2UWQA

Solution structure of aspp2 n-terminus
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
GGSMMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-STIMULATING OF P53 PROTEIN 2
publication title Solution structure of ASPP2 N-terminal domain (N-ASPP2) reveals a ubiquitin-like fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 8
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2uwqA00
3QQ8B 1TGZB 3RD2A 1WGYA 3CF6E 4FBJB 2ZNVB 2MX2A 2MSED 3M63B 2AL3A 4HLEA 3PVLA 3ZW3A 2N7EA 2AYOB 3PHXB 2NBWB 3DQVA 4KSLC 2JZZA 3ZNHB 3KW5B 1V86A 5IAAC 1E8WA 4AJWA 2Z0DB 2IBIB 1X1MA 2FNJB 2ZCCA 3TBLD 2BWFA 1WH3A 4MGZE 1VCBA 2MLBA 2KQ7A 2HE7A 3H1UA 2JRHA 3ZUNA 5CHFA 2IO3B 3DDCB 4EZJA 3A4SC 5CHVC 5JHAA 4K7UA 4MSQB 4NJ6A 3UF8A 2DZJA 4JL9A 2NR2A 4AOFA 4J6IA 1YIWA 2L00B 5AZGA 3HM6X 1UD7A 5IA7A 1UZXB 2CKHB 2BKFA 2KXJA 3ZLZA 1YJ1A 2RPQA 3SDLC 3T8MA 3V61A 1GNUA 2FUHB 2LZ6A 3NY5A 4A20A 2CR5A 3VHTC 2KX3A 3QJZA 2ZJDA 2WX0A 1WZ3A 3L17A 4W9EA 3PPAA 2LWPA 4BFRA 2ZNVC 4IWQA 3LDZE 1WJ4A 2MBOA 3A9JA 3VH3B 2C7NB 2NS5A 1P3QU 5KHOA 4MSMB 2I1KA 4DWFA 2WDTB 4ICUA 2W9NA 1KJTA 4FLHA 1EF5A 2G4SA 4HWIB 3QHTA 1WJUA 4GDKB 1E8XA 5E6OA 2BYFA 1WXMA 2KVRA 2KKCA 3H7PB 2DYOA 4W9KA 3RUIB 3U8ZA 3UIOB 3JVZX 3WA0A 3ZNID 3VVWB 1Q5WB 4IWPA 5C1ZA 2G3QB 4BVUC 1E8ZA 1H4RA 2HTHA 2D11A 3PLUA 2KMCA 2PE9A 2JVCA 2Z0EB 3BY4B 3PT2B 3S2AA 3TJPA 3SHQA 1OTRB 1V49A 2BWES 4GU2A 4NJ7A 1OGWA 3WAMA 4W9DA 4TUUA 1WX8A 4LDTB 3RULA 3H7SA 3QARA 4DDGD 2IO0B 1V80A 1WMHA 1XQQA 2CHXA 5FR6A 4B95A 3ZO5B 5L95C 2K39A 4PS3A 5TR5A 3VTVA 3QWZB 2D3GA 4JQWC 2I1JA 3DBSA 3IFWB 3U7DA 3V60A 5L83A 2M0XA 3C0RB 3PREA 3X23A 4GOCA 3W1YA 1U4AA 1WRDB 3X0WA 3EFUA 5J2RA 2N4FA 1R4NI 1Y8RC 3VQIA 3B08A 3OJ3A 3OJ4B 3KUCB 3PS6A 1MG8A 3JW0X 2G45B 2ZZPB 2JUOA 2G4DB 2C9WB 3P2BA 3ML8A 2LD9A 2O6VD 2V4LA 4AUQC 2AL6A 2C5LC 1WJ6A 4MGIE 3PSEB 4MJSB 2IO1B 3VH4B 4II3B 4EZKA 5D7GA 2UYZB 4OVUA 1I42A 1NI2A 4BKTA 1E7UA 3V62A 3KUZA 3B0AA 4WJNA 4HDOA 3QAQA 1BT0A 2MP2B 2NPTB 1Q0WB 5J17A 3KYCD 1GJZA 4PYUA 4WAAA 4GSWA 2Z59B 2KK8A 2KANA 3VTUA 4DK5A 5DPWA 4DHJD 3L0WB 2KDBA 2K25A 1NDDA 2XK5A 4HCNB 4N9F4 3VDZA 3W1SC 4A3PA 1J19A 4IM2A 1E5WA 1WR1A 2LI5A 3JSVB 4G3XB 1TZ1A 2J0MA 1XD3B 3UQBA 2GBRA 1V81A 3VAWA 3ZDTA 4FHKA 4W9HA 1Z5SB 5CTRC 1E7VA 2KTFA 4EEWA 4FADA 4CYEA 3QA8A 4B6WA 2KFJA 1SIFA 1EO6A 3PRZA 3DVGX 4BKSA 3R66C 4NAWB 2CHZA 2VRRB 4MEMA 3EHVA 4MH0E 2LUEA 2PJHA 2IZVB 1WXVA 3NOBA 2JZ3B 2ZEQA 2ZVNA 4XX5A 1WX9A 2O6VB 4ZRIA 4JGHB 3RCZA 2YVCA 5DPRA 4CHKA 1IPGA 2BYEA 2N1WA 2DHZA 3GZNI 4MM3A 2N9XA 4KDLB 1KOTA 2IY1B 2FAZA 2WYQA 3SU8X 3HM3A 2XBBC 3VFKA 2GBMA 2KQSA 2JXXA 4LJOB 2D10A 4HK2A 2HD5B 3KUDB 4FJVB 5CX3A 2RD0A 4LJPB 3AXCA 4K7WA 1T0YA 3DCGA 3AI5A 1PQSA 2LRWA 4IW0A 4KZCA 4HDQA 2A4ZA 5DCNA 3ZTCA 4W9GA 3AU5A 4IM3A 1GC6A 2LJ5A 4GIVA 5D94A 3CSTA 3N32A 4CO7A 1C1YB 3WANA 3APFA 3ZVVA 2JPHA 4K7SA 3V6EB 1L2NA 1RFAA 2KDEB 4OVVA 3NZSA 4FHJA 2N9EB 1A5RA 1IP9A 4I6NB 3JYUA 3W1SA 3AU4A 3A9KA 2KTRA 1RAXA 2ZVOA 4E71A 2MA9B 1OEYJ 4YL8A 1OEYA 4E3CA 3IHPC 1AARA 2KFKB 2JF5A 3DVNU 4PS7A 2MRPA 4RM9A 3OAWA 1UH6A 4LCDE 4WWNA 5JHBA 3A1QA 3VXWA 5BO4B 2GOWA 5LLIA 2DAJA 1WE6A 1RLFA 2NBUA 3L16A 4TQ0A 2KDFB 2D2QA 2GMIC 2J7QB 2R2OA 3L08A 4NNJB 4GDLA 3VUYA 3ZNGC 2ASQA 4ANWA 3IBEA 3TCAA 4DHZB 3UGBB 5EDSA 2KJHB 1K8RB 2N7DA 4MJSA 2KD0A 5D2MB 2LVPA 2WX1A 3V6CB 4JIOU 3QC8B 3R3MA 1KM7A 1WY8A 1WXAA 2PPHA 1XT9B 1WR6E 2NPTA 3QX1A 1ZKHA 4AP4C 4KIKB 4PS8A 1S3SG 4ZRJA 1GC7A 4ANVA 3WALA 4BBNF 4DHZE 2C60A 2DZIA 2DX5B 2KC1A 2L8JA 2DAFA 2OOBB 2O2VB 2JY6A 4HXDA 1WM3A 3AULA 3M62B 2KN5A 2C7MB 3ZNZB 3ZIMA 3IVFA 4NQKE 2MBHA 3A9JB 2MCNB 1WM2A 5AZHA 2MBEA 2LXCA 4F7ZA 5HKHA 1UBIA 3ONSA 4HCPB 3IG3A 3M3JA 1P1AA 3MHSD 4FJZA 4MELA 3H9DA 3Q3JA 1ZGUB 4URKA 3A33B 2QHOA 2DZKA 2K6QA 4BBNC 2IO2B 2K8BA 4NAWA 2GBNA 4KSKC 4WJQA 4ANUA 3EC8A 4TKNA 5AEKB 3R7RA 4I6LB 3HHMA 2LXAA 4GMVA 1QZEA 2LGYA 3MJWA 2DENB 4KV2A 5D6JB 2FCMA 3CSFA 4ZRKA 4EUTA 2FCQA 4AWJA 1V2YA 4DXAB 3ZKJC 4HPLB 4NY0A 2JT4B 1YQBA 2L0TA 3HIZA 2KHWB 2KNBA 1WGGA 3RYTA 1D3ZA 5E6NA 3PV1A 2LASA 4HPMB 4BOSC 4EOYA 2OJRA 4NQLB 4W9FA 1UBQA 2NCNA 4TV3A 2KZRA 2N9PC 2FCSA 2ZPNA 2KDIA 1YX5B 2V1YA 3L10B 3PRPB 4WQOB 1KLVA 3K9OB 3RZWC 1SE9A 1IYFA 1L7YA 1G6JA 5G55A 4MDKE 2KO3A 3LJ3A 1SGHA 4RM8A 1WE7A 2L05A 1RRBA 3UINB 3KVFB 1LXDA 2NBVB 2IY0B 4GDKA 4IG7B 4WWPA 2Y5BB 4BKSD 3ENEA 4B9KA 4ICVA 3RZFA 3H7PA 4HJKA 1WGDA 1WFYA 1FXTB 1TBEA 3D32A 1CMXB 2LGDA 3ZRFA 3DVGY 2KFKA 2RSUA 4DHJB 3QIJA 4KVGB 1R4MI 3VUXA 2C7HA 2M8SA 3K9PB 3ZDMC 2R2QA 4FJYA 3DBLI 5C23A 2M1MA 1YX6B 4IM0A 2PE6B 5DPTA 1GUAB 3BINA 1C3TA 2WWZA 2KWVB 2N1VA 4MGKE 3I3TB 1HE8A 1Q1OA 2HJ8A 2XK5B 3B1LX 4GGQA 3PTFC 3U30A 4IUMB 4W9IA 4FN2A 3DPDA 2LGXA 1YD8U 4KZ0A 2KWUB 5JH5C 2BYVE 4KDIC 4I6PA 4ANXA 2K8HA 4KIKA 3ZRCA 4LDTD 3DBRI 2NVUI 2K6DB 3M95A 4K1RB 4X57B 1P98A 1WGRA 3PHWB 1J0GA 3APDA 1M94A 3R7QA 1VD2A 4EZLA 3ZTDA 2O2VA 4IWOA 4HVBA 5JZEB 2CS4A 2M17A 2UWQA 3L54A 5AZFA 4EKUA 2XEWA 2K1FA 1LQBA 3EECA 1J8CA 3H6NA 3UIPB 3QCAA 3ML9A 2LRUA 2MWSB 4BOZB 4JLCA 1JRUA 2MBQA 4MGYE 4PYZA 3N30A 2AEHA 3A4RA 1EF1A 1LM8B 1WF9A 4TQ1A 4RMAA 2L3ZA 3ALBA 5LXHA 1V5OA 2IYDB 2BPSA 4WJOA 3TL5A 1Z2MA 1OQYA 2GBKA 4FA6A 4W9CA 1WGHA 2MP2A 2YLMA 2CU1A 2DYMA 3PGEA 4GXBA 4BKGA 3Q3FA 4M0WB 4P7IA 3WAOA 2J0KA 3WIMA 2KLCA 1E90A 4ZDVA 4F8CB 3HK0A 2KJ6A 2BGFA 4ZYNA 2M4NA 1WYWB 1P9DU 2KOXA 3DOWA 4A3OA 2K8CA 3JSVA 1I35A 2LVOA 5DPSA 2J0JA 4G50A 3KH0A 1V5TA 4K81A 3NZUA 1H8CA 3UQAA 4XZ4A 2MW5A 3T9LA 2L0FA 4WWOA 4FULA 3APCA 4IC7B 3OLMD 3A9KB 2KLGA 3N3KB 4M8MA 4DDID 2FIDA 1UELA 2KTRB 2D07B 3RT3B 5J18A 1P0RA 2V3SA 1UGMA 2FIFA 4M8NA 3TMPB 2A5UA 4XC2A 4G11A 4AJYB 4F1SA 2EMSA 2EKEC 2MBBB 2EMTA 1NBFC 1WXSA 2KMAA 3TIXA 2O6VA 4GN1A 4GB9A 5G2NA 1WJNA 2MQJA 5LXIB 2AWTA 2B3AA 1TTNA 1V9JA 3L13A 1EUVB 1LFDA 3A1QB 3VTWA 1WIAA 1WX7A 2ZCBA 1WZ0A 3QK0A 2REXA 2BF8B 1ZW7A 3VUWA 1ISNA 3DBHI 2DZMA 1GG3A 4GDLB 3PRMB 2FCNA 4ASWC 1WMHB 2JRIB 2L7RA 4W9JA 2GBJA 5GMVA 1F9JA 1E8YA 2KWCA 4EFOA 3PZDA 3WAPA 4G0NB 5KHQA 2CHWA 2RGFA 3CMMB 4II2B 2L76A 3KYDD 3ECIA 3NS8A 1S1QB 2DYBA 3DVNV 2KC2A 2LVQA 2KX0A 3O65B 4DBGA 2RR9A 5E6PA 4E74A 4W9LA 2BKRB 2KJRA 1V6EA 5CHWA 3PLVA 3NHEB 3MTNB 3SD5A 2PEAA 2ZPYA 2JWZA 4WJPA 1WI0A 3GOEA 4NPNA
chains in the Genus database with same CATH superfamily
