA 2G9FA 4QB6A 4X8NA 3ZMNA 4CEYA 1JHNA 4DRRA 1R092 5FK7A 2VU9A 4Z8BA 3WX5A 2R072 4YGDA 1WMXA 2AEYA 2LUWA 4GWMA 4Q4X3 1NYWA 5A6XA 2WS91 4LBJA 1QQP1 2GNBA 4QX5A 1RUD3 1D2SA 1C8M3 1DGRA 1URXA 1LHNA 2Q4SA 3USUB 1OQ1A 1YWKA 4OI4A 4IEYA 1DQ6A 1YJKA 5A3NA 3I7DA 4FPHA 4CDUB 5AFEA 2BNNA 5T54A 1VPHA 5FUPA 1VBC1 4UBGA 1DDLA 5KWRA 1AJOA 1PMHX 1CAXA 3M3IA 4R9AA 1BK1A 1DHKB 4MGQA 4Z2WA 4AEJA 4UI9L 5IT6A 2Q30A 4E8CA 2YGLA 1WZXA 3THTA 2ZX1A 4YZ4A 1TME2 3VBFC 3N9NA 4QHBA 5FP7A 5ISLA 3FFQA 2QCSB 3ZYPA 1UZYA 1IG3A 2PLV1 2VVFA 4XABA 5C4WC 2W91A 1QJU2 3LEMA 1NLSA 3VBSB 3GHNA 4Q8LA 5FCCA 3UETA 2K9ZA 2HEWF 3MBWA 1C57A 4M4PA 1JUHA 3I3EA 2W1UA 5A3UA 4QGMA 4FXKB 3ZFGA 3GHMA 4FP3A 2VOXA 4K8RB 1CVNA 1AHSA 3BUCA 1NT0A 2KM2A 4D7SA 3VD9A 3RZMA 1CESA 1Z0HA 2AREA 1K5MC 1S2BA 3WUDA 2JDUA 5JMOA 3LEGA 4FPFA 3ZDSA 2C9KA 5EJ3A 5FYCA 4NMIA 4NIIA 1AR81 3WQ1A 1CZSA 1VBE2 2EALA 2RS31 4EYUA 4OI0A 3OF1A 1LGBA 3G7DA 4EWAA 2VE1A 2W52A 3LFMA 4XACA 4CYDA 4JKLA 4AWDA 5AC91 5HPOA 1WLTA 4ORFA 3CHXA 3ALQA 4WM8A 1QY4A 2RG4A 3DKWA 4MHRA 1RUE3 1SEFA 1JXNA 4UYBA 4JX0A 1JZ4A 3FLTA 5A1AA 1OLRA 4I2OA 1R093 4CDQC 5KXBA 1AR82 5FXXA 4CUGA 3BTYA 4KQ7A 1E5SA 1RUH2 3GALA 2VUJA 3I2JA 4XZPA 2VM9A 4Z2AA 1COV2 4QGLA 2Y8KA 4M0NA 3F2ZA 4XJWA 3U78A 1DGLA 4M3CB 3RZZA 1V6JA 4XC9A 1NQJA 1RYYA 3SH5A 3OYWA 4CDXB 3IDEA 5HXVA 2G19A 3OG2A 5BNPA 3BU0A 2Q8OA 5IFTA 4LIUA 4AHXA 4OI2A 3LEIA 1JYNA 1V00A 1UX7A 4G4FA 1RUF2 5A7WB 3A0NA 4URTA 1ASJ3 4QT6A 3TN91 1O8PA 3WNMA 4KGGA 4QU2A 3WQBA 4NPRA 2A75A 5F32A 4KMQA 2K2SA 4MSVA 4PCRA 4WM7A 2VCAA 2ZCWA 1DYOA 1LRHA 4HG6B 1XRUA 4JAAA 4QQOA 1UU6A 5AC92 4I30A 1GNHA 5KHKA 2VBDA 3ZYRA 3MI8A 2QQWA 3ES1A 4OQ9A 1U5IA 4CP2A 3DKQA 3GCWA 4YW5A 4FI9A 1LENA 2ADEA 1HX6A 4FFHA 5IUQA 1S0DA 2PQSA 4AI3A 5HV0A 2EXIA 3FX3A 5A6ZA 4HONA 2ZMKA 3GYDA 5D2AA 2P37A 1IHMA 2YDEA 1E57A 1LOFC 3ZLIA 2KD7A 3I3BA 5FZOB 5L7OB 4IV3B 2R0HA 4MGYE 1ZBE1 5JLVA 4I3GA 2R1DA 3ZSLA 3KF3A 4A4AA 1W8UA 2JDAA 3PU8A 5APAA 2MHFA 4RD7A 3ZN6A 4Q8KA 5H9RA 1B35A 4XOGA 3KZ4C 4RYDA 3BOWA 5FZKA 1NX9A 4QX0A 4FOQA 3SEPA 4D69A 2BZDA 3MW2A 1Z7S1 2Q8EA 1NUKA 1OUSA 4D0QA 2OS2A 1ZRCA 1GLHA 4CCDA 3Q8FA 4BYYA 1DZRA 1C8NA 2VOVA 3D0JA 1DQ0A 1LU2A 4LE3A 2W68A 3KT7A 4BXSV 4DY5A 1HB4A 4D6SA 1MVQA 3I49A 1OKQA 4AGGA 3WG2A 3ROUA 3HIFA 5M0TA 3VBHA 4ITCA 4NIGA 4AFCA 1LR5A 3CJXA 1GOGA 1AR93 1R64A 4QKDA 1SLTA 2QZ2A 4O9GA 3DGTA 3T2QA 1W2TA 2C1FA 2Y0OA 3KM5A 4XCBA 3BCWA 5LATA 3WZ1A 1IQAA 2WA4A 1A3KA 5DZFA 4Y1XA 2YC4A 5KBFA 3ZSMA 4Y22A 4YLZA 4EQVA 3MFAA 3RI8A 2ZGUA 5HCHA 3PJQA 1HIXA 3V64A 1E5IA 2AH2A 2OPKA 1YI9A 2BDRA 3TWIA 5J96B 3ZDVA 4YPJA 4QPGC 1AR71 1MS0A 3POEA 2VBBA 2KR2A 2E7QA 1JOPA 3ZM8A 1DIWA 2GP5A 2RM23 4N7IA 1FPN1 1SLLA 3WNLA 2XBO1 5JWPA 5JPMB 2JENA 4JRAA 1BXHA 1H9PA 1OVSA 2XLFA 4HVQA 2CGOA 1NZIA 4LITA 3T4HB 2RJ2A 1S0GA 2D40A 2QZ3A 5HI0A 2QQIA 1X9PA 3VBFB 1O3QA 5KHGA 1R082 1F35A 4EN9B 4IETA 3R6SA 5FYIA 1VBD3 3ZFEA 5JSPA 5KC5A 3MICA 5FBZA 3OGSA 2XBO3 4A42A 2WYFA 2ZGRA 3KB5A 3A7QA 2J1VA 4KH9A 4XUOA 3UGFA 4OQ8A 1VAMA 2JEMA 4LJHA 5A7QA 3RGBA 2NPIA 1X8EA 4BM8A 4D6QA 1MEC2 2Y0IA 2AYHA 3SITA 3VGIA 1CX4A 4R9CA 2VTFA 3IIIA 4O61A 5K0UA 3ZR5A 3R0RA 3RS6A 1HB3A 4QX8A 3WF4A 3RG0A 2BV4A 1NXMA 4A6OA 1LOCA 5LA1A 4IGOA 2VBPA 3VDAA 2BW8A 4PF5A 4YGBA 4MV2A 