2UXBL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxbL00
1HNZL 2ZM6Q 1KQSA 4BY7H 4AQYL 1K8AC 2B63H 2R7ZG 4K0KQ 1FL0A 3TEHB 4A3LH 1GO3E 3S14H 1XNQL 1Y1VG 2JA6H 5K36G 2UUAL 1OXTA 1OTCA 3CMAA 1P16A 4L5RC 3T1YL 5JEAJ 1HNXL 2VUMG 5LMNQ 4A3DG 1HZBA 1GD7A 1VQ4A 4OWWB 3HOZH 1NY4A 3BU2A 3PCOB 2HIVA 3EN2A 3PUXA 4DNIA 5E7NA 2C35B 3CC7A 3RLOA 1YI2A 3DLLA 1G51A 1SR3A 2RCNA 5LMNW 2BA1A 3S1QH 4DK6C 4IPCA 3W5OA 1PH5A 3U4VA 1VQOA 1Q12A 1C0AA 4JI4L 4LNQA 2K5VA 2KHIA 3AEVA 1TWCH 2K14A 2VS1A 2Q2TA 4DV2L 3M9BA 4UP8A 3CCMA 2K52A 3PF4A 2Y0SE 3TREA 4A3FH 1S40A 4OX9L 1VQNA 4YCWA 1UEBA 2AWOA 4IFDG 3H0GH 4A3JH 4YCUA 1NMGA 1IBLQ 4A3BH 2DUDA 1NBWA 1AE2A 3NEMA 1GM5A 4LF7Q 3K81C 3KDFA 2OQKA 5AJ3L 2E2IH 4JYAQ 1K9MC 2JA7G 5HY6A 2BA0A 4OONA 4DKAC 4YHHQ 1I94L 2BH8A 4R4IA 1A63A 2I5MX 2IT1A 3HOXG 4LF6L 3U4ZA 4DR7L 1VQBA 4GN3B 4A93G 3CW2C 1W2BA 4LFAL 2VNUD 1HR0L 3CXCA 4YWKA 2B3GA 5IWAL 1QUQB 4WJ3M 4DV7Q 3KLWA 1JJCB 2E5LQ 4A75A 4NXMQ 3G6EA 3E0EA 4DUZQ 3UDIA 4APVA 4IJLA 1IBKL 3S1NH 1N32Q 1VQGA 5M3MG 1I3QH 1VQFA 3PV0A 2K4KA 1Y14B 1FGUA 3GO5A 1NE3A 4DAYB 5IYCG 4DV1Q 3CCUA 3S17H 5IYBG 4DR3L 1YZ6A 3H0GG 4AYBG 5M3FG 2HQLA 4NXNQ 4L5SA 3H3VI 2PMZE 5FLMH 5GROA 2JA5H 2NVTH 2IY5B 4JI1L 4LFBQ 1VQ5A 5GAHC 1CKOA 3HOWG 4KHPQ 1YJ9A 2ZJQA 2CWPA 4A3MG 1B8AA 3KYHC 4L5TA 5C44G 1FJGQ 1L1OC 1VQPA 3I4MH 4DV0L 5J3BA 4LF9L 3NELA 1Q82C 4UP9A 2IHFA 1PH1A 2WFWA 2Q2IA 3CCJA 1VS0A 3J7A5 2YU9H 2JA8G 4A3EG 5GADC 4Y52H 2QEXA 3HOUG 1KHIA 1M1KC 1CSPA 1Q1BA 4C2MH 2I0QA 2KCTA 4DPGA 5GQOA 1K83H 1HZAA 3J81j 3CCEA 1Q46A 3KDFB 2CFMA 3JC66 4LFCL 4R1JA 4A4IA 3PGZA 3K8AA 3ZJYC 4BA1I 4DK3C 4LUZA 2WB1G 2ALYB 4HIMA 1PH4A 1EYGA 4JI7Q 1KRSA 2VY3A 4IPDA 4JG2A 3TQYA 2JA5G 1JE5A 2K5NA 3RLNA 4YY3Q 4BXXG 1MIUA 1X55A 3G48A 4DR1L 2JEAI 3PO3G 4OO1I 4OXPA 4DV4L 2Z6KC 1Y1WH 2R7ZH 4B3TQ 4XIGS 