2UX1A

Identification of two zinc-binding sites in the streptococcus suis dpr protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
151
structure length
151
Chain Sequence
LADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural Basis of the Zinc- and Terbium-Mediated Inhibition of Ferroxidase Activity in Dps Ferritin- Like Proteins.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
total genus 66
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2ux1A00
4LPJA 3PVYB 2Z90A 5ERJA 1TJOA 3NP0X 4LQJA 5J9VA 3WVUA 4TOFA 4LPNA 4A25A 2FG8A 5J8WA 4EVDA 4XKUA 1BFRA 1VJXA 1BG7A 2IB0A 4LQHA 3GVYA 3OGHA 4CVPA 3BVIA 3ERZA 4KVSA 2V2SA 2HTNA 4TOAA 1JI5A 2Z5QA 3RE7A 3HL1A 1S30A 1JREA 4TOCA 4TW3A 4M33A 2CN7A 3AJPA 3R2MA 2XJMA 4TOHA 2V2IA 3KA4A 4DASA 2CHIA 4MN9A 1TK6A 2ZA6A 2D5KA 1JIGA 4DI0A 4LQNA 5K52A 3HIUA 3E6SA 4RC5B 3R2SA 3PVRA 4LQVA 1ZUJA 5LS9A 4IWKA 1QYBA 3OJ5A 1RCIA 4MJYA 3R2OA 2VXIA 2W0OA 5LG2A 2WTLA 4ISMA 4MKUA 2ZURX 3SH6A 4CMYV 3KA6A 3E1JA 1RCDA 3SE1A 1O9RA 4II4B 5CZUA 5CMRA 3E1OA 1LKMA 1QGHA 3IS7A 5HJHA 4DYYA 5J8SA 4ZL5A 1KRQA 1JTSA 2C2FA 1UMNA 2WLAA 3AK9A 3GE4A 4XKTA 2JD80 1YUXA 1VEQA 1RCEA 1Z4AA 3E1LA 1XZ1A 4REUA 1NNQA 3T9JA 2OH3A 4DYUA 3BVEA 1TKOA 3FVBA 3PVYA 3QB9A 1MFRA 4U3GA 1O9IA 3F36A 3KA8A 3E1NA 1F33A 1JKUA 3E2CA 4DYXA 1JGCA 5FFEA 3A68A 3E1QA 4R42A 2Z5PA 2Y3QA 4ZKWA 3E1MA 1Z6OM 4QUWA 1R03A 3FI6A 3KWOA 3PWQC 4AM5A 4TODA 4KVQA 2V2PA 5GN8B 3RGDA 1OTKA 3F39A 3E1PA 4CY9A 4ERUA 2BW1A 5LG8A 1SQ3A 2V2RA 2IU2A 4E6KA 2RBDA 1NF4A 4RC7B 3Q4QA 5D8QA 4RC6B 5FEJA 3IS8A 1LKPA 2V2OA 4RC5A 3F33A 2QQYA 1NF6A 5D8RA 2FKZA 3SHXA 4RC8A 5ERKA 5E1UA 2X170 3ES3A 2CIHA 2IY4A 2V2LA 2BKCA 3QZ3A 4LPMA 3U90A 4PG0A 3PWQA 5D8XA 2GYDA 3BVKA 1F30A 4II4A 4CYAA 3RBCA 4TOGA 3QVDA 2CHPA 1B71A 2V2NA 3WVVA 4Z3BA 3KA3A 3R2LA 4TOBA 1L8HA 2YW7A 3RD0A 3BKNA 3QD8A 1JYBA 2G4HA 1VEIA 4DYZA 3PW1B 4CVTA 3AF7X 5JKLA 4ZJKA 3FSEA 3AF9X 5AXSA 4CYBA 1RCGA 3BVLA 4KVRA 5JKMA 4PG1A 1H96A 3AK8A 5GOUA 1EUMA 4ITTA 5LBHA 4OYNA 2C2JA 3F38A 1JKVA 2Z5RA 3SIDA 3Q4NA 2WLUA 1MOJA 1GWGA 4ML5A 1Z6OA 3Q4OA 3UOIA 5HQOA 1J30A 1ZS3A 4M34A 2GYQA 2VXXA 1L8IA 3NP2X 5GN8A 3EZ0A 4ZKXA 4ZMCA 4YKHA 5FFCA 5FFDA 3NOZX 3QHCA 3TA8A 4XKSA 3KXUA 4M32A 2ZG9X 3QHBA 2ZG8X 1RYTA 4CVSA 1N1QA 5JACA 1LB3A 2VZBA 1JI4A 3UOFA 4RC7A 4DE6A 4RC6A 5C6FA 1VELA 4IXKA 1SOFA 4Y08A 2BJYA 3PVTB 3UNOA 3KA9A 3EGMA 3RAVA 3WNWA 4IWJA 2FJCA 4EVBA 2Z6MA 3PWFA 4TO9A 3R2RA 5FFBA 2BK6A 4AM4A 5FFAA 5D8YA 4ZLWA 2QF9A 3MPSA 5GU1X 3F35A 3O7RA 5D8SA 3H7GA 1S2ZA 3AJOA 1FHAA 1RCCA 3PW8C 1DPSA 1UVHA 2XKQA 1BCFA 5IX6A 2XJNA 3BT5A 3A9QA 5CMQA 1DVBA 2FL0A 1S3QA 2JD60 1NFVA 2F7NA 4ZL6A 5HJFA 2CF7A 3EZUA 4CVRA 3IQ1A 4MUDA 3WVWA 2V15A 4ZKHA 4PGIA 4TOEA 2ITBA 4ISPA 4CMYA 2CEIA 1IESA 3GHQA 2XGWA 3KX9A 4XGSA 5K53A 1YUZA 4ZTTA 5D8OA 4ETRA 2FHAA 3R2HA 3PW1A 4EVCA 2V2MA 4P18A 3AJQA 5GU0X 4LYUA 3Q4RA 3F34A 4Z5SA 2HR5A 2YW6A 1XZ3A 1IERA 2CN6A 3ISFA 5D8PA 3PVRB 3ISEA 1AEWA 3PW8A 2C2UA 4EVEA 2CLUA 2ZA8A 2CLBA 3PZAA 2XJOA 2GS4A 2FZFA 3R2KA 5J93A 1LKOA 2JD70 2PYBA 1TKPA 3BVFA 2UX1A 5E2DA 3F32A 5JKLG 1YV1A 2FFXJ 3AF8X 4LYXA 3O7SA 1HRSA 1VLGA 3F37A 2ZG7X 4ITWA 4MY7A 3VNXA 5JKMG 5GU2X 4M35A 3E6RA 2C41A 2YJJA 4AM2A 2C6RA 2V2JA 2ZA7A 3PVTA 5GU3X 5I4JA 2OC5A 2FG4A 4DZ0A 4PGKA 2YJKA 1DATA