1CJEA 3BVMA 2B76B 4WQMA 4FBJB 4HLEA 4XE0A 4YSXB 1N62A 3DQVA 1KFYB 3NVVA 5IAAC 1X1MA 2ZCCA 1GB1A 2WXRA 2HE7A 3AEBB 3DDCB 1QLBB 5CHVC 4NJ6A 1YN5A 2DLBA 1YIWA 3HM6X 1UD7A 3AEGB 4DXGA 3W5UB 1GNUA 2FUHB 4A20A 1FD6A 3VHTC 2ZJDA 1JWSD 3AE6B 2LWPA 2E3TA 2K0PA 3VH3B 2NS5A 5KHOA 2INDC 1KJTA 5E6OA 1J7CA 3U8ZA 1TS5A 3JVZX 3UIOB 5C1ZA 4BVUC 1E8ZA 1FRRA 1L4ZB 2PE9A 2JVCA 1MG4A 1PGAA 2BWES 2WXPA 4NJ7A 1OGWA 3RULA 1TS3A 3QARA 2IO0B 1WMHA 2HTME 2CHXA 4PS3A 5TR5A 1NEKB 4JQWC 2I1JA 3IFWB 2JQRB 2XN9C 2WDVB 1CK1A 1KTKA 2WXQA 3V05A 4P1CC 1PFDA 1Y8RC 3RI7C 3OJ3A 3KUCB 3PS6A 4RNAA 2JUOA 2G4DB 2J52A 2DNFA 2N7JA 4A90A 3Q3NC 3VH4B 2IO1B 4EZKA 5D7GA 2MP2B 1ZDVA 4GSWA 1C4AA 5DPWA 3L0WB 2KDBA 1NDDA 2BW2A 5EE9A 2N0SB 4G3XB 1TZ1A 1AN8A 1XD3B 4HKQA 1V81A 1EU3A 4EEWA 2KTFA 4NZLB 1E0ZA 2KFJA 1EO6A 3PRZA 2M19A 4BKSA 2AQ2B 3R66C 3R2IA 4XX5A 2AQ1B 4YXDB 1QKZA 2N9XA 1E6EB 1EM7A 1KOTA 1GAQB 2WLBA 3HM3A 2GBMA 2D10A 5CX3A 2HD5B 3ETRA 1RWSA 1PQSA 4P6VF 3ZTCA 4HDQA 2A4ZA 1E10A 3CSTA 3RNEC 1N63A 3APFA 4FHJA 1A5RA 1D4BA 3W1SA 4BZAA 1EWCA 2ZVOA 2MA9B 1TZOA 3BYYB 4WURA 4YL8A 1UWMA 4C80A 4E3CA 3ZJTA 1HQRD 2JF5A 3AE9B 4WWNA 3L4PA 3A1QA 3EUB2 5BO4B 1WE6A 1B1ZA 2D2QA 2GMIC 2J7QB 4NNJB 4ANWA 4GDLA 3VUYA 1VR9A 4DHZB 2KVZA 2N7DA 4MJSA 2KD0A 4YTMB 2PLPA 3QC8B 3KWLA 1WY8A 1VRAB 1PDXA 1ROEA 1WR6E 3QX1A 3RNAC 4AP4C 3J9CA 4RGMA 2WXNA 2DX5B 2KC1A 2L8JA 2OOBB 2JY6A 1WM3A 3P4PB 2KN5A 3ZNZB 3ZIMA 2MCNB 1QOFA 2LXCA 4REZA 3NG0A 3ONSA 4HCPB 3MHSD 4FJZA 3H9DA 1L0YB 1BUIC 1HZ5A 4I6LB 4GMVA 1QZEA 2LEKA 3MJWA 2WXGA 1DOIA 1OQRA 1SE2A 3Q8AA 1C79A 2KDMA 4HPLB 2JT4B 2FE8A 2KHWB 3MC8A 3FAHA 4W9FA 2KZRA 2KDIA 2N9KA 3GE3C 3L10B 3K9OB 1JALA 2M0AA 3E56A 1XLOA 4WH4A 1WE7A 1DOXA 1RRBA 2GB1A 3T3OA 1OQQA 1I4RA 4WWPA 3H7PA 1WXQA 2WQYB 4ZRPA 3D32A 2SAKA 4KVGB 2M8SA 1KRHA 3K9PB 1E7PB 3DBLI 5C23A 2M1MA 1YX6B 5DPTA 4A9AA 2JYTA 2KWVB 1VLBA 2SEBD 1HE8A 2KMMA 2XK5B 2VH2A 3PTFC 4IUMB 4MH8A 4FN2A 3DPDA 1ACCA 2KWUB 5JH5C 1L0XB 3VR8B 2Z8LA 2H89B 2RDHA 3AH7A 4LDTD 2NVUI 2PIAA 4K1RB 1D6EC 1J0GA 3PHWB 4EZLA 4B0MA 4OVZA 1WYGA 2CS4A 2UWQA 5EE1A 5MPOA 3T3NA 1J8CA 3QCAA 2LRUA 2MBQA 1V1OA 3IAS1 4PYZA 3N30A 5I4DA 2AEHA 2GRIA 1I4GA 3IT6B 1HTQA 1EF1A 3NS1A 2WXLA 4RH6A 1N60A 1KLUD 2HJ1A 4WJOA 2WP9B 1BXTA 2J4XA 3RNGC 2YLMA 5G5HA 4GXBA 3Q3FA 3WAOA 2J0KA 3HK0A 2BGFA 3TEYA 3PO0A 2KQ4X 4A3OA 2J0JA 2ONQA 1CZPA 2MH7A 1HTOA 3ABVB 4WWOA 3APCA 4IC7B 4M8MA 2KTRB 1UELA 2D07B 3HVDA 1P0RA 2WXHA 3URYA 4JWSC 4GB9A 5G2NA 1WJNA 1YN4A 1HZ6A 1PYWD 5LXIB 3L13A 1EUVB 1LFDA 1FO4A 2ZCBA 1WX7A 1QOAA 4WIPA 2BF8B 2RDGA 1NI3A 1ISNA 2K22A 3DBHI 2DZMA 1GG3A 3AE8B 2LJIA 2FCNA 4ASWC 1I4QA 2KWCA 1JWAD 4GLSC 3KYDD 2W3RA 1UUPA 1ZP0B 2KC2A 1VDVA 2KX0A 2W3SA 1V6EA 3MTNB 2PEAA 1TGZB 3CF6E 3GP7A 2MSED 2AL3A 3PVLA 4XGAB 2LGSA 1L6VA 3BVZA 2AYOB 3PHXB 2NBWB 4KSLC 2JZZA 1K50A 3ZNHB 1SJHD 2IBIB 1QQRA 1V1PA 2KQ7A 1JWMD 2JRHA 1F1HA 5CHFA 3BWUD 2BB6A 4MSQB 4AOFA 2NR2A 1UZXB 2CKHB 3AECB 4XDCA 3ZLZA 2RPQA 3SDLC 3T8MA 1T6BX 4M01A 2KX3A 5FR3A 2WX0A 1WZ3A 2KYWA 3NRZA 3AEDB 2JSVX 2BS4B 1WJ4A 1T0SC 2MBOA 2C7NB 4YSZB 5G5GA 1V8CA 4FLHA 1OFFA 3QHTA 4GDKB 5T8IA 2V4IB 2KKCA 2W54A 2DYOA 4W9KA 3WA0A 1SE4A 3PLUA 2D11A 2D3CA 2KMCA 3N1YC 3BY4B 3DWGC 4TMAB 3S2AA 1YQ3B 4C4VA 4K3BA 4ZRQA 3WAMA 1WX8A 4LDTB 3H7SA 4R3DA 1M4VA 3ZXVA 1XQQA 1L5PA 5FR6A 3PZ8A 3SFEB 1P7EA 5IOIA 2D3AA 2K39A 4YWGG 1VJKA 1RM6C 1N5XA 3NJTA 3U7DA 3I9V1 2BYTA 3X23A 1QF6A 3ZQ4A 1WRDB 1YJIA 3Q14C 3B08A 1VZ7A 2WXFA 2WDQB 2ZZPB 3W2DA 3P2BA 2V4LA 2C5LC 3PSEB 2J42A 4II3B 1MHHE 2UYZB 5LNK1 3KUZA 3B0AA 4HDOA 1SEBD 3QAQA 2NPTB 1Q0WB 1AW7A 2M56B 2L52A 3KLSX 4DK5A 1DOYA 5GXGB 4N9F4 3AE1B 2LUMA 1E5WA 1WR1A 2LI5A 3JSVB 3FILA 3I63C 3DBHB 3VAWA 2OHFA 3AV8A 5FK9C 4A8XC 1Z5SB 5CTRC 3AMZA 4CYEA 3RPFC 4N59A 1ZXIA 2KACA 1FMAD 3GE8C 4NAWB 3AEAB 4MEMA 2PJHA 1WXVA 1J7BA 2ZEQA 2O6VB 2YVCA 4CHKA 5C2TB 2YEPF 1FIQA 2CJOA 3BVGA 3P4RB 2JXXA 4HK2A 2I38A 3NZ3A 4K7WA 3MFGA 4ARIA 4ZHPA 5DCNA 3FKYA 4W9GA 3AU5A 5D94A 2QILA 1I7HA 3SEBA 3WANA 5BYSA 4K7SA 2KDEB 4OVVA 1ET6A 2N9EB 2HDEA 1IP9A 3A9KA 1MVKA 2IPKD 1RAXA 3IAM1 3IHPC 1AARA 3CWIA 2KFKB 4AQ7A 4PS7A 2MRPA 4RM9A 3C19A 4M00A 3ZYYX 4LCDE 2OJWA 2ZW1A 5JHBA 4AS1A 2WXIA 3FC4A 2W82A 2BB5A 1IUEA 3OG5A 2NBUA 3L16A 4TQ0A 2KDFB 2H88B 3L08A 1TS2A 3ZNGC 2ASQA 2LFIA 3UGBB 1K8RB 3U7ZA 5D2MB 1UF0A 2LVPA 2WX1A 3U4EG 3SR6A 1WXAA 2ON8A 1XT9B 2BS2B 1ZKHA 2IGDA 4PS8A 4ANVA 4DHZE 2C60A 2DAFA 4HXDA 3AULA 3M62B 4TSSA 3N9YC 3VRAB 3ZJUA 4OZCA 4O1NA 5JXVA 2JXTA 2BVCA 1TIFA 2QDFA 3IG3A 3Q3JA 4URKA 2QHOA 2DZKA 2K6QA 4TKNA 1DYQA 2MJEA 3HHMA 2LXAA 1FFUA 3MJ5A 3N1XC 5D6JB 2FCMA 4DXAB 1T0QC 1E9MA 4NY0A 3TSSA 2WS3B 2KNBA 3PV1A 2LASA 1JWBD 2OJRA 3GB1A 4NQLB 1FEHA 4TV3A 2LHEA 4ZOHC 2FCSA 4JPSA 2V1YA 3PRPB 3OWEB 1RFKA 3RZWC 4EE2A 1SE9A 5G55A 4MDKE 2KO3A 1P7FA 2L05A 3UINB 3AE4B 3KVFB 2NBVB 1L4DB 3Q8BA 3Q8FA 4IG7B 1IBXA 2Y5BB 3ENEA 4K3CA 4ICVA 4HJKA 1D5ZC 2RPVA 2LGDA 3I5JC 3DVGY 1QILA 4HROA 2BTEA 4C7ZA 2PE6B 4IDIA 2WWZA 2HJ8A 2OEDA 4FXCA 2LGXA 4KZ0A 4JX1C 1TKGA 3VRBB 4YTNB 3DBRI 3M95A 4ACFA 1R4MB 5TSSA 5BMHA 4HVBA 4IWOA 3AE5B 1JRPA 5JZEB 2K1FA 3EECA 3UIPB 1JRUA 4MGYE 4US9A 4US8A 3A4RA 1TKYA 4ZHOA 1TJEA 1WF9A 4RMAA 4RCOA 2LGIA 3ALBA 1XCQL 1V5OA 3TL5A 1OQYA 2DYMA 3PGEA 4LTUA 4BKGA 4P7IA 2KLCA 4ZDVA 4RGNA 4F8CB 1N6ZA 2KJ6A 2JX5A 1P9DU 2DBYA 2KOXA 3DOWA 1GB4A 2LVOA 3U52E 5DPSA 4G50A 1WGKA 2N9LA 4JE3B 3Q69A 2D5GA 3T9LA 2L0FA 3N3KB 3ZXRA 5HHDG 1QT9A 4DDID 2FIDA 5J18A 4WAFA 1JW9D 1UGMA 5HFYA 1NVID 2EMSA 2MBBB 1YQ4B 1WXSA 2KMAA 3N1ZC 1FNVA 2RDBC 1I4XA 2AWTA 1V9JA 2PTLA 3A1QB 5E6JA 1WSPA 4GDLB 3R8BA 4DQOC 2L7RA 2GBJA 5FKAC 1F9JA 4P16A 1XEEA 4ZYSA 5KHQA 3CMMB 3ECIA 1S1QB 2DYBA 3DVNV 5H8YE 4RF0A 5E6PA 4E74A 4W9LA 3PLVA 3NHEB 1L0VB 3SD5A 4WJPA 1IGDA 2WXMA 3RD2A 4OZBA 3RNCC 1UNSA 1A70A 2N7EA 3ZJVA 1V86A 3ZGZA 4AJWA 2FNJB 2BWFA 4MGZE 1VCBA 2MLBA 3BYTB 3H1UA 4P1BC 1XO3A 3A4SC 5JHAA 4K7UA 3UF8A 2DZJA 4JL9A 4J6IA 2L00B 2V0GA 1YNTE 3CIRB 4KGTA 3RNBC 3V61A 5BMIA 1UWXA 3QJZA 3AE3B 3L17A 2INPE 3PPAA 4W9EA 2ZNVC 3LDZE 3A9JA 3Q8CA 2I1KA 4ICUA 3RN9C 2W9NA 1EF5A 4HWIB 4MM3B 1WJUA 4N6EB 2BYFA 1SE3A 2KVRA 3H7PB 3RUIB 5D3IB 3DBRB 3ZNID 3VVWB 1Q5WB 2QMTA 4C7YA 2PMVA 1WRIA 1F2RC 1T5XD 1OTRB 1V49A 4QAYA 4GU2A 4RF1A 4KGSA 4B95A 1DGJA 1ZOYB 4UDUC 1AWDA 2QCZA 1BMLC 3VTVA 3QWZB 2D3GA 3V60A 5L83A 2X38A 3LB8C 2M0XA 1AYFA 3PREA 4GOCA 1TT5B 4M02A 3W1YA 1U4AA 1ZDXA 3EFUA 1ZE3D 2EKIA 2N4FA 3VQIA 2INCC 3OJ4B 1MG8A 3JW0X 2C9WB 3DHGC 2O6VD 3C8YA 1WJ6A 4MGIE 4B0EA 4OVUA 4BKTA 3V62A 3U2SC 3KYCD 4PYUA 3VTUA 2KANA 3BIID 4WWMA 1EWYC 4PK1A 3AE7B 3W1SC 4A3PA 1J19A 1TS4A 4IM2A 4MT5A 2J0MA 2DWQA 3UQBA 1TY2A 2GBRA 2PW9A 4YTPB 4W9HA 1JQ4A 1E7VA 3GS2A 4LNIA 4FADA 2NTTA 3HUIA 3QA8A 2YEPB 4B6WA 1SIFA 3O13A 3TEWA 2V3PA 3EHVA 2LUEA 5AUKA 4A55A 3NOBA 2JZ3B 1WX9A 3RCZA 2J53A 1IPGA 2N1WA 1T0RC 1XLQA 1F0ZA 4KDLB 5AUIA 2IY1B 2FAZA 3SU8X 2XBBC 3VFKA 2KQSA 2MEKA 2RD0A 3AXCA 3DCGA 1MPEA 4M0WA 2LRWA 4IW0A 1KF6B 2PKOA 4IM3A 3N32A 4CO7A 2QC8A 3ZVVA 2JPHA 3V6EB 1L2NA 1RFAA 3Q6BA 3Q2AC 3NZSA 4S0RA 4I6NB 3JYUA 1I4HA 2Q5WD 4E71A 1OEYJ 3NUHB 1ET9A 1NYRA 1TYGB 3OAWA 1FXAA 1UH6A 4XDDA 5LLIA 1K51A 1V1PB 2FBWB 5H92C 2R2OA 1SF0A 3IBEA 3TCAA 1D5MC 1KH0A 3MHZA 3V6CB 4JIOU 1KM7A 1RYJA 2PPHA 2NPTA 4PT5A 4KIKB 1S3SG 4BBNF 1GC7A 2DZIA 5IKCM 2O2VB 3TUOA 1C9FA 1JWUD 2PVOD 3IVFA 2ICIA 1V97A 4ITKA 3MC9A 5D3DA 3A33B 4BBNC 2IO2B 4NAWA 2GI9A 5AEKB 2WHIA 1JROA 1ZPSA 1EU4A 4ZRKA 3WCQA 2WU5B 4OW0A 1V2YA 1YQBA 2L0TA 3HIZA 3RYTA 4CQNA 1D3ZA 5E6NA 1XXGA 2AQ3B 4HJGE 4NJCA 4BOSC 4EOYA 2ZPNA 1D5XC 2W55A 4WQOB 1KLVA 2KWDA 2MJDA 3LJ3A 1SGHA 1ZXHA 1LXDA 4KKIA 1F2RI 2IY0B 4BKSD 4B9KA 2BT6A 1WFYA 1F77A 1FXTB 1CMXB 3ZRFA 2KFKA 3QIJA 1R4MI 3VUXA 2C7HA 2WNMA 4FJYA 4C56C 2JZPA 1GUAB 1C3TA 4HKZE 3EGRA 2KT7A 1WWTA 3U30A 1C4PA 4W9IA 1ZUD2 2IGGA 3FILB 4KGRA 4I6PA 1NYQA 3ZRCA 1MFWA 1P98A 1WGRA 3APDA 1M94A 2VZKD 2XNAC 1LQBA 3ML9A 1MI0A 4RGTA 1CQVA 2Y5PA 2WGSA 1XF5L 1LGRA 1FXIA 2L3ZA 5LXHA 2GBKA 1WGHA 2MP2A 2L83A 4RFBA 1UGJA 4Q2JA 2Y3AA 1J7AA 4ZYNA 2M4NA 2CJNA 2K8CA 2K3UA 1TY0A 3KH0A 4K81A 1H8CA 3UQAA 4XZ4A 2MW5A 3Q8EA 3BK1A 4LNKA 3A9KB 2IJ0A 2JWUA 2V3SA 