2UWJE

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
GSHMMTALETRLSVADGTHAAALRQRLQAALAECRRELARGACPERFQFLQQQARALEGGLGILSQLTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 26
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2uwjE00
2Q1KA 2QVAA 1DEEG 1EDLA 2KZIA 1OVRA 2K3RA 2OTKE 5EFWB 1EDJA 2M0BA 1ZW0A 4NPDA 4K35A 4KJMA 2I8DA 4NPEA 3ZDMA 2P58A 1MFTA 4JBZA 2LXCB 5CBOA 1Q2NA 2RKLA 2LR2A 2SPZA 5K5GB 4HKZH 1U7JA 1OVVA 5DJUB 3MHVA 1EDIA 4CPGA 4ZMDA 3PH0A 2KZJA 2HR3A 2R44A 2B88A 4EYYQ 4ASVA 1U7MA 1EC5A 2B87A 2KS1B 1BDDA 1S3JA 1ZXGA 4HB1A 2WMMA 3RGUA 4ASWA 4BXLA 2M5AB 5C39A 2LXBA 2ZAEB 4HJGH 1LP1A 1H0TA 1NVOA 1Y47A 5DJTB 1SS1A 2M5AA 3FXDA 2B87B 2KI7B 1JM0A 5CBNA 4WWIA 3S1KA 4IOIH 3FXEA 2KUBA 2JWDA 4GOFA 2QRXA 3QWOC 1BDCA 2B89A 1LP1B 1EDKA 2UWJE 1JMBA 4NPFX 1H0TB 4ZNCA 1LT1A 4MN4C 3MZWB 4GODA 4GOEA 1OVUA 2KIKA 4K3AA 1X0TA 1FC2C
chains in the Genus database with same CATH superfamily
5CJ4A 1SQXD 3BRVB 1GU4A 1W5CE 1QVGO 1HVVA 3CWBG 2FYUD 1FJKA 3CXHD 5AVSB 2Z5IA 5TISE 2CK3H 4QMAA 4XFJA 1N73B 1L0NK 2LXCB 4RO0A 5GTIH 3AE3C 1K04A 1OVVA 3G4SP 3CCJP 2V7QJ 4I7ZB 3H1HG 1M1KQ 4ZKPA 2WQYC 2YMYA 1ZR4A 1AFOA 2P10A 1SQXK 1J1EB 2FYUK 2E76C 3CWBD 1NTZJ 1KQFB 5CJ0A 4Y99C 4DJGA 3L74G 1JO5A 1Q86Q 1LGHB 2IX7C 2Q3IA 5KLIC 1CI6A 1GU5A 5GTHH 4GDOA 5CCHC 5BVZA 3VMZA 3PP5A 2WTYA 3M91A 3BASA 3H1HD 3AEFC 3PJSK 1KB9D 5APTA 2IYOA 3LW5H 3UIAA 4PJ0H 2ZFCA 1KYOE 1IO4A 1BE3J 3OA7A 2Z5HA 1N73A 2CPSA 1RE3C 3KHUA 3L70J 1VQ8P 3EFGA 2AEJA 4YTPC 5KJ7A 1PZQA 5B5EE 1IFIA 1OFCX 1VF5D 3GMAA 3AE4C 3H1KE 2P2UA 1HWTC 1PP9G 2E76B 5AW4B 3NMDA 5APVA 5L8RJ 4Y99B 1YBKA 1JY3O 1Q2NA 3AECC 2R5DA 2LR2A 5KLIB 5K5GB 4HKZH 3L4FA 1SFCB 2YMKA 4U3FG 4ZMDA 3L72J 1NTKJ 3P32A 1RHZB 1HGZA 3V2RA 2A45H 1H8AA 1CSBA 1URQB 1EZVG 3GW6A 4OWFA 1UIXA 3H1JJ 1YTZI 4YXDC 1P84H 5AW9B 3HTKB 4HH2A 2KLUA 1JY3N 1PP9D 2FKWB 5KTBA 3AE8C 2A45I 3U59A 5DJTB 3CC7P 1FZAA 1NGMB 4I2LC 1JM0A 1P84I 1G1JA 1S5LE 4U3FD 2OYHC 4D6TD 2GA1A 1LP1B 2E74C 2I1KA 2KNCB 3SWKA 3CXHH 2LKMA 2WSFH 2JR8A 1LTIC 3JCUH 3L75E 1NAYA 4C46A 2Q1KA 2Y0EA 2WSEH 1S2EA 4WY4D 1ZOYC 1YI2P 1JY2O 2QSIA 3CXHI 1OXZA 1R5SA 1SFCA 5AVVB 1ZV8A 5CCHA 1CW5A 3TK1A 2Q3EA 1NYHA 2ZJSE 3BRTB 1L0NJ 3H1LG 2HYNA 2ZVNB 3H1IJ 1NWQA 2E42A 5APUA 3A2AA 1L0LE 3BVHA 1IC2A 1SQVJ 3HTKA 1JY2N 1QGKB 3CLQA 3H32B 4LGDE 3CD6P 3GLMA 5AVUB 1U7MA 2OYHB 4UB6H 1RE3A 2QM7A 2E74B 5AW2B 1IK9A 1LT9C 2KS1B 2XDJA 1KILD 1Q81Q 3G6EP 3RK3C 5AVXB 2FYUJ 3RGUA 4ASWA 2WSFJ 1CZQA 1LP1A 3VN0A 1Y47A 2WSEJ 1KB9H 2ZT9C 2M5AA 2KNCA 2H8PD 3FXDA 1IFPA 3GF7A 2KB7P 1FBMA 1JMMA 2KSJA 3IN6A 4EOTA 4GOFA 1KB9I 2IBZG 2UWJE 2ZYDA 1KN7A 2RH0A 1NTZG 4NPFX 3P8MC 3BCCE 4GOEA 2KIKA 4K3AA 3CC4P 3KYQA 1VQOP 1ZLLA 3VMXA 3TF5A 2FXOA 4L74A 1EDLA 2P1JA 2K3RA 1SLQA 3B71A 2QJYC 1M1JC 3L73G 1SQQE 3V2PA 2P67A 2I8DA 5AW3B 4NPEA 3H32A 2ITAA 1HJ0A 4IL6E 1PL5A 1VQNP 1MFTA 3D70A 3RK3B 2JKVA 1GD2E 4YXWH 4UB8H 2OYHA 2RKLA 2IBZD 3CX5E 4W7YA 1NTZD 2WSSH 3H1HJ 5DJUB 3MHVA 2D2CC 1FJPA 1G2CB 1K05A 1GW3A 2HG5D 1A02J 1N8RQ 5AW0B 3RK2C 3L74J 5B66E 3TGUG 1S72P 1VL2A 