2UWNA

Crystal structure of human complement factor h, scr domains 6-8 (h402 risk variant), in complex with ligand.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
187
structure length
187
Chain Sequence
b'MGLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN COMPLEMENT FACTOR H
publication title Structural Basis for Complement Factor H Linked Age-Related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2uwnA03
1VVCA 2W80A 2G7IA 1Z92B 2MCZA 2O39C 3KZJA 3SW0X 1G4GA 3RJ3D 1OJVA 2RKYA 5I0QB 1QO6A 1Q3XA 1GHQB 2XWJI 1E88A 4LOTA 4CSYA 1H04P 1HFIA 3ZD2A 2ERJA 2V8EA 4ONTD 3TVJA 4K12A 2RLQA 4AYEA 1TPGA 2YBYA 3L89M 3ZD1A 1OK3A 2RLPA 4MUCA 1SRZA 1C1ZA 2CKUA 2CG6A 2KRIA 1E8BA 2QY0A 3IU3I 3OP8A 1MD7A 5JPMG 2A55A 1FBRA 3OXUD 1H2QP 4F4OC 3R62A 2IZ4A 4JHSA 2KMSA 3MQLA 3EJHA 4ZH1D 1OJWA 3GXEA 5HYTB 1NWVA 3ZRZA 4B2RA 2JGXA 4FXGG 2UWNA 3O8EB 2WIIC 4AYMA 1ZJKA 2RKZA 2B5ID 4PZ5A 5FO8C 2LOJA 4DJZA 1VVDA 2XRDA 2EC3A 1H03P 3T5OA 2JRAA 2EHFA 2XQWC 3ERBA 5HYUB 4A5WB 1U5MA 4C16A 1SS2A 2W81A 3INBC 1OK9A 1OJYA 2RL0A 1E5GA 2MCYA 2YRAA 1OK1A 4B2SA 2IZ3A 4WJG2 3NFPI 3CALA 4AYIA 3M7PA 2XWBF 4YNXA 4J38B 5HYPA 1ELVA 3IX0A 2XRBA 1GKNA 2BZMA 4KKDA 3KXVA 5HZPB 1CKLA 1TPNA 4IGDA 1UOTP 2CG7A 2JGWA 3OEDC 1GKGA 1LY2A 1QGBA 1TPMA 1H2PP 1GPZA 4AYDA 1HFHA 1OK2A 4LOSA 1HCCA 1MD8A 3GOVA 1PPQA 1G4FA 1O9AA 1QUBA
chains in the Genus database with same CATH superfamily
1VVCA 2W80A 2G7IA 1Z92B 2MCZA 2O39C 3KZJA 3SW0X 1G4GA 3RJ3D 1OJVA 2RKYA 5I0QB 1QO6A 1Q3XA 1GHQB 2XWJI 1E88A 4LOTA 4CSYA 1H04P 1HFIA 3ZD2A 3FGTA 2ERJA 2V8EA 4ONTD 3TVJA 4K12A 2RLQA 4AYEA 1TPGA 2YBYA 3L89M 3ZD1A 1OK3A 3ZLDA 2RLPA 4MUCA 1SRZA 1C1ZA 3WSXA 2CKUA 2CG6A 2KRIA 1E8BA 2QY0A 3F6KA 3IU3I 3OP8A 5DN4A 1MD7A 5JPMG 2A55A 4MSLA 1FBRA 3OXUD 1H2QP 4F4OC 3R62A 2IZ4A 4JHSA 2KMSA 3MQLA 1RLHA 3EJHA 4ZH1D 1OJWA 3GXEA 5HYTB 1NWVA 3ZRZA 4B2RA 2JGXA 4FXGG 2UWNA 3O8EB 3VWOA 2WIIC 5DN5A 1ZJKA 4AYMA 2RKZA 2B5ID 4PZ5A 5FO8C 2LOJA 4DJZA 1VVDA 2XRDA 2EC3A 1H03P 3T5OA 2JRAA 