4M8NA 3TMPB 4G11A 5IP4D 5EE0A 2EKEC 1NBFC 1TTNA 3VTWA 4L1BA 3QK0A 2REXA 3VUWA 2AX5A 4MACA 3PRMB 1WMHB 2JRIB 4W9JA 4HPPA 2LMCA 5GMVA 2VH1A 1E8YA 3IT4B 3WAPA 4G0NB 5IN7A 2CHWA 4II2B 2L76A 1B9RA 4NAMA 4OHJA 2LVQA 4DBGA 2RR9A 4LNFA 2JWZA 3GOEA 4NPNA 3QQ8B 1WGYA 4DXFA 2ZNVB 2MX2A 4YSYB 3M63B 3ZW3A 1HA5A 3RFZB 3KW5B 2WXKA 1E8WA 2FUG1 2Z0DB 3B9JA 3TBLD 1WH3A 3ZUNA 1QOGA 1FPYA 2IO3B 4EZJA 5AZGA 2QEJC 3Q3OC 5IA7A 2BKFA 2KXJA 3AEFB 1YJ1A 2JU6X 2WXJA 2LZ6A 3NY5A 2D3BA 2CR5A 2ZW0A 2JYEA 2R61A 3RMKC 1N5WA 4BFRA 4IWQA 1TKEA 3DWMA 1P3QU 4MSMB 4DWFA 2WDTB 1SSNA 2G4SA 1E8XA 1HXYD 1IBXB 1WXMA 1T3QA 3NVYA 3P4QB 3TEZA 4IWPA 2G3QB 1H4RA 2HTHA 2Z0EB 3PT2B 3TJPA 2G9HD 3SHQA 2L1AA 3RNFC 3IXSA 4HRSA 3B2FA 4S17A 3LXFA 4W9DA 4TUUA 4XYCA 4DDGD 1V80A 2VZKB 3E9SA 5BMGA 3ZO5B 5L95C 4IKGA 1GPXA 3DBSA 3C0RB 1VZ8A 2BS3B 3B2GA 3X0WA 3AM9A 5J2RA 1R4NI 5HI1A 1HEZE 2G45B 3ML8A 2LD9A 2QSDA 4AUQC 2AL6A 4MJSB 2BBCA 1I42A 1NI2A 1E7UA 4XWTA 3H8HA 3UI3A 4WJNA 1BT0A 5J17A 3KQ4A 2NTSA 1KLGD 1GJZA 1XLPA 4WAAA 1STEA 2Z59B 2KK8A 4DHJD 4HCNB 2K25A 1FNUA 2XK5A 3VDZA 5HG2A 1YJJA 2K5PA 4C00A 2CU3A 3ZDTA 4FHKA 1PUTA 1SB3C 4USAA 3DVGX 3BZDB 2CHZA 2VRRB 2WDRB 4MH0E 2IZVB 1JMLA 2ZVNA 4ZRIA 4JGHB 5DPRA 2BYEA 3GZNI 2DHZA 4MM3A 2UU7A 5C3JB 3NVZA 2WU2B 4J3OD 2WYQA 1XLNA 2G1EA 4LJOB 3KUDB 4FJVB 1JCKB 5EE3A 4LJPB 1N61A 1T0YA 4HEA1 1K52A 3AI5A 1XCTL 4KZCA 3N20C 3P63A 1GC6A 2LJ5A 4GIVA 3DHIC 1C1YB 4LNNA 4RGOS 3AE2B 3Q3MC 3AU4A 4LK0M 2KTRA 2TSSA 3V3XA 2X8XX 1OEYA 4L2YA 1FRDA 2IDYA 2INNE 3DVNU 2EELA 1K53A 3VXWA 2GOWA 2DAJA 1RLFA 2WXOA 1L6UA 5EDSA 3AEEB 2KJHB 3R3MA 4BAXA 2LHDA 2MHJA 3NVWA 2KAJA 4ZRJA 3WALA 3P42A 2C7MB 2QJLA 4NQKE 4LLGM 2MBHA 3A9JB 4KKJA 4D2KA 1WM2A 5AZHA 2MBEA 3AN1A 4JWUC 1GOZA 4F7ZA 5HKHA 1UBIA 1F52A 2IGHA 3M3JA 1P1AA 4MELA 1C76A 1ZGUB 3HVZA 3P4SB 4ANUA 1FFVA 2K8BA 2MJ3A 2GBNA 4KSKC 4WJQA 3EC8A 3R7RA 2LGYA 4YT0B 1NENB 2DENB 4KV2A 2K9XA 3CSFA 4EUTA 2FCQA 4AWJA 1FCCC 1R4NB 3ZKJC 1YN3A 1WGGA 1Q10A 4HPMB 1UBQA 2NCNA 2N9PC 1YX5B 4L23A 1FNWA 3VR9B 1L7YA 1IYFA 1G6JA 3P1MA 2L32A 4RM8A 1SXTA 2KN4A 4GDKA 3RZFA 3EFCA 1R7SA 1WGDA 1TBEA 2RSUA 4DHJB 3MC0B 3I57A 3ZDMC 2R2QA 1C77A 4IM0A 3BINA 1MHXA 5BYRA 2N1VA 4MGKE 3I3TB 1YOVB 1Q1OA 3GZNB 3B1LX 4GGQA 1VZ6A 2QIEB 1YD8U 2BYVE 1PGXA 4KDIC 4ANXA 2K8HA 4KIKA 1I4PA 3W9CB 2K6DB 4X57B 1Y56A 3R7QA 1VD2A 3ZTDA 2O2VA 3DBLB 2M17A 3L54A 5AZFA 4EKUA 2XEWA 1C4CA 3H6NA 1FM0D 3MP9A 2MWSB 1ESFA 4BOZB 1PGBA 4JLCA 1LM8B 2RMMA 2GLSA 2I2YA 4TQ1A 1MJDA 2IYDB 2BPSA 4IOIE 1ENFA 1Z2MA 4FA6A 4W9CA 3LYYA 2CU1A 3PZ7A 2E6XA 5BYQA 1SJED 2Y5CA 3R2TA 4M0WB 3SFDB 3WIMA 1E90A 1IGCA 4ARCA 1WYWB 3JSVA 3EA6A 1I35A 1V5TA 3BK2A 2ACZB 2BQQA 3NZUA 1C78A 1YMHE 3W5VB 2NMQA 3TEXA 4FULA 3OLMD 2KLGA 4KX6B 3RT3B 2FIFA 2A5UA 3DHHC 4XC2A 4AJYB 4F1SA 2EMTA 3KWVA 3TIXA 2V9HA 2O6VA 4GN1A 2MQJA 1QOBA 2B3AA 1WIAA 4C4VB 1WZ0A 5IO9A 2PVGC 1FCLA 1ZW7A 1LO5D 4N58A 1SIJA 1SBBB 3HRDD 4A6QA 4EFOA 3PZDA 4H2AA 2V3NA 2RGFA 3NS8A 3O65B 3AB5A 4OZAA 2BKRB 2KJRA 5CHWA 4LNOA 2ZPYA 4XWWA 1WI0A
chains in the Genus database with same CATH topology
3QQ8B 1TGZB 3RD2A 1WGYA 3CF6E 4FBJB 2ZNVB 2MX2A 2MSED 3M63B 2AL3A 4HLEA 3PVLA 3ZW3A 2N7EA 2AYOB 3PHXB 2NBWB 3DQVA 4KSLC 2JZZA 3ZNHB 3KW5B 1V86A 5IAAC 1E8WA 4AJWA 2Z0DB 2IBIB 1X1MA 2FNJB 2ZCCA 3TBLD 2BWFA 1WH3A 4MGZE 1VCBA 2MLBA 2KQ7A 2HE7A 3H1UA 2JRHA 3ZUNA 5CHFA 2IO3B 3DDCB 4EZJA 3A4SC 5CHVC 5JHAA 4K7UA 4MSQB 4NJ6A 3UF8A 2DZJA 4JL9A 2NR2A 4AOFA 4J6IA 1YIWA 2L00B 5AZGA 3HM6X 1UD7A 5IA7A 1UZXB 2CKHB 2BKFA 2KXJA 3ZLZA 1YJ1A 2RPQA 3SDLC 3T8MA 3V61A 1GNUA 2FUHB 2LZ6A 3NY5A 4A20A 2CR5A 3VHTC 2KX3A 3QJZA 2ZJDA 2WX0A 1WZ3A 3L17A 4W9EA 3PPAA 2LWPA 4BFRA 2ZNVC 4IWQA 3LDZE 1WJ4A 2MBOA 3A9JA 3VH3B 2C7NB 2NS5A 1P3QU 5KHOA 4MSMB 2I1KA 4DWFA 2WDTB 4ICUA 2W9NA 1KJTA 4FLHA 1EF5A 2G4SA 4HWIB 3QHTA 1WJUA 4GDKB 1E8XA 5E6OA 2BYFA 1WXMA 2KVRA 2KKCA 3H7PB 2DYOA 4W9KA 3RUIB 3U8ZA 3UIOB 3JVZX 3WA0A 3ZNID 3VVWB 1Q5WB 4IWPA 5C1ZA 2G3QB 4BVUC 1E8ZA 1H4RA 2HTHA 2D11A 3PLUA 2KMCA 2PE9A 2JVCA 2Z0EB 3BY4B 3PT2B 3S2AA 3TJPA 3SHQA 1OTRB 1V49A 2BWES 4GU2A 4NJ7A 1OGWA 3WAMA 4W9DA 4TUUA 1WX8A 4LDTB 3RULA 3H7SA 3QARA 4DDGD 2IO0B 1V80A 1WMHA 1XQQA 2CHXA 5FR6A 4B95A 3ZO5B 5L95C 2K39A 4PS3A 5TR5A 3VTVA 3QWZB 2D3GA 4JQWC 2I1JA 3DBSA 3IFWB 3U7DA 3V60A 5L83A 2M0XA 3C0RB 3PREA 3X23A 4GOCA 3W1YA 1U4AA 1WRDB 3X0WA 3EFUA 5J2RA 2N4FA 1R4NI 1Y8RC 3VQIA 3B08A 3OJ3A 3OJ4B 3KUCB 3PS6A 1MG8A 3JW0X 2G45B 2ZZPB 2JUOA 2G4DB 2C9WB 3P2BA 3ML8A 2LD9A 2O6VD 2V4LA 4AUQC 2AL6A 2C5LC 1WJ6A 4MGIE 3PSEB 4MJSB 2IO1B 3VH4B 4II3B 4EZKA 5D7GA 2UYZB 4OVUA 1I42A 1NI2A 4BKTA 1E7UA 3V62A 3KUZA 3B0AA 4WJNA 4HDOA 3QAQA 1BT0A 2MP2B 2NPTB 1Q0WB 5J17A 3KYCD 1GJZA 4PYUA 4WAAA 4GSWA 2Z59B 2KK8A 2KANA 3VTUA 4DK5A 5DPWA 4DHJD 3L0WB 2KDBA 2K25A 1NDDA 2XK5A 4HCNB 4N9F4 3VDZA 3W1SC 4A3PA 1J19A 4IM2A 1E5WA 1WR1A 2LI5A 3JSVB 4G3XB 1TZ1A 2J0MA 1XD3B 3UQBA 2GBRA 1V81A 3VAWA 3ZDTA 4FHKA 4W9HA 1Z5SB 5CTRC 1E7VA 2KTFA 4EEWA 4FADA 4CYEA 3QA8A 4B6WA 2KFJA 1SIFA 1EO6A 3PRZA 3DVGX 4BKSA 3R66C 4NAWB 2CHZA 2VRRB 4MEMA 3EHVA 4MH0E 2LUEA 2PJHA 2IZVB 1WXVA 3NOBA 2JZ3B 2ZEQA 2ZVNA 4XX5A 1WX9A 2O6VB 4ZRIA 4JGHB 3RCZA 2YVCA 5DPRA 4CHKA 1IPGA 2BYEA 2N1WA 2DHZA 3GZNI 4MM3A 2N9XA 4KDLB 1KOTA 2IY1B 2FAZA 2WYQA 3SU8X 3HM3A 2XBBC 3VFKA 2GBMA 2KQSA 2JXXA 4LJOB 2D10A 4HK2A 2HD5B 3KUDB 4FJVB 5CX3A 2RD0A 4LJPB 3AXCA 4K7WA 1T0YA 3DCGA 3AI5A 1PQSA 2LRWA 4IW0A 4KZCA 4HDQA 2A4ZA 5DCNA 3ZTCA 4W9GA 3AU5A 4IM3A 1GC6A 2LJ5A 4GIVA 5D94A 3CSTA 3N32A 4CO7A 1C1YB 3WANA 3APFA 3ZVVA 2JPHA 4K7SA 3V6EB 1L2NA 1RFAA 2KDEB 4OVVA 3NZSA 4FHJA 2N9EB 1A5RA 1IP9A 4I6NB 3JYUA 3W1SA 3AU4A 3A9KA 2KTRA 1RAXA 2ZVOA 4E71A 2MA9B 1OEYJ 4YL8A 1OEYA 4E3CA 3IHPC 1AARA 2KFKB 2JF5A 3DVNU 4PS7A 2MRPA 4RM9A 3OAWA 1UH6A 4LCDE 4WWNA 5JHBA 3A1QA 3VXWA 5BO4B 2GOWA 5LLIA 2DAJA 1WE6A 1RLFA 2NBUA 3L16A 4TQ0A 2KDFB 2D2QA 2GMIC 2J7QB 2R2OA 3L08A 4NNJB 4GDLA 3VUYA 3ZNGC 2ASQA 4ANWA 3IBEA 3TCAA 4DHZB 3UGBB 5EDSA 2KJHB 1K8RB 2N7DA 4MJSA 2KD0A 5D2MB 2LVPA 2WX1A 3V6CB 4JIOU 3QC8B 3R3MA 1KM7A 1WY8A 1WXAA 2PPHA 1XT9B 1WR6E 2NPTA 3QX1A 1ZKHA 4AP4C 4KIKB 4PS8A 1S3SG 4ZRJA 1GC7A 4ANVA 3WALA 4BBNF 4DHZE 2C60A 2DZIA 2DX5B 2KC1A 2L8JA 2DAFA 2OOBB 2O2VB 2JY6A 4HXDA 1WM3A 3AULA 3M62B 2KN5A 2C7MB 3ZNZB 3ZIMA 3IVFA 4NQKE 2MBHA 3A9JB 2MCNB 1WM2A 5AZHA 2MBEA 2LXCA 4F7ZA 5HKHA 1UBIA 3ONSA 4HCPB 3IG3A 3M3JA 1P1AA 3MHSD 4FJZA 4MELA 3H9DA 3Q3JA 1ZGUB 4URKA 3A33B 2QHOA 2DZKA 2K6QA 4BBNC 2IO2B 2K8BA 4NAWA 2GBNA 4KSKC 4WJQA 4ANUA 3EC8A 4TKNA 5AEKB 3R7RA 4I6LB 3HHMA 2LXAA 4GMVA 1QZEA 2LGYA 3MJWA 2DENB 4KV2A 5D6JB 2FCMA 3CSFA 4ZRKA 4EUTA 2FCQA 4AWJA 1V2YA 4DXAB 3ZKJC 4HPLB 4NY0A 2JT4B 1YQBA 2L0TA 3HIZA 2KHWB 2KNBA 1WGGA 3RYTA 1D3ZA 5E6NA 3PV1A 2LASA 4HPMB 4BOSC 4EOYA 2OJRA 4NQLB 4W9FA 1UBQA 2NCNA 4TV3A 2KZRA 2N9PC 2FCSA 2ZPNA 2KDIA 1YX5B 2V1YA 3L10B 3PRPB 4WQOB 1KLVA 3K9OB 3RZWC 1SE9A 1IYFA 1L7YA 1G6JA 5G55A 4MDKE 2KO3A 3LJ3A 1SGHA 4RM8A 1WE7A 2L05A 1RRBA 3UINB 3KVFB 1LXDA 2NBVB 2IY0B 4GDKA 4IG7B 4WWPA 2Y5BB 4BKSD 3ENEA 4B9KA 4ICVA 3RZFA 3H7PA 4HJKA 1WGDA 1WFYA 1FXTB 1TBEA 3D32A 1CMXB 2LGDA 3ZRFA 3DVGY 2KFKA 2RSUA 4DHJB 3QIJA 4KVGB 1R4MI 3VUXA 2C7HA 2M8SA 3K9PB 3ZDMC 2R2QA 4FJYA 3DBLI 5C23A 