chains in the Genus database with same CATH superfamily
4LPJA 3PVYB 2Z90A 5ERJA 1TJOA 3NP0X 4LQJA 5J9VA 3WVUA 4TOFA 4LPNA 4A25A 2FG8A 5J8WA 4EVDA 4XKUA 1BFRA 1VJXA 1BG7A 3FRSA 3VVAA 4E40A 2IB0A 4LQHA 2V8UA 3GVYA 3OGHA 4CVPA 3BVIA 3ERZA 4KVSA 3V3KB 2V2SA 2HTNA 4TOAA 1JI5A 3FRRA 2Z5QA 3RE7A 3HL1A 1S30A 1JREA 4TOCA 4TW3A 4M33A 2CN7A 4YXJA 3AJPA 3R2MA 3JZ9A 2XJMA 4TOHA 2V2IA 3KA4A 3VV9A 4DASA 3GGZA 2CHIA 4MN9A 1TK6A 2ZA6A 2D5KA 1JIGA 4DI0A 4LQNA 5K52A 3HIUA 2G38B 3E6SA 4RC5B 3R2SA 3PVRA 4LQVA 1ZUJA 5LS9A 3DBYA 4IWKA 1QYBA 3OJ5A 1RCIA 4MJYA 3R2OA 2VXIA 2W0OA 5LG2A 2WTLA 4ISMA 4MKUA 2ZURX 3SH6A 4CMYV 3KA6A 3E1JA 1RCDA 3SE1A 1O9RA 3L0MA 4II4B 5CZUA 5CMRA 3E1OA 1LKMA 1QGHA 3IS7A 5HJHA 4DYYA 5J8SA 4ZL5A 1KRQA 1JTSA 2C2FA 1UMNA 2WLAA 3AK9A 3GE4A 4XKTA 2JD80 1YUXA 1VEQA 1RCEA 1Z4AA 3E1LA 1XZ1A 4REUA 1NNQA 3T9JA 2OH3A 4DYUA 3BVEA 1TKOA 3FVBA 3PVYA 3QB9A 1MFRA 4U3GA 1O9IA 3F36A 3KA8A 3E1NA 1F33A 1JKUA 3E2CA 4DYXA 1JGCA 5FFEA 3A68A 3E1QA 4R42A 2Z5PA 2Y3QA 4ZKWA 3E1MA 1Z6OM 4QUWA 1R03A 3FI6A 3KWOA 3PWQC 4AM5A 4TODA 4KVQA 2V2PA 5GN8B 3RGDA 1OTKA 3F39A 3E1PA 4CY9A 4ERUA 2BW1A 5LG8A 1SQ3A 2V2RA 2IU2A 4E6KA 2RBDA 1NF4A 3C21A 4RC7B 3Q4QA 5D8QA 4RC6B 5FEJA 3GGYA 3IS8A 1LKPA 2V2OA 4RC5A 3F33A 2QQYA 1NF6A 5D8RA 2FKZA 3SHXA 4RC8A 5ERKA 5E1UA 2X170 3ES3A 2CIHA 2IY4A 2V2LA 2BKCA 3QZ3A 4LPMA 3U90A 4PG0A 3PWQA 5D8XA 2GYDA 3BVKA 1F30A 4W4LB 4II4A 4CYAA 3N6OA 3RBCA 4TOGA 3QVDA 2CHPA 1B71A 2V2NA 3WVVA 4Z3BA 3KA3A 3R2LA 4TOBA 1L8HA 2YW7A 3RD0A 3BKNA 3QD8A 1JYBA 2G4HA 1VEIA 4DYZA 3PW1B 4CVTA 3AF7X 5JKLA 4W4KB 4ZJKA 3FSEA 4X0JA 3AF9X 5AXSA 4CYBA 1RCGA 3BVLA 4KVRA 5JKMA 4PG1A 1H96A 3AK8A 5GOUA 1EUMA 4WJG4 3C23A 4ITTA 5LBHA 4OYNA 2C2JA 3F38A 3D19A 2OKCA 1JKVA 2Z5RA 3SIDA 3Q4NA 2WLUA 1MOJA 1GWGA 4ML5A 1Z6OA 2N02A 3Q4OA 3UOIA 1J30A 5HQOA 1ZS3A 4M34A 2GYQA 2VXXA 1L8IA 3NP2X 5JDOB 5GN8A 3EZ0A 4ZKXA 4ZMCA 4YKHA 5FFCA 5FFDA 3NOZX 3QHCA 3TA8A 4XKSA 3KXUA 4M32A 2ZG9X 3QHBA 2ZG8X 1RYTA 4CVSA 1N1QA 5JACA 1LB3A 2VZBA 1JI4A 3UOFA 4RC7A 4DE6A 4RC6A 5C6FA 1VELA 4IXKA 1SOFA 4Y08A 2BJYA 3PVTB 3UNOA 3KA9A 3EGMA 4MXPA 3RAVA 3WNWA 4IWJA 2FJCA 4EVBA 2Z6MA 3PWFA 4TO9A 3R2RA 5FFBA 2BK6A 4AM4A 5FFAA 5D8YA 4ZLWA 5HU6D 2QF9A 3MPSA 5GU1X 3F35A 3O7RA 5D8SA 3H7GA 1S2ZA 3AJOA 1FHAA 1RCCA 3PW8C 1DPSA 1UVHA 3JZAB 2XKQA 1BCFA 5IX6A 3KHKA 2XJNA 3BT5A 3A9QA 5CMQA 1DVBA 2CWLA 2FL0A 1S3QA 3C1ZA 2JD60 1NFVA 2F7NA 4ZL6A 5HJFA 2CF7A 2V8TA 3EZUA 4CVRA 4YXMA 3LKDA 3IQ1A 4MUDA 3WVWA 2V15A 4ZKHA 4PGIA 4TOEA 2ITBA 