1X79B 4BRYB 1TU3F 3VYIA 1IFJA 3PTZA 4JYCA 2KYVA 2QEXP 3T97B 1FDIA 1NTZK 2QJYB 1FZFA 1M1JB 1JUNA 4B86A 2KUBA 2JWDA 1K9MQ 3A0HE 2IZ0A 2J5UA 4MN4C 1OVUA 4LC1A 1X0TA 1NU1J 3TGUD 2D2CB 1VQ9P 5AW8B 1J2JB 2OTKE 2Y9ZA 2H88C 2YKQA 1PP9J 3M9QA 1KQLA 1NOHA 3RK2B 3L72D 1GK6A 1J1DB 1NTKD 1G2CA 5AW5B 2Y0DA 1AQTA 1KTMA 1RF0C 4PV1C 1BSHA 2CPBA 4YPCA 3RL0C 3H1JD 4BRYA 3WUTA 3D71A 5APWA 3MD0A 2NPSC 1KILE 3T97A 1S9KE 3K5BA 1VQLP 3H6PA 1M1JA 2BCCE 1M7LA 1NTKK 3KZIH 4I1LA 4BXLA 5AVQB 5C39A 3Q5PA 3TYYA 1SQVG 2E76D 1IJDB 2O1JA 2AEFA 2FFDC 3FXEA 2XU6A 1EDKA 2A06G 4EIJA 4H44C 1BCCE 5KJ7C 5CCHD 2YKPA 2PP6A 2WZ7A 3P8CE 2JP3A 3KXDA 1HBWA 3U1CA 1UIIA 2P7JA 1RQVA 2QVAA 3I5CA 2N9YB 5EFWB 3M06A 1YJWP 1DX7A 4OH8B 1SQVD 3AE5C 3ZDMA 1SVFA 1BGYE 3H1LJ 3SWFA 3CMEP 2IBZI 2L5GB 3VP9A 2A06D 3PLNA 1SQBG 1VDFA 2W6BA 2W27A 2YIUC 1VQ4P 1GW4A 5BU5A 4ASVA 2FFDB 2GM4A 1MFZA 3S4RA 1BSNA 1YHQP 3G3ZA 2KK7A 4H44B 4L76A 1MZ9A 1SQVK 2M8RA 4DCKA 1L4AB 3HD7C 1OX3A 3FX0A 3AEBC 2ZAEB 2G8YA 3OAKA 4HJGH 5GTIE 2W8ZA 4TLFA 1BE3E 5KAIE 1RF0A 3PRJA 1W2EA 1YQ4C 4H13B 3G71P 3L70E 4WWIA 3EQ2A 3RBXA 1DD4A 1GZLA 2WITA 2W83C 4JQ0D 2IFMA 3EWKA 4ZNCA 5KAFH 2NPSA 3D6ZA 3KDPB 4R4MA 1SFCC 3WU2H 4L73A 2YIUB 2XV5A 3V2QA 2E74D 3L73J 4N6JA 2OYIC 3L72E 5GTHE 1T3JA 1Y9BA 3B5NC 1URQC 4BWNA 1K73Q 3D6YA 2YXRB 4JPZB 2N1TC 3FWLA 1PGOA 2NZ2A 2YKOA 2FFDA 1FDMA 1PPJG 1KFMA 1SQQG 3HD7B 4XE5B 3P7KA 3A0BH 4IFMA 3L74D 1NU1G 1QLED 2FXMA 1KYOH 3MTUE 1IFNA 2KLVA 1YQ3C 3VOPA 1N7LA 1L4AA 1DH3A 2HR3A 3WUUA 3L71E 1HH0A 3TGUJ 5CCGC 1KZUB 2WSCJ 3EFFK 1ZRTE 2IPPA 2VRSA 1ZP0C 4PD4H 2O1KA 1JNMA 5KLVG 1DD3A 1JCCA 4N78D 3CC2P 1NTME 1PPJD 1QL2A 2OYIB 1NU1D 4PD4I 1R8EA 3RK3D 4IOIH 3B5NB 1S5LX 1GK4A 2N1TB 1USDA 2B89A 1RY3A 2ZT9D 2HFED 1M8OB 1P84E 1LTTC 2YXQB 1L0NE 5AVRB 4H0LC 3H1IE 3HD7A 5H2FH 1WRGA 2OQQA 4GKGA 1ZW0A 1HJBA 3RBZA 1ZR2A 3AEDC 2R32A 3PHLA 4K35A 1NU1K 1E79H 1USEA 2FBWC 1S5LH 3CCMP 2IZ1A 1VPCA 1VQMP 1SQXE 1ZN5A 4JBZA 3CCRP 1EZVD 2FYUE 3CXHE 2QE7H 3L35A 2KP8A 3JCUE 1SQPG 4CPGA 1H88A 3MIWA 3HE5B 1EC5A 2POHA 3MP7B 2OYIA 3SSUA 2OTJP 2D2CD 3V4WA 2XKMA 3B5NA 3R4YA 3KPEA 1URQA 4HB1A 4RJTA 2N1TA 1A02F 4H0LB 3Q2YA 3RK2D 1DEBA 3CWBE 2WPVB 5CBNA 1QVFO 3Q5SA 1IFDA 1SQPD 1KFNA 5CHXA 4UB6E 1PFIA 2WPQA 2IFNA 2AXTH 2IYPA 2H89C 5CCGA 1IK7A 1T6AA 2QA4P 2K9JB 3H1HE 3H1LD 1KB9E 2KZIA 4WBAA 1Z56A 3E1RA 2ZYAA 4U7JA 5BU8B 2E75C 2KSEA 4A7PA 3TSIA 1SQPK 4IL6X 2W6AA 3AE6C 3HE5A 5AW7B 2MKVA 1SQBJ 3AE2C 3U1AA 3WMM0 1VF5B 3RL0g 1WMKA 2HODB 2R44A 1L0LJ 4DT0A 1OW7A 4PV1D 4HYTB 1AV1A 1NHLA 4EDFA 1NAFA 3RL0D 2G3AA 2M3BA 2N9BA 3HUSC 2WPRA 1YJ9P 4IL6H 4AYCA 1YIJP 2KS1A 4UB8E 4WB4A 1NH4A 5AVWB 1FZGA 4GIFA 2NPSD 4XA4A 1HUCA 2KI7B 4LLHA 2Y0CA 2OARA 4EI2A 1J1DC 2K9JA 1PP9E 2BEQD 2E75B 3L73D 2B9BA 5AW6B 3GHGC 1AVYA 2QIWA 4GODA 1X22A 3BCCJ 3JSVC 4U3FE 4DZOA 1PGQA 4D6TE 1QX8A 1OVRA 1RQUA 2QG4A 1LWUC 3B8EB 4H44D 5KJ7D 2XZRA 1E5WA 1N86A 1SQQJ 3HUSB 2HODA 2P58A 1Q7YQ 1EZVI 1LNQA 3CCVP 2KXPB 3Q3DA 4IFDK 3CPWO 4O9BA 1RH5B 2I1JA 3AEEC 3NFQA 1FDOA 3H1KG 3GHGB 3L71G 1NO4A 3VTPC 1AA0A 5KLVJ 2JWAA 4ZKUA 