2UWJE

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
b'GSHMMTALETRLSVADGTHAAALRQRLQAALAECRRELARGACPERFQFLQQQARALEGGLGILSQLTED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 26
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2uwjE00
2WMMA 2B89A 2KIKA 2K3RA 1FC2C 4GOFA 5EFWB 1ZW0A 2OTKE 4JBZA 2R44A 5CBNA 4NPFX 3ZDMA 1OVRA 2KS1B 2SPZA 1Y47A 1OVVA 4GODA 2RKLA 5DJTB 2HR3A 1JM0A 2JWDA 4ZMDA 4HB1A 3S1KA 2P58A 4IOIH 4HKZH 1Q2NA 4BXLA 1NVOA 1OVUA 4EYYQ 1LT1A 2KUBA 2M0BA 1LP1A 5C39A 2KZJA 4GOEA 1BDCA 4K35A 1BDDA 1U7JA 3FXDA 1DEEG 1EDIA 4HJGH 3PH0A 2ZAEB 1ZXGA 3MZWB 3MHVA 2Q1KA 1JMBA 1MFTA 1LP1B 2KZIA 3FXEA 3QWOC 1X0TA 4NPDA 4ASWA 5CBOA 2I8DA 2LR2A 2LXCB 4ZNCA 1EDJA 1H0TA 2B88A 5K5GB 4ASVA 1EDKA 2M5AB 2QVAA 4NPEA 4WWIA 1S3JA 2UWJE 2M5AA 4KJMA 2KI7B 1SS1A 4CPGA 1U7MA 4K3AA 2B87B 1EC5A 2QRXA 3RGUA 1H0TB 4MN4C 2B87A 5DJUB 1EDLA 2LXBA
chains in the Genus database with same CATH superfamily
1LTBC 2E75B 1KQLA 4N78E 2RN0A 1GL2A 2IPPA 2OTKE 3CWBD 1T2KD 3II6A 2B9BA 1DX7A 5H2FE 5AW6B 2Z4EA 1ZRTE 1RHZB 1L0NJ 1Q82Q 2Z5HA 1BE3G 2WSEH 3B5NB 2E75D 1IFJA 2WSFJ 1SQXJ 1BCCE 4YXDC 3M0AA 2C0WA 1JOCA 3AEBC 1BDCA 5H2FH 2XU6A 2JR8A 3PH0A 1L0LK 2W27A 3EFFK 3H1JE 3V2PA 1FDIA 2CK3H 3P8CE 1AJYA 2JO1A 4RKUJ 2K9YA 4GT1A 1HVVA 2IX7C 2I8DA 1H0TA 1W2EA 2FYZA 1EDKA 4PD4H 1NTMD 1M1JA 1YYCA 3SWKA 1BGYG 2WT7B 3M0DA 1L0LE 1KQGB 3T97B 1N7LA 2QM8A 1VQNP 2WMMA 1BE3J 3LIDA 4GOFA 3RL0g 1JTHA 2E76B 5TJHA 1EZVE 3MTUE 3L72J 4L75A 3H1KJ 2ZT9C 3L74J 1S9KE 4AUWA 3HD7B 2I1JA 3L73G 4WBAA 1YJ9P 1J1DC 2P1JA 2RKLA 1FZCC 3AEDC 5KJ7A 1KD1Q 1WT6A 5APQA 1N2DC 4OGQC 4GIFA 1L4AD 1FJPA 4H0LC 2ZFCA 3GG2A 2PRRA 2WZ7A 4HH2A 1SQXD 3CMEP 3CD6P 4PV1D 1A02F 1M56D 5AW0B 5CMZA 1RH5B 3A7OA 1MFTA 3QWOC 2IBZE 1URQC 4NPDA 1XTCC 3C1LA 3AE6C 2FXOA 3PP5A 2HODA 4D6TE 4UB8E 1AVOA 3LW5J 1NJIQ 2W83C 3S9OA 3CCEP 3VP8A 1VQ5P 1S5LE 2W6AA 1IK9A 3CX5I 1T2KC 1OX3A 3R2PA 1IJDB 1OMIA 3HTKB 1RE4C 2PAJA 4U3FE 1YJWP 5APSA 1RQVA 5AW1B 1H0TB 1X22A 5TISH 1EDLA 1PIXA 3OJAB 3RL0D 3U1AA 1J1EC 3GHGC 2QSIA 3WMM0 1RE3C 3MIWA 4C7NB 2QIWA 3L72D 3Q5RA 3H1KD 4GODA 5KLVK 3L74D 1LWUA 2D2CB 1NU1K 1JTHB 1LTJA 2Z5IA 2AEJA 3KQGA 3RBXA 3AE1C 3SWYA 3H1IJ 3IN6A 2M0BA 2OYHA 1JY3P 1UIXA 1RY3A 3CCRP 3FXDA 1PPJD 1DEEG 1KB9E 1VL2A 2OGUA 3V2NA 1Y9BA 2WSFH 2J59M 1HTLC 5KLVE 3RK3C 1NU1E 2GUVA 1AVYA 5KAIH 3TGUG 1HJBA 5AVUB 1LTIC 4LGDE 2YKOA 1KFNA 1N7SB 2ZVNB 3GMAA 4CPGA 1SFCA 2K37A 3W67A 1FZFA 1M7LA 2B87A 1YIJP 2FFDC 4BRYA 3TF5A 4I2LC 2FXPA 4JYCA 5L8RJ 1L4AC 2KIKA 1FC2C 1LTSC 1N8RQ 3AE2C 1HJ0A 3AEGC 4PV1C 2ZYAA 1N73C 2OYIB 1MKMA 1VQKP 4JQ0D 3EWKA 1GK6A 2OQQA 3HE5A 3V2QA 3CXHE 3UIAA 4HB1A 1FZCA 2P58A 4DT0A 3H6PA 2ITAA 1BSNA 1P84D 1USEA 3TGUJ 1NKNA 1RF1C 2E74C 2KLUA 3H1ID 1BGYE 2KK7A 3H1HD 3CWBG 2VRSA 4W7YA 5BVZA 1FU1A 2Q1KA 2WSSH 1PV3A 5AVXB 1HGVA 1GDTA 2W6BA 2YMYA 3KZIH 1NH4A 3H1LE 4NPEA 2V4HA 2UWJE 1OW6A 3L73E 1M90Q 3V2RA 2PGDA 2O3JA 3LW5H 4MN4C 4GDOA 3CCQP 3HE4B 1ZMEC 4PJ0E 4B86A 5CCHA 3HUSA 1PP9E 3CX5D 4YTPC 2BEQD 3QH9A 2KNCB 1KYOE 2W90A 1KILD 2JKVA 2M3EA 1IFDA 