4ISPA 4CMYA 2CEIA 1IESA 2MGYA 3GHQA 2XGWA 3KX9A 3W54A 4XGSA 5K53A 1YUZA 4ZTTA 5D8OA 4ETRA 2FHAA 3R2HA 3PW1A 4EVCA 2V2MA 4P18A 3AJQA 2AR0A 5GU0X 4LYUA 3Q4RA 3F34A 4Z5SA 2HR5A 2YW6A 1XZ3A 1IERA 2CN6A 3ISFA 5D8PA 3PVRB 3ISEA 1AEWA 3PW8A 2C2UA 3UFBA 4EVEA 2CLUA 2ZA8A 2CLBA 3PZAA 2XJOA 2GS4A 2FZFA 3R2KA 5J93A 2Y44A 1LKOA 2JD70 2PYBA 1TKPA 3BVFA 2UX1A 5E2DA 3F32A 5JKLG 1YV1A 2FFXJ 3AF8X 5JDOA 4LYXA 3C1YA 3O7SA 1HRSA 1VLGA 4KXRB 3KDQA 2WWXB 3F37A 2ZG7X 4ITWA 4MY7A 3VNXA 5JKMG 4YVZA 5GU2X 4M35A 3E6RA 2C41A 3M6JA 2YJJA 4AM2A 2C6RA 2V2JA 2ZA7A 3PVTA 5GU3X 5I4JA 2OC5A 2FG4A 4DZ0A 4PGKA 2YJKA 1DATA
chains in the Genus database with same CATH topology
4LPJA 3PVYB 2Z90A 5ERJA 1TJOA 3NP0X 4LQJA 5J9VA 3WVUA 4TOFA 4LPNA 4A25A 2FG8A 5J8WA 4EVDA 4XKUA 1BFRA 1VJXA 1BG7A 3FRSA 3VVAA 4E40A 2IB0A 4LQHA 2V8UA 3GVYA 3OGHA 4CVPA 3BVIA 3ERZA 4KVSA 3V3KB 2V2SA 2HTNA 4TOAA 1JI5A 3FRRA 2Z5QA 3RE7A 3HL1A 1S30A 1JREA 4TOCA 4TW3A 4M33A 2CN7A 4YXJA 3AJPA 3R2MA 3JZ9A 2XJMA 4TOHA 2V2IA 3KA4A 3VV9A 4DASA 3GGZA 2CHIA 4MN9A 1TK6A 2ZA6A 2D5KA 1JIGA 4DI0A 4LQNA 5K52A 3HIUA 2G38B 3E6SA 4RC5B 3R2SA 3PVRA 4LQVA 1ZUJA 5LS9A 3DBYA 4IWKA 1QYBA 3OJ5A 1RCIA 4MJYA 3R2OA 2VXIA 2W0OA 5LG2A 2WTLA 4ISMA 4MKUA 2ZURX 3SH6A 4CMYV 3KA6A 3E1JA 1RCDA 3SE1A 1O9RA 3L0MA 4II4B 5CZUA 5CMRA 3E1OA 1LKMA 1QGHA 3IS7A 5HJHA 4DYYA 5J8SA 4ZL5A 1KRQA 1JTSA 2C2FA 1UMNA 2WLAA 3AK9A 3GE4A 4XKTA 2JD80 1YUXA 1VEQA 1RCEA 1Z4AA 3E1LA 1XZ1A 4REUA 1NNQA 3T9JA 2OH3A 4DYUA 3BVEA 1TKOA 3FVBA 3PVYA 3QB9A 1MFRA 4U3GA 1O9IA 3F36A 3KA8A 3E1NA 1F33A 1JKUA 3E2CA 4DYXA 1JGCA 5FFEA 3A68A 3E1QA 4R42A 2Z5PA 2Y3QA 4ZKWA 3E1MA 1Z6OM 4QUWA 1R03A 3FI6A 3KWOA 3PWQC 4AM5A 4TODA 4KVQA 2V2PA 5GN8B 3RGDA 1OTKA 3F39A 3E1PA 4CY9A 4ERUA 2BW1A 5LG8A 1SQ3A 2V2RA 2IU2A 4E6KA 2RBDA 1NF4A 3C21A 4RC7B 3Q4QA 5D8QA 4RC6B 5FEJA 3GGYA 3IS8A 1LKPA 2V2OA 4RC5A 3F33A 2QQYA 1NF6A 5D8RA 2FKZA 3SHXA 4RC8A 5ERKA 5E1UA 2X170 3ES3A 2CIHA 2IY4A 2V2LA 2BKCA 3QZ3A 4LPMA 3U90A 4PG0A 3PWQA 5D8XA 2GYDA 3BVKA 1F30A 4W4LB 4II4A 4CYAA 3N6OA 3RBCA 4TOGA 3QVDA 2CHPA 1B71A 2V2NA 3WVVA 4Z3BA 3KA3A 3R2LA 4TOBA 1L8HA 2YW7A 3RD0A 3BKNA 3QD8A 1JYBA 2G4HA 1VEIA 4DYZA 3PW1B 4CVTA 3AF7X 5JKLA 4W4KB 4ZJKA 3FSEA 4X0JA 3AF9X 5AXSA 4CYBA 1RCGA 3BVLA 4KVRA 5JKMA 4PG1A 1H96A 3AK8A 5GOUA 1EUMA 4WJG4 3C23A 4ITTA 5LBHA 4OYNA 2C2JA 3F38A 3D19A 2OKCA 1JKVA 2Z5RA 3SIDA 3Q4NA 2WLUA 1MOJA 1GWGA 4ML5A 1Z6OA 2N02A 3Q4OA 3UOIA 1J30A 5HQOA 1ZS3A 4M34A 2GYQA 2VXXA 1L8IA 3NP2X 5JDOB 5GN8A 3EZ0A 4ZKXA 4ZMCA 4YKHA 5FFCA 5FFDA 3NOZX 3QHCA 3TA8A 4XKSA 3KXUA 4M32A 2ZG9X 3QHBA 2ZG8X 1RYTA 4CVSA 1N1QA 5JACA 1LB3A 2VZBA 1JI4A 3UOFA 4RC7A 4DE6A 4RC6A 5C6FA 1VELA 4IXKA 1SOFA 4Y08A 2BJYA 3PVTB 3UNOA 3KA9A 3EGMA 4MXPA 3RAVA 3WNWA 4IWJA 2FJCA 4EVBA 2Z6MA 3PWFA 4TO9A 3R2RA 5FFBA 2BK6A 4AM4A 5FFAA 5D8YA 4ZLWA 5HU6D 2QF9A 3MPSA 5GU1X 3F35A 3O7RA 5D8SA 3H7GA 1S2ZA 3AJOA 1FHAA 