2M3EA 1PIXA 2LXBA 4W7ZA 1SS1A 1RE4C 4KT0J 2L91A 1LWUB 1KILB 2W6JH 1NKNA 1KYOD 1NTMG 2FYZA 3HD7D 2FYNB 1Q82Q 1IZNB 3II6A 3I56P 1X8YA 1JY3P 3S9OA 3H1LE 3H1KD 2PFXA 1M57D 3G9RA 4AQRD 3HUSA 1DEEG 4C7NB 2BASA 4RESB 4PD4D 2R5BA 1PGJA 1T2KC 5APYA 2J59M 1SFCD 1D7MA 2FXPA 3CCEP 1FU1A 1JOCA 1L4AC 3CL3D 1KQGB 4C7RA 4OVNF 1SQPJ 3A7OA 3B5ND 3GHGA 1AQ5A 4H13C 1URQD 3L75G 2GUVA 2N1TD 3ABVC 1GMJA 2JO1A 4OGQC 2IBZE 1L2PA 2KOGA 1NTZE 5E79H 3Q5RA 2YNYA 1LWUA 1LTAC 1KILA 4AUWA 2BCCJ 3C1LA 1RF1B 5CCGD 1JY2P 3JC22 3F89A 3CCUP 1L0LG 3L73E 3H25A 3L37A 3S1KA 2MJZA 5TISH 3L75D 2QRXA 4C7NA 2Q9IA 3OJAB 3VMAA 1JMBA 1AJYA 2Z4EA 1VQ6P 4Y28J 2BEZF 1AVOA 1BCCJ 2O01N 3M0DC 1FZEA 2WVRA 5KAIH 1SQBD 2O01J 2WSCH 2M0BA 4OGQB 2ZXEB 3TGUE 1RE4A 2J58A 1FZBA 3USSA 1L0LD 4H0LD 5KAFE 3BCCG 1FS0E 1BGYJ 1GL2C 1LJ2A 3WU2E 2PRRA 1U7JA 1XTCC 1NTKE 1KC8Q 2KZJA 1JB0J 3E1IA 3Q1MA 1RF1A 3AE1C 1SQBK 3H1JE 2K1AA 4PJ0E 1ZMEC 3MUDC 1S3JA 2WMMA 1L0LK 1PV3A 3A0BE 1N7SC 4KHXA 3BCCD 1W2BO 1KYOI 5B5EH 2ZXXA 3KQGA 4W80A 1LTSC 4R4LA 3F5HA 1MUUA 1DIPA 1S4XA 1EQ7A 3ITKA 3IR9A 3VMYA 3FWNA 4PD4E 1GL2B 1FC2C 1SQQD 3M9BA 3C8VA 2JJLA 2ZVOB 2Q7CA 1VQPP 3BATA 3E7KA 4D6TG 3CX5D 1NJIQ 1EXIA 1H89A 4M3LA 3IAOA 1VQKP 2Y9YA 3LW5J 4GT1A 1OMIA 1N7SB 3NTNA 5AVYB 1SQVE 5KLVD 2E75D 2OYOA 3N7NA 1SQQK 5H2FE 2HLOA 4EYYQ 3H1KJ 3L71J 3M0DA 2A06E 1XTGB 1QEXA 4Z1MH 1K8AQ 5KKZC 1ZXGA 2PGDA 3N4XA 2M5AB 3A5TA 1NVOA 3LIDA 3V5BA 2B87B 1NTMJ 1GL2A 1JTHB 5KLVK 1U57A 3QWOC 5APSA 2K88A 1LTGC 3V4QA 3W67A 1VF5C 2BCCG 1FZCC 1SQBE 3IF4A 1OW6A 3MUDA 5APXA 2C0WA 1LTJC 1NKZB 1N7SA 1KV4A 2XNXA 1R5LA 3CMAP 3MGNA 5AW1B 1KORA 1QL1A 3L36A 2K9YA 2AXTE 1SQXJ 3QH9A 5KKZB 1HTLC 4I6MC 1YITP 2C0XA 2QM8A 3L75J 2H43A 1BCCG 2SPZA 4WVZA 1S9KD 2YO2A 2C9LY 1EDIA 5M1BA 2Q6QA 1HGVA 2OTLP 3PH0A 2BCCD 3CCLP 1HF9A 3SFDC 3HRNA 2XNDH 3L74E 1YJNP 2B87A 2V4HA 1GTWA 1VQ7P 1JTHA 3NXSA 3AEAC 2H7HA 1M90Q 4TT3H 1FZCB 1S1CX 1BGYG 1WT6A 3C9IA 1T8ZA 2IDBA 3OW2O 1G1IA 3GG2A 3IFMA 2WPSA 2JEEA 3AE9C 2R3CA 1LTJB 3V6IA 1BCCD 3CWBJ 2E5TA 1FE6A 2DW3A 2R3SA 3O6QB 3P8CD 5CMZA 3TNUB 4WY4C 1LTBC 4N78E 1PPJE 1LT1A 2ZYGA 4IFFA 1NU1E 2JDIH 1LT9B 3RK3E 3CX5H 5AVTB 2W90A 4DOJA 1FOSF 2Q5UA 1OW8A 1BE3G 3WUVA 1BGYD 1KQSO 2ZT9B 3CX5I 3L70G 2YO3A 5B66H 2FY8A 5KLVE 3CCSP 1T2KD 3CCQP 5APQA 3VP8A 1KILC 1L4AD 2GUSA 1FZCA 1EZVE 2FYNC 2B88A 1JEKA 3FGAD 2AXCA 3L72G 4WY4B 1NTKG 1X9VA 3R2PA 1GDTA 1BE3D 3A0HH 1FOSE 2WWWA 4H13D 1LTJA 1OIPA 1Q90D 4JYBA 1BDDA 3L70D 2QJKC 3O6QA 3HE4B 3TNUA 1OZHA 2RMZA 3H1JG 3AEGC 2K37A 4OGQD 3SFEC 1IFMA 3O8ZA 2AEMA 3AE7C 1LT9A 1N2DC 1T3UA 2HPCB 2O3JA 2QJPC 1BDCA 3CI9A 1H0TB 3GF3A 5AVZB 3MZWB 2OGUA 1SQPE 1JCDA 4RKUJ 4U3FJ 4D6TJ 1EDJA 5TJHA 3M0AA 4NPDA 3V2NA 3A3YB 4KJMA 2WT7B 2A45G 3KZIE 2QJKB 5CBOA 3L71D 1RF1C 4WY4A 1SP4A 2RN0A 2PAJA 1M56D 1ZRTD 1L0NG 3HE4A 3M9HA 1VQ5P 3H1IG 2NRGA 4N3YB 2QJPB 1MV8A 1GL2D 1NTMD 3LIEA 1YTZT 1MKMA 1Y8AA 2E5YA 3TDKA 1N73C 1SQXG 4L75A 2HPCA 1EXJA 1PGPA 4PV1B 2FYUG 1H0TA 2E43A 2O01H 2C9NY 3I55P 3RL0B 2V7QH 4I7ZC 4JF7A 1P84D 1KMIZ 3SWYA 1FAVA 1L0ND 1OWAA 3W68A 1J1EC 2NPSB 1N7SD 1YYCA 5E79E 3H1ID 1KD1Q 1CI6B 1NTMK 3B4SA 2WT7A