3JBG1 3P6BA 2FDKA 1PVC2 2Q1ZB 3KSCA 3LFIA 3N9OA 2H6BA 1H6YA 3AYEA 3NAPA 5A32A 5A1LA 1RHI2 2DTWA 1RMU2 2UWAA 1REDA 5FMOS 5FZ6A 4NHLA 1CAVB 4K1YA 1VMJA 4RR3A 1HQNA 3J26N 2WWJA 3OY8A 1YQ5A 3T1MA 1UMZA 3AXEA 1CZTA 1GU3A 3DPRA 4XAEA 1NE4A 4KG0A 2CGNA 1VLNA 2LROA 4YG6A 5F3EA 3U14A 3DL3A 1LESA 4CP9A 3V0BA 3MUY1 3VBRB 4FPLA 1W6QB 3VZKA 5GZGA 2JG9C 3BYWA 4KI5M 1TMF1 2WINB 1G86A 2ZGLA 4JCKA 2ETEA 4NRQA 4XUQA 4AHZA 1UZWA 3TNQA 1AXKA 1U12A 4JC1A 1KQRA 1W9SA 3B9CA 5IAXA 3S30A 4LOSA 2VW0A 1NG0A 3UT0A 3AVSA 3ETQA 3ACIA 4FPOB 4XQWA 4DOUA 1C8M2 2DVDA 5CG8A 3N36A 4XVHA 1GQGA 5CKMA 1YEWA 2BRTA 2JB4A 5AVAA 1PIV2 2HEVF 2HWE2 4RL7A 5IK7A 3HJRA 1SDWA 3TOJA 5C7GA 1Q8VA 2IXHA 3JQXA 3ZXDA 1PGW2 1TQ5A 2JXAA 2W9XA 3KD4A 2HLEA 5JIAA 4L99A 1MS5A 2E32A 1AL23 5T50A 5DAVA 4AI9A 5BNOC 4FPCA 4UF0B 1W0OA 3PNAA 5LK5A 1ZX5A 4QHOA 1UXZA 2VUAA 2W46A 5IVEA 3ZSEA 5C6CA 3VBHB 1AR61 1EUUA 4YW2A 1YFUA 1GP6A 2JICA 2WAOA 3DXTA 3MO4A 3N9QA 4FFIA 4M3CA 3RPQA 4AGVA 4QDRA 1BCXA 4FFFA 5DUVA 5ABJC 3HQUA 4AHWA 5J7MA 2D3PA 5FZEA 1JYCA 4MXWA 2VD7A 2WO2A 3BIWE 4BQXA 2HWC2 4QKBA 2CV6A 3LWCA 1UOGA 3IWZA 3KF5A 4K21A 4QGNA 4QHZA 3O1MA 2DCKA 3WF1A 4XFIA 5EZWA 4D6RA 4N8MA 2OXBA 3RRDA 5BPXA 3WF2A 2J22A 3AYDA 3LPGA 3TEYA 2VW1A 2OZ6A 3C7HA 1B09A 2Q8CA 4AE2A 1JZ5A 1QWRA 1UAIA 2IVJA 2RM22 1PZ9A 2XMLA 3O1RA 2XLGA 5FO8B 3O7OA 4O9EA 1ENRA 1UF2C 3P3NA 4CUCA 2BP6A 3J9SA 3QLQA 3VLBB 3RZJA 2ZEXA 3J7LA 2RR13 3BOPA 1O5UA 2W39A 3DYOA 4XBQA 3HEIA 4CRQA 3HNMA 1UQXA 2PYTA 3FUQA 5E88A 4NIAA 2BNMA 3WNNA 4JDOA 1CIYA 5CVRA 1CJDA 4DQAA 2A1XA 2FQPA 4MADA 2XHKA 2VXRA 4HK8A 5IVVA 4HFSA 1CX1A 5DXDA 5C71A 2DCYA 4L0PA 1UY1A 4Y5TA 2EAKA 5A7NA 4Q26A 4FTEA 5FMOL 4XW3A 2AR6A 2V5DA 1XB9A 4DINB 3I54A 2PHRA 2ZGOA 3J7MA 5F5AA 1OOPB 2BNOA 3C3VA 1ZBA2 1AF9A 1W0PA 5BNQA 5LBEA 4GMP0 4CU6A 2D6PA 2XL7A 4CUAA 4JTNA 4LIVA 1ACCA 4JKMA 5F3GA 1RUH3 1N3OA 3B9IA 2BFUS 2E51A 4IV1C 3AZVA 4JHZA 5G04L 4KU8A 2ZEWA 1PVC3 1LHWA 4E4DX 2Q1MA 1EAH2 2PLV2 3MV01 4IDZA 1A78A 1Y9QA 4CCKA 3R4SA 2RS11 4RA0A 1RUH1 2JG8C 3AYAA 3T08A 1VR3A 5J3UA 3DPRB 1OURA 2ERFA 3ASIA 2ZA9A 3NAPB 5FXVA 4XZUG 5C3SA 4Y22B 1XYOA 2J1UA 3K46A 4D7TA 5FZ4A 3NAPC 4YZ3A 2QVSB 3PIJA 1FNYA 1Y7BA 1AXZA 4Y5SA 4MGKE 1XYPA 3DECA 3VBRA 2JG8B 2ZEZA 1NXD1 1QJX3 5C70A 3LDRA 2ID4A 4WM8C 4ZKTB 1RTVA 4BJ0A 1JYXA 4XUPA 1QJU3 2BQPA 4P02B 1G9FA 2XVKA 1ZBE3 3E1F1 3VZOA 1BEV1 1ODNA 1RITA 3EB7A 4QPWA 2RDRA 1FI2A 2PAKA 3NVCA 2ZHLA 5F5IA 1S4CA 2JIGA 4P5YA 1F8VA 5FUNA 1QIQA 4Y4RA 1XU1A 4YYOA 1IS5A 3LAGA 5IYYA 4B4PA 5C3OA 1R1ZA 2XKPA 2XQRA 3GJAA 3IMMA 1XXNA 4GJYA 4JGYA 4ZU7A 5FO9B 1UX6A 2R6QA 3MZHA 3USSA 4B4RA 1S0CA 1HKDA 3O0XA 2UY9A 4JGZB 1LGCA 3O12A 2EAAA 1W99A 4V2WA 2C5DA 3VUOA 1KFXL 2YU2A 1MACA 3POYA 5D8AA 3NWKA 3CBNA 5FZ9A 2OKXA 1GUIA 1CONA 3AL6A 3WP6A 1AR91 4NPLA 1KS5A 5E8AA 1ZREA 4AQ6A 2UWBA 1G8WA 3WT3A 2Z42A 5IK5A 2CWMA 4Q4Y1 1SCSA 4ZONA 4ZU5A 1COV3 5JSOA 4BZ4A 1PO21 3B01A 2PFWA 4M3CE 5HV4A 2XQXA 1PK6B 1UZVA 4MXVA 3TEWA 3ES4A 1YLLA 1DQ4A 4N7UA 5DABA 4XF9A 3D5OA 3WNPA 2WKKA 4GKYA 2A7AA 1HJGA 3HR9A 1SFPA 2WNOA 2AACA 5LZ6A 1SLIA 1IGOA 1QJY1 2A3YA 4RR3B 1DP0A 1GWMA 3NW4A 1WUVA 3BN6A 3WR0A 5ANQA 2VZQA 4NPMA 1ULPA 4QDQA 2B9VA 5FZ8A 3NV4A 2FCUA 3H3LA 5H9SA 1BVVA 1UL9A 4YG0A 3WP4A 3LSDA 3B5LB 3WG3A 