1RCCA 3PW8C 1DPSA 1UVHA 3JZAB 2XKQA 1BCFA 5IX6A 3KHKA 2XJNA 3BT5A 3A9QA 5CMQA 1DVBA 2CWLA 2FL0A 1S3QA 3C1ZA 2JD60 1NFVA 2F7NA 4ZL6A 5HJFA 2CF7A 2V8TA 3EZUA 4CVRA 4YXMA 3LKDA 3IQ1A 4MUDA 3WVWA 2V15A 4ZKHA 4PGIA 4TOEA 2ITBA 4ISPA 4CMYA 2CEIA 1IESA 2MGYA 3GHQA 2XGWA 3KX9A 3W54A 4XGSA 5K53A 1YUZA 4ZTTA 5D8OA 4ETRA 2FHAA 3R2HA 3PW1A 4EVCA 2V2MA 4P18A 3AJQA 2AR0A 5GU0X 4LYUA 3Q4RA 3F34A 4Z5SA 2HR5A 2YW6A 1XZ3A 1IERA 2CN6A 3ISFA 5D8PA 3PVRB 3ISEA 1AEWA 3PW8A 2C2UA 3UFBA 4EVEA 2CLUA 2ZA8A 2CLBA 3PZAA 2XJOA 2GS4A 2FZFA 3R2KA 5J93A 2Y44A 1LKOA 2JD70 2PYBA 1TKPA 3BVFA 2UX1A 5E2DA 3F32A 5JKLG 1YV1A 2FFXJ 3AF8X 5JDOA 4LYXA 3C1YA 3O7SA 1HRSA 1VLGA 4KXRB 3KDQA 2WWXB 3F37A 2ZG7X 4ITWA 4MY7A 3VNXA 5JKMG 4YVZA 5GU2X 4M35A 3E6RA 2C41A 3M6JA 2YJJA 4AM2A 2C6RA 2V2JA 2ZA7A 3PVTA 5GU3X 5I4JA 2OC5A 2FG4A 4DZ0A 4PGKA 2YJKA 1DATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPJ A;  3PVY B;  2Z90 A;  5ERJ A;  1TJO A;  3NP0 X;  4LQJ A;  5J9V A;  3WVU A;  4TOF A;  4LPN A;  4A25 A;  2FG8 A;  5J8W A;  4EVD A;  4XKU A;  1BFR A;  1VJX A;  1BG7 A;  2IB0 A;  4LQH A;  3GVY A;  3OGH A;  4CVP A;  3BVI A;  3ERZ A;  4KVS A;  2V2S A;  2HTN A;  4TOA A;  1JI5 A;  2Z5Q A;  3RE7 A;  3HL1 A;  1S30 A;  1JRE A;  4TOC A;  4TW3 A;  4M33 A;  2CN7 A;  3AJP A;  3R2M A;  2XJM A;  4TOH A;  2V2I A;  3KA4 A;  4DAS A;  2CHI A;  4MN9 A;  1TK6 A;  2ZA6 A;  2D5K A;  1JIG A;  4DI0 A;  4LQN A;  5K52 A;  3HIU A;  3E6S A;  4RC5 B;  3R2S A;  3PVR A;  4LQV A;  1ZUJ A;  5LS9 A;  4IWK A;  1QYB A;  3OJ5 A;  1RCI A;  4MJY A;  3R2O A;  2VXI A;  2W0O A;  5LG2 A;  2WTL A;  4ISM A;  4MKU A;  2ZUR X;  3SH6 A;  4CMY V;  3KA6 A;  3E1J A;  1RCD A;  3SE1 A;  1O9R A;  4II4 B;  5CZU A;  5CMR A;  3E1O A;  1LKM A;  1QGH A;  3IS7 A;  5HJH A;  4DYY A;  5J8S A;  4ZL5 A;  1KRQ A;  1JTS A;  2C2F A;  1UMN A;  2WLA A;  3AK9 A;  3GE4 A;  4XKT A;  2JD8 0;  1YUX A;  1VEQ A;  1RCE A;  1Z4A A;  3E1L A;  1XZ1 A;  4REU A;  1NNQ A;  3T9J A;  2OH3 A;  4DYU A;  3BVE A;  1TKO A;  3FVB A;  3PVY A;  3QB9 A;  1MFR A;  4U3G A;  1O9I A;  3F36 A;  3KA8 A;  3E1N A;  1F33 A;  1JKU A;  3E2C A;  4DYX A;  1JGC A;  5FFE A;  3A68 A;  3E1Q A;  4R42 A;  2Z5P A;  2Y3Q A;  4ZKW A;  3E1M A;  1Z6O M;  4QUW A;  1R03 A;  3FI6 A;  3KWO A;  3PWQ C;  4AM5 A;  4TOD A;  4KVQ A;  2V2P A;  5GN8 B;  3RGD A;  1OTK A;  3F39 A;  3E1P A;  4CY9 A;  4ERU A;  2BW1 A;  5LG8 A;  1SQ3 A;  2V2R A;  2IU2 A;  4E6K A;  2RBD A;  1NF4 A;  4RC7 B;  3Q4Q A;  5D8Q A;  4RC6 B;  5FEJ A;  3IS8 A;  1LKP A;  2V2O A;  4RC5 A;  3F33 A;  2QQY A;  1NF6 A;  5D8R A;  2FKZ A;  3SHX A;  4RC8 A;  5ERK A;  5E1U A;  2X17 0;  3ES3 A;  2CIH A;  2IY4 A;  2V2L A;  2BKC A;  3QZ3 A;  4LPM A;  3U90 A;  4PG0 A;  3PWQ A;  5D8X A;  2GYD A;  3BVK A;  1F30 A;  4II4 A;  4CYA A;  3RBC A;  4TOG A;  3QVD A;  2CHP A;  1B71 A;  2V2N A;  3WVV A;  4Z3B A;  3KA3 A;  3R2L A;  