3FWNA 5APWA 3VMAA 3PRJA 1JY3N 1OVRA 2KS1B 4BRYB 3GHGA 1NTMG 2Q3EA 1MZ9A 1KN7A 2A06D 2OARA 3MP7B 1YQ4C 3AECC 1VQ6P 4N3YB 1QLED 1AV1A 1JY2P 4BXLA 1M8OB 3BCCJ 2V7QH 2ZT9B 2YIUC 3L70J 5AVSB 1KTMA 1OW7A 3B4SA 1NTKJ 1J1DB 4U7JA 1TU3F 1FZCB 3MZWB 4TT3H 4OGQB 3FXEA 5GTHE 3CCMP 1G1IA 2FYUK 3KYQA 5K5GB 3SSUA 2ZXXA 3L71J 4I1LA 5GTIH 1UIIA 3CI9A 2KI7B 1H88A 2HLOA 1HF9A 1VQPP 1SQXG 4UB6E 2WT7A 3L75J 1KB9I 4H0LD 1URQB 5CCGC 4JYBA 3PTZA 3T97A 4WY4D 2KXPB 1CW5A 2FYUE 1HGZA 2RMZA 2P67A 4H44D 2Q5UA 3VOPA 2XDJA 3CX5H 5AW8B 4DZOA 3MUDA 3HD7A 2IYOA 5E79H 1K05A 3P8CD 1VQ7P 4IL6E 1N73A 1YHQP 3OAKA 1SQVJ 2N9YB 1J1EB 3TK1A 3GHGB 2KLVA 3O6QB 4K35A 1E79H 4JPZB 3BCCD 1R8EA 1S1CX 3G71P 3AEAC 3L70D 4IL6H 1NTKD 3L72G 3H1KG 3L74G 2KOGA 2IDBA 1NHLA 3USSA 1EZVD 2B88A 2R5DA 4ZKUA 4PD4E 1KILC 5CJ0A 4TLFA 5AVWB 2GM4A 3KDPB 1VF5D 1GW4A 3L71D 2E42A 3RK3B 1T8ZA 1FZBA 2H8PD 3HTKA 2N9BA 1PPJG 3EFGA 1YBKA 4DJGA 2AEMA 3CC4P 2K88A 3BRVB 3L75D 2WTYA 1JY2N 1S4XA 1RF0A 3A0BH 2Q7CA 3ZDMA 3RK3D 4C46A 1NAYA 1SLQA 4WB4A 1OFCX 3CWBE 2JEEA 3MD0A 1R5SA 3AEFC 4C7NA 3AE5C 1IFMA 3P32A 5AW5B 2QJYB 2FFDB 2G8YA 2FYNC 1L4AB 4L76A 3N7NA 1QGKB 1NOHA 3TYYA 1LT1A 3RK2D 2KZJA 2PFXA 1P84I 1SQVD 2CPSA 1U7JA 4PV1B 2XNXA 1N73B 3TNUA 2Y0CA 1ZXGA 2OTLP 2JDIH 3C8VA 1BSHA 1LTAC 3C9IA 3HRNA 3GF7A 4WVZA 2GA1A 2C0XA 4WY4C 3O8ZA 3BASA 4C7RA 1XTGB 3CCSP 4H44C 1E5WA 1RF1B 1LT9C 2N1TD 2YMKA 4L73A 3K5BA 1N7SA 2H89C 2IFMA 2JP3A 3H1IG 1VQ4P 1HBWA 3H1HG 2AXCA 1T3JA 4I7ZC 5TISE 2LXBA 5AVYB 4Z1MH 2B89A 3RL0B 1OIPA 1GL2D 2E74D 2NPSC 3V6IA 1L0NK 1VQLP 3B71A 2WPRA 1VQ8P 1EXIA 5AW4B 2O01N 1KB9D 2Q6QA 4I6MC 5BU5A 3W68A 1NU1D 1QL1A 2OYIA 1NTZJ 3H1LJ 5B66H 4EIJA 1X8YA 2BCCE 1GZLA 3ABVC 1Q2NA 2JWAA 2XNDH 1JY3O 1JCDA 1L0NE 1CZQA 1PL5A 3H25A 1HUCA 2O1JA 1LTGC 1VF5C 3GW6A 1AA0A 4AQRD 1SQQJ 1HH0A 1KORA 2YNYA 3MHVA 1PP9J 1SQXE 3IAOA 3M91A 3P8MC 1K73Q 5KAIE 1X0TA 3JSVC 4ASWA 2A06G 1YTZI 3FWLA 5CBOA 3H1HJ 3V4WA 2LXCB 2Y9YA 2YIUB 3B5NC 3TNUB 1FOSF 4H13D 1KC8Q 1S3JA 3Q2YA 4L74A 2QEXP 1KV4A 4JF7A 1VDFA 2GUSA 1FDOA 5KAFH 1OZHA 3NMDA 3HE4A 1VQ9P 1SQPJ 1YTZT 3AE7C 3A2AA 2R3SA 5B5EH 1ZR4A 1SQBJ 3RK2C 2R5BA 2KNCA 3G4SP 3PJSK 1QVFO 4PD4I 3I55P 1OVVA 2HYNA 2YXRB 2K9JB 3WUUA 1W2BO 4EDFA 5DJTB 1BE3E 2KS1A 3L35A 4KT0J 1DH3A 3L72E 3H1KE 1Y8AA 1DD4A 2WPQA 2QG4A 1CI6B 1NVOA 1NTZD 3H1LD 2DW3A 2KSEA 2N1TC 1BDDA 5CCGD 1MFZA 4QMAA 2H7HA 2HFED 2WSCJ 2XV5A 3GLMA 2MKVA 2K1AA 1SQQD 3L4FA 1FZEA 1PP9D 5AVVB 3KZIE 4Y99C 3G6EP 1K9MQ 1GL2C 1EZVI 1FS0E 4EI2A 3VYIA 2WSEJ 4W80A 1SS1A 3Q5SA 1U7MA 3RGUA 3BCCG 5DJUB 3L70G 3Q5PA 1L2PA 5AVQB 1URQA 2NZ2A 1NTKG 1IC2A 1Q86Q 3AEEC 1KILB 1JCCA 1J2JB 1Z56A 1SQPD 1EZVG 2L5GB 1BCCJ 1NGMB 2SPZA 2ZYDA 1RE4A 1SQBD 1Y47A 5KLIC 1S5LX 2HR3A 2JWDA 3L71G 2IBZI 4IOIH 3L36A 3H1JJ 1GK4A 1ZN5A 1OVUA 3CPWO 3VMYA 5BU8B 2LKMA 3L75G 5C39A 3O6QA 1M1JC 4H13C 1ZR2A 5APTA 2A45I 2WPSA 1EDIA 1RE3A 3M0DC 1LTTC 3H1IE 1JMBA 2FYNB 2H43A 3SWFA 2FYUD 2D2CC 2PP6A 1QEXA 3IF4A 1L0LJ 3M06A 5GTIE 2AEFA 4WWIA 1P84H 4R4MA 1FZGA 2BASA 1IFIA 3A0HH 1SQVG 4AYCA 2A45G 4RESB 2QRXA 1GMJA 3R4YA 