chains in the Genus database with same CATH topology
2Q1KA 2QVAA 1DEEG 1EDLA 2KZIA 1OVRA 2K3RA 2OTKE 5EFWB 1EDJA 2M0BA 1ZW0A 4NPDA 4K35A 4KJMA 2I8DA 4NPEA 3ZDMA 2P58A 1MFTA 4JBZA 2LXCB 5CBOA 1Q2NA 2RKLA 2LR2A 2SPZA 5K5GB 4HKZH 1U7JA 1OVVA 5DJUB 3MHVA 1EDIA 4CPGA 4ZMDA 3PH0A 2KZJA 2HR3A 2R44A 2B88A 4EYYQ 4ASVA 1U7MA 1EC5A 2B87A 2KS1B 1BDDA 1S3JA 1ZXGA 4HB1A 2WMMA 3RGUA 4ASWA 4BXLA 2M5AB 5C39A 2LXBA 2ZAEB 4HJGH 1LP1A 1H0TA 1NVOA 1Y47A 5DJTB 1SS1A 2M5AA 3FXDA 2B87B 2KI7B 1JM0A 5CBNA 4WWIA 3S1KA 4IOIH 3FXEA 2KUBA 2JWDA 4GOFA 2QRXA 3QWOC 1BDCA 2B89A 1LP1B 1EDKA 2UWJE 1JMBA 4NPFX 1H0TB 4ZNCA 1LT1A 4MN4C 3MZWB 4GODA 4GOEA 1OVUA 2KIKA 4K3AA 1X0TA 1FC2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1K A;  2QVA A;  1DEE G;  1EDL A;  2KZI A;  1OVR A;  2K3R A;  2OTK E;  5EFW B;  1EDJ A;  2M0B A;  1ZW0 A;  4NPD A;  4K35 A;  4KJM A;  2I8D A;  4NPE A;  3ZDM A;  2P58 A;  1MFT A;  4JBZ A;  2LXC B;  5CBO A;  1Q2N A;  2RKL A;  2LR2 A;  2SPZ A;  5K5G B;  4HKZ H;  1U7J A;  1OVV A;  5DJU B;  3MHV A;  1EDI A;  4CPG A;  4ZMD A;  3PH0 A;  2KZJ A;  2HR3 A;  2R44 A;  2B88 A;  4EYY Q;  4ASV A;  1U7M A;  1EC5 A;  2B87 A;  2KS1 B;  1BDD A;  1S3J A;  1ZXG A;  4HB1 A;  2WMM A;  3RGU A;  4ASW A;  4BXL A;  2M5A B;  5C39 A;  2LXB A;  2ZAE B;  4HJG H;  1LP1 A;  1H0T A;  1NVO A;  1Y47 A;  5DJT B;  1SS1 A;  2M5A A;  3FXD A;  2B87 B;  2KI7 B;  1JM0 A;  5CBN A;  4WWI A;  3S1K A;  4IOI H;  3FXE A;  2KUB A;  2JWD A;  4GOF A;  2QRX A;  3QWO C;  1BDC A;  2B89 A;  1LP1 B;  1EDK A;  2UWJ E;  1JMB A;  4NPF X;  1H0T B;  4ZNC A;  1LT1 A;  4MN4 C;  3MZW B;  4GOD A;  4GOE A;  1OVU A;  2KIK A;  4K3A A;  1X0T A;  1FC2 C; 
#chains in the Genus database with same CATH topology
 5CJ4 A;  1SQX D;  3BRV B;  1GU4 A;  1W5C E;  1QVG O;  1HVV A;  3CWB G;  2FYU D;  1FJK A;  3CXH D;  5AVS B;  2Z5I A;  5TIS E;  2CK3 H;  4QMA A;  4XFJ A;  1N73 B;  1L0N K;  2LXC B;  4RO0 A;  5GTI H;  3AE3 C;  1K04 A;  1OVV A;  3G4S P;  3CCJ P;  2V7Q J;  4I7Z B;  3H1H G;  1M1K Q;  4ZKP A;  2WQY C;  2YMY A;  1ZR4 A;  1AFO A;  2P10 A;  1SQX K;  1J1E B;  2FYU K;  2E76 C;  3CWB D;  1NTZ J;  1KQF B;  5CJ0 A;  4Y99 C;  4DJG A;  3L74 G;  1JO5 A;  1Q86 Q;  1LGH B;  2IX7 C;  2Q3I A;  5KLI C;  1CI6 A;  1GU5 A;  5GTH H;  4GDO A;  5CCH C;  5BVZ A;  3VMZ A;  3PP5 A;  2WTY A;  3M91 A;  3BAS A;  3H1H D;  3AEF C;  3PJS K;  1KB9 D;  5APT A;  2IYO A;  3LW5 H;  3UIA A;  4PJ0 H;  2ZFC A;  1KYO E;  1IO4 A;  1BE3 J;  3OA7 A;  2Z5H A;  1N73 A;  2CPS A;  1RE3 C;  3KHU A;  3L70 J;  1VQ8 P;  3EFG A;  2AEJ A;  4YTP C;  5KJ7 A;  1PZQ A;  5B5E E;  1IFI A;  1OFC X;  1VF5 D;  3GMA A;  3AE4 C;  3H1K E;  2P2U A;  1HWT C;  1PP9 G;  2E76 B;  5AW4 B;  3NMD A;  5APV A;  5L8R J;  4Y99 B;  1YBK A;  1JY3 O;  1Q2N A;  3AEC C;  2R5D A;  2LR2 A;  5KLI B;  5K5G B;  4HKZ H;  3L4F A;  1SFC B;  2YMK A;  4U3F G;  4ZMD A;  3L72 J;  1NTK J;  3P32 A;  1RHZ B;  1HGZ A;  3V2R A;  2A45 H;  1H8A A;  1CSB A;  1URQ B;  1EZV G;  3GW6 