2UWNA

Crystal structure of human complement factor h, scr domains 6-8 (h402 risk variant), in complex with ligand.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
187
structure length
187
Chain Sequence
MGLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN COMPLEMENT FACTOR H
publication title Structural Basis for Complement Factor H Linked Age-Related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA03
3GOVA 1GPZA 2MCZA 1OK1A 4MUCA 2A55A 5HYUB 1Q3XA 1MD8A 2XWJI 2W81A 3RJ3D 1VVCA 2KRIA 3MQLA 4C16A 4CSYA 2UWNA 3EJHA 2CG6A 2RKYA 3INBC 4AYMA 1QO6A 2RL0A 1E88A 2CKUA 3R62A 1E8BA 3T5OA 3ZRZA 2XRBA 4PZ5A 3ZD1A 5FO8C 2B5ID 2WIIC 1HCCA 1GKGA 1NWVA 4KKDA 2EHFA 4AYEA 3ERBA 1ZJKA 1QUBA 4WJG2 5HYPA 1OK9A 1LY2A 2O39C 1G4FA 2RLPA 3KXVA 5JPMG 4A5WB 3SW0X 4LOSA 4B2RA 4AYIA 1TPNA 2XRDA 2EC3A 2RLQA 4YNXA 2XQWC 3ZD2A 2JGWA 1E5GA 3O8EB 2BZMA 1TPGA 1G4GA 1PPQA 1OK2A 2KMSA 1C1ZA 2G7IA 2LOJA 4J38B 2YBYA 1GKNA 3IU3I 4ONTD 1H2QP 1U5MA 1UOTP 2CG7A 3KZJA 1ELVA 2XWBF 1GHQB 1OJYA 1QGBA 4ZH1D 3OP8A 1OJWA 2JRAA 2MCYA 2V8EA 2IZ3A 2ERJA 3GXEA 1H04P 1H2PP 3OEDC 2W80A 4IGDA 3TVJA 5I0QB 4B2SA 4K12A 1MD7A 2QY0A 1SRZA 2JGXA 1O9AA 4FXGG 1OK3A 1H03P 3OXUD 1HFIA 1CKLA 1HFHA 5HYTB 1VVDA 4LOTA 4AYDA 2IZ4A 4F4OC 1FBRA 1SS2A 4JHSA 1OJVA 4DJZA 3M7PA 2YRAA 3L89M 1TPMA 3IX0A 5HZPB 3CALA 2RKZA 1Z92B 3NFPI
chains in the Genus database with same CATH superfamily
3GOVA 1GPZA 2MCZA 3NJAA 1OK1A 3WSYA 4MUCA 2A55A 5HYUB 1Q3XA 1MD8A 2XWJI 2W81A 3RJ3D 1VVCA 2KRIA 3MQLA 4C16A 4CSYA 2UWNA 3EJHA 2CG6A 2RKYA 3INBC 4AYMA 1QO6A 2RL0A 1E88A 2CKUA 3K3TA 3R62A 1E8BA 5DN4A 3T5OA 3ZRZA 2XRBA 4PZ5A 3ZD1A 5FO8C 2B5ID 2WIIC 1HCCA 1GKGA 1NWVA 4KKDA 2EHFA 4AYEA 3ERBA 1ZJKA 1QUBA 4WJG2 5HYPA 1OK9A 1LY2A 2O39C 1G4FA 2RLPA 3KXVA 3WSXA 4MSLA 5JPMG 4A5WB 3SW0X 4LOSA 4B2RA 4AYIA 1TPNA 2XRDA 2EC3A 2RLQA 2Y8RA 2XQWC 3F6KA 2JGWA 3FGTA 4YIZA 4YNXA 3ZD2A 3O8EB 1E5GA 2BZMA 1TPGA 1G4GA 1PPQA 1OK2A 2KMSA 1C1ZA 2G7IA 2ZYCA 2LOJA 4APLA 2I2LA 4J38B 2YBYA 