1FV3A 5JUVA 1W03A 1XSRA 1HRI1 4LO6B 1NCQA 1WWYA 3B00A 4W6XA 2RMU2 2RS33 5JOWA 5E16A 4LQRA 5FYHA 5AC93 1AJKA 2AC1A 1SZBA 1OXCA 1RUJ3 3GF6A 3NJYA 1BYHA 1OSGA 2XUEA 3TAYA 4E8DA 4CCNA 2D44A 3NJVA 2GAUA 2ILMA 3NV1A 4HKOA 1F15A 1OFNA 4OMCA 2QUOA 3HOBA 5KXCA 4GD4A 3U0ZA 2XJSA 1RHI3 2A3XA 3RNSA 4BQ5A 2VW2A 2ZGTA 2YPJA 3GBFA 5B4NA 5DAWA 1LEMA 4FSJA 2O1QA 4COYA 1DGRN 4I0AA 1T6GC 2I74A 1GZWA 5I0TA 5LEKA 3J8F3 1OQEA 3O1PA 1JZ2A 1AL22 2A6ZA 2EICA 1CN1A 2Z4FA 2FBEA 4J1XA 1G6NA 5EV7A 3WDTA 4CPBA 4E4ZA 3C7OA 3MGUA 2P2KA 4FPYA 2RR12 1CIWA 4G9SB 1UCXA 2JKBA 4MH0E 1AYM2 1XSQA 2YB7A 4QPIA 2NYYA 5H9QA 4YVSC 4MVTA 2PHDA 4CDWB 3CJIC 5FPZA 1AUYA 2TEPA 2XXZA 4UW5A 2JJ6A 3UJOA 2B45X 4QX3A 3AKTA 1ENXA 3CIHA 1IS4A 4TXWA 5AFBA 4XE9A 1YFXA 1RUE1 3LDBA 3MIGA 4Q5OA 1YIPA 5LBBA 3ZX7A 3WHTA 3WW2A 2C0ZA 2MNGA 2Y26A 4DY3A 3WOGA 5FOBB 2I2SA 4JDNA 1C4RA 4WVZA 4H7MA 1SQ4A 3U11A 5FYUA 2B9UA 4BQ3A 1OC1A 5BY5A 4IW3A 1IPKA 3WW1A 3DYPA 4AEMA 4EV0A 2JG8A 4XJ8A 3URFA 3AJYA 1D4M1 3POIA 4IESA 4LOTA 4AAXA 4QXCA 4OFGA 4K1ZA 3AFKA 1UY2A 1MR5A 1BBT2 1REFA 5IVCA 2A6XA 2K46A 2YC2A 4IXLA 4BDVB 3OUHA 1JOBA 3TBDA 3VBSA 4UW3A 4W65A 4QU1A 2GP3A 3VZMA 1J83A 2ARXA 2HWE1 4WM7B 2IXJA 3ZXAC 1KGYA 3K4ZA 2WNVA 1GNYA 1UIKA 3S0MA 5JPNB 4ES8A 3T3YA 1XE8A 2YGMA 3VDDB 4X6QB 1ASJ1 3TN93 2WYSA 5JAXA 3OBZA 2R043 2YMZA 5A3WA 1DF0A 1YXWA 3A4UA 4KG8A 2O8QA 1MZ6A 2HWE3 5IWFA 2W08A 4RSUA 3FLRA 2UYAA 5D8AB 4RHV2 1AZDA 4MLOA 5DG1A 2XPJA 2DU1A 1FOD3 4W4ZA 5B4XA 5FLHA 2JD4A 5LY2A 3W9AA 4KWKA 1UU5A 3LDKA 3N7KA 4FP2A 3POJA 2J1EA 2JDZA 4GMP3 3MYXA 4S2HA 4IE0A 3M1HA 5JR2A 1H2KA 4G3YC 5KHHA 1VBB2 3JD71 5CKQA 1YI7A 3WP3A 1J3RA 2YHJA 5J48A 4J1WA 4OUSA 4WZCA 4GWNA 1FT9A 1J1TA 2XLAA 3IPVA 5D8AC 3I59B 3DEMA 5FYMA 3H8OA 5CYYA 2Y33A 4E2GA 1HN1A 2JG9A 1N3QA 2CDOA 1G7YA 3NNFA 4GMP1 4ISQA 1UZ0A 2W1WA 3BALA 4LO5B 2JDHA 2WT0A 3POFA 5EQUA 1TNRA 3S7IA 1WA4A 1H6XA 3OD0A 1AR62 2WQZC 5CADA 2JDMA 1PX4A 2RM21 2QQJA 2GC1A 1HXS3 2XUMA 3V0AA 3KCXA 1FPN3 4MGZE 2XGXA 1QKQA 3EXUA 4MG2A 1UXXX 3JXSA 4AI2A 4AEDA 3GGLA 1ZA4A 4ET7A 3BVCA 2ZGMA 4N90A 5F39A 5I0UA 2VC9A 3AZWA 4PIXA 1OLME 1UYYA 4QM8A 1DGWA 1VJ2A 2JB8A 4M01A 5F2WA 2WBKA 2AEZA 4NWWA 3UV9A 4Q1PA 2ARAA 4XF1A 4CDWC 4JQRA 4LK7A 4LMFA 1VRH2 4Z07A 1SFNA 3ZYIB 4ZS2A 4BQ2A 4IUGA 3ZKYA 3E97A 3ECQA 3FL7A 4PBPA 3POGA 5FZOA 2YROA 1Q8PA 1N1TA 5DUWA 3K3NA 4JGYB 4RHV3 2GN7A 3WLUA 4OHWA 4PQ9A 5ABJA 3ITQA 1WW5A 4HSJA 4IGQA 1VRH1 4JGZA 1ZZ6A 2WR9A 4CZSA 3NNLA 1HQLA 1ZA7A 3VKNA 4XJZA 5T55A 4Y5Z0 4OI1A 4PI2A 3RVHA 4FQZA 3EHKA 2BERA 1V9U3 4TWTA 2FZ2A 4XUTA 3KS7A 2DF7A 2J42A 4LK6A 4Y20A 5BNNA 2Y6GA 2Q5TA 1MS8A 4S2DA 3I2FA 2XWJB 1JYIA 2NZ9A 4OHVA 4B8EA 1APNA 3S5AA 1LOEA 2R32A 3WF3A 1PK6A 1TME1 4QPIB 2C24A 2ORXA 3N9LA 2HWF3 2D6OX 2D43A 2IXKA 1VBE3 2WFF1 4HPKA 1QOOA 1XNKA 3SCHA 2VMFA 4L92A 2ARCA 5T5PA 2WQ8A 4BQYA 5DAQA 1K42A 5JXGA 3MDPA 2DV9A 3AKRA 1WMFA 3IDBB 1QF3A 3V56A 4ASLA 2JDPA 1ZRDA 2VXJA 3FUOA 4Q4Y2 3VL8A 1FNZA 4HMZA 3ZYJB 4INDA 4NO4A 4OULA 1W6OB 2VZRA 4RN5A 4UFJA 5BNOB 3N3HA 1FXZA 1BZWA 5C9AC 1RVF1 1JI6A 1CAUB 1YC61 5L9BA 2EIBA 2VNGA 2VY0A 2RE9A 4QM9A 5EP9A 2XB6C 4QB1A 1PO11 4HETA 5T3NA 5FR3A 1RXFA 3MW4A 5T5JA 4AI0A 4CXYA 1W6QA 1VBA2 1KS4A 4FXGB 2D3SA 4N43C 4LBMA 1PIV1 4YRDA 4YVWB 2OYZA 2PAEA 