4TOB A;  1L8H A;  2YW7 A;  3RD0 A;  3BKN A;  3QD8 A;  1JYB A;  2G4H A;  1VEI A;  4DYZ A;  3PW1 B;  4CVT A;  3AF7 X;  5JKL A;  4ZJK A;  3FSE A;  3AF9 X;  5AXS A;  4CYB A;  1RCG A;  3BVL A;  4KVR A;  5JKM A;  4PG1 A;  1H96 A;  3AK8 A;  5GOU A;  1EUM A;  4ITT A;  5LBH A;  4OYN A;  2C2J A;  3F38 A;  1JKV A;  2Z5R A;  3SID A;  3Q4N A;  2WLU A;  1MOJ A;  1GWG A;  4ML5 A;  1Z6O A;  3Q4O A;  3UOI A;  5HQO A;  1J30 A;  1ZS3 A;  4M34 A;  2GYQ A;  2VXX A;  1L8I A;  3NP2 X;  5GN8 A;  3EZ0 A;  4ZKX A;  4ZMC A;  4YKH A;  5FFC A;  5FFD A;  3NOZ X;  3QHC A;  3TA8 A;  4XKS A;  3KXU A;  4M32 A;  2ZG9 X;  3QHB A;  2ZG8 X;  1RYT A;  4CVS A;  1N1Q A;  5JAC A;  1LB3 A;  2VZB A;  1JI4 A;  3UOF A;  4RC7 A;  4DE6 A;  4RC6 A;  5C6F A;  1VEL A;  4IXK A;  1SOF A;  4Y08 A;  2BJY A;  3PVT B;  3UNO A;  3KA9 A;  3EGM A;  3RAV A;  3WNW A;  4IWJ A;  2FJC A;  4EVB A;  2Z6M A;  3PWF A;  4TO9 A;  3R2R A;  5FFB A;  2BK6 A;  4AM4 A;  5FFA A;  5D8Y A;  4ZLW A;  2QF9 A;  3MPS A;  5GU1 X;  3F35 A;  3O7R A;  5D8S A;  3H7G A;  1S2Z A;  3AJO A;  1FHA A;  1RCC A;  3PW8 C;  1DPS A;  1UVH A;  2XKQ A;  1BCF A;  5IX6 A;  2XJN A;  3BT5 A;  3A9Q A;  5CMQ A;  1DVB A;  2FL0 A;  1S3Q A;  2JD6 0;  1NFV A;  2F7N A;  4ZL6 A;  5HJF A;  2CF7 A;  3EZU A;  4CVR A;  3IQ1 A;  4MUD A;  3WVW A;  2V15 A;  4ZKH A;  4PGI A;  4TOE A;  2ITB A;  4ISP A;  4CMY A;  2CEI A;  1IES A;  3GHQ A;  2XGW A;  3KX9 A;  4XGS A;  5K53 A;  1YUZ A;  4ZTT A;  5D8O A;  4ETR A;  2FHA A;  3R2H A;  3PW1 A;  4EVC A;  2V2M A;  4P18 A;  3AJQ A;  5GU0 X;  4LYU A;  3Q4R A;  3F34 A;  4Z5S A;  2HR5 A;  2YW6 A;  1XZ3 A;  1IER A;  2CN6 A;  3ISF A;  5D8P A;  3PVR B;  3ISE A;  1AEW A;  3PW8 A;  2C2U A;  4EVE A;  2CLU A;  2ZA8 A;  2CLB A;  3PZA A;  2XJO A;  2GS4 A;  2FZF A;  3R2K A;  5J93 A;  1LKO A;  2JD7 0;  2PYB A;  1TKP A;  3BVF A;  2UX1 A;  5E2D A;  3F32 A;  5JKL G;  1YV1 A;  2FFX J;  3AF8 X;  4LYX A;  3O7S A;  1HRS A;  1VLG A;  3F37 A;  2ZG7 X;  4ITW A;  4MY7 A;  3VNX A;  5JKM G;  5GU2 X;  4M35 A;  3E6R A;  2C41 A;  2YJJ A;  4AM2 A;  2C6R A;  2V2J A;  2ZA7 A;  3PVT A;  5GU3 X;  5I4J A;  2OC5 A;  2FG4 A;  4DZ0 A;  4PGK A;  2YJK A;  1DAT A; 
#chains in the Genus database with same CATH topology
 4LPJ A;  3PVY B;  2Z90 A;  5ERJ A;  1TJO A;  3NP0 X;  4LQJ A;  5J9V A;  3WVU A;  4TOF A;  4LPN A;  4A25 A;  2FG8 A;  5J8W A;  4EVD A;  4XKU A;  1BFR A;  1VJX A;  1BG7 A;  3FRS A;  3VVA A;  4E40 A;  2IB0 A;  4LQH A;  2V8U A;  3GVY A;  3OGH A;  4CVP A;  3BVI A;  3ERZ A;  4KVS A;  3V3K B;  2V2S A;  2HTN A;  4TOA A;  1JI5 A;  3FRR A;  2Z5Q A;  3RE7 A;  3HL1 A;  1S30 A;  1JRE A;  4TOC A;  4TW3 A;  4M33 A;  2CN7 A;  4YXJ A;  3AJP A;  3R2M A;  3JZ9 A;  2XJM A;  4TOH A;  2V2I A;  3KA4 A;  3VV9 A;  4DAS A;  3GGZ A;  2CHI A;  4MN9 A;  1TK6 A;  2ZA6 A;  2D5K A;  1JIG A;  4DI0 A;  4LQN A;  5K52 A;  3HIU A;  2G38 B;  