1GKNA 3IU3I 4ONTD 1H2QP 1U5MA 1UOTP 2CG7A 3KZJA 4PO7A 1ELVA 2XWBF 1GHQB 1OJYA 1QGBA 1RLHA 4ZH1D 3OP8A 1OJWA 2JRAA 2Y8SA 2MCYA 3FGRA 2V8EA 2IZ3A 4BWCA 2ERJA 3GXEA 1H04P 3ZLDA 1H2PP 3OEDC 2W80A 4IGDA 3TVJA 5I0QB 4B2SA 4K12A 1MD7A 2QY0A 1SRZA 2JGXA 1O9AA 4FXGG 5DN5A 1OK3A 3ZLEA 1H03P 3OXUD 1HFIA 1CKLA 2X2ZA 1HFHA 5HYTB 2Y8TA 1VVDA 4LOTA 4AYDA 2IZ4A 3VWOA 4F4OC 1FBRA 1SS2A 4JHSA 1OJVA 4N7EA 4DJZA 3M7PA 2YRAA 3L89M 1TPMA 3IX0A 5HZPB 3CALA 3CI0J 2RKZA 1Z92B 3NFPI
chains in the Genus database with same CATH topology
3GOVA 1GPZA 2MCZA 1OK1A 4MUCA 2A55A 5HYUB 1Q3XA 1MD8A 2XWJI 2W81A 3RJ3D 1VVCA 2KRIA 3MQLA 4C16A 4CSYA 2UWNA 3EJHA 2CG6A 2RKYA 3INBC 4AYMA 1QO6A 2RL0A 1E88A 2CKUA 3R62A 1E8BA 3T5OA 3ZRZA 2XRBA 4PZ5A 3ZD1A 5FO8C 2B5ID 2WIIC 1HCCA 1GKGA 1NWVA 4KKDA 2EHFA 4AYEA 3ERBA 1ZJKA 1QUBA 4WJG2 5HYPA 1OK9A 1LY2A 2O39C 1G4FA 2RLPA 3KXVA 5JPMG 4A5WB 3SW0X 4LOSA 4B2RA 4AYIA 1TPNA 2XRDA 2EC3A 2RLQA 4YNXA 2XQWC 3ZD2A 2JGWA 1E5GA 3O8EB 2BZMA 1TPGA 1G4GA 1PPQA 1OK2A 2KMSA 1C1ZA 2G7IA 2LOJA 4J38B 2YBYA 1GKNA 3IU3I 4ONTD 1H2QP 1U5MA 1UOTP 2CG7A 3KZJA 1ELVA 2XWBF 1GHQB 1OJYA 1QGBA 4ZH1D 3OP8A 1OJWA 2JRAA 2MCYA 2V8EA 2IZ3A 2ERJA 3GXEA 1H04P 1H2PP 3OEDC 2W80A 4IGDA 3TVJA 5I0QB 4B2SA 4K12A 1MD7A 2QY0A 1SRZA 2JGXA 1O9AA 4FXGG 1OK3A 1H03P 3OXUD 1HFIA 1CKLA 1HFHA 5HYTB 1VVDA 4LOTA 4AYDA 2IZ4A 4F4OC 1FBRA 1SS2A 4JHSA 1OJVA 4DJZA 3M7PA 2YRAA 3L89M 1TPMA 3IX0A 5HZPB 3CALA 2RKZA 1Z92B 3NFPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GOV A;  1GPZ A;  2MCZ A;  1OK1 A;  4MUC A;  2A55 A;  5HYU B;  1Q3X A;  1MD8 A;  2XWJ I;  2W81 A;  3RJ3 D;  1VVC A;  2KRI A;  3MQL A;  4C16 A;  4CSY A;  2UWN A;  3EJH A;  2CG6 A;  2RKY A;  3INB C;  4AYM A;  1QO6 A;  2RL0 A;  1E88 A;  2CKU A;  3R62 A;  1E8B A;  3T5O A;  3ZRZ A;  2XRB A;  4PZ5 A;  3ZD1 A;  5FO8 C;  2B5I D;  2WII C;  1HCC A;  1GKG A;  1NWV A;  4KKD A;  2EHF A;  4AYE A;  3ERB A;  1ZJK A;  1QUB A;  4WJG 2;  5HYP A;  1OK9 A;  1LY2 A;  2O39 C;  1G4F A;  2RLP A;  3KXV