2M1MA 1YX6B 4IM0A 2PE6B 5DPTA 1GUAB 3BINA 1C3TA 2WWZA 2KWVB 2N1VA 4MGKE 3I3TB 1HE8A 1Q1OA 2HJ8A 2XK5B 3B1LX 4GGQA 3PTFC 3U30A 4IUMB 4W9IA 4FN2A 3DPDA 2LGXA 1YD8U 4KZ0A 2KWUB 5JH5C 2BYVE 4KDIC 4I6PA 4ANXA 2K8HA 4KIKA 3ZRCA 4LDTD 3DBRI 2NVUI 2K6DB 3M95A 4K1RB 4X57B 1P98A 1WGRA 3PHWB 1J0GA 3APDA 1M94A 3R7QA 1VD2A 4EZLA 3ZTDA 2O2VA 4IWOA 4HVBA 5JZEB 2CS4A 2M17A 2UWQA 3L54A 5AZFA 4EKUA 2XEWA 2K1FA 1LQBA 3EECA 1J8CA 3H6NA 3UIPB 3QCAA 3ML9A 2LRUA 2MWSB 4BOZB 4JLCA 1JRUA 2MBQA 4MGYE 4PYZA 3N30A 2AEHA 3A4RA 1EF1A 1LM8B 1WF9A 4TQ1A 4RMAA 2L3ZA 3ALBA 5LXHA 1V5OA 2IYDB 2BPSA 4WJOA 3TL5A 1Z2MA 1OQYA 2GBKA 4FA6A 4W9CA 1WGHA 2MP2A 2YLMA 2CU1A 2DYMA 3PGEA 4GXBA 4BKGA 3Q3FA 4M0WB 4P7IA 3WAOA 2J0KA 3WIMA 2KLCA 1E90A 4ZDVA 4F8CB 3HK0A 2KJ6A 2BGFA 4ZYNA 2M4NA 1WYWB 1P9DU 2KOXA 3DOWA 4A3OA 2K8CA 3JSVA 1I35A 2LVOA 5DPSA 2J0JA 4G50A 3KH0A 1V5TA 4K81A 3NZUA 1H8CA 3UQAA 4XZ4A 2MW5A 3T9LA 2L0FA 4WWOA 4FULA 3APCA 4IC7B 3OLMD 3A9KB 2KLGA 3N3KB 4M8MA 4DDID 2FIDA 1UELA 2KTRB 2D07B 3RT3B 5J18A 1P0RA 2V3SA 1UGMA 2FIFA 4M8NA 3TMPB 2A5UA 4XC2A 4G11A 4AJYB 4F1SA 2EMSA 2EKEC 2MBBB 2EMTA 1NBFC 1WXSA 2KMAA 3TIXA 2O6VA 4GN1A 4GB9A 5G2NA 1WJNA 2MQJA 5LXIB 2AWTA 2B3AA 1TTNA 1V9JA 3L13A 1EUVB 1LFDA 3A1QB 3VTWA 1WIAA 1WX7A 2ZCBA 1WZ0A 3QK0A 2REXA 2BF8B 1ZW7A 3VUWA 1ISNA 3DBHI 2DZMA 1GG3A 4GDLB 3PRMB 2FCNA 4ASWC 1WMHB 2JRIB 2L7RA 4W9JA 2GBJA 5GMVA 1F9JA 1E8YA 2KWCA 4EFOA 3PZDA 3WAPA 4G0NB 5KHQA 2CHWA 2RGFA 3CMMB 4II2B 2L76A 3KYDD 3ECIA 3NS8A 1S1QB 2DYBA 3DVNV 2KC2A 2LVQA 2KX0A 3O65B 4DBGA 2RR9A 5E6PA 4E74A 4W9LA 2BKRB 2KJRA 1V6EA 5CHWA 3PLVA 3NHEB 3MTNB 3SD5A 2PEAA 2ZPYA 2JWZA 4WJPA 1WI0A 3GOEA 4NPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ8 B;  1TGZ B;  3RD2 A;  1WGY A;  3CF6 E;  4FBJ B;  2ZNV B;  2MX2 A;  2MSE D;  3M63 B;  2AL3 A;  4HLE A;  3PVL A;  3ZW3 A;  2N7E A;  2AYO B;  3PHX B;  2NBW B;  3DQV A;  4KSL C;  2JZZ A;  3ZNH B;  3KW5 B;  1V86 A;  5IAA C;  1E8W A;  4AJW A;  2Z0D B;  2IBI B;  1X1M A;  2FNJ B;  2ZCC A;  3TBL D;  2BWF A;  1WH3 A;  4MGZ E;  1VCB A;  2MLB A;  2KQ7 A;  2HE7 A;  3H1U A;  2JRH A;  3ZUN A;  5CHF A;  2IO3 B;  3DDC B;  4EZJ A;  3A4S C;  5CHV C;  5JHA A;  4K7U A;  4MSQ B;  4NJ6 A;  3UF8 A;  2DZJ A;  4JL9 A;  2NR2 A;  4AOF A;  4J6I A;  1YIW A;  2L00 B;  5AZG A;  3HM6 X;  1UD7 A;  5IA7 A;  1UZX B;  2CKH B;  2BKF A;  2KXJ A;  3ZLZ A;  1YJ1 A;  2RPQ A;  3SDL C;  3T8M A;  3V61 A;  1GNU A;  2FUH B;  2LZ6 A;  3NY5 A;  4A20 A;  2CR5 A;  3VHT C;  2KX3 A;  3QJZ A;  2ZJD A;  2WX0 A;  1WZ3 A;  3L17 A;  4W9E A;  3PPA A;  2LWP A;  4BFR A;  2ZNV C;  4IWQ A;  3LDZ E;  1WJ4 A;  2MBO A;  3A9J A;  3VH3 B;  2C7N B;  2NS5 A;  1P3Q U;  5KHO A;  4MSM B;  2I1K A;  4DWF A;  2WDT B;  4ICU A;  2W9N A;  1KJT A;  4FLH A;  1EF5 A;  2G4S A;  4HWI B;  3QHT A;  1WJU A;  4GDK B;  1E8X A;  5E6O A;  2BYF A;  1WXM A;  2KVR A;  2KKC A;  3H7P B;  2DYO A;  4W9K A;  3RUI B;  3U8Z A;  3UIO B;  3JVZ X;  3WA0 A;  3ZNI D;  3VVW B;  1Q5W B;  4IWP A;  5C1Z A;  2G3Q B;  4BVU C;  1E8Z A;  1H4R A;  2HTH A;  2D11 A;  3PLU A;  2KMC A;  2PE9 A;  2JVC A;  2Z0E B;  3BY4 B;  3PT2 B;  3S2A A;  3TJP A;  3SHQ A;  1OTR B;  1V49 A;  2BWE S;  4GU2 A;  4NJ7 A;  1OGW A;  3WAM A;  4W9D A;  4TUU A;  1WX8 A;  4LDT B;  3RUL A;  3H7S A;  3QAR A;  4DDG D;  2IO0 B;  1V80 A;  1WMH A;  1XQQ A;  2CHX A;  5FR6 A;  4B95 A;  3ZO5 B;  5L95 C;  2K39 A;  4PS3 A;  5TR5 A;  3VTV A;  3QWZ B;  2D3G A;  4JQW C;  2I1J A;  3DBS A;  3IFW B;  3U7D A;  3V60 A;  5L83 A;  2M0X A;  3C0R B;  3PRE A;  3X23 A;  4GOC A;  3W1Y A;  1U4A A;  1WRD B;  3X0W A;  3EFU A;  5J2R A;  2N4F A;  1R4N I;  1Y8R C;  3VQI A;  3B08 A;  3OJ3 A;  3OJ4 B;  3KUC B;  3PS6 A;  1MG8 A;  3JW0 X;  2G45 B;  2ZZP B;  2JUO A;  2G4D B;  2C9W B;  3P2B A;  3ML8 A;  2LD9 A;  2O6V D;  2V4L A;  4AUQ C;  2AL6 A;  2C5L C;  1WJ6 A;  4MGI E;  3PSE B;  4MJS B;  2IO1 B;  3VH4 B;  4II3 B;  4EZK A;  5D7G A;  2UYZ B;  4OVU A;  1I42 A;  1NI2 A;  4BKT A;  1E7U A;  3V62 A;  3KUZ A;  3B0A A;  4WJN A;  4HDO A;  3QAQ A;  1BT0 A;  2MP2 B;  2NPT B;  1Q0W B;  5J17 A;  3KYC D;  1GJZ A;  4PYU A;  4WAA A;  4GSW A;  2Z59 B;  2KK8 A;  2KAN A;  3VTU A;  4DK5 A;  5DPW A;  4DHJ D;  3L0W B;  2KDB A;  2K25 A;  1NDD A;  2XK5 A;  4HCN B;  4N9F 4;  3VDZ A;  3W1S C;  4A3P A;  1J19 A;  4IM2 A;  1E5W A;  1WR1 A;  2LI5 A;  3JSV B;  4G3X B;  1TZ1 A;  2J0M A;  1XD3 B;  3UQB A;  2GBR A;  1V81 A;  3VAW A;  3ZDT A;  4FHK A;  4W9H A;  1Z5S B;  5CTR C;  1E7V A;  2KTF A;  4EEW A;  4FAD A;  4CYE A;  3QA8 A;  4B6W A;  2KFJ A;  1SIF A;  1EO6 A;  3PRZ A;  3DVG X;  4BKS A;  3R66 C;  4NAW B;  2CHZ A;  2VRR B;  4MEM A;  3EHV A;  4MH0 E;  2LUE A;  2PJH A;  2IZV B;  1WXV A;  3NOB A;  2JZ3 B;  2ZEQ A;  2ZVN A;  4XX5 A;  1WX9 A;  2O6V B;  4ZRI A;  4JGH B;  3RCZ A;  2YVC A;  5DPR A;  4CHK A;  1IPG A;  2BYE A;  2N1W A;  2DHZ A;  3GZN I;  4MM3 A;  2N9X A;  4KDL B;  1KOT A;  2IY1 B;  2FAZ A;  2WYQ A;  3SU8 X;  3HM3 A;  2XBB C;  3VFK A;  2GBM A;  2KQS A;  2JXX A;  4LJO B;  2D10 A;  4HK2 A;  2HD5 B;  3KUD B;  4FJV B;  5CX3 A;  2RD0 A;  4LJP B;  3AXC A;  4K7W A;  1T0Y A;  3DCG A;  3AI5 A;  1PQS A;  2LRW A;  4IW0 A;  4KZC A;  4HDQ A;  2A4Z A;  5DCN A;  3ZTC A;  4W9G A;  3AU5 A;  4IM3 A;  1GC6 A;  2LJ5 A;  4GIV A;  5D94 A;  3CST A;  3N32 A;  4CO7 A;  1C1Y B;  3WAN A;  3APF A;  3ZVV A;  2JPH A;  4K7S A;  3V6E B;  1L2N A;  1RFA A;  2KDE B;  4OVV A;  3NZS A;  4FHJ A;  2N9E B;  1A5R A;  1IP9 A;  4I6N B;  3JYU A;  3W1S A;  3AU4 A;  3A9K A;  2KTR A;  1RAX A;  2ZVO A;  4E71 A;  2MA9 B;  1OEY J;  4YL8 A;  1OEY A;  4E3C A;  3IHP C;  1AAR A;  2KFK B;  2JF5 A;  3DVN U;  4PS7 A;  2MRP A;  4RM9 A;  3OAW A;  1UH6 A;  4LCD E;  4WWN A;  5JHB A;  3A1Q A;  3VXW A;  5BO4 B;  2GOW A;  5LLI A;  2DAJ A;  1WE6 A;  1RLF A;  2NBU A;  3L16 A;  4TQ0 A;  2KDF B;  2D2Q A;  2GMI C;  2J7Q B;  2R2O A;  3L08 A;  4NNJ B;  4GDL A;  3VUY A;  3ZNG C;  2ASQ A;  4ANW A;  3IBE A;  3TCA A;  4DHZ B;  3UGB B;  5EDS A;  2KJH B;  1K8R B;  2N7D A;  4MJS A;  2KD0 A;  5D2M B;  2LVP A;  2WX1 A;  3V6C B;  4JIO U;  3QC8 B;  3R3M A;  1KM7 A;  1WY8 A;  1WXA A;  2PPH A;  1XT9 B;  1WR6 E;  2NPT A;  3QX1 A;  1ZKH A;  4AP4 C;  4KIK B;  4PS8 A;  1S3S G;  4ZRJ A;  1GC7 A;  4ANV A;  3WAL A;  4BBN F;  4DHZ E;  2C60 A;  2DZI A;  2DX5 B;  2KC1 A;  2L8J A;  2DAF A;  2OOB B;  2O2V B;  2JY6 A;  4HXD A;  1WM3 A;  3AUL A;  3M62 B;  2KN5 A;  2C7M B;  3ZNZ B;  3ZIM A;  3IVF A;  4NQK E;  2MBH A;  3A9J B;  2MCN B;  1WM2 A;  5AZH A;  2MBE A;  2LXC A;  4F7Z A;  5HKH A;  1UBI A;  3ONS A;  4HCP B;  3IG3 A;  3M3J A;  1P1A A;  3MHS D;  4FJZ A;  4MEL A;  3H9D A;  3Q3J A;  1ZGU B;  4URK A;  3A33 B;  2QHO A;  2DZK A;  2K6Q A;  4BBN C;  2IO2 B;  2K8B A;  4NAW A;  2GBN A;  4KSK C;  4WJQ A;  4ANU A;  3EC8 A;  4TKN A;  5AEK B;  3R7R A;  4I6L B;  3HHM A;  2LXA A;  4GMV A;  1QZE A;  2LGY A;  3MJW A;  2DEN B;  4KV2 A;  5D6J B;  2FCM A;  3CSF A;  4ZRK A;  4EUT A;  2FCQ A;  4AWJ A;  1V2Y A;  4DXA B;  3ZKJ C;  4HPL B;  4NY0 A;  2JT4 B;  1YQB A;  2L0T A;  3HIZ A;  2KHW B;  2KNB A;  1WGG A;  3RYT A;  1D3Z A;  5E6N A;  3PV1 A;  2LAS A;  4HPM B;  4BOS C;  4EOY