1P8JA 3QH7A 2W0XA 2HYKA 4C1XA 1DFQA 2UURA 3MIFA 4IQPA 2Q8DA 4CEYC 5KHJA 1Q8SA 1SHWB 4NIHA 2IZWA 4NUBA 1PGW1 1RC6A 2OA2A 2E33A 3ELNA 2BWAA 3HMYA 3H7YA 1M4WA 3CJIB 3U75A 2WS93 4S2FA 5CFDC 1YYNA 2Y64A 3N35A 1MVEA 1WCSA 4FVVA 2NQYA 2IUWA 1S0BA 5E6HA 2BOJA 3C7GA 4XXAA 5FZBA 4OCTA 2QQPA 2ZEYA 1LECA 4O65A 4FAGA 3WNOA 3WDXA 5K0UB 1XE0A 3N9MA 4F83A 1LOAA 2FDIA 3AP5A 3HBKA 1YQ8A 3VDCA 4FBFA 4AFAA 1SBFA 2IC1A 4OHYA 3UGHA 1EUTA 4CEYB 1VBC3 4LUKA 3RZHA 3GZEA 1QNWA 3SCFA 2CSGA 3AMHA 2OUJA 1PGL2 5B2GB 1PX3A 3SCGA 4QMAA 1NCRB 4B7EA 5F6KA 2RR11 4FFGA 1VBA1 4IEQA 3TB0A 1GQPA 2BGPA 3VBOA 1YIFA 4RFRB 4FTBA 1UN1A 4HT1T 4NAMA 1LHOA 5FRAA 1MS9A 4R9DA 3MPBA 2B5HA 5F1RA 3OPWA 3V0AB 3H7JA 4Y26A 2PTMA 1QQP3 2CU5A 3W59A 4DB5A 1RUD1 1J58A 2DYCA 3ZXEA 1VBA3 1D0HA 4B1LA 5A70A 1UKRA 3AP6A 1X8MA 1EYBA 1UYXA 5LWBA 1CPNA 1BQPA 4R4XA 1YCIA 4PQQA 4XFGA 2CNAA 2N7GA 4PHZA 3UKTA 4IEOA 2ENRA 2VMDA 5CNAA 2J1RA 2YV8A 3W21A 1Q8QA 1F4HA 2RJLA 4LA2A 1JZ6A 1GANA 4BQ4A 3THPA 1F9KA 4GWJA 1JODA 3JB4C 2VPVA 3M3QA 2VCMA 3ZVXA 4DMIA 1KEXA 4YM0A 4A2UA 1ULEA 4PLNA 1R091 4XIOA 2P1BA 2VZVA 5JVVA 3THDA 2R071 4XUNA 4AG4A 2V4AA 1NAEA 2P6CA 4KL1A 4LHNA 3NSTA 2F4LA 1LHVA 1OVPA 2WFPA 4IE4A 3AMPA 3PMEA 4BE3A 2ZOEB 2DUQA 2BWCA 3VBUA 3JBG2 1XNAA 1LTEA 4JQTA 5FMCA 5FJHA 5EYXA 2WO3A 1EAH1 1DGWX 2ATFA 4BMEA 5BNNB 1JU4A 1DQ1A 3KWVA 2RDSA 1LJ7A 1V70A 4PLMA 4CCEA 3TYJA 4ZU4A 1IKPA 1VIWB 4UXAA 3L2YA 1A6CA 3QACA 3G6JB 4MGIE 4RS5A 2KA3A 2R1BA 1D4M3 4RQPA 3T2PA 2HWB3 2DVGA 2W1QA 4GKXA 2ARBA 3H8UA 4MXWB 4CDUA 4Z1VA 2MEV3 2JE7A 1BBT1 4ONUA 3BKZA 3T4VA 4ATEA 4KNCA 2DVAA 2RJKA 2PELA 4I0WB 2YY1A 5FXWA 1K45A 2GALA 2Y38A 4AW7A 4OHXA 2UWCA 2E53A 4UW6A 5LB6A 3RYKA 1ZNPA 5A7WA 5GALA 5FZ0A 1PVC1 3ZYHA 5FFOC 1RUE2 5FPVA 5F2SA 1BBT3 4NHYA 2VVDA 2BTVC 2OX0A 4OVEA 1RJ8A 2NMOA 4WVMA 5FYZA 2R041 2AENA 3GJBA 3NNMA 5LCWL 3FHAA 5JZGB 5JOZA 1OMIA 4YVWA 4LKDA 3S6PA 4HVRA 1RUJ2 4PDWC 3WD5A 1RL3A 5GZEA 4QKFA 5CKNA 4QPIC 1UYZA 3K77A 2CTVA 3N7MA 4C0BA 4DZGA 3WDVA 4WZFA 3MHZA 1R083 1LCLA 5EWSA 4Q4Y3 4KBZA 4NIDA 2GNDA 2HKXA 5CB7A 5ABJB 1U5XA 3P1IA 2VNOA 2DVBA 3ZYGA 4AVAA 3SMHA 4E4SA 5L7OA 3NKGA 1H1MA 1POV1 5FWEA 2WNUB 4KWUA 4AK3A 5FY0A 3VL9A 5DMYA 1W8ZA 2JDYA 5DAXA 3M3OA 3WP5A 2G4IA 3PUSA 4GJZA 4IERA 1DG6A 2D7FA 4RGGA 4EE2A 1ZM1A 2YBPA 1YUDA 1GMMA 4UBHA 4IE5A 2B39A 1RUF1 2GNTA 2XKOA 4V2VA 2A71A 4ATFA 5BUVA 1JU3A 2MEV2 2RS32 3WCRA 4BPZA 2V09A 1VB4A 4I0BA 2WZR3 4MGSA 5ANNA 2I45A 3ZXKA 2WO7A 2HWF2 2WAAA 2WNVC 2XH6A 3BU7A 4QX7A 4BIOA 1HV1A 4BQ1A 2WZEA 3IN9A 1GR3A 5JDBA 1NA1A 3UJQA 3WG1A 3Q8CA 3OYWB 4P5HA 4OHZA 3OCPA 1GOHA 3AP9A 2FDJA 2QQUA 4UOJA 3OBTA 1RUC1 1UIJA 1AR73 4LUMA 1XNDA 4FTSA 2E7TA 3GCXA 5IATA 3A22A 1OBNA 3O0WA 2K0GA 3WDYA 4N9HA 4QXHA 4YZ5A 2XJPA 5I0SA 3J8F2 3KVAA 2BYVE 4MUVA 3ZFEC 1D7PM 3I8TA 1JYWA 3SHRA 1RUOA 4YZ2A 1ONAA 3CZJA 3WV6A 3KGZA 3PL0A 5J98B 5I93A 2PQQA 3RZLA 5FQ0B 4Y1ZA 3T2TA 2YFZA 1MZEA 4RGAA 1AYM3 5K9YA 2HWC3 4TLGA 3ZPOA 2V72A 4LTAA 4FQ4A 4IEVA 2W5FA 3PURA 1GZTA 2HEYF 5DUXA 4IV3C 4XETA 2O8OA 1EV12 1VRBA 2WS92 1UU4A 2Y6FA 3GBWA 3PUAA 3ZXGA 3RFRA 4BU2A 1JYVA 2VOKA 5FJKA 5FZ7A 4R9BA 2PHUA 3JBG3 4C0HA 4AF9A 3B02A 3K51A 2P34A 4E4HA 1WMEA 3AXDA 3ZFEB 1UW8A 1V9U2 5L19A 5FZLA 3FE5A 4RR3C 4XTMA 2F4PA 2VNVA 1EV11 