2UXBD

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 52
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 2uxbD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 2uxbD02
3T1YD 4DV7D 4B3RD 1KSVA 4LFBD 4LFCD 4JI3D 2ZM6D 4JI5D 2UXBD 2F4VD 1XMOD 4DV0D 4JI1D 4X62D 4GKJD 4LF8D 4GKKD 4DV5D 4DR1D 4NXMD 4AQYD 4B3SD 1XMQD 4KHPD 4OX9D 4JYAD 4NXND 1VIOA 1N34D 2ISTA 4LF7D 4LF6D 4JI2D 1JH3A 4DR4D 4LF5D 4X66D 5LMUD 1KSKA 2HHHD 4DUYD 1XNQD 4DV3D 4OUDA 5IWAD 1FKAD 1HNXD 3T1HD 1H3EA 1I94D 3HP7A 1KSLA 2UUBD 4LGTA 4YHHD 1IBMD 4LF4D 4DR7D 2UXDD 4DR5D 5LMND 1HNZD 2JANA 4K0KD 3KBGA 4DR3D 4DUZD 4LF9D 1IBLD 2UUCD 1C05A 1FJGD 3DH3A 1N33D 4DV1D 4X64D 4JI4D 2E5LD 5BR8D 4LFAD 1P9KA 4DV4D 4DR2D 4YY3D 4B3MD 2UU9D 1DM9A 2KTLA 4DV6D 4JV5D 3OTOD 4JI7D 1XNRD 1J5ED 4JI0D 1HNWD 1N32D 4B3TD 1N36D 2VQFD 2UUAD 1IBKD 4JI6D 4JI8D 2VQED 2UXCD 4DV2D 1C06A 2K6PA 1H3FA 4X65D 1HR0D 4DR6D
chains in the Genus database with same CATH superfamily
3T1YD 4NNJA 4DV7D 4II2A 5FLXE 4B3RD 5KNLA 1KSVA 4LFBD 4LFCD 4JI3D 2ZM6D 4JI5D 2UXBD 2F4VD 1XMOD 4DV0D 4JI1D 3CMMA 4X62D 4GKJD 4LF8D 4GKKD 4DV5D 4DR1D 4NXMD 4AQYD 4B3SD 1XMQD 3J81E 4KHPD 4OX9D 4JYAD 4NXND 1VIOA 1N34D 3ONHA 2ISTA 4LF7D 4LF6D 4JI2D 4II3A 5FQ2B 1JH3A 4DR4D 4LF5D 4X66D 5LMUD 2NVUB 3JAME 1KSKA 2HHHD 4DUYD 1XNQD 4DV3D 4OUDA 5IWAD 1FKAD 1HNXD 3T1HD 1Y8QB 3FN1A 1H3EA 1I94D 3HP7A 5A2QE 1KSLA 5IT9E 2UUBD 4LGTA 4YHHD 1IBMD 3KYDB 4LF4D 4DR7D 2UXDD 4DR5D 5LMND 1HNZD 2JANA 4K0KD 3KBGA 5LL6S 4DR3D 4DUZD 4LF9D 1IBLD 2UUCD 1C05A 1FJGD 3DH3A 1N33D 4DV1D 2ZTBA 4X64D 4JI4D 2E5LD 5BR8D 1Y8XB 4LFAD 1P9KA 4DV4D 3J80E 4DR2D 2I1SA 4YY3D 4B3MD 1Y8RB 2UU9D 1DM9A 2KTLA 4DV6D 4JV5D 3OTOD 4JI7D 2L3NA 1XNRD 3KYCB 1J5ED 4JI0D 1HNWD 1N32D 4B3TD 2LQ7A 1N36D 2VQFD 2UUAD 1IBKD 4JI6D 4W5VB 4JI8D 2VQED 2UXCD 4DV2D 1C06A 2K6PA 1H3FA 4X65D 3ONGA 1HR0D 3J7AF 4DR6D
chains in the Genus database with same CATH topology