A;  2OJR A;  4NQL B;  4W9F A;  1UBQ A;  2NCN A;  4TV3 A;  2KZR A;  2N9P C;  2FCS A;  2ZPN A;  2KDI A;  1YX5 B;  2V1Y A;  3L10 B;  3PRP B;  4WQO B;  1KLV A;  3K9O B;  3RZW C;  1SE9 A;  1IYF A;  1L7Y A;  1G6J A;  5G55 A;  4MDK E;  2KO3 A;  3LJ3 A;  1SGH A;  4RM8 A;  1WE7 A;  2L05 A;  1RRB A;  3UIN B;  3KVF B;  1LXD A;  2NBV B;  2IY0 B;  4GDK A;  4IG7 B;  4WWP A;  2Y5B B;  4BKS D;  3ENE A;  4B9K A;  4ICV A;  3RZF A;  3H7P A;  4HJK A;  1WGD A;  1WFY A;  1FXT B;  1TBE A;  3D32 A;  1CMX B;  2LGD A;  3ZRF A;  3DVG Y;  2KFK A;  2RSU A;  4DHJ B;  3QIJ A;  4KVG B;  1R4M I;  3VUX A;  2C7H A;  2M8S A;  3K9P B;  3ZDM C;  2R2Q A;  4FJY A;  3DBL I;  5C23 A;  2M1M A;  1YX6 B;  4IM0 A;  2PE6 B;  5DPT A;  1GUA B;  3BIN A;  1C3T A;  2WWZ A;  2KWV B;  2N1V A;  4MGK E;  3I3T B;  1HE8 A;  1Q1O A;  2HJ8 A;  2XK5 B;  3B1L X;  4GGQ A;  3PTF C;  3U30 A;  4IUM B;  4W9I A;  4FN2 A;  3DPD A;  2LGX A;  1YD8 U;  4KZ0 A;  2KWU B;  5JH5 C;  2BYV E;  4KDI C;  4I6P A;  4ANX A;  2K8H A;  4KIK A;  3ZRC A;  4LDT D;  3DBR I;  2NVU I;  2K6D B;  3M95 A;  4K1R B;  4X57 B;  1P98 A;  1WGR A;  3PHW B;  1J0G A;  3APD A;  1M94 A;  3R7Q A;  1VD2 A;  4EZL A;  3ZTD A;  2O2V A;  4IWO A;  4HVB A;  5JZE B;  2CS4 A;  2M17 A;  2UWQ A;  3L54 A;  5AZF A;  4EKU A;  2XEW A;  2K1F A;  1LQB A;  3EEC A;  1J8C A;  3H6N A;  3UIP B;  3QCA A;  3ML9 A;  2LRU A;  2MWS B;  4BOZ B;  4JLC A;  1JRU A;  2MBQ A;  4MGY E;  4PYZ A;  3N30 A;  2AEH A;  3A4R A;  1EF1 A;  1LM8 B;  1WF9 A;  4TQ1 A;  4RMA A;  2L3Z A;  3ALB A;  5LXH A;  1V5O A;  2IYD B;  2BPS A;  4WJO A;  3TL5 A;  1Z2M A;  1OQY A;  2GBK A;  4FA6 A;  4W9C A;  1WGH A;  2MP2 A;  2YLM A;  2CU1 A;  2DYM A;  3PGE A;  4GXB A;  4BKG A;  3Q3F A;  4M0W B;  4P7I A;  3WAO A;  2J0K A;  3WIM A;  2KLC A;  1E90 A;  4ZDV A;  4F8C B;  3HK0 A;  2KJ6 A;  2BGF A;  4ZYN A;  2M4N A;  1WYW B;  1P9D U;  2KOX A;  3DOW A;  4A3O A;  2K8C A;  3JSV A;  1I35 A;  2LVO A;  5DPS A;  2J0J A;  4G50 A;  3KH0 A;  1V5T A;  4K81 A;  3NZU A;  1H8C A;  3UQA A;  4XZ4 A;  2MW5 A;  3T9L A;  2L0F A;  4WWO A;  4FUL A;  3APC A;  4IC7 B;  3OLM D;  3A9K B;  2KLG A;  3N3K B;  4M8M A;  4DDI D;  2FID A;  1UEL A;  2KTR B;  2D07 B;  3RT3 B;  5J18 A;  1P0R A;  2V3S A;  1UGM A;  2FIF A;  4M8N A;  3TMP B;  2A5U A;  4XC2 A;  4G11 A;  4AJY B;  4F1S A;  2EMS A;  2EKE C;  2MBB B;  2EMT A;  1NBF C;  1WXS A;  2KMA A;  3TIX A;  2O6V A;  4GN1 A;  4GB9 A;  5G2N A;  1WJN A;  2MQJ A;  5LXI B;  2AWT A;  2B3A A;  1TTN A;  1V9J A;  3L13 A;  1EUV B;  1LFD A;  3A1Q B;  3VTW A;  1WIA A;  1WX7 A;  2ZCB A;  1WZ0 A;  3QK0 A;  2REX A;  2BF8 B;  1ZW7 A;  3VUW A;  1ISN A;  3DBH I;  2DZM A;  1GG3 A;  4GDL B;  3PRM B;  2FCN A;  4ASW C;  1WMH B;  2JRI B;  2L7R A;  4W9J A;  2GBJ A;  5GMV A;  1F9J A;  1E8Y A;  2KWC A;  4EFO A;  3PZD A;  3WAP A;  4G0N B;  5KHQ A;  2CHW A;  2RGF A;  3CMM B;  4II2 B;  2L76 A;  3KYD D;  3ECI A;  3NS8 A;  1S1Q B;  2DYB A;  3DVN V;  2KC2 A;  2LVQ A;  2KX0 A;  3O65 B;  4DBG A;  2RR9 A;  5E6P A;  4E74 A;  4W9L A;  2BKR B;  2KJR A;  1V6E A;  5CHW A;  3PLV A;  3NHE B;  3MTN B;  3SD5 A;  2PEA A;  2ZPY A;  2JWZ A;  4WJP A;  1WI0 A;  3GOE A;  4NPN A; 
#chains in the Genus database with same CATH topology
 1CJE A;  3BVM A;  2B76 B;  4WQM A;  4FBJ B;  4HLE A;  4XE0 A;  4YSX B;  1N62 A;  3DQV A;  1KFY B;  3NVV A;  5IAA C;  1X1M A;  2ZCC A;  1GB1 A;  2WXR A;  2HE7 A;  3AEB B;  3DDC B;  1QLB B;  5CHV C;  4NJ6 A;  1YN5 A;  2DLB A;  1YIW A;  3HM6 X;  1UD7 A;  3AEG B;  4DXG A;  3W5U B;  1GNU A;  2FUH B;  4A20 A;  1FD6 A;  3VHT C;  2ZJD A;  1JWS D;  3AE6 B;  2LWP A;  2E3T A;  2K0P A;  3VH3 B;  2NS5 A;  5KHO A;  2IND C;  1KJT A;  5E6O A;  1J7C A;  3U8Z A;  1TS5 A;  3JVZ X;  3UIO B;  5C1Z A;  4BVU C;  1E8Z A;  1FRR A;  1L4Z B;  2PE9 A;  2JVC A;  1MG4 A;  1PGA A;  2BWE S;  2WXP A;  4NJ7 A;  1OGW A;  3RUL A;  1TS3 A;  3QAR A;  2IO0 B;  1WMH A;  2HTM E;  2CHX A;  4PS3 A;  5TR5 A;  1NEK B;  4JQW C;  2I1J A;  3IFW B;  2JQR B;  2XN9 C;  2WDV B;  1CK1 A;  1KTK A;  2WXQ A;  3V05 A;  4P1C C;  1PFD A;  1Y8R C;  3RI7 C;  3OJ3 A;  3KUC B;  3PS6 A;  4RNA A;  2JUO A;  2G4D B;  2J52 A;  2DNF A;  2N7J A;  4A90 A;  3Q3N C;  3VH4 B;  2IO1 B;  4EZK A;  5D7G A;  2MP2 B;  1ZDV A;  4GSW A;  1C4A A;  5DPW A;  3L0W B;  2KDB A;  1NDD A;  2BW2 A;  5EE9 A;  2N0S B;  4G3X B;  1TZ1 A;  1AN8 A;  1XD3 B;  4HKQ A;  1V81 A;  1EU3 A;  4EEW A;  2KTF A;  4NZL B;  1E0Z A;  2KFJ A;  1EO6 A;  3PRZ A;  2M19 A;  4BKS A;  2AQ2 B;  3R66 C;  3R2I A;  4XX5 A;  2AQ1 B;  4YXD B;  1QKZ A;  2N9X A;  1E6E B;  1EM7 A;  1KOT A;  1GAQ B;  2WLB A;  3HM3 A;  2GBM A;  2D10 A;  5CX3 A;  2HD5 B;  3ETR A;  1RWS A;  1PQS A;  4P6V F;  3ZTC A;  4HDQ A;  2A4Z A;  1E10 A;  3CST A;  3RNE C;  1N63 A;  3APF A;  4FHJ A;  1A5R A;  1D4B A;  3W1S A;  4BZA A;  1EWC A;  2ZVO A;  2MA9 B;  1TZO A;  3BYY B;  4WUR A;  4YL8 A;  1UWM A;  4C80 A;  4E3C A;  3ZJT A;  1HQR D;  2JF5 A;  3AE9 B;  4WWN A;  3L4P A;  3A1Q A;  3EUB 2;  5BO4 B;  1WE6 A;  1B1Z A;  2D2Q A;  2GMI C;  2J7Q B;  4NNJ B;  4ANW A;  4GDL A;  3VUY A;  1VR9 A;  4DHZ B;  2KVZ A;  2N7D A;  4MJS A;  2KD0 A;  4YTM B;  2PLP A;  3QC8 B;  3KWL A;  1WY8 A;  1VRA B;  1PDX A;  1ROE A;  1WR6 E;  3QX1 A;  3RNA C;  4AP4 C;  3J9C A;  4RGM A;  2WXN A;  2DX5 B;  2KC1 A;  2L8J A;  2OOB B;  2JY6 A;  1WM3 A;  3P4P B;  2KN5 A;  3ZNZ B;  3ZIM A;  2MCN B;  1QOF A;  2LXC A;  4REZ A;  3NG0 A;  3ONS A;  4HCP B;  3MHS D;  4FJZ A;  3H9D A;  1L0Y B;  1BUI C;  1HZ5 A;  4I6L B;  4GMV A;  1QZE A;  2LEK A;  3MJW A;  2WXG A;  1DOI A;  1OQR A;  1SE2 A;  3Q8A A;  1C79 A;  2KDM A;  4HPL B;  2JT4 B;  2FE8 A;  2KHW B;  3MC8 A;  3FAH A;  4W9F A;  2KZR A;  2KDI A;  2N9K A;  3GE3 C;  3L10 B;  3K9O B;  1JAL A;  2M0A A;  3E56 A;  1XLO A;  4WH4 A;  1WE7 A;  1DOX A;  1RRB A;  2GB1 A;  3T3O A;  1OQQ A;  1I4R A;  4WWP A;  3H7P A;  1WXQ A;  2WQY B;  4ZRP A;  3D32 A;  2SAK A;  4KVG B;  2M8S A;  1KRH A;  3K9P B;  1E7P B;  3DBL I;  5C23 A;  2M1M A;  1YX6 B;  5DPT A;  4A9A A;  2JYT A;  2KWV B;  1VLB A;  2SEB D;  1HE8 A;  2KMM A;  2XK5 B;  2VH2 A;  3PTF C;  4IUM B;  4MH8 A;  4FN2 A;  3DPD A;  1ACC A;  2KWU B;  5JH5 C;  1L0X B;  3VR8 B;  2Z8L A;  2H89 B;  2RDH A;  3AH7 A;  4LDT D;  2NVU I;  2PIA A;  4K1R B;  1D6E C;  1J0G A;  3PHW B;  4EZL A;  4B0M A;  4OVZ A;  1WYG A;  2CS4 A;  2UWQ A;  5EE1 A;  5MPO A;  3T3N A;  1J8C A;  3QCA A;  2LRU A;  2MBQ A;  1V1O A;  3IAS 1;  4PYZ A;  3N30 A;  5I4D A;  2AEH A;  2GRI A;  1I4G A;  3IT6 B;  1HTQ A;  1EF1 A;  3NS1 A;  2WXL A;  4RH6 A;  1N60 A;  1KLU D;  2HJ1 A;  4WJO A;  2WP9 B;  1BXT A;  2J4X A;  3RNG C;  2YLM A;  5G5H A;  4GXB A;  3Q3F A;  3WAO A;  2J0K A;  3HK0 A;  2BGF A;  3TEY A;  3PO0 A;  2KQ4 X;  4A3O A;  2J0J A;  2ONQ A;  1CZP A;  2MH7 A;  1HTO A;  3ABV B;  4WWO A;  3APC A;  4IC7 B;  4M8M A;  2KTR B;  1UEL A;  2D07 B;  3HVD A;  1P0R A;  2WXH A;  3URY A;  4JWS C;  4GB9 A;  5G2N A;  1WJN A;  1YN4 A;  1HZ6 A;  1PYW D;  5LXI B;  3L13 A;  1EUV B;  1LFD A;  1FO4 A;  2ZCB A;  1WX7 A;  1QOA A;  4WIP A;  2BF8 B;  2RDG A;  1NI3 A;  1ISN A;  2K22 A;  3DBH I;  2DZM A;  1GG3 A;  3AE8 B;  