4BBRG 1Y1VH 2ZTCA 3OTOQ 1KIXA 2F4VQ 2PNHA 1WFQA 4R4TA 5C0XG 1N33L 4C3HH 1HNZQ 4IOAA 2Q2HA 1QZHA 4AQYQ 2VW9A 1WYDA 2VUMH 3GTOH 4A3DH 2MNAA 2UXDL 1Q7YC 1NTGA 2N8NA 5BR8L 2NVXH 1XNQQ 4DR6Q 2UUAQ 2IHEA 3M85A 4DR2Q 2UXBL 2JQOA 3T1YQ 1HNXQ 1VQ9A 4GNXC 3CC2A 1V43A 3A0JA 3D31A 1PA6A 3TS0A 2RF4A 5M5YH 1N34L 3L2PA 1HZ9A 3LGJA 1IBML 2D0PA 1R9TH 3HKSA 1X3EA 4QJFA 2R92G 4JI6L 2HT1A 3CC4A 2KBNA 3STBC 4OO1G 3FP9A 1G6PA 2OWOA 3AQQA 1Y1WG 2B29A 4JI4Q 1BKBA 1VQAA 2ZTDA 1Q1EA 4DV3L 1M90C 2ZJPA 4X6AH 1HH2P 2CWAA 2NVYH 4YWLA 3IRBA 4X62L 1TWAH 4B3ML 3GDEA 4OX9Q 1QVFA 5M5WH 3S24A 4C3IH 1L2FA 3HFZB 1PH2A 2JA7H 1VQ6A 1A8VA 4MTNA 3HOXH 2EIFA 1EFWA 2VL6A 3I4OA 2Y0SG 1OXVA 2OQ0A 3OYYA 1QZGA 4A93H 4GOPA 1CKMA 2MFIA 1VQMA 4R4CA 4R4QA 2JA9A 3GTGH 3K0XA 1XMOL 1XJVA 1AE3A 2A1AA 4LF6Q 4DR7Q 1RL2A 2ATWA 4X64Q 3J81c 1E24A 2JJQA 5C4XG 2HIXA 1YEZA 4LFAQ 1HR0Q 2ZTEA 1YJWA 5C3EG 2VQFL 5IWAQ 2GN5A 4PZ8A 1I5FA 5M3MH 4L5QA 2EQSA 4JCVE 1YHBA 3A74A 5IYCH 1Q8KA 1U5KA 2HHHL 5IYBH 2YTYA 4UPAA 5M3FH 4JBMA 4B3RQ 2NN6I 1P8LA 4R4OA 2L15A 5IP9G 4UY8C 3TRZA 1E22A 3HKZE 3HOWH 3CF5A 5FJ8G 3MXNB 3J81i 4A3MH 5IP7G 2RHSB 2VZAA 3W1BA 4J15A 4DR3Q 2N78A 1IYJB 4GN4B 3G71A 1YITA 4LF5L 5C44H 4GN5A 2NZOA 3JAMc 1MJCA 1Q81C 3DM3A 5GAGC 2ZM6L 4JI1Q 1KD1C 1VQJA 4JI0L 4QQBX 2N3SA 2E2HH 4O2DA 3F8TA 1LM0A 4YCVA 4JI8Q 3RZDH 3T1HL 3AFPA 4EX5A 4A3EH 3AFQA 2JA8H 3HOYG 3S1MH 1VQ8A 2UXCQ 3HOUH 1JJ2A 3PUWA 4FDBA 4LF4Q 3KFUA 1UE7A 5LMNL 3PSIA 2R7FA 4KI0A 1KL9A 4PMWA 4DV5L 4P71A 1LYLA 2LXJA 1IXRA 3BJUA 1WCMG 4P74A 1D7QA 3HOVG 3UDFA 4DV6L 3JAMi 4IPGA 1E1TA 3CMEA 5ELNA 1J6QA 2VQEQ 3CCQA 4C3JH 3ULJA 3GTMH 1B7YB 1XMQQ 4LFCQ 3SGIA 3UE1A 4BXXH 3KJPA 4B3SL 1IZ6A 4A3KG 1YHAA 3PO3H 2ASBA 1PFSA 4O0AA 4NB3A 1W3SA 2UUBQ 1N36L 2V1CC 4X65Q 4LW1A 2OTJA 1TWHH 4A3IG 2OCEA 4BBRH 4DR1Q 4HIKA 1IBLL 3GTKH 