2EHFA 2XQWC 3ERBA 5HYUB 4A5WB 1U5MA 3CI0J 4C16A 1SS2A 2W81A 3INBC 1OK9A 4BWCA 1OJYA 2RL0A 1E5GA 2MCYA 2YRAA 1OK1A 3K3TA 4B2SA 2IZ3A 4WJG2 2X2ZA 3NFPI 4YIZA 3CALA 4AYIA 3M7PA 2XWBF 4YNXA 4J38B 5HYPA 1ELVA 3IX0A 2XRBA 3ZLEA 4N7EA 1GKNA 2BZMA 4KKDA 3KXVA 2Y8SA 2Y8TA 5HZPB 4APLA 1CKLA 1TPNA 4IGDA 1UOTP 2CG7A 2JGWA 3OEDC 1GKGA 1LY2A 1QGBA 2I2LA 2ZYCA 1TPMA 1H2PP 4PO7A 1GPZA 4AYDA 3FGRA 1HFHA 1OK2A 2Y8RA 4LOSA 3WSYA 1HCCA 1MD8A 3GOVA 1PPQA 3NJAA 1G4FA 1O9AA 1QUBA
chains in the Genus database with same CATH topology
1VVCA 2W80A 2G7IA 1Z92B 2MCZA 2O39C 3KZJA 3SW0X 1G4GA 3RJ3D 1OJVA 2RKYA 5I0QB 1QO6A 1Q3XA 1GHQB 2XWJI 1E88A 4LOTA 4CSYA 1H04P 1HFIA 3ZD2A 2ERJA 2V8EA 4ONTD 3TVJA 4K12A 2RLQA 4AYEA 1TPGA 2YBYA 3L89M 3ZD1A 1OK3A 2RLPA 4MUCA 1SRZA 1C1ZA 2CKUA 2CG6A 2KRIA 1E8BA 2QY0A 3IU3I 3OP8A 1MD7A 5JPMG 2A55A 1FBRA 3OXUD 1H2QP 4F4OC 3R62A 2IZ4A 4JHSA 2KMSA 3MQLA 3EJHA 4ZH1D 1OJWA 3GXEA 5HYTB 1NWVA 3ZRZA 4B2RA 2JGXA 4FXGG 2UWNA 3O8EB 2WIIC 4AYMA 1ZJKA 2RKZA 2B5ID 4PZ5A 5FO8C 2LOJA 4DJZA 1VVDA 2XRDA 2EC3A 1H03P 3T5OA 2JRAA 2EHFA 2XQWC 3ERBA 5HYUB 4A5WB 1U5MA 4C16A 1SS2A 2W81A 3INBC 1OK9A 1OJYA 2RL0A 1E5GA 2MCYA 2YRAA 1OK1A 4B2SA 2IZ3A 4WJG2 3NFPI 3CALA 4AYIA 3M7PA 2XWBF 4YNXA 4J38B 5HYPA 1ELVA 3IX0A 2XRBA 1GKNA 2BZMA 4KKDA 3KXVA 5HZPB 1CKLA 1TPNA 4IGDA 1UOTP 2CG7A 2JGWA 3OEDC 1GKGA 1LY2A 1QGBA 1TPMA 1H2PP 1GPZA 4AYDA 1HFHA 1OK2A 4LOSA 1HCCA 1MD8A 3GOVA 1PPQA 1G4FA 1O9AA 1QUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VVC A;  2W80 A;  2G7I A;  1Z92 B;  2MCZ A;  2O39 C;  3KZJ A;  3SW0 X;  1G4G A;  3RJ3 D;  1OJV A;  2RKY A;  5I0Q B;  1QO6 A;  1Q3X A;  1GHQ B;  2XWJ I;  1E88 A;  4LOT A;  4CSY A;  1H04 P;  1HFI A;  3ZD2 A;  2ERJ A;  2V8E A;  4ONT D;  3TVJ A;  4K12 A;  2RLQ A;  4AYE A;  1TPG A;  2YBY A;  3L89 M;  3ZD1 A;  1OK3 A;  2RLP A;  4MUC A;  1SRZ A;  1C1Z A;  2CKU A;  2CG6 A;  2KRI A;  1E8B A;  2QY0 A;  3IU3 I;  3OP8 A;  1MD7 A;  5JPM G;  2A55 A;  1FBR A;  3OXU D;  1H2Q P;  4F4O C;  