4H0LB 4OWFA 4W7ZA 1LGHB 5APUA 3NXSA 4N78D 3JCUE 4WY4B 4YXWH 2HG5D 1G1JA 1KMIZ 2W6JH 5EFWB 3VMXA 4H44B 1LT9B 3E1RA 3D6ZA 1ZRTD 2L91A 3CX5E 2YKPA 4NPFX 1QL2A 1KILE 3A5TA 3VMZA 1NAFA 3JCUH 5E79E 4I7ZB 3BATA 1BCCD 1H8AA 3IR9A 3PLNA 4IFDK 2XZRA 2FFDA 3S1KA 2A06E 1OWAA 3VP9A 5AW2B 2WWWA 1L4AA 1Q90D 4GKGA 1GD2E 4PD4D 1LP1A 2KP8A 1R5LA 3WU2H 3H1JD 1GU5A 4D6TJ 3H32A 4HJGH 1T6AA 2R32A 1KFMA 2NPSD 3AE9C 1K04A 2ZXEB 3TGUE 1QX8A 3TSIA 1NU1G 4U3FJ 4ZNCA 3AE8C 4XA4A 3VN0A 2M5AB 2WSCH 1KQFB 1ZLLA 3EQ2A 4KHXA 1L0LD 1VF5B 5APXA 3Q1MA 1RF1A 2RH0A 1X9VA 2YKQA 2BCCJ 1QVGO 1LWUC 3E1IA 3P7KA 3U1CA 1EC5A 2FY8A 4O9BA 4A7PA 1LTJC 2Q3IA 3AE4C 2P10A 4RJTA 5CCHD 1JUNA 3CXHI 2Q9IA 1S9KD 2OTJP 1FJKA 1K8AQ 1ZW0A 2OYHC 3OA7A 1RQUA 2KB7P 3CC7P 3A0BE 5CBNA 4BWNA 5AW9B 3CCJP 4LLHA 2QA4P 2WITA 1JM0A 1X79B 3U59A 1IK7A 3B5ND 1Q7YQ 1NTKK 5KKZC 5KLVJ 1G2CB 3RK2B 1NU1J 4GOEA 2O01J 1SFCC 2WQYC 2QJKC 2IBZD 2ZAEB 2MJZA 2OYOA 2Y0DA 1IFNA 3BCCE 1IO4A 4D6TD 1LP1B 1S2EA 2KZIA 3L70E 3G9RA 1NTKE 4M3LA 3H32B 2R3CA 2KSJA 1PGPA 2QJPC 1KYOI 2N1TB 4U3FD 3E7KA 1NTMK 4OVNF 1WMKA 1NTZG 3H1LG 1N86A 4DCKA 4EOTA 1SP4A 3MGNA 1FZAA 2I1KA 4YPCA 3L71E 2BCCD 2CPBA 3BRTB 4Y99B 3D71A 3SFEC 1GL2B 2KYVA 2E74B 1AQ5A 1SQQG 1L0ND 2E76D 1PP9G 3L75E 2R44A 1NTME 3HD7D 1SQVK 2IYPA 2POHA 2AXTE 3N4XA 3KPEA 3RK3E 2K9JA 1FAVA 5CCGA 4DOJA 2WVRA 5B66E 1BGYJ 4RO0A 2E43A 2P2UA 2C9LY 1CI6A 2G3AA 3WUTA 1DEBA 2WPVB 5KLVD 1SQXK 5AVZB 2AXTH 5KLIB 1FE6A 1SQPG 1SQVE 3D6YA 3FGAD 1PFIA 1AQTA 1SQBG 3L73J 5CCHC 1M57D 3HUSC 4UB8H 1EDJA 3CCUP 3JC22 2E75C 4IL6X 1M1JB 4H13B 1S5LH 2JJLA 1NKZB 2A45H 1BE3D 4LC1A 2ZJSE 1U57A 5KAFE 2V7QJ 1YJNP 5AVTB 3CLQA 3CMAP 5B5EE 2J5UA 2BEZF 2FYUG 4JBZA 1CSBA 1YITP 3CL3D 3M9QA 1KILA 1PGQA 1LNQA 1JNMA 2QE7H 3CXHD 1FOSE 5AW3B 2H88C 2D2CD 1NYHA 1JMMA 3V5BA 3AE3C 1BGYD 1AFOA 1GTWA 5KJ7D 5APYA 2P7JA 2IZ0A 3LIEA 1KB9H 3L37A 5AVRB 2YO3A 3L74E 1PGJA 1ZP0C 3BVHA 2HODB 2FXMA 3ITKA 2E5TA 3D70A 2QJYC 1BCCG 2LR2A 2O01H 3M9BA 2M8RA 1Q81Q 3L73D 3CC2P 2E76C 1YI2P 3RBZA 1N7SD 4KJMA 4HYTB 3MUDC 2FYUJ 1M1KQ 3HD7C 1PPJE 3Q3DA 3H1JG 2J58A 1KYOD 3TDKA 1GW3A 4WY4A 1YQ3C 1KZUB 1T3UA 1VPCA 1USDA 2O1KA 2HPCA 1LT9A 3G3ZA 1NTZK 1LWUB 3M9HA 4IFFA 1LJ2A 1LTJB 1VQOP 1L0LG 3F89A 1JEKA 4OH8B 2YXQB 3CXHH 3V4QA 3S4RA 2YO2A 4HKZH 3F5HA 1SQQK 2OYHB 3KHUA 1VQMP 2KUBA 2NPSA 1NWQA 1OW8A 3RL0C 4IFMA 1EXJA 1NTZE 2FBWC 1FDMA 3A3YB 5AW7B 4ZKPA 2Y0EA 1JY2O 1GU4A 1DIPA 5KKZB 5CJ4A 1SQQE 2QVAA 4Y28J 1P84E 1RF0C 5M1BA 1FBMA 1SFCB 2QJKB 2M5AA 1OXZA 3NFQA 3A0HE 3KXDA 1SQPK 1S72P 1ZV8A 2M3BA 3B8EB 3GF3A 4K3AA 2B87B 3H1HE 3WUVA 2C9NY 1SQBK 2IBZG 3I56P 4PJ0H 4D6TG 3CWBJ 2QJPB 2K3RA 1NO4A 5CHXA 1SVFA 1SFCD 1KYOH 3B5NA 2FKWB 3IFMA 1ZOYC 1JO5A 1W5CE 3CCLP 5KJ7C 2QM7A 4U3FG 4XFJA 2IFNA 1SQPE 1HWTC 3HE5B 1DD3A 3TGUD 4ZMDA 1SQBE 2E5YA 3NTNA 2HPCB 4N6JA 1IFPA 2BCCG 3VTPC 1MUUA 3SFDC 3OW2O 4EYYQ 2ZT9D 1G2CA 1PZQA 3WU2E 2XKMA 1L0NG 2Y9ZA 1N7SC 2ZVOB 4R4LA 2IZ1A 3CCVP 3I5CA 3FX0A 2NPSB 1IZNB 4OGQD 2NRGA 5GTHH 1KQSO 1D7MA 1NTMJ 1WRGA 2ZYGA 5APVA 4ASVA 1JB0J 2W8ZA 4XE5B 1A02J 2N1TA 3PHLA 5KTBA 5KLVG 4UB6H 1MV8A 2OYIC 1PGOA 1EQ7A 1URQD 1H89A 3HUSB