3OTFA 1W8OA 3VBUB 1MZFA 4ASMB 3T0AA 4BOWA 4AL9A 3LA3A 4KWJA 2YU1A 3AC0A 2VCCA 3RZKA 4XQDA 2IXCA 5FZ3A 1IKQA 2ZX3A 5A3TA 1JW6A 1OH3A 3OGVA 4UT5A 1GFF2 4QKNA 3EMRA 3WCSA 5KC6A 2OIIA 2WJSA 4IEUA 3VKMA 1C3HA 2WIIB 1RVF3 4Q4W3 3OB8A 4WBBA 4Q29A 1ODMA 1KXGA 3U10A 1OD3A 2VOWA 1ZBA3 2R061 2C26A 2ZXQA 3HN1A 4RS5C 5LEJA 2J7MA 4LKEA 3BTZA 4Z92B 2QQVA 3HQXA 2P5BA 3PHMA 3HT1A 2J1AA 1W06A 4O7XA 1BMV2 3FJSA 4YW3A 4BLJA 3ZN5A 1WW6A 1WCUA 2XJQA 4Q4W1 4FAHA 2VZUA 1XNCA 3ST7A 2QBXA 4M0HA 5IVYA 4E2SA 4BH9A 4XMIA 2V73A 1DZQA 4OZXA 3I2OA 1S0IA 2ZHMA 1PGL1 1SPPB 1V6IA 3FFZA 1RGSA 4E9KA 4AFDA 5IVFA 3E6BA 4NAOA 4URAA 1AX0A 1QOSA 4H3WA 4R8HA 3H3UA 5F37A 5EJZB 3Q8EA 2WN3A 3AX4A 5I0RA 1ZZ8A 1PK6C 1J59A 5GLUA 3CEWA 4EN0A 5JOXA 2BBAA 2P4EA 4BWOA 2D5HA 4FPJA 1DYPA 1L3JA 1OA3A 1S0EA 1H1IA 4Y1VA 3OPTA 5HCFA 1JMUB 4DEQA 5A80A 1X50A 4YW7A 4KGQA 3WUCA 3A0KA 2X05A 1WLWA 4A6SA 3UNPA 1RUNA 2CHHA 5FMBA 4W50A 1QNYA 4DIQA 5HCBA 5CFCB 5F3CA 4XCAA 4LO7A 2WNUA 1FPN2 2TUNA 4LEJA 3M2MA 1UPIA 5C33A 1YJLA 3GM8A 1JHJA 1V6MA 2WL1A 5D21A 4GXLA 2VZTA 2PHFA 3GDBA 4XFHA 1W28A 2GMMA 2W95A 4P9YA 4YZ1A 5C8WA 1TEIA 3I59A 4H14A 2ZGKA 3WVJA 4EZ4A 1AXYA 1SBEA 3KHBA 1H4HA 3I2GA 4HKLA 1QH6A 2WWUA 1O3SA 3PVNA 4L97A 3SQOA 3U37A 4B3NA 4HL0A 3ILFA 3ATGA 4QQPA 1AX2A 4P9WA 2PHTA 3R4UA 1PZ8A 4GWIA 1H0BA 3RQ0A 2YBKA 3K3OA 4GA9A 4D3WA 4LT5A 4PF1A 2VQ0A 4PLOA 1AYN1 1DCSA 3RWKX 3T1LA 4AXOA 1LB2A 3ACLA 4LHLA 1SLAA 3W20A 3AFGA 3E5QA 1HB1A 1Y9GA 2DCJA 2WO1A 2ZS6B 1CJPA 3KLSA 2LW8A 5GZDA 5L9RA 1NKGA 5A7SA 1UPSA 1US2A 4I3PA 4QXBA 3B94A 4H7LA 4YGCA 4DEVA 5I91A 1K5JA 1SMVA 1BKZA 3GZTB 3SH4A 3LA7A 2VAUA 1I5PA 4Q27A 3UYJA 4COUA 1VMFA 1CGPA 3ENRA 3DXUA 1W6NA 3V0BB 2XG3A 1W8NA 3ME2A 3FBYA 3C7FA 1HRI2 4L8QA 4YFWA 4IV1A 1D4M2 1F5JA 1C5IA 4P08A 4YNIA 4B7KA 2AZ5A 3WW4A 1KJLA 1O59A 2F17A 4Q1RA 4XFCA 1W3VA 4LHKA 3VD4A 1ZZBA 1QEXA 2E9QA 1T6BX 4QX2A 5JR7B 4AHYA 5C9AB 2B42B 1WD3A 5IK8A 1GBGA 1R1A3 2GDFA 2Y6JA 3H50A 3MLJA 5GZFA 3RJRA 3SLIA 2VZOA 1L7LA 4P9JA 4K40A 2VUCA 1W9FA 1WW7A 3FWEA 1UY4A 2VNRA 3DV8A 3DUIA 1ULDA 3CKHA 2W3JA 4LBOA 2GMEA 3OD4A 1BLZA 1AVBA 5GLVA 1H4GA 2CAVA 3PUHA 2TNFA 2BJSA 3AKPA 4TSVA 1HN0A 3PU3A 4XDPA 4IE6A 3SEEA 1I9RA 5BNPC 4MX3A 3ZKUA 3L2HA 3D4KA 1PVXA 2HYXA 2LM3A 5F5CA 1K5MB 1XYNA 1MQTA 4QWNA 1ULFA 2PHXA 3OJBA 4P9LA 1UWWA 3LA2A 1W6MB 4HANA 1YQ6A 3LSEA 1MS3A 1HRV2 1IPJA 1AX1A 3SKVA 1QXRA 1W9YA 3WG4A 5A3PA 3NKTA 2Z79A 4LO4B 1QQP2 5JZGC 2NLRA 4WVWA 2Q1FA 1W2NA 3DPRC 2GC3A 3GZAA 4OUMA 2ZAAA 3I2HA 1V6LA 4LLFA 4XF3A 4XIKA 2PHLA 5A1FA 1BHGA 3PJYA 1NY72 4XXPA 5FWJA 5H9PA 1J1LA 3I2IA 3WNXA 3I2DA 2VO5A 1RINA 2HWD3 5LRSA 5FZFA 1SACA 2B7YA 2VECA 4QQHA 4FO9A 5F3IA 4CDXC 2NMNA 3IM0A 5EHDA 1WCKA 1H2NA 2QDRA 1YFYA 3M3CA 5J09A 3KHCA 3OBRA 4HXCA 4XEZA 3LF7A 1S2EA 3CDZB 4UFIA 1B35C 3VKFC 1MS1A 4QQLA 5CFDB 3IDAA 4FPEA 4CTEA 2UYBA 1X33A 2RS53 4CEWC 2VH9A 1UO9A 3ZFFA 1O4ZA 4CA9A 3MIDA 5LA2A 2AUYA 4Q4V3 2QFEA 1STMA 3CU7A 1RUG3 5FYBA 5FY1A 1FMD3 3E5XA 2VMCA 2YPDA 1GICA 4Y3OA 2XHNA 1N3PA 2C9AA 3ON7A 5DQ0A 2ZX0A 3VBHC 3NNGA 2RS51 2YYOA 2XVLA 2JE8A 4BIFA 3PVBB 4XAAA 4LULA 5HXMA 4HPKB 2FHRA 1OFSA 3HD8B 3O5SA 4Q4V1 1DLLA 3FC0A 1EPWA 1E5HA 4MOAA 3VHOA 5C3QA 2GN3A 1LOBA 1RUJ1 4HN0A 5FREA 1NY71 1YNAA 2EXHA 4LBQD 4J6GA 5HBAA 