1LTLA 1DGSA 4QGUA 4GKJL 1ASYA 5JEAG 4P72A 1MJEA 4LF8L 1KXLA 4HJ9A 1X65A 4JYAL 1X54A 3M4PA 3BZCA 3FKIG 4TQUS 2UU9L 1EIYB 3TS2A 2KENA 3RN2A 3UDGA 3F2DA 1J5EL 4IFDI 4MNOA 2WAQE 3CCSA 2UXDQ 4AIMA 3GTPH 5BR8Q 5IYDG 5EAYA 3A5UA 2UXBQ 2D62A 2IX0A 5H1SE 4DV7L 4DR5L 1Q86C 2UUCL 3MEFA 2R92H 2WP8J 1VQHA 4GLXA 1N34Q 4DR4L 4JV5L 1SRUA 3NBHB 1IBMQ 1K3RA 1SLJA 2F52A 4A3GG 3CP0A 3CD6A 1VCIA 4DV1L 4JI6Q 4ME3A 1N9WA 4X66L 1V1QA 4XTCS 3KJOA 1PH8A 2AWNA 2I5HA 3RN5A 3K80C 1X3GA 2Z0SA 4JC0A 1O7IA 4PG3A 4LFBL 4KHPL 4IOCA 5C4JH 5LMUL 4JI3L 4DV3Q 4HIDA 2BH2A 2R93G 2QGQA 3RR5A 5IY0A 4X62Q 4B3MQ 4GLVB 1ASZA 4WJ4A 3KF6A 1I6HH 4POFA 3PUVA 1AH9A 5JJKA 2NVQH 1UWVA 1OXUA 3STBD 3D0FA 1PH3A 1BBWA 1SMXA 4TVAB 3K7AH 1YBYA 1VQCA 4JI5L 4A3CG 3W1GA 3KOJA 5C4XH 3PO2G 1IL2A 4JI2L 1XMOQ 2N49A 5C3EH 1JMCA 2MQHA 4MZ9A 4RG1A 4GKKL 2F3IA 2NN6G 4P75A 2JK8A 3ERSX 4JI7L 2VQFQ 1A0IA 4DV2Q 3RZOH 4Y7NH 5IP9H 2E2JH 1K8GA 5FJ8H 1FVIA 3U50C 1GKHA 5IP7H 4YY3L 2HHHQ 1QVCA 2AKWB 1UE1A 3KF8B 1XNRQ 4IPHA 1S3OA 3I55A 1V9PA 4BBSH 1VQIA 2KHJA 5AJ3Q 5M5XH 3CAMA 3ULLA 3S15H 3ULPA 1HNWL 1OXXK 1YVCA 1I94Q 1NJIC 3HOYH 4LF5Q 1G291 3L7ZC 1D8LA 1HZCA 4JI0Q 3HKZG 1YIJA 1U0LA 4JOIA 4QY7A 1XMQL 3T1HQ 1A62A 1L1OA 3M4QA 4DR6L 1WCMH 1PYBA 4DR2L 1WI5A 1XPRA 2CQOA 5HGQA 4IJHA 3HOVH 1RIPA 1KRTA 3I4NG 3CQZH 2IX1A 5C0XI 1BBUA 4DV5Q 1VQLA 4DUYL 2ZJRA 4BY1G 2KCMA 1IBKQ 1HR0W 2MO0A 3PUYA 4HJAA 2MO1A 2I5LX 3KF6B 1YHQA 4JBKA 3M4OH 4DV6Q 3S1RH 1VQKA 2E8GA 3K7UC 5JJIA 2YTVA 2OTLA 3NENA 4JBWA 4PZ7A 1E1OA 3I56A 4A3KH 2PQAA 1PH9A 2GVBA 2EXDA 1CKNA 4A3IH 2GVAA 4DAMA 3UDXA 4K0KL 3GTJH 5GAEC 4B3SQ 3GTLH 2Q2UA 3F2CA 1N36Q 4BY7G 1E7ZA 3WWVA 4PZ6A 4DV0Q 3RLFA 4LF9Q 3FKIH 1PH6A 2B63G 2K5HA 4A3LG 3B6YA 2NZHA 1TWGH 2YV5A 2YYZA 2JA6G 2AMCB 2CKZB 2Z6KA 3J80c 4GKJQ 2YTXA 5C0XJ 4A76A 4LF8Q 3L0OA 3RNUA 1LUZA 