chains in the Genus database with same CATH topology
2WMMA 2B89A 2KIKA 2K3RA 1FC2C 4GOFA 5EFWB 1ZW0A 2OTKE 4JBZA 2R44A 5CBNA 4NPFX 3ZDMA 1OVRA 2KS1B 2SPZA 1Y47A 1OVVA 4GODA 2RKLA 5DJTB 2HR3A 1JM0A 2JWDA 4ZMDA 4HB1A 3S1KA 2P58A 4IOIH 4HKZH 1Q2NA 4BXLA 1NVOA 1OVUA 4EYYQ 1LT1A 2KUBA 2M0BA 1LP1A 5C39A 2KZJA 4GOEA 1BDCA 4K35A 1BDDA 1U7JA 3FXDA 1DEEG 1EDIA 4HJGH 3PH0A 2ZAEB 1ZXGA 3MZWB 3MHVA 2Q1KA 1JMBA 1MFTA 1LP1B 2KZIA 3FXEA 3QWOC 1X0TA 4NPDA 4ASWA 5CBOA 2I8DA 2LR2A 2LXCB 4ZNCA 1EDJA 1H0TA 2B88A 5K5GB 4ASVA 1EDKA 2M5AB 2QVAA 4NPEA 4WWIA 1S3JA 2UWJE 2M5AA 4KJMA 2KI7B 1SS1A 4CPGA 1U7MA 4K3AA 2B87B 1EC5A 2QRXA 3RGUA 1H0TB 4MN4C 2B87A 5DJUB 1EDLA 2LXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMM A;  2B89 A;  2KIK A;  2K3R A;  1FC2 C;  4GOF A;  5EFW B;  1ZW0 A;  2OTK E;  4JBZ A;  2R44 A;  5CBN A;  4NPF X;  3ZDM A;  1OVR A;  2KS1 B;  2SPZ A;  1Y47 A;  1OVV A;  4GOD A;  2RKL A;  5DJT B;  2HR3 A;  1JM0 A;  2JWD A;  4ZMD A;  4HB1 A;  3S1K A;  2P58 A;  4IOI H;  4HKZ H;  1Q2N A;  4BXL A;  1NVO A;  1OVU A;  4EYY Q;  1LT1 A;  2KUB A;  2M0B A;  1LP1 A;  5C39 A;  2KZJ A;  4GOE A;  1BDC A;  4K35 A;  1BDD A;  1U7J A;  3FXD A;  1DEE G;  1EDI A;  4HJG H;  3PH0 A;  2ZAE B;  1ZXG A;  3MZW B;  3MHV A;  2Q1K A;  1JMB A;  1MFT A;  1LP1 B;  2KZI A;  3FXE A;  3QWO C;  1X0T A;  4NPD A;  4ASW A;  5CBO A;  2I8D A;  2LR2 A;  2LXC B;  4ZNC A;  1EDJ A;  1H0T A;  2B88 A;  5K5G B;  4ASV A;  1EDK A;  2M5A B;  2QVA A;  4NPE A;  4WWI A;  1S3J A;  2UWJ E;  2M5A A;  4KJM A;  2KI7 B;  1SS1 A;  4CPG A;  1U7M A;  4K3A A;  2B87 B;  1EC5 A;  2QRX A;  3RGU A;  1H0T B;  4MN4 C;  2B87 A;  5DJU B;  1EDL A;  2LXB A; 
#chains in the Genus database with same CATH topology
 1LTB C;  2E75 B;  1KQL A;  4N78 E;  2RN0 A;  1GL2 A;  2IPP A;  2OTK E;  3CWB D;  1T2K D;  3II6 A;  2B9B A;  1DX7 A;  5H2F E;  5AW6 B;  2Z4E A;  1ZRT E;  1RHZ B;  1L0N J;  1Q82 Q;  2Z5H A;  1BE3 G;  2WSE H;  3B5N B;  2E75 D;  1IFJ A;  2WSF J;  1SQX J;  1BCC E;  4YXD C;  3M0A A;  2C0W A;  1JOC A;  3AEB C;  1BDC A;  5H2F H;  2XU6 A;  2JR8 A;  3PH0 A;  1L0L K;  2W27 A;  3EFF K;  3H1J E;  3V2P A;  1FDI A;  2CK3 H;  3P8C E;  1AJY A;  2JO1 A;  4RKU J;  2K9Y A;  4GT1 A;  1HVV A;  2IX7 C;  2I8D A;  1H0T A;  1W2E A;  2FYZ A;  1EDK A;  4PD4 H;  1NTM D;  1M1J A;  1YYC A;  3SWK A;  1BGY G;  2WT7 B;  3M0D A;  1L0L E;  1KQG B;  3T97 B;  1N7L A;  2QM8 A;  1VQN P;  2WMM A;  1BE3 J;  3LID A;  4GOF A;  3RL0 g;  1JTH A;  2E76 B;  5TJH A;  1EZV E;  3MTU E;  3L72 J;  4L75 A;  3H1K J;  2ZT9 C;  3L74 J;  1S9K E;  4AUW A;  3HD7 B;  2I1J A;  3L73 G;  4WBA A;  1YJ9 P;  1J1D C;  2P1J A;  2RKL A;  1FZC C;  3AED C;  5KJ7 A;  1KD1 Q;  1WT6 A;  5APQ A;  1N2D C;  4OGQ C;  4GIF A;  1L4A D;  1FJP A;  4H0L C;  2ZFC A;  3GG2 A;  2PRR A;  2WZ7 A;  4HH2 A;  1SQX D;  3CME P;  3CD6 P;  4PV1 D;  1A02 F;  1M56 D;  5AW0 B;  5CMZ A;  1RH5 B;  3A7O A;  1MFT A;  3QWO C;  2IBZ E;  1URQ C;  4NPD A;  1XTC C;  3C1L A;  