3R62 A;  2IZ4 A;  4JHS A;  2KMS A;  3MQL A;  3EJH A;  4ZH1 D;  1OJW A;  3GXE A;  5HYT B;  1NWV A;  3ZRZ A;  4B2R A;  2JGX A;  4FXG G;  2UWN A;  3O8E B;  2WII C;  4AYM A;  1ZJK A;  2RKZ A;  2B5I D;  4PZ5 A;  5FO8 C;  2LOJ A;  4DJZ A;  1VVD A;  2XRD A;  2EC3 A;  1H03 P;  3T5O A;  2JRA A;  2EHF A;  2XQW C;  3ERB A;  5HYU B;  4A5W B;  1U5M A;  4C16 A;  1SS2 A;  2W81 A;  3INB C;  1OK9 A;  1OJY A;  2RL0 A;  1E5G A;  2MCY A;  2YRA A;  1OK1 A;  4B2S A;  2IZ3 A;  4WJG 2;  3NFP I;  3CAL A;  4AYI A;  3M7P A;  2XWB F;  4YNX A;  4J38 B;  5HYP A;  1ELV A;  3IX0 A;  2XRB A;  1GKN A;  2BZM A;  4KKD A;  3KXV A;  5HZP B;  1CKL A;  1TPN A;  4IGD A;  1UOT P;  2CG7 A;  2JGW A;  3OED C;  1GKG A;  1LY2 A;  1QGB A;  1TPM A;  1H2P P;  1GPZ A;  4AYD A;  1HFH A;  1OK2 A;  4LOS A;  1HCC A;  1MD8 A;  3GOV A;  1PPQ A;  1G4F A;  1O9A A;  1QUB A; 
#chains in the Genus database with same CATH topology
 1VVC A;  2W80 A;  2G7I A;  1Z92 B;  2MCZ A;  2O39 C;  3KZJ A;  3SW0 X;  1G4G A;  3RJ3 D;  1OJV A;  2RKY A;  5I0Q B;  1QO6 A;  1Q3X A;  1GHQ B;  2XWJ I;  1E88 A;  4LOT A;  4CSY A;  1H04 P;  1HFI A;  3ZD2 A;  3FGT A;  2ERJ A;  2V8E A;  4ONT D;  3TVJ A;  4K12 A;  2RLQ A;  4AYE A;  1TPG A;  2YBY A;  3L89 M;  3ZD1 A;  1OK3 A;  3ZLD A;  2RLP A;  4MUC A;  1SRZ A;  1C1Z A;  3WSX A;  2CKU A;  2CG6 A;  2KRI A;  1E8B A;  2QY0 A;  3F6K A;  3IU3 I;  3OP8 A;  5DN4 A;  1MD7 A;  5JPM G;  2A55 A;  4MSL A;  1FBR A;  3OXU D;  1H2Q P;  4F4O C;  3R62 A;  2IZ4 A;  4JHS A;  2KMS A;  3MQL A;  1RLH A;  3EJH A;  4ZH1 D;  1OJW A;  3GXE A;  5HYT B;  1NWV A;  3ZRZ A;  4B2R A;  2JGX A;  4FXG G;  2UWN A;  3O8E B;  3VWO A;  2WII C;  5DN5 A;  1ZJK A;  4AYM A;  2RKZ A;  2B5I D;  4PZ5 A;  5FO8 C;  2LOJ A;  4DJZ A;  1VVD A;  2XRD A;  2EC3 A;  1H03 P;  3T5O A;  2JRA A;  2EHF A;  2XQW C;  3ERB A;  5HYU B;  4A5W B;  1U5M A;  3CI0 J;  4C16 A;  1SS2 A;  2W81 A;  3INB C;  1OK9 A;  4BWC A;  1OJY A;  2RL0 A;  1E5G A;  2MCY A;  2YRA A;  1OK1 A;  3K3T A;  4B2S A;  