A;  5JPM G;  4A5W B;  3SW0 X;  4LOS A;  4B2R A;  4AYI A;  1TPN A;  2XRD A;  2EC3 A;  2RLQ A;  4YNX A;  2XQW C;  3ZD2 A;  2JGW A;  1E5G A;  3O8E B;  2BZM A;  1TPG A;  1G4G A;  1PPQ A;  1OK2 A;  2KMS A;  1C1Z A;  2G7I A;  2LOJ A;  4J38 B;  2YBY A;  1GKN A;  3IU3 I;  4ONT D;  1H2Q P;  1U5M A;  1UOT P;  2CG7 A;  3KZJ A;  1ELV A;  2XWB F;  1GHQ B;  1OJY A;  1QGB A;  4ZH1 D;  3OP8 A;  1OJW A;  2JRA A;  2MCY A;  2V8E A;  2IZ3 A;  2ERJ A;  3GXE A;  1H04 P;  1H2P P;  3OED C;  2W80 A;  4IGD A;  3TVJ A;  5I0Q B;  4B2S A;  4K12 A;  1MD7 A;  2QY0 A;  1SRZ A;  2JGX A;  1O9A A;  4FXG G;  1OK3 A;  1H03 P;  3OXU D;  1HFI A;  1CKL A;  1HFH A;  5HYT B;  1VVD A;  4LOT A;  4AYD A;  2IZ4 A;  4F4O C;  1FBR A;  1SS2 A;  4JHS A;  1OJV A;  4DJZ A;  3M7P A;  2YRA A;  3L89 M;  1TPM A;  3IX0 A;  5HZP B;  3CAL A;  2RKZ A;  1Z92 B;  3NFP I; 
#chains in the Genus database with same CATH topology
 3GOV A;  1GPZ A;  2MCZ A;  3NJA A;  1OK1 A;  3WSY A;  4MUC A;  2A55 A;  5HYU B;  1Q3X A;  1MD8 A;  2XWJ I;  2W81 A;  3RJ3 D;  1VVC A;  2KRI A;  3MQL A;  4C16 A;  4CSY A;  2UWN A;  3EJH A;  2CG6 A;  2RKY A;  3INB C;  4AYM A;  1QO6 A;  2RL0 A;  1E88 A;  2CKU A;  3K3T A;  3R62 A;  1E8B A;  5DN4 A;  3T5O A;  3ZRZ A;  2XRB A;  4PZ5 A;  3ZD1 A;  5FO8 C;  2B5I D;  2WII C;  1HCC A;  1GKG A;  1NWV A;  4KKD A;  2EHF A;  4AYE A;  3ERB A;  1ZJK A;  1QUB A;  4WJG 2;  5HYP A;  1OK9 A;  1LY2 A;  2O39 C;  1G4F A;  2RLP A;  3KXV A;  3WSX A;  4MSL A;  5JPM G;  4A5W B;  3SW0 X;  4LOS A;  4B2R A;  4AYI A;  1TPN A;  2XRD A;  2EC3 A;  2RLQ A;  2Y8R A;  2XQW C;  3F6K A;  2JGW A;  3FGT A;  4YIZ A;  4YNX A;  3ZD2 A;  3O8E B;  1E5G A;  2BZM A;  1TPG A;  1G4G A;  1PPQ A;  1OK2 A;  2KMS A;  1C1Z A;  2G7I A;  2ZYC A;  2LOJ A;  4APL A;  2I2L A;  4J38 B;  2YBY A;  1GKN A;  3IU3 I;  4ONT D;  1H2Q P;  1U5M A;  1UOT P;  2CG7 A;  3KZJ A;  4PO7 A;  1ELV A;  2XWB F;  1GHQ B;  1OJY A;  1QGB A;  1RLH A;  4ZH1 D;  3OP8 A;  1OJW A;  2JRA A;  2Y8S A;  2MCY A;  