2UU9Q 1EIFA 2DGYA 2AHOB 3PIPA 5IYDH 1KC8C 3HOZG 3I7FA 1E3PA 1J5EQ 3UE0A 1X56A 4X64L 4GOPB 4P73A 3S2DH 1EUJA 4GLAC 1PV4A 3S2HH 4HJ8A 3GTQH 1Z9FA 4GNXA 1SROA 2XTIA 4DR5Q 3E9IA 3J80i 4A3GH 2UUCQ 4RMFA 3OW2A 2WAQG 3CCLA 2A8VA 3F1ZA 1L1OB 1CUKA 4DR4Q 4JV5Q 1JT8A 4B3RL 1OXSC 3J7ZC 4HJ7A 4HJ5A 4LF7L 1XPOA 4DV4Q 4A3FG 4ALPA 3Q8DA 4BBSG 1C9OA 4GOPC 2JEBI 1EOVA 2K50A 4X66Q 4YHHL 4A3JG 4A3BG 2R93H 1XPUA 4QL5A 1N33Q 1GVPA 4IO9A 2FXQA 3I2ZA 1MKHA 1JB7A 2LXKA 5LMUQ 4JI3Q 4JBJA 4JI8L 2JE6I 4QIWE 3CCRA 1N8RC 3E9HA 3FHWA 4JOIC 2PQAB 2UXCL 4A3CH 1VQDA 2E5LL 4LF4L 1CKNB 4EQ5A 1QVGA 3PO2H 1PYSB 1TXYA 2K75A 4NXML 4OWXB 4AYBE 4LUOA 4DUZL 1N32L 1WOCA 1K0RA 4JI5Q 1EQQA 1PVOA 4H02A 4JI2Q 2VQEL 3VDYA 4NXNL 1T9HA 4GKKQ 1KAWA 3A5ZB 3EIVA 3S16H 5IE8A 5DLQE 3M7NA 1VQ7A 1UE6A 4KHZA 1EQRA 1YNXA 3AYHB 2R7DA 3F2BA 3ER0A 3CPFA 1HJPA 4IFDJ 4UP7A 1WJJA 2R6GA 1PH7A 1FJGL 5FLMG 2UUBL 2PI2A 4OWTB 1X3FA 4X65L 3EBEA 3U58A 1L0WA 5ELOA 1UE5A 1S72A 1C7YA 1TWFH 2A19A 4YWMA 4GNXB 1H95A 4HIOA 1SE8A 1B70B 1BVSA 3I4MG 4POGA 4AH6A 2WB1E 3PIOA 1HNWQ 2PI2E 1SFOH 3M3YH 3GD7A 2CCZA 1X6OA 3G4SA 5JJLA 1XNRL 3I4NH 3H3VH 3PUZA 2QA4A 1K73C 3BZKA 1NMFA 2H5XA 2ID0A 4BY1H 4BA2I 1XTDA 5FLXc 3PF5A 4KLKA 2RHQB 4NPSA 4DUYQ 4GS3A 1I50H 1VQEA 3CPWA 2XGTA 1SN8A 2D0OA 2ES2A 1Z47A 2LSSA 5IT9c 3CCVA 1X9NA 4B3TL 1CSQA 4LWCA 3H15A 2F4VL 3OTOL 1YJNA 3ICEA 4LUVA 1JJGA 1PHJA 1QUQA 1EWIA
chains in the Genus database with same CATH superfamily
1HNZL 1R4PB 2ZM6Q 4EQOA 4BY7H 3TP8A 1K8AC 4WJWA 3TEHB 4K0KQ 3KBGA 1GO3E 1ILPA 5M9OA 2N88A 5DM63 1V8QA 2NB0A 4A3DG 4HAEA 4OWWB 5J22A 4HEDA 4DNIA 1WVLA 5E7NA 3QG1A 2DNCA 4IPCA 1YNND 1PH5A 4UAIA 3J80E 4LNQA 3AEVA 4OEMB 1JOOA 1TWHB 3OSOA 3TREA 4A3FH 4LMQD 4HCSA 2L12A 2AWOA 3EQLC 1NMGA 1NBWA 1AE2A 2ZXPA 3NEMA 4O1NA 1GM5A 4CKBA 4LF7Q 4DKAC 4YHHQ 2I5MX 