1AL0G 1RB8G 3NV3A 2P17A 1ULGA 3AMNA 3VKLA 1COV1 3RDIA 3VBOB 1C8M1 4U36A 4DFSA 1GQHA 3RZGA 1V0AA 3QH6A 4QB2A 5K8SA 1EPZA 1WBFA 3IDCB 3JQWA 4HSLA 3MV11 4AAPA 4IL7A 2HWC1 1JZ8A 1L7QA 5EXOA 4Q4X1 4QPGA 4E2QA 5CZKA 3CNAA 1LODA 4NE9A 4UFKA 3WDUA 3M3EA 5A6YA 3RJ2X 3VHPA 2XONA 2EXKA 4K8FA 3OGRA 1XE7A 2QTWB 3MFCA 5KXDA 3S57A 2OW4A 2JDKA 1JH5A 1GYKA 1QMJA 2RV9A 2VQAA 1QJEA 4FPKA 1RHI1 1HDKA 4GB33 4NHMA 1F31A 1OKOA 3N9PA 1ZRRA 1OT5A 5EPAA 1WGPA 1ENQA 2PLV3 1W6NB 3NMBA 4META 1RUI3 1Z7S2 3M4FA 1IS6A 5JXIA 1AR92 4V1PA 1RXGA 1VE0A 3CJIA 2OVUA 5SV5A 2X09A 2YXSA 5CBLA 1OD5A 5FLJA 1HLCA 2JKXA 1UY0A 2ZJCA 1H2MA 2A73B 3BODA 3NL1A 1PM7A 3ORJA 4Q4V2 3NNJA 4L11A 2DCTA 3WY6A 3KT4A 1GP4A 1OLQA 1YQ2A 3OEAA 2WZPP 3ZIXA 4AQTA 4DUWA 3VN4A 5K0UC 1WW4A 4CP1A 2R0FA 3ZFGC 3PUQA 1S0JA 3PTYA 3PVEA 2QNKA 4CPBD 1W05A 1ZBA1 2R063 2W87A 3H42B 4F3JA 5CG9A 1W8FA 2BFUL 1OPMA 1CPMA 1GWKA 3LE0A 3KV6A 4JKKA 1AR83 3J8F1 1U5ZA 3SXWA 3VD5A 4F7ZA 2W47A 5A7OA 4RS5B 4CCMA 4YGEA 1Q5OA 1XBFA 3O14A 2RMU1 4U2AA 4YVSB 5T5OA 1WD4A 4NOTA 3ZXJA 2IFRA 4BLIA 2LALA 3ZIWA 4EZHA 1W8TA 4IEWA 5DPNA 2DWRA 1TMF3 3W5MA 5D1IA 2RHPA 2WRAA 2PHWA 5JCTA 1KITA 2EIGA 5K4LA 1ASJ2 2A70A 4JDMA 2QE3A 1PZ7A 3VBRC 2BOIA 1H8TC 4A3XA 1MS4A 3T0DA 3EJKA 5JZGA 5FTTC 2Y6HA 4CVUA 4LXLA 1UOBA 1UKGA 1X82A 2QQOA 1QXJA 3H0OA 3I4IA 3LOBA 3FMGA 3POSA 3B7MA 5FZ1A 5GJ6A 3UESA 1WBLA 4YW6A 3VV1A 3WQ0A 3UGGA 3N7JA 3LCPA 4N53B 1HRV3 2WZR2 3U07A 3ZR6A 4CCJA 1XOYA 3ZXFA 2C4XA 3FHIB 4AGRA 1TNFA 5C5UA 5FZGA 3PLQA 3ZN6B 1DLCA 1HQWA 3JD73 1CD3G 1HJFA 4NROA 1YRZA 4JGYC 1PGSA 5LBCA 1DZTA 1RUG2 1ZVFA 2ZACA 1W8HA 1ZRIA 1HV0A 4LBQA 3W58A 1NLRA 4QD2A 1Q43A 4PI0A 2VOTA 1JS9A 2XJTA 3UK9A 2O0OA 5F8PA 2DFBA 3I3MA 4Y24A 2QQLA 5FZCA 1ZZ9A 4TLFA 3H8RA 1LGNA 1LOFA 4GULA 4PIZA 1W8WA 5IK4A 4XHXA 5C3PA 3S7EA 4X6RB 1FOD1 3SISA 2EXJA 3K48A 4LA3A 3I3QA 4YWAA 4CDWA 1Y4WA 2VULA 3IAQA 1CAVA 2BVVA 1PO22 2X5IA 3AMMA 1VAKA 1W6MA 3EQEA 4LPLA 4UFMA 3LGRA 1AYM1 3K4DA 4A44A 3FLPA 2XVGA 5BYNA 1UY3A 4ZHNA 5FZHA 4CU9A
chains in the Genus database with same CATH topology
3D0SA 3LKJA 2GU9A 2WQ4A 2Q0AA 1CAWB 4XILA 4JRLA 4K6BA 3LB9A 4JGZC 3WQ7A 1VRH3 3B69A 1OHFA 2BUKA 4GB32 1J3PA 4QPGB 3ZXLA 1VBC2 1RJ7A 1H9WA 2GMPA 3IIAA 4GQ7A 3VDDA 2BGCA 3APBA 2DUOA 3E5UA 4PIYA 4AYUA 2D98A 1N1SA 1HRI3 2YUEA 4Q0QA 2HWD2 4H55A 2A6WA 4AI1A 2WNEA 3E6DA 3H1MA 4AVCA 2A5ZA 5F6LB 5FDBA 1V9U1 4QQ2A 1HXS2 2LTNA 4CDQB 3OGGA 1YO8A 4FCAA 3NO8A 1NOVA 4AFMA 2IFWA 1D0GA 3MF9A 5FPXA 2XJRA 2ZZJA 2X8KA 2BPA2 2V5YA 1V6OA 5C4WB 1VBD2 3CF6E 1WMDA 2Z5WA 3IPVB 1VBE1 2CAUA 2WFF3 5DDJ3 2ZGSA 1M06G 4LR4A 4YVSA 1H8TB 1N1VA 1VBD1 4LLOA 4I01A 5DUUA 3H3ZA 1QU0A 1U5YA 4HVOA 3GBGA 2NM1A 4FOWA 4K3UA 2FMYA 1REEA 1PIV3 3AZYA 4GH4C 4AEDB 5ACA1 5EYYA 1CAXB 1ZZ7A 3AM2A 2RS52 4K9SA 4NN0A 5FOJB 1ND2A 1RMU1 4EWDA 1LHUA 2HWF1 3VKOA 1H2LA 4FPGA 4Y1YA 1XNBA 2WLPA 2BEOA 4YG3A 5FQ0A 4P9XA 3RYRA 3ZSKA 1X7NA 1C1FA 1PNFA 3VBSC 4DXZA 1V6NA 3H1WA 3IT8A 4N43B 2SBAA 3KCCA 1RMU3 1PMIA 3SISA 1SLCA 5JPNB 3QD6A 3VHRA 4B29A 2ET1A 3NJZA 2ZGNA 2A6YA 3ZFGB 2P3JA 2ZAHA 3KQRA 4AVVA 1FMD1 2WT2A 4C1WA 5LK7B 2ZX4A 1FAYA 4LBQB 2GC2A 1OA2A 5GLWA 1QDOA 1WLCA 3H9AA 4C91A 5JI9A 1Y3TA 1X36A 3JB8A 4Y20B 1ZYBA 3IBMA 1OOPA 3KT1A 4DS0A 1CQ9A 4UW4A 1C5HA 1OA4A 