3T1YD 4DV7D 4B3RD 1KSVA 4LFBD 4LFCD 4JI3D 2ZM6D 4JI5D 2UXBD 2F4VD 1XMOD 4DV0D 4JI1D 4X62D 4GKJD 4LF8D 4GKKD 4DV5D 4DR1D 4NXMD 4AQYD 4B3SD 1XMQD 4KHPD 4OX9D 4JYAD 4NXND 1VIOA 1N34D 2ISTA 4LF7D 4LF6D 4JI2D 1JH3A 4DR4D 4LF5D 4X66D 5LMUD 1KSKA 2HHHD 4DUYD 1XNQD 4DV3D 4OUDA 5IWAD 1FKAD 1HNXD 3T1HD 1H3EA 1I94D 3HP7A 1KSLA 2UUBD 4LGTA 4YHHD 1IBMD 4LF4D 4DR7D 2UXDD 4DR5D 5LMND 1HNZD 2JANA 4K0KD 3KBGA 4DR3D 4DUZD 4LF9D 1IBLD 2UUCD 1C05A 1FJGD 3DH3A 1N33D 4DV1D 4X64D 4JI4D 2E5LD 5BR8D 4LFAD 1P9KA 4DV4D 4DR2D 4YY3D 4B3MD 2UU9D 1DM9A 2KTLA 4DV6D 4JV5D 3OTOD 4JI7D 2L3NA 1XNRD 1J5ED 4JI0D 1HNWD 1N32D 4B3TD 1N36D 2VQFD 2UUAD 1IBKD 4JI6D 4JI8D 2VQED 2UXCD 4DV2D 1C06A 2K6PA 1H3FA 4X65D 1HR0D 4DR6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y D;  4DV7 D;  4B3R D;  1KSV A;  4LFB D;  4LFC D;  4JI3 D;  2ZM6 D;  4JI5 D;  2UXB D;  2F4V D;  1XMO D;  4DV0 D;  4JI1 D;  4X62 D;  4GKJ D;  4LF8 D;  4GKK D;  4DV5 D;  4DR1 D;  4NXM D;  4AQY D;  4B3S D;  1XMQ D;  4KHP D;  4OX9 D;  4JYA D;  4NXN D;  1VIO A;  1N34 D;  2IST A;  4LF7 D;  4LF6 D;  4JI2 D;  1JH3 A;  4DR4 D;  4LF5 D;  4X66 D;  5LMU D;  1KSK A;  2HHH D;  4DUY D;  1XNQ D;  4DV3 D;  4OUD A;  5IWA D;  1FKA D;  1HNX D;  3T1H D;  1H3E A;  1I94 D;  3HP7 A;  1KSL A;  2UUB D;  4LGT A;  4YHH D;  1IBM D;  4LF4 D;  4DR7 D;  2UXD D;  4DR5 D;  5LMN D;  1HNZ D;  2JAN A;  4K0K D;  3KBG A;  4DR3 D;  4DUZ D;  4LF9 D;  1IBL D;  2UUC D;  1C05 A;  1FJG D;  3DH3 A;  1N33 D;  4DV1 D;  4X64 D;  4JI4 D;  2E5L D;  5BR8 D;  4LFA D;  1P9K A;  4DV4 D;  4DR2 D;  4YY3 D;  4B3M D;  2UU9 D;  1DM9 A;  2KTL A;  4DV6 D;  4JV5 D;  3OTO D;  4JI7 D;  1XNR D;  1J5E D;  4JI0 D;  1HNW D;  1N32 D;  4B3T D;  1N36 D;  2VQF D;  2UUA D;  1IBK D;  4JI6 D;  4JI8 D;  2VQE D;  2UXC D;  4DV2 D;  1C06 A;  2K6P A;  1H3F A;  4X65 D;  1HR0 D;  4DR6 D; 
#chains in the Genus database with same CATH topology
 3T1Y D;  4NNJ A;  4DV7 D;  4II2 A;  5FLX E;  4B3R D;  5KNL A;  1KSV A;  4LFB D;  4LFC D;  4JI3 D;  2ZM6 D;  4JI5 D;  2UXB D;  2F4V D;  1XMO D;  4DV0 D;  4JI1 D;  3CMM A;  4X62 D;  4GKJ D;  4LF8 D;  4GKK D;  4DV5 D;  4DR1 D;  4NXM D;  4AQY D;  4B3S D;  1XMQ D;  3J81 E;  4KHP D;  4OX9 D;  4JYA D;  4NXN D;  1VIO A;  1N34 D;  3ONH A;  2IST A;  4LF7 D;  4LF6 D;  4JI2 D;  4II3 A;  5FQ2 B;  1JH3 A;  4DR4 D;  4LF5 D;  4X66 D;  5LMU D;  2NVU B;  3JAM E;  1KSK A;  2HHH D;  4DUY D;  1XNQ D;  4DV3 D;  4OUD A;  5IWA D;  1FKA D;  1HNX D;  3T1H D;  1Y8Q B;  3FN1 A;  1H3E A;  1I94 D;  3HP7 A;  5A2Q E;  1KSL A;  5IT9 E;  2UUB D;  4LGT A;  4YHH D;  1IBM D;  3KYD B;  4LF4 D;  4DR7 D;  2UXD D;  4DR5 D;  5LMN D;  1HNZ D;  2JAN A;  4K0K D;  3KBG A;  5LL6 S;  4DR3 D;  4DUZ D;  4LF9 D;  1IBL D;  2UUC D;  1C05 A;  1FJG D;  3DH3 A;  1N33 D;  4DV1 D;  2ZTB A;  4X64 D;  4JI4 D;  2E5L D;  5BR8 D;  1Y8X B;  4LFA D;  1P9K A;  4DV4 D;  3J80 E;  4DR2 D;  2I1S A;  4YY3 D;  4B3M D;  1Y8R B;  2UU9 D;  1DM9 A;  2KTL A;  4DV6 D;  4JV5 D;  3OTO D;  4JI7 D;  2L3N A;  1XNR D;  3KYC B;  1J5E D;  4JI0 D;  1HNW D;  1N32 D;  4B3T D;  2LQ7 A;  1N36 D;  2VQF D;  2UUA D;  1IBK D;  4JI6 D;  4W5V B;  4JI8 D;  2VQE D;  2UXC D;  4DV2 D;  1C06 A;  2K6P A;  1H3F A;  4X65 D;  3ONG A;  1HR0 D;  3J7A F;  4DR6 D; 
#chains in the Genus database with same CATH homology
 3T1Y D;  4DV7 D;  4B3R D;  1KSV A;  4LFB D;  4LFC D;  4JI3 D;  2ZM6 D;  4JI5 D;  2UXB D;  2F4V D;  1XMO D;  4DV0 D;  4JI1 D;  4X62 D;  4GKJ D;  4LF8 D;  4GKK D;  4DV5 D;  4DR1 D;  4NXM D;  4AQY D;  4B3S D;  1XMQ D;  4KHP D;  4OX9 D;  4JYA D;  4NXN D;  1VIO A;  1N34 D;  2IST A;  4LF7 D;  4LF6 D;  4JI2 D;  1JH3 A;  4DR4 D;  4LF5 D;  4X66 D;  5LMU D;  1KSK A;  2HHH D;  4DUY D;  1XNQ D;  4DV3 D;  4OUD A;  5IWA D;  1FKA D;  1HNX D;  3T1H D;  1H3E A;  1I94 D;  3HP7 A;  1KSL A;  2UUB D;  4LGT A;  4YHH D;  1IBM D;  4LF4 D;  4DR7 D;  2UXD D;  4DR5 D;  5LMN D;  1HNZ D;  2JAN A;  4K0K D;  3KBG A;  4DR3 D;  4DUZ D;  4LF9 D;  1IBL D;  2UUC D;  1C05 A;  1FJG D;  3DH3 A;  1N33 D;  4DV1 D;  4X64 D;  4JI4 D;  2E5L D;  5BR8 D;  4LFA D;  1P9K A;  4DV4 D;  4DR2 D;  4YY3 D;  4B3M D;  2UU9 D;  1DM9 A;  2KTL A;  4DV6 D;  4JV5 D;  3OTO D;  4JI7 D;  2L3N A;  1XNR D;  1J5E D;  4JI0 D;  1HNW D;  1N32 D;  4B3T D;  1N36 D;  2VQF D;  2UUA D;  1IBK D;  4JI6 D;  4JI8 D;  2VQE D;  2UXC D;  4DV2 D;  1C06 A;  2K6P A;  1H3F A;  4X65 D;  1HR0 D;  4DR6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...