3E6S A;  4RC5 B;  3R2S A;  3PVR A;  4LQV A;  1ZUJ A;  5LS9 A;  3DBY A;  4IWK A;  1QYB A;  3OJ5 A;  1RCI A;  4MJY A;  3R2O A;  2VXI A;  2W0O A;  5LG2 A;  2WTL A;  4ISM A;  4MKU A;  2ZUR X;  3SH6 A;  4CMY V;  3KA6 A;  3E1J A;  1RCD A;  3SE1 A;  1O9R A;  3L0M A;  4II4 B;  5CZU A;  5CMR A;  3E1O A;  1LKM A;  1QGH A;  3IS7 A;  5HJH A;  4DYY A;  5J8S A;  4ZL5 A;  1KRQ A;  1JTS A;  2C2F A;  1UMN A;  2WLA A;  3AK9 A;  3GE4 A;  4XKT A;  2JD8 0;  1YUX A;  1VEQ A;  1RCE A;  1Z4A A;  3E1L A;  1XZ1 A;  4REU A;  1NNQ A;  3T9J A;  2OH3 A;  4DYU A;  3BVE A;  1TKO A;  3FVB A;  3PVY A;  3QB9 A;  1MFR A;  4U3G A;  1O9I A;  3F36 A;  3KA8 A;  3E1N A;  1F33 A;  1JKU A;  3E2C A;  4DYX A;  1JGC A;  5FFE A;  3A68 A;  3E1Q A;  4R42 A;  2Z5P A;  2Y3Q A;  4ZKW A;  3E1M A;  1Z6O M;  4QUW A;  1R03 A;  3FI6 A;  3KWO A;  3PWQ C;  4AM5 A;  4TOD A;  4KVQ A;  2V2P A;  5GN8 B;  3RGD A;  1OTK A;  3F39 A;  3E1P A;  4CY9 A;  4ERU A;  2BW1 A;  5LG8 A;  1SQ3 A;  2V2R A;  2IU2 A;  4E6K A;  2RBD A;  1NF4 A;  3C21 A;  4RC7 B;  3Q4Q A;  5D8Q A;  4RC6 B;  5FEJ A;  3GGY A;  3IS8 A;  1LKP A;  2V2O A;  4RC5 A;  3F33 A;  2QQY A;  1NF6 A;  5D8R A;  2FKZ A;  3SHX A;  4RC8 A;  5ERK A;  5E1U A;  2X17 0;  3ES3 A;  2CIH A;  2IY4 A;  2V2L A;  2BKC A;  3QZ3 A;  4LPM A;  3U90 A;  4PG0 A;  3PWQ A;  5D8X A;  2GYD A;  3BVK A;  1F30 A;  4W4L B;  4II4 A;  4CYA A;  3N6O A;  3RBC A;  4TOG A;  3QVD A;  2CHP A;  1B71 A;  2V2N A;  3WVV A;  4Z3B A;  3KA3 A;  3R2L A;  4TOB A;  1L8H A;  2YW7 A;  3RD0 A;  3BKN A;  3QD8 A;  1JYB A;  2G4H A;  1VEI A;  4DYZ A;  3PW1 B;  4CVT A;  3AF7 X;  5JKL A;  4W4K B;  4ZJK A;  3FSE A;  4X0J A;  3AF9 X;  5AXS A;  4CYB A;  1RCG A;  3BVL A;  4KVR A;  5JKM A;  4PG1 A;  1H96 A;  3AK8 A;  5GOU A;  1EUM A;  4WJG 4;  3C23 A;  4ITT A;  5LBH A;  4OYN A;  2C2J A;  3F38 A;  3D19 A;  2OKC A;  1JKV A;  2Z5R A;  3SID A;  3Q4N A;  2WLU A;  1MOJ A;  1GWG A;  4ML5 A;  1Z6O A;  2N02 A;  3Q4O A;  3UOI A;  1J30 A;  5HQO A;  1ZS3 A;  4M34 A;  2GYQ A;  2VXX A;  1L8I A;  3NP2 X;  5JDO B;  5GN8 A;  3EZ0 A;  4ZKX A;  4ZMC A;  4YKH A;  5FFC A;  5FFD A;  3NOZ X;  3QHC A;  3TA8 A;  4XKS A;  3KXU A;  4M32 A;  2ZG9 X;  3QHB A;  2ZG8 X;  1RYT A;  4CVS A;  1N1Q A;  5JAC A;  1LB3 A;  2VZB A;  1JI4 A;  3UOF A;  4RC7 A;  4DE6 A;  4RC6 A;  5C6F A;  1VEL A;  4IXK A;  1SOF A;  4Y08 A;  2BJY A;  3PVT B;  3UNO A;  3KA9 A;  3EGM A;  4MXP A;  3RAV A;  3WNW A;  4IWJ A;  2FJC A;  4EVB A;  2Z6M A;  3PWF A;  4TO9 A;  3R2R A;  5FFB A;  2BK6 A;  4AM4 A;  5FFA A;  5D8Y A;  4ZLW A;  5HU6 D;  2QF9 A;  3MPS A;  5GU1 X;  3F35 A;  3O7R A;  5D8S A;  3H7G A;  1S2Z A;  3AJO A;  1FHA A;  1RCC A;  3PW8 C;  1DPS A;  1UVH A;  3JZA B;  2XKQ A;  1BCF A;  5IX6 A;  3KHK A;  2XJN A;  3BT5 A;  3A9Q A;  5CMQ A;  1DVB A;  2CWL A;  2FL0 A;  1S3Q A;  3C1Z A;  2JD6 0;  1NFV A;  2F7N A;  4ZL6 A;  5HJF A;  2CF7 