3FGR A;  2V8E A;  2IZ3 A;  4BWC A;  2ERJ A;  3GXE A;  1H04 P;  3ZLD A;  1H2P P;  3OED C;  2W80 A;  4IGD A;  3TVJ A;  5I0Q B;  4B2S A;  4K12 A;  1MD7 A;  2QY0 A;  1SRZ A;  2JGX A;  1O9A A;  4FXG G;  5DN5 A;  1OK3 A;  3ZLE A;  1H03 P;  3OXU D;  1HFI A;  1CKL A;  2X2Z A;  1HFH A;  5HYT B;  2Y8T A;  1VVD A;  4LOT A;  4AYD A;  2IZ4 A;  3VWO A;  4F4O C;  1FBR A;  1SS2 A;  4JHS A;  1OJV A;  4N7E A;  4DJZ A;  3M7P A;  2YRA A;  3L89 M;  1TPM A;  3IX0 A;  5HZP B;  3CAL A;  3CI0 J;  2RKZ A;  1Z92 B;  3NFP I; 
#chains in the Genus database with same CATH homology
 3GOV A;  1GPZ A;  2MCZ A;  1OK1 A;  4MUC A;  2A55 A;  5HYU B;  1Q3X A;  1MD8 A;  2XWJ I;  2W81 A;  3RJ3 D;  1VVC A;  2KRI A;  3MQL A;  4C16 A;  4CSY A;  2UWN A;  3EJH A;  2CG6 A;  2RKY A;  3INB C;  4AYM A;  1QO6 A;  2RL0 A;  1E88 A;  2CKU A;  3R62 A;  1E8B A;  3T5O A;  3ZRZ A;  2XRB A;  4PZ5 A;  3ZD1 A;  5FO8 C;  2B5I D;  2WII C;  1HCC A;  1GKG A;  1NWV A;  4KKD A;  2EHF A;  4AYE A;  3ERB A;  1ZJK A;  1QUB A;  4WJG 2;  5HYP A;  1OK9 A;  1LY2 A;  2O39 C;  1G4F A;  2RLP A;  3KXV A;  5JPM G;  4A5W B;  3SW0 X;  4LOS A;  4B2R A;  4AYI A;  1TPN A;  2XRD A;  2EC3 A;  2RLQ A;  4YNX A;  2XQW C;  3ZD2 A;  2JGW A;  1E5G A;  3O8E B;  2BZM A;  1TPG A;  1G4G A;  1PPQ A;  1OK2 A;  2KMS A;  1C1Z A;  2G7I A;  2LOJ A;  4J38 B;  2YBY A;  1GKN A;  3IU3 I;  4ONT D;  1H2Q P;  1U5M A;  1UOT P;  2CG7 A;  3KZJ A;  1ELV A;  2XWB F;  1GHQ B;  1OJY A;  1QGB A;  4ZH1 D;  3OP8 A;  1OJW A;  2JRA A;  2MCY A;  2V8E A;  2IZ3 A;  2ERJ A;  3GXE A;  1H04 P;  1H2P P;  3OED C;  2W80 A;  4IGD A;  3TVJ A;  5I0Q B;  4B2S A;  4K12 A;  1MD7 A;  2QY0 A;  1SRZ A;  2JGX A;  1O9A A;  4FXG G;  1OK3 A;  1H03 P;  3OXU D;  1HFI A;  1CKL A;  1HFH A;  5HYT B;  1VVD A;  4LOT A;  4AYD A;  2IZ4 A;  4F4O C;  1FBR A;  1SS2 A;  4JHS A;  1OJV A;  4DJZ A;  3M7P A;  2YRA A;  3L89 M;  1TPM A;  3IX0 A;  5HZP B;  3CAL A;  2RKZ A;  1Z92 B;  3NFP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...