A;  4OWF A;  1UIX A;  3H1J J;  1YTZ I;  4YXD C;  1P84 H;  5AW9 B;  3HTK B;  4HH2 A;  2KLU A;  1JY3 N;  1PP9 D;  2FKW B;  5KTB A;  3AE8 C;  2A45 I;  3U59 A;  5DJT B;  3CC7 P;  1FZA A;  1NGM B;  4I2L C;  1JM0 A;  1P84 I;  1G1J A;  1S5L E;  4U3F D;  2OYH C;  4D6T D;  2GA1 A;  1LP1 B;  2E74 C;  2I1K A;  2KNC B;  3SWK A;  3CXH H;  2LKM A;  2WSF H;  2JR8 A;  1LTI C;  3JCU H;  3L75 E;  1NAY A;  4C46 A;  2Q1K A;  2Y0E A;  2WSE H;  1S2E A;  4WY4 D;  1ZOY C;  1YI2 P;  1JY2 O;  2QSI A;  3CXH I;  1OXZ A;  1R5S A;  1SFC A;  5AVV B;  1ZV8 A;  5CCH A;  1CW5 A;  3TK1 A;  2Q3E A;  1NYH A;  2ZJS E;  3BRT B;  1L0N J;  3H1L G;  2HYN A;  2ZVN B;  3H1I J;  1NWQ A;  2E42 A;  5APU A;  3A2A A;  1L0L E;  3BVH A;  1IC2 A;  1SQV J;  3HTK A;  1JY2 N;  1QGK B;  3CLQ A;  3H32 B;  4LGD E;  3CD6 P;  3GLM A;  5AVU B;  1U7M A;  2OYH B;  4UB6 H;  1RE3 A;  2QM7 A;  2E74 B;  5AW2 B;  1IK9 A;  1LT9 C;  2KS1 B;  2XDJ A;  1KIL D;  1Q81 Q;  3G6E P;  3RK3 C;  5AVX B;  2FYU J;  3RGU A;  4ASW A;  2WSF J;  1CZQ A;  1LP1 A;  3VN0 A;  1Y47 A;  2WSE J;  1KB9 H;  2ZT9 C;  2M5A A;  2KNC A;  2H8P D;  3FXD A;  1IFP A;  3GF7 A;  2KB7 P;  1FBM A;  1JMM A;  2KSJ A;  3IN6 A;  4EOT A;  4GOF A;  1KB9 I;  2IBZ G;  2UWJ E;  2ZYD A;  1KN7 A;  2RH0 A;  1NTZ G;  4NPF X;  3P8M C;  3BCC E;  4GOE A;  2KIK A;  4K3A A;  3CC4 P;  3KYQ A;  1VQO P;  1ZLL A;  3VMX A;  3TF5 A;  2FXO A;  4L74 A;  1EDL A;  2P1J A;  2K3R A;  1SLQ A;  3B71 A;  2QJY C;  1M1J C;  3L73 G;  1SQQ E;  3V2P A;  2P67 A;  2I8D A;  5AW3 B;  4NPE A;  3H32 A;  2ITA A;  1HJ0 A;  4IL6 E;  1PL5 A;  1VQN P;  1MFT A;  3D70 A;  3RK3 B;  2JKV A;  1GD2 E;  4YXW H;  4UB8 H;  2OYH A;  2RKL A;  2IBZ D;  3CX5 E;  4W7Y A;  1NTZ D;  2WSS H;  3H1H J;  5DJU B;  3MHV A;  2D2C C;  1FJP A;  1G2C B;  1K05 A;  1GW3 A;  2HG5 D;  1A02 J;  1N8R Q;  5AW0 B;  3RK2 C;  3L74 J;  5B66 E;  3TGU G;  1S72 P;  1VL2 A;  1X79 B;  4BRY B;  1TU3 F;  3VYI A;  1IFJ A;  3PTZ A;  4JYC A;  2KYV A;  2QEX P;  3T97 B;  1FDI A;  1NTZ K;  2QJY B;  1FZF A;  1M1J B;  1JUN A;  4B86 A;  2KUB A;  2JWD A;  1K9M Q;  3A0H E;  2IZ0 A;  2J5U A;  4MN4 C;  1OVU A;  4LC1 A;  1X0T A;  1NU1 J;  3TGU D;  2D2C B;  1VQ9 P;  5AW8 B;  1J2J B;  2OTK E;  2Y9Z A;  2H88 C;  2YKQ A;  1PP9 J;  3M9Q A;  1KQL A;  1NOH A;  3RK2 B;  3L72 D;  1GK6 A;  1J1D B;  1NTK D;  1G2C A;  5AW5 B;  2Y0D A;  1AQT A;  1KTM A;  1RF0 C;  4PV1 C;  1BSH A;  2CPB A;  4YPC A;  3RL0 C;  3H1J D;  4BRY A;  3WUT A;  3D71 A;  5APW A;  3MD0 A;  2NPS C;  1KIL E;  3T97 A;  1S9K E;  3K5B A;  1VQL P;  3H6P A;  1M1J A;  2BCC E;  1M7L A;  1NTK K;  3KZI H;  4I1L A;  4BXL A;  5AVQ B;  5C39 A;  3Q5P A;  3TYY A;  1SQV G;  2E76 D;  1IJD B;  2O1J A;  2AEF A;  2FFD C;  3FXE A;  2XU6 A;  1EDK A;  2A06 G;  4EIJ A;  4H44 C;  1BCC E;  5KJ7 C;  5CCH D;  2YKP A;  2PP6 A;  2WZ7 A;  3P8C E;  2JP3 A;  3KXD A;  1HBW A;  3U1C A;  1UII A;  2P7J A;  1RQV A;  2QVA A;  3I5C A;  2N9Y B;  5EFW B;  3M06 A;  1YJW P;  1DX7 A;  4OH8 B;  1SQV D;  3AE5 C;  3ZDM A;  1SVF A;  1BGY E;  3H1L J;  3SWF