A;  2V8T A;  3EZU A;  4CVR A;  4YXM A;  3LKD A;  3IQ1 A;  4MUD A;  3WVW A;  2V15 A;  4ZKH A;  4PGI A;  4TOE A;  2ITB A;  4ISP A;  4CMY A;  2CEI A;  1IES A;  2MGY A;  3GHQ A;  2XGW A;  3KX9 A;  3W54 A;  4XGS A;  5K53 A;  1YUZ A;  4ZTT A;  5D8O A;  4ETR A;  2FHA A;  3R2H A;  3PW1 A;  4EVC A;  2V2M A;  4P18 A;  3AJQ A;  2AR0 A;  5GU0 X;  4LYU A;  3Q4R A;  3F34 A;  4Z5S A;  2HR5 A;  2YW6 A;  1XZ3 A;  1IER A;  2CN6 A;  3ISF A;  5D8P A;  3PVR B;  3ISE A;  1AEW A;  3PW8 A;  2C2U A;  3UFB A;  4EVE A;  2CLU A;  2ZA8 A;  2CLB A;  3PZA A;  2XJO A;  2GS4 A;  2FZF A;  3R2K A;  5J93 A;  2Y44 A;  1LKO A;  2JD7 0;  2PYB A;  1TKP A;  3BVF A;  2UX1 A;  5E2D A;  3F32 A;  5JKL G;  1YV1 A;  2FFX J;  3AF8 X;  5JDO A;  4LYX A;  3C1Y A;  3O7S A;  1HRS A;  1VLG A;  4KXR B;  3KDQ A;  2WWX B;  3F37 A;  2ZG7 X;  4ITW A;  4MY7 A;  3VNX A;  5JKM G;  4YVZ A;  5GU2 X;  4M35 A;  3E6R A;  2C41 A;  3M6J A;  2YJJ A;  4AM2 A;  2C6R A;  2V2J A;  2ZA7 A;  3PVT A;  5GU3 X;  5I4J A;  2OC5 A;  2FG4 A;  4DZ0 A;  4PGK A;  2YJK A;  1DAT A; 
#chains in the Genus database with same CATH homology
 4LPJ A;  3PVY B;  2Z90 A;  5ERJ A;  1TJO A;  3NP0 X;  4LQJ A;  5J9V A;  3WVU A;  4TOF A;  4LPN A;  4A25 A;  2FG8 A;  5J8W A;  4EVD A;  4XKU A;  1BFR A;  1VJX A;  1BG7 A;  3FRS A;  3VVA A;  4E40 A;  2IB0 A;  4LQH A;  2V8U A;  3GVY A;  3OGH A;  4CVP A;  3BVI A;  3ERZ A;  4KVS A;  3V3K B;  2V2S A;  2HTN A;  4TOA A;  1JI5 A;  3FRR A;  2Z5Q A;  3RE7 A;  3HL1 A;  1S30 A;  1JRE A;  4TOC A;  4TW3 A;  4M33 A;  2CN7 A;  4YXJ A;  3AJP A;  3R2M A;  3JZ9 A;  2XJM A;  4TOH A;  2V2I A;  3KA4 A;  3VV9 A;  4DAS A;  3GGZ A;  2CHI A;  4MN9 A;  1TK6 A;  2ZA6 A;  2D5K A;  1JIG A;  4DI0 A;  4LQN A;  5K52 A;  3HIU A;  2G38 B;  3E6S A;  4RC5 B;  3R2S A;  3PVR A;  4LQV A;  1ZUJ A;  5LS9 A;  3DBY A;  4IWK A;  1QYB A;  3OJ5 A;  1RCI A;  4MJY A;  3R2O A;  2VXI A;  2W0O A;  5LG2 A;  2WTL A;  4ISM A;  4MKU A;  2ZUR X;  3SH6 A;  4CMY V;  3KA6 A;  3E1J A;  1RCD A;  3SE1 A;  1O9R A;  3L0M A;  4II4 B;  5CZU A;  5CMR A;  3E1O A;  1LKM A;  1QGH A;  3IS7 A;  5HJH A;  4DYY A;  5J8S A;  4ZL5 A;  1KRQ A;  1JTS A;  2C2F A;  1UMN A;  2WLA A;  3AK9 A;  3GE4 A;  4XKT A;  2JD8 0;  1YUX A;  1VEQ A;  1RCE A;  1Z4A A;  3E1L A;  1XZ1 A;  4REU A;  1NNQ A;  3T9J A;  2OH3 A;  4DYU A;  3BVE A;  1TKO A;  3FVB A;  3PVY A;  3QB9 A;  1MFR A;  4U3G A;  1O9I A;  3F36 A;  3KA8 A;  3E1N A;  1F33 A;  1JKU A;  3E2C A;  4DYX A;  1JGC A;  5FFE A;  3A68 A;  3E1Q A;  4R42 A;  2Z5P A;  2Y3Q A;  4ZKW A;  3E1M A;  1Z6O M;  4QUW A;  1R03 A;  3FI6 A;  3KWO A;  3PWQ C;  4AM5 A;  4TOD A;  4KVQ A;  2V2P A;  5GN8 B;  3RGD A;  1OTK A;  3F39 A;  3E1P A;  4CY9 A;  4ERU A;  2BW1 A;  5LG8 A;  1SQ3 A;  2V2R A;  2IU2 A;  4E6K A;  2RBD A;  1NF4 A;  3C21 A;  4RC7 B;  3Q4Q A;  5D8Q A;  4RC6 B;  5FEJ A;  3GGY A;  3IS8 A;  1LKP A;  2V2O