2IZ3 A;  4WJG 2;  2X2Z A;  3NFP I;  4YIZ A;  3CAL A;  4AYI A;  3M7P A;  2XWB F;  4YNX A;  4J38 B;  5HYP A;  1ELV A;  3IX0 A;  2XRB A;  3ZLE A;  4N7E A;  1GKN A;  2BZM A;  4KKD A;  3KXV A;  2Y8S A;  2Y8T A;  5HZP B;  4APL A;  1CKL A;  1TPN A;  4IGD A;  1UOT P;  2CG7 A;  2JGW A;  3OED C;  1GKG A;  1LY2 A;  1QGB A;  2I2L A;  2ZYC A;  1TPM A;  1H2P P;  4PO7 A;  1GPZ A;  4AYD A;  3FGR A;  1HFH A;  1OK2 A;  2Y8R A;  4LOS A;  3WSY A;  1HCC A;  1MD8 A;  3GOV A;  1PPQ A;  3NJA A;  1G4F A;  1O9A A;  1QUB A; 
#chains in the Genus database with same CATH homology
 1VVC A;  2W80 A;  2G7I A;  1Z92 B;  2MCZ A;  2O39 C;  3KZJ A;  3SW0 X;  1G4G A;  3RJ3 D;  1OJV A;  2RKY A;  5I0Q B;  1QO6 A;  1Q3X A;  1GHQ B;  2XWJ I;  1E88 A;  4LOT A;  4CSY A;  1H04 P;  1HFI A;  3ZD2 A;  2ERJ A;  2V8E A;  4ONT D;  3TVJ A;  4K12 A;  2RLQ A;  4AYE A;  1TPG A;  2YBY A;  3L89 M;  3ZD1 A;  1OK3 A;  2RLP A;  4MUC A;  1SRZ A;  1C1Z A;  2CKU A;  2CG6 A;  2KRI A;  1E8B A;  2QY0 A;  3IU3 I;  3OP8 A;  1MD7 A;  5JPM G;  2A55 A;  1FBR A;  3OXU D;  1H2Q P;  4F4O C;  3R62 A;  2IZ4 A;  4JHS A;  2KMS A;  3MQL A;  3EJH A;  4ZH1 D;  1OJW A;  3GXE A;  5HYT B;  1NWV A;  3ZRZ A;  4B2R A;  2JGX A;  4FXG G;  2UWN A;  3O8E B;  2WII C;  4AYM A;  1ZJK A;  2RKZ A;  2B5I D;  4PZ5 A;  5FO8 C;  2LOJ A;  4DJZ A;  1VVD A;  2XRD A;  2EC3 A;  1H03 P;  3T5O A;  2JRA A;  2EHF A;  2XQW C;  3ERB A;  5HYU B;  4A5W B;  1U5M A;  4C16 A;  1SS2 A;  2W81 A;  3INB C;  1OK9 A;  1OJY A;  2RL0 A;  1E5G A;  2MCY A;  2YRA A;  1OK1 A;  4B2S A;  2IZ3 A;  4WJG 2;  3NFP I;  3CAL A;  4AYI A;  3M7P A;  2XWB F;  4YNX A;  4J38 B;  5HYP A;  1ELV A;  3IX0 A;  2XRB A;  1GKN A;  2BZM A;  4KKD A;  3KXV A;  5HZP B;  1CKL A;  1TPN A;  4IGD A;  1UOT P;  2CG7 A;  2JGW A;  3OED C;  1GKG A;  1LY2 A;  1QGB A;  1TPM A;  1H2P P;  1GPZ A;  4AYD A;  1HFH A;  1OK2 A;  4LOS A;  1HCC A;  1MD8 A;  3GOV A;  1PPQ A;  1G4F A;  1O9A A;  1QUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...