3AE6 C;  2FXO A;  3PP5 A;  2HOD A;  4D6T E;  4UB8 E;  1AVO A;  3LW5 J;  1NJI Q;  2W83 C;  3S9O A;  3CCE P;  3VP8 A;  1VQ5 P;  1S5L E;  2W6A A;  1IK9 A;  3CX5 I;  1T2K C;  1OX3 A;  3R2P A;  1IJD B;  1OMI A;  3HTK B;  1RE4 C;  2PAJ A;  4U3F E;  1YJW P;  5APS A;  1RQV A;  5AW1 B;  1H0T B;  1X22 A;  5TIS H;  1EDL A;  1PIX A;  3OJA B;  3RL0 D;  3U1A A;  1J1E C;  3GHG C;  2QSI A;  3WMM 0;  1RE3 C;  3MIW A;  4C7N B;  2QIW A;  3L72 D;  3Q5R A;  3H1K D;  4GOD A;  5KLV K;  3L74 D;  1LWU A;  2D2C B;  1NU1 K;  1JTH B;  1LTJ A;  2Z5I A;  2AEJ A;  3KQG A;  3RBX A;  3AE1 C;  3SWY A;  3H1I J;  3IN6 A;  2M0B A;  2OYH A;  1JY3 P;  1UIX A;  1RY3 A;  3CCR P;  3FXD A;  1PPJ D;  1DEE G;  1KB9 E;  1VL2 A;  2OGU A;  3V2N A;  1Y9B A;  2WSF H;  2J59 M;  1HTL C;  5KLV E;  3RK3 C;  1NU1 E;  2GUV A;  1AVY A;  5KAI H;  3TGU G;  1HJB A;  5AVU B;  1LTI C;  4LGD E;  2YKO A;  1KFN A;  1N7S B;  2ZVN B;  3GMA A;  4CPG A;  1SFC A;  2K37 A;  3W67 A;  1FZF A;  1M7L A;  2B87 A;  1YIJ P;  2FFD C;  4BRY A;  3TF5 A;  4I2L C;  2FXP A;  4JYC A;  5L8R J;  1L4A C;  2KIK A;  1FC2 C;  1LTS C;  1N8R Q;  3AE2 C;  1HJ0 A;  3AEG C;  4PV1 C;  2ZYA A;  1N73 C;  2OYI B;  1MKM A;  1VQK P;  4JQ0 D;  3EWK A;  1GK6 A;  2OQQ A;  3HE5 A;  3V2Q A;  3CXH E;  3UIA A;  4HB1 A;  1FZC A;  2P58 A;  4DT0 A;  3H6P A;  2ITA A;  1BSN A;  1P84 D;  1USE A;  3TGU J;  1NKN A;  1RF1 C;  2E74 C;  2KLU A;  3H1I D;  1BGY E;  2KK7 A;  3H1H D;  3CWB G;  2VRS A;  4W7Y A;  5BVZ A;  1FU1 A;  2Q1K A;  2WSS H;  1PV3 A;  5AVX B;  1HGV A;  1GDT A;  2W6B A;  2YMY A;  3KZI H;  1NH4 A;  3H1L E;  4NPE A;  2V4H A;  2UWJ E;  1OW6 A;  3L73 E;  1M90 Q;  3V2R A;  2PGD A;  2O3J A;  3LW5 H;  4MN4 C;  4GDO A;  3CCQ P;  3HE4 B;  1ZME C;  4PJ0 E;  4B86 A;  5CCH A;  3HUS A;  1PP9 E;  3CX5 D;  4YTP C;  2BEQ D;  3QH9 A;  2KNC B;  1KYO E;  2W90 A;  1KIL D;  2JKV A;  2M3E A;  1IFD A;  3FWN A;  5APW A;  3VMA A;  3PRJ A;  1JY3 N;  1OVR A;  2KS1 B;  4BRY B;  3GHG A;  1NTM G;  2Q3E A;  1MZ9 A;  1KN7 A;  2A06 D;  2OAR A;  3MP7 B;  1YQ4 C;  3AEC C;  1VQ6 P;  4N3Y B;  1QLE D;  1AV1 A;  1JY2 P;  4BXL A;  1M8O B;  3BCC J;  2V7Q H;  2ZT9 B;  2YIU C;  3L70 J;  5AVS B;  1KTM A;  1OW7 A;  3B4S A;  1NTK J;  1J1D B;  4U7J A;  1TU3 F;  1FZC B;  3MZW B;  4TT3 H;  4OGQ B;  3FXE A;  5GTH E;  3CCM P;  1G1I A;  2FYU K;  3KYQ A;  5K5G B;  3SSU A;  2ZXX A;  3L71 J;  4I1L A;  5GTI H;  1UII A;  3CI9 A;  2KI7 B;  1H88 A;  2HLO A;  1HF9 A;  1VQP P;  1SQX G;  4UB6 E;  2WT7 A;  3L75 J;  1KB9 I;  4H0L D;  1URQ B;  5CCG C;  4JYB A;  3PTZ A;  3T97 A;  4WY4 D;  2KXP B;  1CW5 A;  2FYU E;  1HGZ A;  2RMZ A;  2P67 A;  4H44 D;  2Q5U A;  3VOP A;  2XDJ A;  3CX5 H;  5AW8 B;  4DZO A;  3MUD A;  3HD7 A;  2IYO A;  5E79 H;  1K05 A;  3P8C D;  1VQ7 P;  4IL6 E;  1N73 A;  1YHQ P;  3OAK A;  1SQV J;  2N9Y B;  1J1E B;  3TK1 A;  3GHG B;  2KLV A;  3O6Q B;  4K35 A;  1E79 H;  4JPZ B;  3BCC D;  1R8E A;  1S1C X;  3G71 P;  3AEA C;  3L70 D;  4IL6 H;  1NTK D;  3L72 G;  3H1K G;  3L74 G;  2KOG A;  2IDB A;  1NHL A;  3USS A;  1EZV