3KCYA 4AVTA 2XBO2 2D6NA 4XQ4A 1O7FA 4Y4YA 3TNPB 2X53S 1Y43B 4HN1A 1QJY3 2XJUA 1O4YA 1MEC3 2PA7A 3MIHA 3USUA 1ULCA 2ZKNA 4SLIA 2XL9A 1JOJA 2EF6A 5BV6A 5K7PA 3ZMOA 3PMSA 2NN8A 2G9GA 1KRIA 3AK0A 1AL21 4CDXA 5JMCA 1PO12 1VALA 1O5LA 2X29A 4TYSA 5BNPB 3RI9A 1NCRA 1MEC1 5J37A 1BEV2 2IXIA 3RMXA 3LZZA 3INAA 1G9AA 5DZEA 1NCQC 5I8TA 2X5IC 1QDCA 4YW1A 1UD1A 1O3TA 2QDNA 2WC2A 4CEWA 4YM2A 3MPPG 2VGDA 3ZFFC 2R073 1W39A 1I1EA 1RUC2 4A7KA 1PNGA 1H8VA 4AI8A 1AYN3 5FAXA 2D3RA 1YFWA 4N53A 1EAH3 2GNMA 2IXLA 4R52A 3ZPYA 1BMV1 3AMQA 2GH8A 2KXLA 4XJAA 3P3PA 1AR72 2UU8A 3ZSJA 5JIUA 1IZ3A 4RQPC 5GZCA 4XYXA 3OPZA 4AQSA 1OPOA 3KMHA 4LBKA 3QCWA 1LKNA 2VMHA 4XJ9A 3TRSB 2PAMA 1TMF2 4GH4B 4LNVA 2R49A 2WT1A 4W6YA 2CYFA 4XF4A 2RMU3 2HWB1 1PHMA 2R062 3JU9A 3Q9OA 1O3RA 4IEXA 5FO7B 1ALYA 3ZO0B 3R4DB 4ZXKA 4EN7B 4AVSA 4Q0VA 1ENSA 4XPVA 1RUD2 4YVWC 3IKWA 2Z2SB 4WVVA 4PDWA 2X5IB 3GZUC 4EWEA 5CA6A 4XMAA 3R05A 4TZDA 5DG2A 1SCRA 2WSVA 1MQTB 3HBZA 1CR7A 1Q3EA 2WA3A 5L73A 2QKDA 1POV0 4KU7A 5GLZA 1SLBA 3EBRA 4BA6A 3MF6A 2XJVA 1V6KA 4F8AA 5DZGA 4R4ZA 4Q2FA 1DYKA 2WWSA 5SV8A 3M7AA 4AQ2A 3KGLA 1ND2B 4MYEA 1POV3 1R081 4YM1A 1NCQB 4YW4A 3ILRA 4PJYA 2F6BA 1G9BA 1MZ5A 4JV4A 2QJVA 1QJX2 1KJRA 1RVF2 3VZJA 2GH2A 4COVA 1O91A 2D6MA 1RUI2 1Z7S3 2ZMNA 1RUG1 4N43A 2H0VA 1A8DA 2DVFA 1RUF3 3VZNA 1KDMA 4KBBA 4OLLA 1GZWB 4AEKA 1QJX1 3LOIA 2ZHKA 1VBB1 1RIRA 3JD72 2D5FA 4JVAA 3VBFA 1EP0A 1NA1C 4COWA 4GALA 5CFDA 3O0VA 5C4WA 1ZBE2 2HWD1 2E7AA 4PBOA 4EN8B 1GV9A 3MIBA 4M3CF 1BJQA 3WINE 1XQNA 2DTYA 1OOPC 4Q4W2 4RFT0 4RQPB 1H8TA 2EVXA 3QOPA 3FBMA 1K5MA 2ZABA 2ET7A 2PN5A 2R042 1NE6A 2D97A 4HKWA 1TE1B 2IWGB 1GKBA 3AKSA 1PO23 3J4UH 4GB31 3D6EA 5EFUA 4AEDC 4XJUA 2GC0A 1RUI1 4C90A 1ZRFA 4WVMB 1OI6A 3MEPA 3POWA 4XDQA 2EA7A 1N47A 2WZR1 1G9CA 2B8MA 5I8YA 4NVPA 1XU2A 1G9DA 3AP4A 2ZBJA 2R16A 2RS12 1D2QA 2VG9A 4RHV1 1S2KA 1W6PB 3SH3A 4DPNA 3CLPA 4XFBA 5ACA2 3FZ3A 1DQ2A 1QXPA 1VP6A 2A6VA 2R30A 3WW3A 4MZUA 4Z82A 1Z78A 4XTPA 1SFYA 2WSUA 4FOVA 1HW5A 4SBVA 2BBVA 1QH7A 4X8PA 1ND3B 2P3IA 5CFCC 4N53C 3L9JT 5DDJ1 3D8CA 1IOAA 3NV2A 4D7YA 5L36A 2XWBB 3WHUA 1TME3 2I07B 1C1LA 2UY8A 3M70A 4WM7C 4B4QA 3U4XA 4NWVA 5CU1A 2ZTNA 4GIQA 3RWNA 4I02A 3VBUC 4BHPA 5DDJ2 2WFF2 1FV2A 2JG9B 1KFUL 3QBQA 2GSYA 4YSFA 3PVOA 1I3HA 5J36A 5KXEA 1C28A 1FX5A 3VDDC 4L2NA 5JI7A 1F5FA 5A32B 4LO8A 1GNZA 3TN92 1UZZA 4AFBA 1KD7A 1EV13 3OY8B 3HT2A 4YM3A 1NA1B 4KWLA 3X29B 5E1RA 1D4VB 3ZN4A 2MEV1 4CP0A 2YC0A 4CEWB 3UL2A 5KHIA 4FOYA 3D82A 1JTZX 4K7JA 2ZGPA 4IEPA 2ZKLA 2WNVB 4IEZA 5A33A 2WNUC 1OQDA 1QOTA 5C8CA 1QJY2 2DFCA 3UKVA 5A3LA 1ND3C 2CY6A 2DCZA 2MPFA 4EROA 2ZZQA 4W6WA 1FATA 3MIEA 4L9BA 2AGSA 4Q4X2 2E6VA 4FT8A 2H0BA 1O4TA 3B3QE 3BPZA 4P9GA 1NQDA 3WDWA 5CAZA 4XFAA 5HCAA 3AJZA 3JUUA 2CL2A 4LBLA 2D6LX 1JUIA 1LOGA 3AYCA 4GH4A 4LBNA 4YARA 5L7OC 3E6CC 2E63A 2VMIA 3DF0A 1ND2C 3GNEA 4NR1A 1HRV1 1FOD2 2FZ1A 3OGJA 4BMBA 3RYPA 2GZWA 5T52A 2JE9A 4PDWB 2TBVA 1FYUA 2DURA 2YZ4A 4I09A 4ES9A 1S55A 4XF0A 3VBOC 2WLQA 4HZFA 1QHDA 5AVPA 2B46X 2OUHA 3SNMA 2ZX2A 3CO2A 2DU0A 1ZZCA 2ZPXA 3HAGA 4Q0UA 1AR63 1IS3A 2A3WA 3MLLA 5GLTA 1GSLA 4JTOA 5T5LA 2H6CA 4XBNA 4Q0PA 3AP7A 1RUC3 3M8LA 1CAUA 2ES3A 2ZHNA 1F2NA 1R1A1 4HK9A 3RSJA 5GKAC 3MLKA 5FLIA 2ZMLA 2HJIA 2VMGA 1Q8OA 1HXS1 