A;  3CME P;  2IBZ I;  2L5G B;  3VP9 A;  2A06 D;  3PLN A;  1SQB G;  1VDF A;  2W6B A;  2W27 A;  2YIU C;  1VQ4 P;  1GW4 A;  5BU5 A;  4ASV A;  2FFD B;  2GM4 A;  1MFZ A;  3S4R A;  1BSN A;  1YHQ P;  3G3Z A;  2KK7 A;  4H44 B;  4L76 A;  1MZ9 A;  1SQV K;  2M8R A;  4DCK A;  1L4A B;  3HD7 C;  1OX3 A;  3FX0 A;  3AEB C;  2ZAE B;  2G8Y A;  3OAK A;  4HJG H;  5GTI E;  2W8Z A;  4TLF A;  1BE3 E;  5KAI E;  1RF0 A;  3PRJ A;  1W2E A;  1YQ4 C;  4H13 B;  3G71 P;  3L70 E;  4WWI A;  3EQ2 A;  3RBX A;  1DD4 A;  1GZL A;  2WIT A;  2W83 C;  4JQ0 D;  2IFM A;  3EWK A;  4ZNC A;  5KAF H;  2NPS A;  3D6Z A;  3KDP B;  4R4M A;  1SFC C;  3WU2 H;  4L73 A;  2YIU B;  2XV5 A;  3V2Q A;  2E74 D;  3L73 J;  4N6J A;  2OYI C;  3L72 E;  5GTH E;  1T3J A;  1Y9B A;  3B5N C;  1URQ C;  4BWN A;  1K73 Q;  3D6Y A;  2YXR B;  4JPZ B;  2N1T C;  3FWL A;  1PGO A;  2NZ2 A;  2YKO A;  2FFD A;  1FDM A;  1PPJ G;  1KFM A;  1SQQ G;  3HD7 B;  4XE5 B;  3P7K A;  3A0B H;  4IFM A;  3L74 D;  1NU1 G;  1QLE D;  2FXM A;  1KYO H;  3MTU E;  1IFN A;  2KLV A;  1YQ3 C;  3VOP A;  1N7L A;  1L4A A;  1DH3 A;  2HR3 A;  3WUU A;  3L71 E;  1HH0 A;  3TGU J;  5CCG C;  1KZU B;  2WSC J;  3EFF K;  1ZRT E;  2IPP A;  2VRS A;  1ZP0 C;  4PD4 H;  2O1K A;  1JNM A;  5KLV G;  1DD3 A;  1JCC A;  4N78 D;  3CC2 P;  1NTM E;  1PPJ D;  1QL2 A;  2OYI B;  1NU1 D;  4PD4 I;  1R8E A;  3RK3 D;  4IOI H;  3B5N B;  1S5L X;  1GK4 A;  2N1T B;  1USD A;  2B89 A;  1RY3 A;  2ZT9 D;  2HFE D;  1M8O B;  1P84 E;  1LTT C;  2YXQ B;  1L0N E;  5AVR B;  4H0L C;  3H1I E;  3HD7 A;  5H2F H;  1WRG A;  2OQQ A;  4GKG A;  1ZW0 A;  1HJB A;  3RBZ A;  1ZR2 A;  3AED C;  2R32 A;  3PHL A;  4K35 A;  1NU1 K;  1E79 H;  1USE A;  2FBW C;  1S5L H;  3CCM P;  2IZ1 A;  1VPC A;  1VQM P;  1SQX E;  1ZN5 A;  4JBZ A;  3CCR P;  1EZV D;  2FYU E;  3CXH E;  2QE7 H;  3L35 A;  2KP8 A;  3JCU E;  1SQP G;  4CPG A;  1H88 A;  3MIW A;  3HE5 B;  1EC5 A;  2POH A;  3MP7 B;  2OYI A;  3SSU A;  2OTJ P;  2D2C D;  3V4W A;  2XKM A;  3B5N A;  3R4Y A;  3KPE A;  1URQ A;  4HB1 A;  4RJT A;  2N1T A;  1A02 F;  4H0L B;  3Q2Y A;  3RK2 D;  1DEB A;  3CWB E;  2WPV B;  5CBN A;  1QVF O;  3Q5S A;  1IFD A;  1SQP D;  1KFN A;  5CHX A;  4UB6 E;  1PFI A;  2WPQ A;  2IFN A;  2AXT H;  2IYP A;  2H89 C;  5CCG A;  1IK7 A;  1T6A A;  2QA4 P;  2K9J B;  3H1H E;  3H1L D;  1KB9 E;  2KZI A;  4WBA A;  1Z56 A;  3E1R A;  2ZYA A;  4U7J A;  5BU8 B;  2E75 C;  2KSE A;  4A7P A;  3TSI A;  1SQP K;  4IL6 X;  2W6A A;  3AE6 C;  3HE5 A;  5AW7 B;  2MKV A;  1SQB J;  3AE2 C;  3U1A A;  3WMM 0;  1VF5 B;  3RL0 g;  1WMK A;  2HOD B;  2R44 A;  1L0L J;  4DT0 A;  1OW7 A;  4PV1 D;  4HYT B;  1AV1 A;  1NHL A;  4EDF A;  1NAF A;  3RL0 D;  2G3A A;  2M3B A;  2N9B A;  3HUS C;  2WPR A;  1YJ9 P;  4IL6 H;  4AYC A;  1YIJ P;  2KS1 A;  4UB8 E;  4WB4 A;  1NH4 A;  5AVW B;  1FZG A;  4GIF A;  2NPS D;  4XA4 A;  1HUC A;  2KI7 B;  4LLH A;  2Y0C A;  2OAR A;  4EI2 A;  1J1D C;  2K9J A;  1PP9 E;  2BEQ D;  2E75 B;  3L73 D;  2B9B A;  5AW6 B;  3GHG C;  1AVY A;  2QIW A;  4GOD A;  1X22 A;  3BCC J;  3JSV C;  4U3F E;  4DZO