D;  2B88 A;  2R5D A;  4ZKU A;  4PD4 E;  1KIL C;  5CJ0 A;  4TLF A;  5AVW B;  2GM4 A;  3KDP B;  1VF5 D;  1GW4 A;  3L71 D;  2E42 A;  3RK3 B;  1T8Z A;  1FZB A;  2H8P D;  3HTK A;  2N9B A;  1PPJ G;  3EFG A;  1YBK A;  4DJG A;  2AEM A;  3CC4 P;  2K88 A;  3BRV B;  3L75 D;  2WTY A;  1JY2 N;  1S4X A;  1RF0 A;  3A0B H;  2Q7C A;  3ZDM A;  3RK3 D;  4C46 A;  1NAY A;  1SLQ A;  4WB4 A;  1OFC X;  3CWB E;  2JEE A;  3MD0 A;  1R5S A;  3AEF C;  4C7N A;  3AE5 C;  1IFM A;  3P32 A;  5AW5 B;  2QJY B;  2FFD B;  2G8Y A;  2FYN C;  1L4A B;  4L76 A;  3N7N A;  1QGK B;  1NOH A;  3TYY A;  1LT1 A;  3RK2 D;  2KZJ A;  2PFX A;  1P84 I;  1SQV D;  2CPS A;  1U7J A;  4PV1 B;  2XNX A;  1N73 B;  3TNU A;  2Y0C A;  1ZXG A;  2OTL P;  2JDI H;  3C8V A;  1BSH A;  1LTA C;  3C9I A;  3HRN A;  3GF7 A;  4WVZ A;  2GA1 A;  2C0X A;  4WY4 C;  3O8Z A;  3BAS A;  4C7R A;  1XTG B;  3CCS P;  4H44 C;  1E5W A;  1RF1 B;  1LT9 C;  2N1T D;  2YMK A;  4L73 A;  3K5B A;  1N7S A;  2H89 C;  2IFM A;  2JP3 A;  3H1I G;  1VQ4 P;  1HBW A;  3H1H G;  2AXC A;  1T3J A;  4I7Z C;  5TIS E;  2LXB A;  5AVY B;  4Z1M H;  2B89 A;  3RL0 B;  1OIP A;  1GL2 D;  2E74 D;  2NPS C;  3V6I A;  1L0N K;  1VQL P;  3B71 A;  2WPR A;  1VQ8 P;  1EXI A;  5AW4 B;  2O01 N;  1KB9 D;  2Q6Q A;  4I6M C;  5BU5 A;  3W68 A;  1NU1 D;  1QL1 A;  2OYI A;  1NTZ J;  3H1L J;  5B66 H;  4EIJ A;  1X8Y A;  2BCC E;  1GZL A;  3ABV C;  1Q2N A;  2JWA A;  2XND H;  1JY3 O;  1JCD A;  1L0N E;  1CZQ A;  1PL5 A;  3H25 A;  1HUC A;  2O1J A;  1LTG C;  1VF5 C;  3GW6 A;  1AA0 A;  4AQR D;  1SQQ J;  1HH0 A;  1KOR A;  2YNY A;  3MHV A;  1PP9 J;  1SQX E;  3IAO A;  3M91 A;  3P8M C;  1K73 Q;  5KAI E;  1X0T A;  3JSV C;  4ASW A;  2A06 G;  1YTZ I;  3FWL A;  5CBO A;  3H1H J;  3V4W A;  2LXC B;  2Y9Y A;  2YIU B;  3B5N C;  3TNU B;  1FOS F;  4H13 D;  1KC8 Q;  1S3J A;  3Q2Y A;  4L74 A;  2QEX P;  1KV4 A;  4JF7 A;  1VDF A;  2GUS A;  1FDO A;  5KAF H;  1OZH A;  3NMD A;  3HE4 A;  1VQ9 P;  1SQP J;  1YTZ T;  3AE7 C;  3A2A A;  2R3S A;  5B5E H;  1ZR4 A;  1SQB J;  3RK2 C;  2R5B A;  2KNC A;  3G4S P;  3PJS K;  1QVF O;  4PD4 I;  3I55 P;  1OVV A;  2HYN A;  2YXR B;  2K9J B;  3WUU A;  1W2B O;  4EDF A;  5DJT B;  1BE3 E;  2KS1 A;  3L35 A;  4KT0 J;  1DH3 A;  3L72 E;  3H1K E;  1Y8A A;  1DD4 A;  2WPQ A;  2QG4 A;  1CI6 B;  1NVO A;  1NTZ D;  3H1L D;  2DW3 A;  2KSE A;  2N1T C;  1BDD A;  5CCG D;  1MFZ A;  4QMA A;  2H7H A;  2HFE D;  2WSC J;  2XV5 A;  3GLM A;  2MKV A;  2K1A A;  1SQQ D;  3L4F A;  1FZE A;  1PP9 D;  5AVV B;  3KZI E;  4Y99 C;  3G6E P;  1K9M Q;  1GL2 C;  1EZV I;  1FS0 E;  4EI2 A;  3VYI A;  2WSE J;  4W80 A;  1SS1 A;  3Q5S A;  1U7M A;  3RGU A;  3BCC G;  5DJU B;  3L70 G;  3Q5P A;  1L2P A;  5AVQ B;  1URQ A;  2NZ2 A;  1NTK G;  1IC2 A;  1Q86 Q;  3AEE C;  1KIL B;  1JCC A;  1J2J B;  1Z56 A;  1SQP D;  1EZV G;  2L5G B;  1BCC J;  1NGM B;  2SPZ A;  2ZYD A;  1RE4 A;  1SQB D;  1Y47 A;  5KLI C;  1S5L X;  2HR3 A;  2JWD A;  3L71 G;  2IBZ I;  4IOI H;  3L36 A;  3H1J J;  1GK4 A;  1ZN5 A;  1OVU A;  3CPW O;  3VMY A;  5BU8 B;  2LKM A;  3L75 G;  5C39 