1QGLA 1S1AA 1I6XA 3JZVA 1WCDJ 5F5QA 1S0FA 3EO6A 4EJRA 4YFZA 5E89A 4E27A 2JX9A 1I5ZA 4Y1UA 2CGPA 5BXXA 1DBNA 3AZZA 1R1A2 2BVBA 1GZCA 3AZXA 4QXKA 1NZCA 4NHKA 4IV3A 4A7YA 5GM0A 4CDQA 1MQTC 1NCRC 2FMDA 4QPYA 1VAVA 3BTAA 4WV8A 4XFFA 3UKNA 5CFCA 2JECA 3HWJA 2ZGQA 4XBLA 4WM8B 5TSWA 1BVP1 2D93A 4DRVA 4ISRA 1EY2A 4K20A 4A7ZA 4EN6B 5A3MA 4CDUC 1GZ9A 3VHNA 3C2UA 1J3QA 2Z69A 3RMYA 3AKQA 1LULA 4COZA 1W2UA 1DU3D 1BEV3 3H1YA 1W6OA 4N9IA 5BNNC 5BNOA 1CAWA 1A8MA 3IMNA 4HBNA 4S2GA 1JN2P 3AB0A 4D94A 2NP0A 1LU1A 4Q0SA 4DNYA 1VB2A 4P9IA 5A33B 1LEDA 1Q56A 3B93A 2RS13 4M00A 1W6PA 2CWSA 5JSRA 2VVEA 1VBB3 1JBCA 4HLTA 2DUPA 5ACA3 5JOYA 1AYN2 5F9TA 1QJZA 2D6KA 1FMD2 3VZLA 5C8CB 3N4MA 2HWB2 5I8SA 3JCIA 3N7LA 5C8CC 3BB6A 1H1AA 4IV1B 1ND3A 5LRRA 2SLIA 4XHBA 5C9AA 3V65A 1U0AA 1B35B 1WLDA 1SBDA 3MW3A 4LE4A 1QJU1 4AVBA 1YHFA 1PO13 4BCUA 2OZJA 2P3KA 1KDKA 1DQ5A 3ZFFB 3DN7A 3CL1A 3ILNA 5CIRA 4P14A 1N1YA 1H30A 4CEYA 3WXPA 2G9FA 4X8NA 4DRRA 3ZMNA 4Z8BA 1JHNA 1R092 2VU9A 3WX5A 2R072 4YGDA 2LUWA 4Q4X3 4GWMA 1NYWA 2WS91 4LBJA 1QQP1 2GNBA 4QX5A 1RUD3 1D2SA 1C8M3 1DGRA 1URXA 1LHNA 2Q4SA 3USUB 1OQ1A 1YWKA 4OI4A 4IEYA 1DQ6A 1YJKA 3I7DA 4FPHA 4CDUB 5AFEA 2BNNA 5T54A 1DDLA 1VBC1 4UBGA 5KWRA 1AJOA 1CAXA 3M3IA 4R9AA 1BK1A 1DHKB 4Z2WA 5IT6A 4AEJA 2Q30A 2YGLA 3THTA 2ZX1A 4YZ4A 1TME2 3VBFC 4QHBA 3FFQA 2QCSB 3ZYPA 1UZYA 2PLV1 2VVFA 5C4WC 1QJU2 1NLSA 3VBSB 3GHNA 4Q8LA 5FCCA 2K9ZA 2HEWF 1C57A 1JUHA 4QGMA 4FXKB 3ZFGA 3GHMA 4FP3A 2VOXA 1CVNA 1AHSA 2KM2A 4D7SA 1CESA 1Z0HA 2AREA 1K5MC 1S2BA 3WUDA 4FPFA 3ZDSA 5EJ3A 1AR81 3WQ1A 1VBE2 2EALA 2RS31 4OI0A 3OF1A 1LGBA 3G7DA 4EWAA 2W52A 5AC91 4CYDA 4AWDA 1WLTA 4ORFA 3ALQA 4WM8A 1QY4A 3DKWA 1RUE3 1SEFA 1JXNA 3FLTA 1OLRA 4I2OA 1R093 4CDQC 5KXBA 1AR82 4KQ7A 3GALA 1RUH2 4XZPA 2VUJA 1COV2 4QGLA 4M0NA 4XJWA 1DGLA 4M3CB 3RZZA 1V6JA 1NQJA 3SH5A 3OYWA 4CDXB 3IDEA 5HXVA 5BNPA 2Q8OA 4AHXA 4OI2A 1V00A 4G4FA 1RUF2 3A0NA 4URTA 1ASJ3 4QT6A 3TN91 4KGGA 4QU2A 4NPRA 2A75A 2K2SA 4MSVA 4PCRA 4WM7A 4QQOA 2ZCWA 1LRHA 1XRUA 4JAAA 1UU6A 5AC92 4I30A 1GNHA 5KHKA 3ZYRA 3MI8A 3ES1A 1U5IA 4CP2A 4YW5A 1LENA 1HX6A 5IUQA 1S0DA 4AI3A 2EXIA 3FX3A 2ZMKA 3GYDA 2P37A 1IHMA 2YDEA 1E57A 1LOFC 5L7OB 4IV3B 2R0HA 4MGYE 1ZBE1 5JLVA 4I3GA 2R1DA 3ZSLA 2MHFA 4RD7A 3ZN6A 4Q8KA 5H9RA 1B35A 4XOGA 3KZ4C 3BOWA 4D69A 4FOQA 3MW2A 1Z7S1 1ZRCA 1GLHA 4BYYA 1DZRA 1C8NA 2VOVA 3D0JA 1DQ0A 1LU2A 4LE3A 2W68A 3KT7A 4DY5A 1MVQA 1OKQA 4AGGA 3WG2A 3ROUA 3HIFA 3VBHA 4ITCA 4AFCA 1LR5A 3CJXA 1AR93 1SLTA 2QZ2A 4O9GA 3DGTA 2C1FA 2Y0OA 3KM5A 3BCWA 3WZ1A 1IQAA 2WA4A 1A3KA 5DZFA 4Y1XA 5KBFA 3ZSMA 4Y22A 4YLZA 3MFAA 3RI8A 2ZGUA 3PJQA 1HIXA 3V64A 2AH2A 2OPKA 1YI9A 3TWIA 5J96B 4QPGC 1AR71 1MS0A 2E7QA 1DIWA 2RM23 4N7IA 1FPN1 1SLLA 2XBO1 5JWPA 5JPMB 2JENA 4JRAA 1BXHA 1H9PA 4HVQA 2XLFA 2CGOA 5HI0A 1S0GA 2D40A 2QZ3A 3VBFB 1O3QA 5KHGA 1R082 4EN9B 4IETA 3R6SA 1VBD3 3ZFEA 5JSPA 5KC5A 3MICA 5FBZA 2XBO3 3KB5A 2ZGRA 4KH9A 1VAMA 2JEMA 2NPIA 1X8EA 4BM8A 1MEC2 2Y0IA 2AYHA 3SITA 3VGIA 1CX4A 4R9CA 5K0UA 3R0RA 3RS6A 3RG0A 1NXMA 1LOCA 2BW8A 4PF5A 4YGBA 4MV2A 3JBG1 1PVC2 2Q1ZB 3KSCA 5A32A 2H6BA 3NAPA 3AYEA 1RHI2 2DTWA 1RMU2 2UWAA 1REDA 5FMOS 4NHLA 1CAVB 4K1YA 4RR3A 1HQNA 3J26N 3OY8A 3T1MA 1UMZA 3AXEA 3DPRA 1NE4A 4KG0A 2CGNA 1VLNA