A;  1PGQ A;  4D6T E;  1QX8 A;  1OVR A;  1RQU A;  2QG4 A;  1LWU C;  3B8E B;  4H44 D;  5KJ7 D;  2XZR A;  1E5W A;  1N86 A;  1SQQ J;  3HUS B;  2HOD A;  2P58 A;  1Q7Y Q;  1EZV I;  1LNQ A;  3CCV P;  2KXP B;  3Q3D A;  4IFD K;  3CPW O;  4O9B A;  1RH5 B;  2I1J A;  3AEE C;  3NFQ A;  1FDO A;  3H1K G;  3GHG B;  3L71 G;  1NO4 A;  3VTP C;  1AA0 A;  5KLV J;  2JWA A;  4ZKU A;  2M3E A;  1PIX A;  2LXB A;  4W7Z A;  1SS1 A;  1RE4 C;  4KT0 J;  2L91 A;  1LWU B;  1KIL B;  2W6J H;  1NKN A;  1KYO D;  1NTM G;  2FYZ A;  3HD7 D;  2FYN B;  1Q82 Q;  1IZN B;  3II6 A;  3I56 P;  1X8Y A;  1JY3 P;  3S9O A;  3H1L E;  3H1K D;  2PFX A;  1M57 D;  3G9R A;  4AQR D;  3HUS A;  1DEE G;  4C7N B;  2BAS A;  4RES B;  4PD4 D;  2R5B A;  1PGJ A;  1T2K C;  5APY A;  2J59 M;  1SFC D;  1D7M A;  2FXP A;  3CCE P;  1FU1 A;  1JOC A;  1L4A C;  3CL3 D;  1KQG B;  4C7R A;  4OVN F;  1SQP J;  3A7O A;  3B5N D;  3GHG A;  1AQ5 A;  4H13 C;  1URQ D;  3L75 G;  2GUV A;  2N1T D;  3ABV C;  1GMJ A;  2JO1 A;  4OGQ C;  2IBZ E;  1L2P A;  2KOG A;  1NTZ E;  5E79 H;  3Q5R A;  2YNY A;  1LWU A;  1LTA C;  1KIL A;  4AUW A;  2BCC J;  3C1L A;  1RF1 B;  5CCG D;  1JY2 P;  3JC2 2;  3F89 A;  3CCU P;  1L0L G;  3L73 E;  3H25 A;  3L37 A;  3S1K A;  2MJZ A;  5TIS H;  3L75 D;  2QRX A;  4C7N A;  2Q9I A;  3OJA B;  3VMA A;  1JMB A;  1AJY A;  2Z4E A;  1VQ6 P;  4Y28 J;  2BEZ F;  1AVO A;  1BCC J;  2O01 N;  3M0D C;  1FZE A;  2WVR A;  5KAI H;  1SQB D;  2O01 J;  2WSC H;  2M0B A;  4OGQ B;  2ZXE B;  3TGU E;  1RE4 A;  2J58 A;  1FZB A;  3USS A;  1L0L D;  4H0L D;  5KAF E;  3BCC G;  1FS0 E;  1BGY J;  1GL2 C;  1LJ2 A;  3WU2 E;  2PRR A;  1U7J A;  1XTC C;  1NTK E;  1KC8 Q;  2KZJ A;  1JB0 J;  3E1I A;  3Q1M A;  1RF1 A;  3AE1 C;  1SQB K;  3H1J E;  2K1A A;  4PJ0 E;  1ZME C;  3MUD C;  1S3J A;  2WMM A;  1L0L K;  1PV3 A;  3A0B E;  1N7S C;  4KHX A;  3BCC D;  1W2B O;  1KYO I;  5B5E H;  2ZXX A;  3KQG A;  4W80 A;  1LTS C;  4R4L A;  3F5H A;  1MUU A;  1DIP A;  1S4X A;  1EQ7 A;  3ITK A;  3IR9 A;  3VMY A;  3FWN A;  4PD4 E;  1GL2 B;  1FC2 C;  1SQQ D;  3M9B A;  3C8V A;  2JJL A;  2ZVO B;  2Q7C A;  1VQP P;  3BAT A;  3E7K A;  4D6T G;  3CX5 D;  1NJI Q;  1EXI A;  1H89 A;  4M3L A;  3IAO A;  1VQK P;  2Y9Y A;  3LW5 J;  4GT1 A;  1OMI A;  1N7S B;  3NTN A;  5AVY B;  1SQV E;  5KLV D;  2E75 D;  2OYO A;  3N7N A;  1SQQ K;  5H2F E;  2HLO A;  4EYY Q;  3H1K J;  3L71 J;  3M0D A;  2A06 E;  1XTG B;  1QEX A;  4Z1M H;  1K8A Q;  5KKZ C;  1ZXG A;  2PGD A;  3N4X A;  2M5A B;  3A5T A;  1NVO A;  3LID A;  3V5B A;  2B87 B;  1NTM J;  1GL2 A;  1JTH B;  5KLV K;  1U57 A;  3QWO C;  5APS A;  2K88 A;  1LTG C;  3V4Q A;  3W67 A;  1VF5 C;  2BCC G;  1FZC C;  1SQB E;  3IF4 A;  1OW6 A;  3MUD A;  5APX A;  2C0W A;  1LTJ C;  1NKZ B;  1N7S A;  1KV4 A;  2XNX A;  1R5L A;  3CMA P;  3MGN A;  5AW1 B;  1KOR A;  1QL1 A;  3L36 A;  2K9Y A;  2AXT E;  1SQX J;  3QH9 A;  5KKZ B;  1HTL C;  4I6M C;  1YIT P;  2C0X A;  2QM8 A;  3L75 J;  2H43 A;  1BCC G;  2SPZ A;  4WVZ A;  1S9K D;  2YO2 A;  2C9L Y;  1EDI A;  5M1B A;  2Q6Q A;  1HGV A;  2OTL P;  3PH0 