A;  4RC5 A;  3F33 A;  2QQY A;  1NF6 A;  5D8R A;  2FKZ A;  3SHX A;  4RC8 A;  5ERK A;  5E1U A;  2X17 0;  3ES3 A;  2CIH A;  2IY4 A;  2V2L A;  2BKC A;  3QZ3 A;  4LPM A;  3U90 A;  4PG0 A;  3PWQ A;  5D8X A;  2GYD A;  3BVK A;  1F30 A;  4W4L B;  4II4 A;  4CYA A;  3N6O A;  3RBC A;  4TOG A;  3QVD A;  2CHP A;  1B71 A;  2V2N A;  3WVV A;  4Z3B A;  3KA3 A;  3R2L A;  4TOB A;  1L8H A;  2YW7 A;  3RD0 A;  3BKN A;  3QD8 A;  1JYB A;  2G4H A;  1VEI A;  4DYZ A;  3PW1 B;  4CVT A;  3AF7 X;  5JKL A;  4W4K B;  4ZJK A;  3FSE A;  4X0J A;  3AF9 X;  5AXS A;  4CYB A;  1RCG A;  3BVL A;  4KVR A;  5JKM A;  4PG1 A;  1H96 A;  3AK8 A;  5GOU A;  1EUM A;  4WJG 4;  3C23 A;  4ITT A;  5LBH A;  4OYN A;  2C2J A;  3F38 A;  3D19 A;  2OKC A;  1JKV A;  2Z5R A;  3SID A;  3Q4N A;  2WLU A;  1MOJ A;  1GWG A;  4ML5 A;  1Z6O A;  2N02 A;  3Q4O A;  3UOI A;  1J30 A;  5HQO A;  1ZS3 A;  4M34 A;  2GYQ A;  2VXX A;  1L8I A;  3NP2 X;  5JDO B;  5GN8 A;  3EZ0 A;  4ZKX A;  4ZMC A;  4YKH A;  5FFC A;  5FFD A;  3NOZ X;  3QHC A;  3TA8 A;  4XKS A;  3KXU A;  4M32 A;  2ZG9 X;  3QHB A;  2ZG8 X;  1RYT A;  4CVS A;  1N1Q A;  5JAC A;  1LB3 A;  2VZB A;  1JI4 A;  3UOF A;  4RC7 A;  4DE6 A;  4RC6 A;  5C6F A;  1VEL A;  4IXK A;  1SOF A;  4Y08 A;  2BJY A;  3PVT B;  3UNO A;  3KA9 A;  3EGM A;  4MXP A;  3RAV A;  3WNW A;  4IWJ A;  2FJC A;  4EVB A;  2Z6M A;  3PWF A;  4TO9 A;  3R2R A;  5FFB A;  2BK6 A;  4AM4 A;  5FFA A;  5D8Y A;  4ZLW A;  5HU6 D;  2QF9 A;  3MPS A;  5GU1 X;  3F35 A;  3O7R A;  5D8S A;  3H7G A;  1S2Z A;  3AJO A;  1FHA A;  1RCC A;  3PW8 C;  1DPS A;  1UVH A;  3JZA B;  2XKQ A;  1BCF A;  5IX6 A;  3KHK A;  2XJN A;  3BT5 A;  3A9Q A;  5CMQ A;  1DVB A;  2CWL A;  2FL0 A;  1S3Q A;  3C1Z A;  2JD6 0;  1NFV A;  2F7N A;  4ZL6 A;  5HJF A;  2CF7 A;  2V8T A;  3EZU A;  4CVR A;  4YXM A;  3LKD A;  3IQ1 A;  4MUD A;  3WVW A;  2V15 A;  4ZKH A;  4PGI A;  4TOE A;  2ITB A;  4ISP A;  4CMY A;  2CEI A;  1IES A;  2MGY A;  3GHQ A;  2XGW A;  3KX9 A;  3W54 A;  4XGS A;  5K53 A;  1YUZ A;  4ZTT A;  5D8O A;  4ETR A;  2FHA A;  3R2H A;  3PW1 A;  4EVC A;  2V2M A;  4P18 A;  3AJQ A;  2AR0 A;  5GU0 X;  4LYU A;  3Q4R A;  3F34 A;  4Z5S A;  2HR5 A;  2YW6 A;  1XZ3 A;  1IER A;  2CN6 A;  3ISF A;  5D8P A;  3PVR B;  3ISE A;  1AEW A;  3PW8 A;  2C2U A;  3UFB A;  4EVE A;  2CLU A;  2ZA8 A;  2CLB A;  3PZA A;  2XJO A;  2GS4 A;  2FZF A;  3R2K A;  5J93 A;  2Y44 A;  1LKO A;  2JD7 0;  2PYB A;  1TKP A;  3BVF A;  2UX1 A;  5E2D A;  3F32 A;  5JKL G;  1YV1 A;  2FFX J;  3AF8 X;  5JDO A;  4LYX A;  3C1Y A;  3O7S A;  1HRS A;  1VLG A;  4KXR B;  3KDQ A;  2WWX B;  3F37 A;  2ZG7 X;  4ITW A;  4MY7 A;  3VNX A;  5JKM G;  4YVZ A;  5GU2 X;  4M35 A;  3E6R A;  2C41 A;  3M6J A;  2YJJ A;  4AM2 A;  2C6R A;  2V2J A;  2ZA7 A;  3PVT A;  5GU3 X;  5I4J A;  2OC5 A;  2FG4 A;  4DZ0 A;  4PGK A;  2YJK A;  1DAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...