2LJI A;  2FCN A;  4ASW C;  1I4Q A;  2KWC A;  1JWA D;  4GLS C;  3KYD D;  2W3R A;  1UUP A;  1ZP0 B;  2KC2 A;  1VDV A;  2KX0 A;  2W3S A;  1V6E A;  3MTN B;  2PEA A;  1TGZ B;  3CF6 E;  3GP7 A;  2MSE D;  2AL3 A;  3PVL A;  4XGA B;  2LGS A;  1L6V A;  3BVZ A;  2AYO B;  3PHX B;  2NBW B;  4KSL C;  2JZZ A;  1K50 A;  3ZNH B;  1SJH D;  2IBI B;  1QQR A;  1V1P A;  2KQ7 A;  1JWM D;  2JRH A;  1F1H A;  5CHF A;  3BWU D;  2BB6 A;  4MSQ B;  4AOF A;  2NR2 A;  1UZX B;  2CKH B;  3AEC B;  4XDC A;  3ZLZ A;  2RPQ A;  3SDL C;  3T8M A;  1T6B X;  4M01 A;  2KX3 A;  5FR3 A;  2WX0 A;  1WZ3 A;  2KYW A;  3NRZ A;  3AED B;  2JSV X;  2BS4 B;  1WJ4 A;  1T0S C;  2MBO A;  2C7N B;  4YSZ B;  5G5G A;  1V8C A;  4FLH A;  1OFF A;  3QHT A;  4GDK B;  5T8I A;  2V4I B;  2KKC A;  2W54 A;  2DYO A;  4W9K A;  3WA0 A;  1SE4 A;  3PLU A;  2D11 A;  2D3C A;  2KMC A;  3N1Y C;  3BY4 B;  3DWG C;  4TMA B;  3S2A A;  1YQ3 B;  4C4V A;  4K3B A;  4ZRQ A;  3WAM A;  1WX8 A;  4LDT B;  3H7S A;  4R3D A;  1M4V A;  3ZXV A;  1XQQ A;  1L5P A;  5FR6 A;  3PZ8 A;  3SFE B;  1P7E A;  5IOI A;  2D3A A;  2K39 A;  4YWG G;  1VJK A;  1RM6 C;  1N5X A;  3NJT A;  3U7D A;  3I9V 1;  2BYT A;  3X23 A;  1QF6 A;  3ZQ4 A;  1WRD B;  1YJI A;  3Q14 C;  3B08 A;  1VZ7 A;  2WXF A;  2WDQ B;  2ZZP B;  3W2D A;  3P2B A;  2V4L A;  2C5L C;  3PSE B;  2J42 A;  4II3 B;  1MHH E;  2UYZ B;  5LNK 1;  3KUZ A;  3B0A A;  4HDO A;  1SEB D;  3QAQ A;  2NPT B;  1Q0W B;  1AW7 A;  2M56 B;  2L52 A;  3KLS X;  4DK5 A;  1DOY A;  5GXG B;  4N9F 4;  3AE1 B;  2LUM A;  1E5W A;  1WR1 A;  2LI5 A;  3JSV B;  3FIL A;  3I63 C;  3DBH B;  3VAW A;  2OHF A;  3AV8 A;  5FK9 C;  4A8X C;  1Z5S B;  5CTR C;  3AMZ A;  4CYE A;  3RPF C;  4N59 A;  1ZXI A;  2KAC A;  1FMA D;  3GE8 C;  4NAW B;  3AEA B;  4MEM A;  2PJH A;  1WXV A;  1J7B A;  2ZEQ A;  2O6V B;  2YVC A;  4CHK A;  5C2T B;  2YEP F;  1FIQ A;  2CJO A;  3BVG A;  3P4R B;  2JXX A;  4HK2 A;  2I38 A;  3NZ3 A;  4K7W A;  3MFG A;  4ARI A;  4ZHP A;  5DCN A;  3FKY A;  4W9G A;  3AU5 A;  5D94 A;  2QIL A;  1I7H A;  3SEB A;  3WAN A;  5BYS A;  4K7S A;  2KDE B;  4OVV A;  1ET6 A;  2N9E B;  2HDE A;  1IP9 A;  3A9K A;  1MVK A;  2IPK D;  1RAX A;  3IAM 1;  3IHP C;  1AAR A;  3CWI A;  2KFK B;  4AQ7 A;  4PS7 A;  2MRP A;  4RM9 A;  3C19 A;  4M00 A;  3ZYY X;  4LCD E;  2OJW A;  2ZW1 A;  5JHB A;  4AS1 A;  2WXI A;  3FC4 A;  2W82 A;  2BB5 A;  1IUE A;  3OG5 A;  2NBU A;  3L16 A;  4TQ0 A;  2KDF B;  2H88 B;  3L08 A;  1TS2 A;  3ZNG C;  2ASQ A;  2LFI A;  3UGB B;  1K8R B;  3U7Z A;  5D2M B;  1UF0 A;  2LVP A;  2WX1 A;  3U4E G;  3SR6 A;  1WXA A;  2ON8 A;  1XT9 B;  2BS2 B;  1ZKH A;  2IGD A;  4PS8 A;  4ANV A;  4DHZ E;  2C60 A;  2DAF A;  4HXD A;  3AUL A;  3M62 B;  4TSS A;  3N9Y C;  3VRA B;  3ZJU A;  4OZC A;  4O1N A;  5JXV A;  2JXT A;  2BVC A;  1TIF A;  2QDF A;  3IG3 A;  3Q3J A;  4URK A;  2QHO A;  2DZK A;  2K6Q A;  4TKN A;  1DYQ A;  2MJE A;  3HHM A;  2LXA A;  1FFU A;  3MJ5 A;  3N1X C;  5D6J B;  2FCM A;  4DXA B;  1T0Q C;  1E9M A;  4NY0 A;  3TSS A;  2WS3 B;  2KNB A;  3PV1 A;  2LAS A;  1JWB D;  2OJR A;  3GB1 A;  4NQL B;  1FEH A;  4TV3 A;  2LHE A;  4ZOH C;  2FCS A;  4JPS A;  2V1Y A;  3PRP B;  3OWE B;  1RFK A;  3RZW C;  4EE2 A;  1SE9 A;  5G55 A;  4MDK E;  2KO3 A;  1P7F A;  2L05 A;  3UIN B;  3AE4 B;  3KVF B;  2NBV B;  1L4D B;  3Q8B A;  3Q8F A;  4IG7 B;  1IBX A;  2Y5B B;  3ENE A;  4K3C A;  4ICV A;  4HJK A;  1D5Z C;  2RPV A;  2LGD A;  3I5J C;  3DVG Y;  1QIL A;  4HRO A;  2BTE A;  4C7Z A;  2PE6 B;  4IDI A;  2WWZ A;  2HJ8 A;  2OED A;  4FXC A;  2LGX A;  4KZ0 A;  4JX1 C;  1TKG A;  3VRB B;  4YTN B;  3DBR I;  3M95 A;  4ACF A;  1R4M B;  5TSS A;  5BMH A;  4HVB A;  4IWO A;  3AE5 B;  1JRP A;  5JZE B;  2K1F A;  3EEC A;  3UIP B;  1JRU A;  4MGY E;  4US9 A;  4US8 A;  3A4R A;  1TKY A;  4ZHO A;  1TJE A;  1WF9 A;  4RMA A;  4RCO A;  2LGI A;  3ALB A;  1XCQ L;  1V5O A;  3TL5 A;  1OQY A;  2DYM A;  3PGE A;  4LTU A;  4BKG A;  4P7I A;  2KLC A;  4ZDV A;  4RGN A;  4F8C B;  1N6Z A;  2KJ6 A;  2JX5 A;  1P9D U;  2DBY A;  2KOX A;  3DOW A;  1GB4 A;  2LVO A;  3U52 E;  5DPS A;  4G50 A;  1WGK A;  2N9L A;  4JE3 B;  3Q69 A;  2D5G A;  3T9L A;  2L0F A;  3N3K B;  3ZXR A;  5HHD G;  1QT9 A;  4DDI D;  2FID A;  5J18 A;  4WAF A;  1JW9 D;  1UGM A;  5HFY A;  1NVI D;  2EMS A;  2MBB B;  1YQ4 B;  1WXS A;  2KMA A;  3N1Z C;  1FNV A;  2RDB C;  1I4X A;  2AWT A;  1V9J A;  2PTL A;  3A1Q B;  5E6J A;  1WSP A;  4GDL B;  3R8B A;  4DQO C;  2L7R A;  2GBJ A;  5FKA C;  1F9J A;  4P16 A;  1XEE A;  4ZYS A;  5KHQ A;  3CMM B;  3ECI A;  1S1Q B;  2DYB A;  3DVN V;  5H8Y E;  4RF0 A;  5E6P A;  4E74 A;  4W9L A;  3PLV A;  3NHE B;  1L0V B;  3SD5 A;  4WJP A;  1IGD A;  2WXM A;  3RD2 A;  4OZB A;  3RNC C;  1UNS A;  1A70 A;  2N7E A;  3ZJV A;  1V86 A;  3ZGZ A;  4AJW A;  2FNJ B;  2BWF A;  4MGZ E;  1VCB A;  2MLB A;  3BYT B;  3H1U A;  4P1B C;  1XO3 A;  3A4S C;  5JHA A;  4K7U A;  3UF8 A;  2DZJ A;  4JL9 A;  4J6I A;  2L00 B;  2V0G A;  1YNT E;  3CIR B;  4KGT A;  3RNB C;  3V61 A;  5BMI A;  1UWX A;  3QJZ A;  3AE3 B;  3L17 A;  2INP E;  3PPA A;  4W9E A;  2ZNV C;  3LDZ E;  3A9J A;  3Q8C A;  2I1K A;  4ICU A;  3RN9 C;  2W9N A;  1EF5 A;  4HWI B;  4MM3 B;  1WJU A;  4N6E B;  2BYF A;  1SE3 A;  2KVR A;  3H7P B;  3RUI B;  5D3I B;  3DBR B;  3ZNI D;  3VVW B;  1Q5W B;  2QMT A;  4C7Y A;  2PMV A;  1WRI A;  1F2R C;  1T5X D;  1OTR B;  1V49 A;  4QAY A;  4GU2 A;  4RF1 A;  4KGS A;  4B95 A;  1DGJ A;  1ZOY B;  4UDU C;  1AWD A;  2QCZ A;  1BML C;  3VTV A;  3QWZ B;  2D3G A;  3V60 A;  5L83 A;  2X38 A;  3LB8 C;  2M0X A;  1AYF A;  3PRE A;  4GOC A;  1TT5 B;  4M02 A;  3W1Y A;  1U4A A;  1ZDX A;  3EFU A;  1ZE3 D;  2EKI A;  2N4F A;  3VQI A;  2INC C;  3OJ4 B;  1MG8 A;  3JW0 X;  2C9W B;  3DHG C;  2O6V D;  3C8Y A;  1WJ6 A;  4MGI E;  4B0E A;  4OVU A;  4BKT A;  3V62 A;  3U2S C;  3KYC D;  4PYU A;  3VTU A;  2KAN A;  3BII D;  4WWM A;  1EWY C;  4PK1 A;  3AE7 B;  3W1S C;  4A3P A;  1J19 A;  1TS4 A;  4IM2 A;  4MT5 A;  2J0M A;  2DWQ A;  3UQB A;  1TY2 A;  2GBR A;  2PW9 A;  4YTP B;  4W9H A;  1JQ4 A;  1E7V A;  3GS2 A;  4LNI A;  4FAD A;  2NTT A;  3HUI A;  3QA8 A;  2YEP B;  4B6W A;  1SIF A;  3O13 A;  3TEW A;  2V3P A;  3EHV A;  2LUE A;  5AUK A;  4A55 A;  3NOB A;  2JZ3 B;  1WX9 A;  3RCZ A;  2J53 A;  1IPG A;  2N1W A;  1T0R C;  1XLQ A;  1F0Z A;  4KDL B;  5AUI A;  2IY1 B;  2FAZ A;  3SU8 X;  2XBB C;  3VFK A;  2KQS A;  2MEK A;  2RD0 A;  3AXC A;  3DCG A;  1MPE A;  4M0W A;  2LRW A;  4IW0 A;  1KF6 B;  2PKO A;  4IM3 A;  3N32 A;  4CO7 A;  2QC8 A;  3ZVV A;  2JPH A;  3V6E B;  1L2N A;  1RFA A;  3Q6B A;  3Q2A C;  3NZS A;  4S0R A;  4I6N B;  3JYU A;  1I4H A;  2Q5W D;  4E71 A;  1OEY J;  3NUH B;  1ET9 A;  1NYR A;  1TYG B;  3OAW A;  1FXA A;  1UH6 A;  4XDD A;  5LLI A;  1K51 A;  1V1P B;  2FBW B;  5H92 C;  2R2O A;  1SF0 A;  3IBE A;  3TCA A;  1D5M C;  1KH0 A;  3MHZ A;  3V6C B;  4JIO U;  1KM7 A;  1RYJ A;  2PPH A;  2NPT A;  4PT5 A;  4KIK B;  1S3S G;  4BBN F;  1GC7 A;  2DZI A;  5IKC M;  2O2V B;  3TUO A;  1C9F A;  1JWU D;  2PVO D;  3IVF A;  2ICI A;  1V97 A;  4ITK A;  3MC9 A;  5D3D A;  3A33 B;  4BBN C;  2IO2 B;  4NAW A;  2GI9 A;  5AEK B;  2WHI A;  1JRO A;  1ZPS A;  1EU4 A;  4ZRK A;  3WCQ A;  2WU5 B;  4OW0 A;  1V2Y A;  1YQB A;  2L0T A;  3HIZ A;  3RYT A;  4CQN A;  1D3Z A;  5E6N A;  1XXG A;  2AQ3 B;  4HJG E;  4NJC A;  4BOS C;  4EOY A;  2ZPN A;  1D5X C;  2W55 A;  4WQO B;  1KLV A;  2KWD A;  2MJD A;  3LJ3 A;  1SGH A;  1ZXH A;  1LXD A;  4KKI A;  1F2R I;  2IY0 B;  4BKS D;  4B9K A;  2BT6 A;  1WFY A;  1F77 A;  1FXT B;  1CMX B;  3ZRF A;  2KFK A;  3QIJ A;  1R4M I;  3VUX A;  2C7H A;  2WNM A;  4FJY A;  4C56 C;  2JZP A;  1GUA B;  1C3T A;  4HKZ E;  3EGR A;  2KT7 A;  1WWT A;  3U30 A;  1C4P A;  4W9I A;  1ZUD 2;  2IGG A;  3FIL B;  4KGR A;  4I6P A;  1NYQ A;  3ZRC A;  1MFW A;  1P98 A;  1WGR A;  3APD A;  1M94 A;  2VZK D;  2XNA C;  1LQB A;  3ML9 A;  1MI0 A;  4RGT A;  1CQV A;  2Y5P A;  2WGS A;  1XF5 L;  1LGR A;  1FXI A;  2L3Z A;  5LXH A;  2GBK A;  1WGH A;  2MP2 A;  2L83 A;  4RFB A;  1UGJ A;  4Q2J A;  2Y3A A;  1J7A A;  4ZYN A;  2M4N A;  2CJN A;  2K8C A;  2K3U A;  1TY0 A;  3KH0 A;  4K81 A;  1H8C A;  3UQA A;  4XZ4 A;  2MW5 A;  3Q8E A;  3BK1 A;  4LNK A;  3A9K B;  2IJ0 A;  2JWU A;  2V3S A;  4M8N A;  3TMP B;  4G11 A;  5IP4 D;  5EE0 A;  2EKE C;  1NBF C;  1TTN A;  3VTW A;  4L1B A;  3QK0 A;  2REX A;  3VUW A;  2AX5 A;  4MAC A;  3PRM B;  1WMH B;  2JRI B;  4W9J A;  4HPP A;  2LMC A;  5GMV A;  2VH1 A;  1E8Y A;  3IT4 B;  3WAP A;  4G0N B;  5IN7 A;  2CHW A;  4II2 B;  2L76 A;  1B9R A;  4NAM A;  4OHJ A;  2LVQ A;  4DBG A;  2RR9 A;  4LNF A;  2JWZ A;  3GOE A;  4NPN A;  3QQ8 B;  1WGY A;  4DXF A;  2ZNV B;  2MX2 A;  4YSY B;  3M63 B;  3ZW3 A;  1HA5 A;  3RFZ B;  3KW5 B;  2WXK A;  1E8W A;  2FUG 1;  2Z0D B;  3B9J A;  3TBL D;  1WH3 A;  3ZUN A;  1QOG A;  1FPY A;  2IO3 B;  4EZJ A;  5AZG A;  2QEJ C;  3Q3O C;  5IA7 A;  2BKF A;  2KXJ A;  3AEF B;  1YJ1 A;  2JU6 X;  2WXJ A;  2LZ6 A;  3NY5 A;  2D3B A;  2CR5 A;  2ZW0 A;  2JYE A;  2R61 A;  3RMK C;  1N5W A;  4BFR A;  4IWQ A;  1TKE A;  3DWM A;  1P3Q U;  4MSM B;  4DWF A;  2WDT B;  1SSN A;  2G4S A;  1E8X A;  1HXY D;  1IBX B;  1WXM A;  1T3Q A;  3NVY A;  3P4Q B;  3TEZ A;  4IWP A;  2G3Q B;  1H4R A;  2HTH A;  2Z0E B;  3PT2 B;  3TJP A;  2G9H D;  3SHQ A;  2L1A A;  3RNF C;  3IXS A;  4HRS A;  3B2F A;  4S17 A;  3LXF A;  4W9D A;  4TUU A;  4XYC A;  4DDG D;  1V80 A;  2VZK B;  3E9S A;  5BMG A;  3ZO5 B;  5L95 C;  4IKG A;  1GPX A;  3DBS A;  3C0R B;  1VZ8 A;  2BS3 B;  3B2G A;  3X0W A;  3AM9 A;  5J2R A;  1R4N I;  5HI1 A;  1HEZ E;  2G45 B;  3ML8 A;  2LD9 A;  2QSD A;  4AUQ C;  2AL6 A;  4MJS B;  2BBC A;  1I42 A;  1NI2 A;  1E7U A;  4XWT A;  3H8H A;  3UI3 A;  4WJN A;  1BT0 A;  5J17 A;  3KQ4 A;  2NTS A;  1KLG D;  1GJZ A;  1XLP A;  4WAA A;  1STE A;  2Z59 B;  2KK8 A;  4DHJ D;  4HCN B;  2K25 A;  1FNU A;  2XK5 A;  3VDZ A;  5HG2 A;  1YJJ A;  2K5P A;  4C00 A;  2CU3 A;  3ZDT A;  4FHK A;  1PUT A;  1SB3 C;  4USA A;  3DVG X;  3BZD B;  2CHZ A;  2VRR B;  2WDR B;  4MH0 E;  2IZV B;  1JML A;  2ZVN A;  4ZRI A;  4JGH B;  5DPR A;  2BYE A;  3GZN I;  2DHZ A;  4MM3 A;  2UU7 A;  5C3J B;  3NVZ A;  2WU2 B;  4J3O D;  2WYQ A;  1XLN A;  2G1E A;  4LJO B;  3KUD B;  4FJV B;  1JCK B;  5EE3 A;  4LJP B;  1N61 A;  1T0Y A;  4HEA 1;  1K52 A;  3AI5 A;  1XCT L;  4KZC A;  3N20 C;  3P63 A;  1GC6 A;  2LJ5 A;  4GIV A;  3DHI C;  1C1Y B;  4LNN A;  4RGO S;  3AE2 B;  3Q3M C;  3AU4 A;  4LK0 M;  2KTR A;  2TSS A;  3V3X A;  2X8X X;  1OEY A;  4L2Y A;  1FRD A;  2IDY A;  2INN E;  3DVN U;  2EEL A;  1K53 A;  3VXW A;  2GOW A;  2DAJ A;  1RLF A;  2WXO A;  1L6U A;  5EDS A;  3AEE B;  2KJH B;  3R3M A;  4BAX A;  2LHD A;  2MHJ A;  3NVW A;  2KAJ A;  4ZRJ A;  3WAL A;  3P42 A;  2C7M B;  2QJL A;  4NQK E;  4LLG M;  2MBH A;  3A9J B;  4KKJ A;  4D2K A;  1WM2 A;  5AZH A;  2MBE A;  3AN1 A;  4JWU C;  1GOZ A;  4F7Z A;  5HKH A;  1UBI A;  1F52 A;  2IGH A;  3M3J A;  1P1A A;  4MEL A;  1C76 A;  1ZGU B;  3HVZ A;  3P4S B;  4ANU A;  1FFV A;  2K8B A;  2MJ3 A;  2GBN A;  4KSK C;  4WJQ A;  3EC8 A;  3R7R A;  2LGY A;  4YT0 B;  1NEN B;  2DEN B;  4KV2 A;  2K9X A;  3CSF A;  4EUT A;  2FCQ A;  4AWJ A;  1FCC C;  1R4N B;  3ZKJ C;  1YN3 A;  1WGG A;  1Q10 A;  4HPM B;  1UBQ A;  2NCN A;  2N9P C;  1YX5 B;  4L23 A;  1FNW A;  3VR9 B;  1L7Y A;  1IYF A;  1G6J A;  3P1M A;  2L32 A;  4RM8 A;  1SXT A;  2KN4 A;  4GDK A;  3RZF A;  3EFC A;  1R7S A;  1WGD A;  1TBE A;  2RSU A;  4DHJ B;  3MC0 B;  3I57 A;  3ZDM C;  2R2Q A;  1C77 A;  4IM0 A;  3BIN A;  1MHX A;  5BYR A;  2N1V A;  4MGK E;  3I3T B;  1YOV B;  1Q1O A;  3GZN B;  3B1L X;  4GGQ A;  1VZ6 A;  2QIE B;  1YD8 U;  2BYV E;  1PGX A;  4KDI C;  4ANX A;  2K8H A;  4KIK A;  1I4P A;  3W9C B;  2K6D B;  4X57 B;  1Y56 A;  3R7Q A;  1VD2 A;  3ZTD A;  2O2V A;  3DBL B;  2M17 A;  3L54 A;  5AZF A;  4EKU A;  2XEW A;  1C4C A;  3H6N A;  1FM0 D;  3MP9 A;  2MWS B;  1ESF A;  4BOZ B;  1PGB A;  4JLC A;  1LM8 B;  2RMM A;  2GLS A;  2I2Y A;  4TQ1 A;  1MJD A;  2IYD B;  2BPS A;  4IOI E;  1ENF A;  1Z2M A;  4FA6 A;  4W9C A;  3LYY A;  2CU1 A;  3PZ7 A;  2E6X A;  5BYQ A;  1SJE D;  2Y5C A;  3R2T A;  4M0W B;  3SFD B;  3WIM A;  1E90 A;  1IGC A;  4ARC A;  1WYW B;  3JSV A;  3EA6 A;  1I35 A;  1V5T A;  3BK2 A;  2ACZ B;  2BQQ A;  3NZU A;  1C78 A;  1YMH E;  3W5V B;  2NMQ A;  3TEX A;  4FUL A;  3OLM D;  2KLG A;  4KX6 B;  3RT3 B;  2FIF A;  2A5U A;  3DHH C;  4XC2 A;  4AJY B;  4F1S A;  2EMT A;  3KWV A;  3TIX A;  2V9H A;  2O6V A;  4GN1 A;  2MQJ A;  1QOB A;  2B3A A;  1WIA A;  4C4V B;  1WZ0 A;  5IO9 A;  2PVG C;  1FCL A;  1ZW7 A;  1LO5 D;  4N58 A;  1SIJ A;  1SBB B;  3HRD D;  4A6Q A;  4EFO A;  3PZD A;  4H2A A;  2V3N A;  2RGF A;  3NS8 A;  3O65 B;  3AB5 A;  4OZA A;  2BKR B;  2KJR A;  5CHW A;  4LNO A;  2ZPY A;  4XWW A;  1WI0 A; 
#chains in the Genus database with same CATH homology
 3QQ8 B;  1TGZ B;  3RD2 A;  1WGY A;  3CF6 E;  4FBJ B;  2ZNV B;  2MX2 A;  2MSE D;  3M63 B;  2AL3 A;  4HLE A;  3PVL A;  3ZW3 A;  2N7E A;  2AYO B;  3PHX B;  2NBW B;  3DQV A;  4KSL C;  2JZZ A;  3ZNH B;  3KW5 B;  1V86 A;  5IAA C;  1E8W A;  4AJW A;  2Z0D B;  2IBI B;  1X1M A;  2FNJ B;  2ZCC A;  3TBL D;  2BWF A;  1WH3 A;  4MGZ E;  1VCB A;  2MLB A;  2KQ7 A;  2HE7 A;  3H1U A;  2JRH A;  3ZUN A;  5CHF A;  2IO3 B;  3DDC B;  4EZJ A;  3A4S C;  5CHV C;  5JHA A;  4K7U A;  4MSQ B;  4NJ6 A;  3UF8 A;  2DZJ A;  4JL9 A;  2NR2 A;  4AOF A;  4J6I A;  1YIW A;  2L00 B;  5AZG A;  3HM6 X;  1UD7 A;  5IA7 A;  1UZX B;  2CKH B;  2BKF A;  2KXJ A;  3ZLZ A;  1YJ1 A;  2RPQ A;  3SDL C;  3T8M A;  3V61 A;  1GNU A;  2FUH B;  2LZ6 A;  3NY5 A;  4A20 A;  2CR5 A;  3VHT C;  2KX3 A;  3QJZ A;  2ZJD A;  2WX0 A;  1WZ3 A;  3L17 A;  4W9E A;  3PPA A;  2LWP A;  4BFR A;  2ZNV C;  4IWQ A;  3LDZ E;  1WJ4 A;  2MBO A;  3A9J A;  3VH3 B;  2C7N B;  2NS5 A;  1P3Q U;  5KHO A;  4MSM B;  2I1K A;  4DWF A;  2WDT B;  4ICU A;  2W9N A;  1KJT A;  4FLH A;  1EF5 A;  2G4S A;  4HWI B;  3QHT A;  1WJU A;  4GDK B;  1E8X A;  5E6O A;  2BYF A;  1WXM A;  2KVR A;  2KKC A;  3H7P B;  2DYO A;  4W9K A;  3RUI B;  3U8Z A;  3UIO B;  3JVZ X;  3WA0 A;  3ZNI D;  3VVW B;  1Q5W B;  4IWP A;  5C1Z A;  2G3Q B;  4BVU C;  1E8Z A;  1H4R A;  2HTH A;  2D11 A;  3PLU A;  2KMC A;  2PE9 A;  2JVC A;  2Z0E B;  3BY4 B;  3PT2 B;  3S2A A;  3TJP A;  3SHQ A;  1OTR B;  1V49 A;  2BWE S;  4GU2 A;  4NJ7 A;  1OGW A;  3WAM A;  4W9D A;  4TUU A;  