A;  3O6Q A;  1M1J C;  4H13 C;  1ZR2 A;  5APT A;  2A45 I;  2WPS A;  1EDI A;  1RE3 A;  3M0D C;  1LTT C;  3H1I E;  1JMB A;  2FYN B;  2H43 A;  3SWF A;  2FYU D;  2D2C C;  2PP6 A;  1QEX A;  3IF4 A;  1L0L J;  3M06 A;  5GTI E;  2AEF A;  4WWI A;  1P84 H;  4R4M A;  1FZG A;  2BAS A;  1IFI A;  3A0H H;  1SQV G;  4AYC A;  2A45 G;  4RES B;  2QRX A;  1GMJ A;  3R4Y A;  4H0L B;  4OWF A;  4W7Z A;  1LGH B;  5APU A;  3NXS A;  4N78 D;  3JCU E;  4WY4 B;  4YXW H;  2HG5 D;  1G1J A;  1KMI Z;  2W6J H;  5EFW B;  3VMX A;  4H44 B;  1LT9 B;  3E1R A;  3D6Z A;  1ZRT D;  2L91 A;  3CX5 E;  2YKP A;  4NPF X;  1QL2 A;  1KIL E;  3A5T A;  3VMZ A;  1NAF A;  3JCU H;  5E79 E;  4I7Z B;  3BAT A;  1BCC D;  1H8A A;  3IR9 A;  3PLN A;  4IFD K;  2XZR A;  2FFD A;  3S1K A;  2A06 E;  1OWA A;  3VP9 A;  5AW2 B;  2WWW A;  1L4A A;  1Q90 D;  4GKG A;  1GD2 E;  4PD4 D;  1LP1 A;  2KP8 A;  1R5L A;  3WU2 H;  3H1J D;  1GU5 A;  4D6T J;  3H32 A;  4HJG H;  1T6A A;  2R32 A;  1KFM A;  2NPS D;  3AE9 C;  1K04 A;  2ZXE B;  3TGU E;  1QX8 A;  3TSI A;  1NU1 G;  4U3F J;  4ZNC A;  3AE8 C;  4XA4 A;  3VN0 A;  2M5A B;  2WSC H;  1KQF B;  1ZLL A;  3EQ2 A;  4KHX A;  1L0L D;  1VF5 B;  5APX A;  3Q1M A;  1RF1 A;  2RH0 A;  1X9V A;  2YKQ A;  2BCC J;  1QVG O;  1LWU C;  3E1I A;  3P7K A;  3U1C A;  1EC5 A;  2FY8 A;  4O9B A;  4A7P A;  1LTJ C;  2Q3I A;  3AE4 C;  2P10 A;  4RJT A;  5CCH D;  1JUN A;  3CXH I;  2Q9I A;  1S9K D;  2OTJ P;  1FJK A;  1K8A Q;  1ZW0 A;  2OYH C;  3OA7 A;  1RQU A;  2KB7 P;  3CC7 P;  3A0B E;  5CBN A;  4BWN A;  5AW9 B;  3CCJ P;  4LLH A;  2QA4 P;  2WIT A;  1JM0 A;  1X79 B;  3U59 A;  1IK7 A;  3B5N D;  1Q7Y Q;  1NTK K;  5KKZ C;  5KLV J;  1G2C B;  3RK2 B;  1NU1 J;  4GOE A;  2O01 J;  1SFC C;  2WQY C;  2QJK C;  2IBZ D;  2ZAE B;  2MJZ A;  2OYO A;  2Y0D A;  1IFN A;  3BCC E;  1IO4 A;  4D6T D;  1LP1 B;  1S2E A;  2KZI A;  3L70 E;  3G9R A;  1NTK E;  4M3L A;  3H32 B;  2R3C A;  2KSJ A;  1PGP A;  2QJP C;  1KYO I;  2N1T B;  4U3F D;  3E7K A;  1NTM K;  4OVN F;  1WMK A;  1NTZ G;  3H1L G;  1N86 A;  4DCK A;  4EOT A;  1SP4 A;  3MGN A;  1FZA A;  2I1K A;  4YPC A;  3L71 E;  2BCC D;  2CPB A;  3BRT B;  4Y99 B;  3D71 A;  3SFE C;  1GL2 B;  2KYV A;  2E74 B;  1AQ5 A;  1SQQ G;  1L0N D;  2E76 D;  1PP9 G;  3L75 E;  2R44 A;  1NTM E;  3HD7 D;  1SQV K;  2IYP A;  2POH A;  2AXT E;  3N4X A;  3KPE A;  3RK3 E;  2K9J A;  1FAV A;  5CCG A;  4DOJ A;  2WVR A;  5B66 E;  1BGY J;  4RO0 A;  2E43 A;  2P2U A;  2C9L Y;  1CI6 A;  2G3A A;  3WUT A;  1DEB A;  2WPV B;  5KLV D;  1SQX K;  5AVZ B;  2AXT H;  5KLI B;  1FE6 A;  1SQP G;  1SQV E;  3D6Y A;  3FGA D;  1PFI A;  1AQT A;  1SQB G;  3L73 J;  5CCH C;  1M57 D;  3HUS C;  4UB8 H;  1EDJ A;  3CCU P;  3JC2 2;  2E75 C;  4IL6 X;  1M1J B;  4H13 B;  1S5L H;  2JJL A;  1NKZ B;  2A45 H;  1BE3 D;  4LC1 A;  2ZJS E;  1U57 A;  5KAF E;  2V7Q J;  1YJN P;  5AVT B;  3CLQ A;  3CMA P;  5B5E E;  2J5U A;  2BEZ F;  2FYU G;  4JBZ A;  1CSB A;  1YIT P;  3CL3 D;  3M9Q A;  1KIL A;  1PGQ A;  1LNQ A;  1JNM A;  2QE7 H;  3CXH D;  1FOS E;  5AW3 B;  2H88 C;  2D2C D;  1NYH