A;  2BCC D;  3CCL P;  1HF9 A;  3SFD C;  3HRN A;  2XND H;  3L74 E;  1YJN P;  2B87 A;  2V4H A;  1GTW A;  1VQ7 P;  1JTH A;  3NXS A;  3AEA C;  2H7H A;  1M90 Q;  4TT3 H;  1FZC B;  1S1C X;  1BGY G;  1WT6 A;  3C9I A;  1T8Z A;  2IDB A;  3OW2 O;  1G1I A;  3GG2 A;  3IFM A;  2WPS A;  2JEE A;  3AE9 C;  2R3C A;  1LTJ B;  3V6I A;  1BCC D;  3CWB J;  2E5T A;  1FE6 A;  2DW3 A;  2R3S A;  3O6Q B;  3P8C D;  5CMZ A;  3TNU B;  4WY4 C;  1LTB C;  4N78 E;  1PPJ E;  1LT1 A;  2ZYG A;  4IFF A;  1NU1 E;  2JDI H;  1LT9 B;  3RK3 E;  3CX5 H;  5AVT B;  2W90 A;  4DOJ A;  1FOS F;  2Q5U A;  1OW8 A;  1BE3 G;  3WUV A;  1BGY D;  1KQS O;  2ZT9 B;  3CX5 I;  3L70 G;  2YO3 A;  5B66 H;  2FY8 A;  5KLV E;  3CCS P;  1T2K D;  3CCQ P;  5APQ A;  3VP8 A;  1KIL C;  1L4A D;  2GUS A;  1FZC A;  1EZV E;  2FYN C;  2B88 A;  1JEK A;  3FGA D;  2AXC A;  3L72 G;  4WY4 B;  1NTK G;  1X9V A;  3R2P A;  1GDT A;  1BE3 D;  3A0H H;  1FOS E;  2WWW A;  4H13 D;  1LTJ A;  1OIP A;  1Q90 D;  4JYB A;  1BDD A;  3L70 D;  2QJK C;  3O6Q A;  3HE4 B;  3TNU A;  1OZH A;  2RMZ A;  3H1J G;  3AEG C;  2K37 A;  4OGQ D;  3SFE C;  1IFM A;  3O8Z A;  2AEM A;  3AE7 C;  1LT9 A;  1N2D C;  1T3U A;  2HPC B;  2O3J A;  2QJP C;  1BDC A;  3CI9 A;  1H0T B;  3GF3 A;  5AVZ B;  3MZW B;  2OGU A;  1SQP E;  1JCD A;  4RKU J;  4U3F J;  4D6T J;  1EDJ A;  5TJH A;  3M0A A;  4NPD A;  3V2N A;  3A3Y B;  4KJM A;  2WT7 B;  2A45 G;  3KZI E;  2QJK B;  5CBO A;  3L71 D;  1RF1 C;  4WY4 A;  1SP4 A;  2RN0 A;  2PAJ A;  1M56 D;  1ZRT D;  1L0N G;  3HE4 A;  3M9H A;  1VQ5 P;  3H1I G;  2NRG A;  4N3Y B;  2QJP B;  1MV8 A;  1GL2 D;  1NTM D;  3LIE A;  1YTZ T;  1MKM A;  1Y8A A;  2E5Y A;  3TDK A;  1N73 C;  1SQX G;  4L75 A;  2HPC A;  1EXJ A;  1PGP A;  4PV1 B;  2FYU G;  1H0T A;  2E43 A;  2O01 H;  2C9N Y;  3I55 P;  3RL0 B;  2V7Q H;  4I7Z C;  4JF7 A;  1P84 D;  1KMI Z;  3SWY A;  1FAV A;  1L0N D;  1OWA A;  3W68 A;  1J1E C;  2NPS B;  1N7S D;  1YYC A;  5E79 E;  3H1I D;  1KD1 Q;  1CI6 B;  1NTM K;  3B4S A;  2WT7 A; 
#chains in the Genus database with same CATH homology
 2Q1K A;  2QVA A;  1DEE G;  1EDL A;  2KZI A;  1OVR A;  2K3R A;  2OTK E;  5EFW B;  1EDJ A;  2M0B A;  1ZW0 A;  4NPD A;  4K35 A;  4KJM A;  2I8D A;  4NPE A;  3ZDM A;  2P58 A;  1MFT A;  4JBZ A;  2LXC B;  5CBO A;  1Q2N A;  2RKL A;  2LR2 A;  2SPZ A;  5K5G B;  4HKZ H;  1U7J A;  1OVV A;  5DJU B;  3MHV A;  1EDI A;  4CPG A;  4ZMD A;  3PH0 A;  2KZJ A;  2HR3 A;  2R44 A;  2B88 A;  4EYY Q;  4ASV A;  1U7M A;  1EC5 A;  2B87 A;  2KS1 B;  1BDD A;  1S3J A;  1ZXG A;  4HB1 A;  2WMM A;  3RGU A;  4ASW A;  4BXL A;  2M5A B;  5C39 A;  2LXB A;  2ZAE B;  4HJG H;  1LP1 A;  1H0T A;  1NVO A;  1Y47 A;  5DJT B;  1SS1 A;  2M5A A;  3FXD A;  2B87 B;  2KI7 B;  1JM0 A;  5CBN A;  4WWI A;  3S1K A;  4IOI H;  3FXE A;  2KUB A;  2JWD A;  4GOF A;  2QRX A;  3QWO C;  1BDC A;  2B89 A;  1LP1 B;  1EDK A;  2UWJ E;  1JMB A;  4NPF X;  1H0T B;  4ZNC A;  1LT1 A;  4MN4 C;  3MZW B;  4GOD A;  4GOE A;  1OVU A;  2KIK A;  4K3A A;  1X0T A;  1FC2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...