1WX8 A;  4LDT B;  3RUL A;  3H7S A;  3QAR A;  4DDG D;  2IO0 B;  1V80 A;  1WMH A;  1XQQ A;  2CHX A;  5FR6 A;  4B95 A;  3ZO5 B;  5L95 C;  2K39 A;  4PS3 A;  5TR5 A;  3VTV A;  3QWZ B;  2D3G A;  4JQW C;  2I1J A;  3DBS A;  3IFW B;  3U7D A;  3V60 A;  5L83 A;  2M0X A;  3C0R B;  3PRE A;  3X23 A;  4GOC A;  3W1Y A;  1U4A A;  1WRD B;  3X0W A;  3EFU A;  5J2R A;  2N4F A;  1R4N I;  1Y8R C;  3VQI A;  3B08 A;  3OJ3 A;  3OJ4 B;  3KUC B;  3PS6 A;  1MG8 A;  3JW0 X;  2G45 B;  2ZZP B;  2JUO A;  2G4D B;  2C9W B;  3P2B A;  3ML8 A;  2LD9 A;  2O6V D;  2V4L A;  4AUQ C;  2AL6 A;  2C5L C;  1WJ6 A;  4MGI E;  3PSE B;  4MJS B;  2IO1 B;  3VH4 B;  4II3 B;  4EZK A;  5D7G A;  2UYZ B;  4OVU A;  1I42 A;  1NI2 A;  4BKT A;  1E7U A;  3V62 A;  3KUZ A;  3B0A A;  4WJN A;  4HDO A;  3QAQ A;  1BT0 A;  2MP2 B;  2NPT B;  1Q0W B;  5J17 A;  3KYC D;  1GJZ A;  4PYU A;  4WAA A;  4GSW A;  2Z59 B;  2KK8 A;  2KAN A;  3VTU A;  4DK5 A;  5DPW A;  4DHJ D;  3L0W B;  2KDB A;  2K25 A;  1NDD A;  2XK5 A;  4HCN B;  4N9F 4;  3VDZ A;  3W1S C;  4A3P A;  1J19 A;  4IM2 A;  1E5W A;  1WR1 A;  2LI5 A;  3JSV B;  4G3X B;  1TZ1 A;  2J0M A;  1XD3 B;  3UQB A;  2GBR A;  1V81 A;  3VAW A;  3ZDT A;  4FHK A;  4W9H A;  1Z5S B;  5CTR C;  1E7V A;  2KTF A;  4EEW A;  4FAD A;  4CYE A;  3QA8 A;  4B6W A;  2KFJ A;  1SIF A;  1EO6 A;  3PRZ A;  3DVG X;  4BKS A;  3R66 C;  4NAW B;  2CHZ A;  2VRR B;  4MEM A;  3EHV A;  4MH0 E;  2LUE A;  2PJH A;  2IZV B;  1WXV A;  3NOB A;  2JZ3 B;  2ZEQ A;  2ZVN A;  4XX5 A;  1WX9 A;  2O6V B;  4ZRI A;  4JGH B;  3RCZ A;  2YVC A;  5DPR A;  4CHK A;  1IPG A;  2BYE A;  2N1W A;  2DHZ A;  3GZN I;  4MM3 A;  2N9X A;  4KDL B;  1KOT A;  2IY1 B;  2FAZ A;  2WYQ A;  3SU8 X;  3HM3 A;  2XBB C;  3VFK A;  2GBM A;  2KQS A;  2JXX A;  4LJO B;  2D10 A;  4HK2 A;  2HD5 B;  3KUD B;  4FJV B;  5CX3 A;  2RD0 A;  4LJP B;  3AXC A;  4K7W A;  1T0Y A;  3DCG A;  3AI5 A;  1PQS A;  2LRW A;  4IW0 A;  4KZC A;  4HDQ A;  2A4Z A;  5DCN A;  3ZTC A;  4W9G A;  3AU5 A;  4IM3 A;  1GC6 A;  2LJ5 A;  4GIV A;  5D94 A;  3CST A;  3N32 A;  4CO7 A;  1C1Y B;  3WAN A;  3APF A;  3ZVV A;  2JPH A;  4K7S A;  3V6E B;  1L2N A;  1RFA A;  2KDE B;  4OVV A;  3NZS A;  4FHJ A;  2N9E B;  1A5R A;  1IP9 A;  4I6N B;  3JYU A;  3W1S A;  3AU4 A;  3A9K A;  2KTR A;  1RAX A;  2ZVO A;  4E71 A;  2MA9 B;  1OEY J;  4YL8 A;  1OEY A;  4E3C A;  3IHP C;  1AAR A;  2KFK B;  2JF5 A;  3DVN U;  4PS7 A;  2MRP A;  4RM9 A;  3OAW A;  1UH6 A;  4LCD E;  4WWN A;  5JHB A;  3A1Q A;  3VXW A;  5BO4 B;  2GOW A;  5LLI A;  2DAJ A;  1WE6 A;  1RLF A;  2NBU A;  3L16 A;  4TQ0 A;  2KDF B;  2D2Q A;  2GMI C;  2J7Q B;  2R2O A;  3L08 A;  4NNJ B;  4GDL A;  3VUY A;  3ZNG C;  2ASQ A;  4ANW A;  3IBE A;  3TCA A;  4DHZ B;  3UGB B;  5EDS A;  2KJH B;  1K8R B;  2N7D A;  4MJS A;  2KD0 A;  5D2M B;  2LVP A;  2WX1 A;  3V6C B;  4JIO U;  3QC8 B;  3R3M A;  1KM7 A;  1WY8 A;  1WXA A;  2PPH A;  1XT9 B;  1WR6 E;  2NPT A;  3QX1 A;  1ZKH A;  4AP4 C;  4KIK B;  4PS8 A;  1S3S G;  4ZRJ A;  1GC7 A;  4ANV A;  3WAL A;  4BBN F;  4DHZ E;  2C60 A;  2DZI A;  2DX5 B;  2KC1 A;  2L8J A;  2DAF A;  2OOB B;  2O2V B;  2JY6 A;  4HXD A;  1WM3 A;  3AUL A;  3M62 B;  2KN5 A;  2C7M B;  3ZNZ B;  3ZIM A;  3IVF A;  4NQK E;  2MBH A;  3A9J B;  2MCN B;  1WM2 A;  5AZH A;  2MBE A;  2LXC A;  4F7Z A;  5HKH A;  1UBI A;  3ONS A;  4HCP B;  3IG3 A;  3M3J A;  1P1A A;  3MHS D;  4FJZ A;  4MEL A;  3H9D A;  3Q3J A;  1ZGU B;  4URK A;  3A33 B;  2QHO A;  2DZK A;  2K6Q A;  4BBN C;  2IO2 B;  2K8B A;  4NAW A;  2GBN A;  4KSK C;  4WJQ A;  4ANU A;  3EC8 A;  4TKN A;  5AEK B;  3R7R A;  4I6L B;  3HHM A;  2LXA A;  4GMV A;  1QZE A;  2LGY A;  3MJW A;  2DEN B;  4KV2 A;  5D6J B;  2FCM A;  3CSF A;  4ZRK A;  4EUT A;  2FCQ A;  4AWJ A;  1V2Y A;  4DXA B;  3ZKJ C;  4HPL B;  4NY0 A;  2JT4 B;  1YQB A;  2L0T A;  3HIZ A;  2KHW B;  2KNB A;  1WGG A;  3RYT A;  1D3Z A;  5E6N A;  3PV1 A;  2LAS A;  4HPM B;  4BOS C;  4EOY A;  2OJR A;  4NQL B;  4W9F A;  1UBQ A;  2NCN A;  4TV3 A;  2KZR A;  2N9P C;  2FCS A;  2ZPN A;  2KDI A;  1YX5 B;  2V1Y A;  3L10 B;  3PRP B;  4WQO B;  1KLV A;  3K9O B;  3RZW C;  1SE9 A;  1IYF A;  1L7Y A;  1G6J A;  5G55 A;  4MDK E;  2KO3 A;  3LJ3 A;  1SGH A;  4RM8 A;  1WE7 A;  2L05 A;  1RRB A;  3UIN B;  3KVF B;  1LXD A;  2NBV B;  2IY0 B;  4GDK A;  4IG7 B;  4WWP A;  2Y5B B;  4BKS D;  3ENE A;  4B9K A;  4ICV A;  3RZF A;  3H7P A;  4HJK A;  1WGD A;  1WFY A;  1FXT B;  1TBE A;  3D32 A;  1CMX B;  2LGD A;  3ZRF A;  3DVG Y;  2KFK A;  2RSU A;  4DHJ B;  3QIJ A;  4KVG B;  1R4M I;  3VUX A;  2C7H A;  2M8S A;  3K9P B;  3ZDM C;  2R2Q A;  4FJY A;  3DBL I;  5C23 A;  2M1M A;  1YX6 B;  4IM0 A;  2PE6 B;  5DPT A;  1GUA B;  3BIN A;  1C3T A;  2WWZ A;  2KWV B;  2N1V A;  4MGK E;  3I3T B;  1HE8 A;  1Q1O A;  2HJ8 A;  2XK5 B;  3B1L X;  4GGQ A;  3PTF C;  3U30 A;  4IUM B;  4W9I A;  4FN2 A;  3DPD A;  2LGX A;  1YD8 U;  4KZ0 A;  2KWU B;  5JH5 C;  2BYV E;  4KDI C;  4I6P A;  4ANX A;  2K8H A;  4KIK A;  3ZRC A;  4LDT D;  3DBR I;  2NVU I;  2K6D B;  3M95 A;  4K1R B;  4X57 B;  1P98 A;  1WGR A;  3PHW B;  1J0G A;  3APD A;  1M94 A;  3R7Q A;  1VD2 A;  4EZL A;  3ZTD A;  2O2V A;  4IWO A;  4HVB A;  5JZE B;  2CS4 A;  2M17 A;  2UWQ A;  3L54 A;  5AZF A;  4EKU A;  2XEW A;  2K1F A;  1LQB A;  3EEC A;  1J8C A;  3H6N A;  3UIP B;  3QCA A;  3ML9 A;  2LRU A;  2MWS B;  4BOZ B;  4JLC A;  1JRU A;  2MBQ A;  4MGY E;  4PYZ A;  3N30 A;  2AEH A;  3A4R A;  1EF1 A;  1LM8 B;  1WF9 A;  4TQ1 A;  4RMA A;  2L3Z A;  3ALB A;  5LXH A;  1V5O A;  2IYD B;  2BPS A;  4WJO A;  3TL5 A;  1Z2M A;  1OQY A;  2GBK A;  4FA6 A;  4W9C A;  1WGH A;  2MP2 A;  2YLM A;  2CU1 A;  2DYM A;  3PGE A;  4GXB A;  4BKG A;  3Q3F A;  4M0W B;  4P7I A;  3WAO A;  2J0K A;  3WIM A;  2KLC A;  1E90 A;  4ZDV A;  4F8C B;  3HK0 A;  2KJ6 A;  2BGF A;  4ZYN A;  2M4N A;  1WYW B;  1P9D U;  2KOX A;  3DOW A;  4A3O A;  2K8C A;  3JSV A;  1I35 A;  2LVO A;  5DPS A;  2J0J A;  4G50 A;  3KH0 A;  1V5T A;  4K81 A;  3NZU A;  1H8C A;  3UQA A;  4XZ4 A;  2MW5 A;  3T9L A;  2L0F A;  4WWO A;  4FUL A;  3APC A;  4IC7 B;  3OLM D;  3A9K B;  2KLG A;  3N3K B;  4M8M A;  4DDI D;  2FID A;  1UEL A;  2KTR B;  2D07 B;  3RT3 B;  5J18 A;  1P0R A;  2V3S A;  1UGM A;  2FIF A;  4M8N A;  3TMP B;  2A5U A;  4XC2 A;  4G11 A;  4AJY B;  4F1S A;  2EMS A;  2EKE C;  2MBB B;  2EMT A;  1NBF C;  1WXS A;  2KMA A;  3TIX A;  2O6V A;  4GN1 A;  4GB9 A;  5G2N A;  1WJN A;  2MQJ A;  5LXI B;  2AWT A;  2B3A A;  1TTN A;  1V9J A;  3L13 A;  1EUV B;  1LFD A;  3A1Q B;  3VTW A;  1WIA A;  1WX7 A;  2ZCB A;  1WZ0 A;  3QK0 A;  2REX A;  2BF8 B;  1ZW7 A;  3VUW A;  1ISN A;  3DBH I;  2DZM A;  1GG3 A;  4GDL B;  3PRM B;  2FCN A;  4ASW C;  1WMH B;  2JRI B;  2L7R A;  4W9J A;  2GBJ A;  5GMV A;  1F9J A;  1E8Y A;  2KWC A;  4EFO A;  3PZD A;  3WAP A;  4G0N B;  5KHQ A;  2CHW A;  2RGF A;  3CMM B;  4II2 B;  2L76 A;  3KYD D;  3ECI A;  3NS8 A;  1S1Q B;  2DYB A;  3DVN V;  2KC2 A;  2LVQ A;  2KX0 A;  3O65 B;  4DBG A;  2RR9 A;  5E6P A;  4E74 A;  4W9L A;  2BKR B;  2KJR A;  1V6E A;  5CHW A;  3PLV A;  3NHE B;  3MTN B;  3SD5 A;  2PEA A;  2ZPY A;  2JWZ A;  4WJP A;  1WI0 A;  3GOE A;  4NPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...