A;  1JMM A;  3V5B A;  3AE3 C;  1BGY D;  1AFO A;  1GTW A;  5KJ7 D;  5APY A;  2P7J A;  2IZ0 A;  3LIE A;  1KB9 H;  3L37 A;  5AVR B;  2YO3 A;  3L74 E;  1PGJ A;  1ZP0 C;  3BVH A;  2HOD B;  2FXM A;  3ITK A;  2E5T A;  3D70 A;  2QJY C;  1BCC G;  2LR2 A;  2O01 H;  3M9B A;  2M8R A;  1Q81 Q;  3L73 D;  3CC2 P;  2E76 C;  1YI2 P;  3RBZ A;  1N7S D;  4KJM A;  4HYT B;  3MUD C;  2FYU J;  1M1K Q;  3HD7 C;  1PPJ E;  3Q3D A;  3H1J G;  2J58 A;  1KYO D;  3TDK A;  1GW3 A;  4WY4 A;  1YQ3 C;  1KZU B;  1T3U A;  1VPC A;  1USD A;  2O1K A;  2HPC A;  1LT9 A;  3G3Z A;  1NTZ K;  1LWU B;  3M9H A;  4IFF A;  1LJ2 A;  1LTJ B;  1VQO P;  1L0L G;  3F89 A;  1JEK A;  4OH8 B;  2YXQ B;  3CXH H;  3V4Q A;  3S4R A;  2YO2 A;  4HKZ H;  3F5H A;  1SQQ K;  2OYH B;  3KHU A;  1VQM P;  2KUB A;  2NPS A;  1NWQ A;  1OW8 A;  3RL0 C;  4IFM A;  1EXJ A;  1NTZ E;  2FBW C;  1FDM A;  3A3Y B;  5AW7 B;  4ZKP A;  2Y0E A;  1JY2 O;  1GU4 A;  1DIP A;  5KKZ B;  5CJ4 A;  1SQQ E;  2QVA A;  4Y28 J;  1P84 E;  1RF0 C;  5M1B A;  1FBM A;  1SFC B;  2QJK B;  2M5A A;  1OXZ A;  3NFQ A;  3A0H E;  3KXD A;  1SQP K;  1S72 P;  1ZV8 A;  2M3B A;  3B8E B;  3GF3 A;  4K3A A;  2B87 B;  3H1H E;  3WUV A;  2C9N Y;  1SQB K;  2IBZ G;  3I56 P;  4PJ0 H;  4D6T G;  3CWB J;  2QJP B;  2K3R A;  1NO4 A;  5CHX A;  1SVF A;  1SFC D;  1KYO H;  3B5N A;  2FKW B;  3IFM A;  1ZOY C;  1JO5 A;  1W5C E;  3CCL P;  5KJ7 C;  2QM7 A;  4U3F G;  4XFJ A;  2IFN A;  1SQP E;  1HWT C;  3HE5 B;  1DD3 A;  3TGU D;  4ZMD A;  1SQB E;  2E5Y A;  3NTN A;  2HPC B;  4N6J A;  1IFP A;  2BCC G;  3VTP C;  1MUU A;  3SFD C;  3OW2 O;  4EYY Q;  2ZT9 D;  1G2C A;  1PZQ A;  3WU2 E;  2XKM A;  1L0N G;  2Y9Z A;  1N7S C;  2ZVO B;  4R4L A;  2IZ1 A;  3CCV P;  3I5C A;  3FX0 A;  2NPS B;  1IZN B;  4OGQ D;  2NRG A;  5GTH H;  1KQS O;  1D7M A;  1NTM J;  1WRG A;  2ZYG A;  5APV A;  4ASV A;  1JB0 J;  2W8Z A;  4XE5 B;  1A02 J;  2N1T A;  3PHL A;  5KTB A;  5KLV G;  4UB6 H;  1MV8 A;  2OYI C;  1PGO A;  1EQ7 A;  1URQ D;  1H89 A;  3HUS B; 
#chains in the Genus database with same CATH homology
 2WMM A;  2B89 A;  2KIK A;  2K3R A;  1FC2 C;  4GOF A;  5EFW B;  1ZW0 A;  2OTK E;  4JBZ A;  2R44 A;  5CBN A;  4NPF X;  3ZDM A;  1OVR A;  2KS1 B;  2SPZ A;  1Y47 A;  1OVV A;  4GOD A;  2RKL A;  5DJT B;  2HR3 A;  1JM0 A;  2JWD A;  4ZMD A;  4HB1 A;  3S1K A;  2P58 A;  4IOI H;  4HKZ H;  1Q2N A;  4BXL A;  1NVO A;  1OVU A;  4EYY Q;  1LT1 A;  2KUB A;  2M0B A;  1LP1 A;  5C39 A;  2KZJ A;  4GOE A;  1BDC A;  4K35 A;  1BDD A;  1U7J A;  3FXD A;  1DEE G;  1EDI A;  4HJG H;  3PH0 A;  2ZAE B;  1ZXG A;  3MZW B;  3MHV A;  2Q1K A;  1JMB A;  1MFT A;  1LP1 B;  2KZI A;  3FXE A;  3QWO C;  1X0T A;  4NPD A;  4ASW A;  5CBO A;  2I8D A;  2LR2 A;  2LXC B;  4ZNC A;  1EDJ A;  1H0T A;  2B88 A;  5K5G B;  4ASV A;  1EDK A;  2M5A B;  2QVA A;  4NPE A;  4WWI A;  1S3J A;  2UWJ E;  2M5A A;  4KJM A;  2KI7 B;  1SS1 A;  4CPG A;  1U7M A;  4K3A A;  2B87 B;  1EC5 A;  2QRX A;  3RGU A;  1H0T B;  4MN4 C;  2B87 A;  5DJU B;  1EDL A;  2LXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...