1D5ZC 4LF6L 1TY0A 2O5IC 1VQBA 3NHHA 1W2BA 2VNUD 1JOKA 4YWKA 1SNPA 2KVMA 1QUQB 4WJ3M 4KK7A 4A75A 3BDCA 3UDIA 4IJLA 1D6EC 1I3QH 4KHVA 5IYCG 1ESFA 5IYBG 4DR3L 4AYBG 2EYMA 2PMZE 1PRTC 3R8BA 5FLMH 2IY5B 4LFBQ 5GAHC 1ZYRC 3KLRA 3R3OA 4DXGA 3K58A 2HDLA 2B8FA 4WRDA 5EKIA 1L1OC 2B2YC 1K28A 4LF9L 2EY1A 2IHFA 5C4HA 2Q2IA 1B9NA 2B2WC 1EY4A 3HOUG 1CSPA 4C2MH 2G5DA 1WTOA 3J81j 1Y8PB 3KDFB 4ID6A 1LT3D 1CQFA 1QCBD 4LFCL 4BA1I 1XMQL 4Y7NB 3A54A 2E2JB 4HMIA 2TMPA 1UEAB 2K5NA 3RLNA 4NMZA 4QMGA 1DXMA 2OEOA 1CA5A 5M5XB 4ULLA 1EOTA 2TSSA 1G2TA 1Y1WH 2R7ZH 3NWTA 4B3TQ 5EKKA 2F4IA 4BBRG 1Y1VH 1PMRA 2PNHA 5C0XG 2KECA 1N33L 2Q2HA 1QZHA 3TZUA 1PFMA 2ICEC 4NW2A 1HTLD 2UXDL 1Q7YC 5BR8L 3HOVB 5D65A 5IT9E 1ONLA 2UUAQ 3ERQA 4DR2Q 1UUPA 2JQOA 3T1YQ 1VQ9A 3D31A 1PA6A 3LNNA 2RF4A 5M5YH 3IAYA 3L2PA 4NKLA 3Q24A 2D0PA 1R9TH 3HKSA 2RKSA 1GHKA 4RCOA 3STBC 4FF2A 4FXKC 3SE0A 3TN2A 1VMPA 4JI4Q 3CU7A 1VQAA 2ZTDA 5EBDA 5LL6S 2MPMA 3CKIB 3FKIB 4YWLA 1MHWC 4OX9Q 1TWGB 5M5WH 1L2FA 1TU2B 3HOXH 3J81L 3I4OA 2Y0SG 1OXVA 2F1MA 3TBIB 1QZGA 3D6WA 5KRUA 1CKMA 1F2LA 3S2DB 4DR7Q 1VF7A 4KD3A 2HIXA 2EVBA 2ZTEA 4A3GB 4UHVA 1SNMA 2AUJD 4F87A 4L5QA 3A74A 1Q8KA 4R9WA 2HHHL 4B3RQ 4G4KA 1V1PA 5IP9G 3HOWH 3CF5A 2R93B 3MXNB 2VZAA 1BNZA 4LF5L 4K8IA 5C44H 1KD1C 2NZOA 1Q81C 4QQBX 4JI1Q 1VQJA 4XXEA 2N3SA 1NUCA 3F8TA 4DAVA 4YCVA 3HOYG 3AFQA 1VQ8A 4RGOS 1TR5A 4LF4Q 3BDOA 3PSIA 1IKLA 4KI0A 4RAUC 3V05A 4I7ZC 1PRTD 1IXRA 1WCMG 3MZ5A 4P74A 1D7QA 4KKTA 1ZYRD 3UDFA 4IN3A 3SK8A 1E1TA 3S16B 2J7ZA 4RH6A 3EJIA 1B7YB 3K5OA 3CHBD 1ILQA 3KJPA 4B3SL 3HS0C 1E2ZA 5EPJA 4A3KG 4NB3A 2RDFA 2V1CC 1CFMA 2OTJA 1TWHH 4K8JA 4HIKA 4ZYSA 1C48A 3I91A 1MJEA 3HZXA 4HJ9A 4JYAL 3IFDA 1I4HA 5CR3A 4DGZA 1JICA 1EIYB 2KHSA 2KENA 1J5EL 3MVVA 2LY7A 1GUTA 2J0TD 4EGVA 4MNOA 1SE4A 1T5XD 1S5CD 5EAYA 1SJED 1MI2A 2IX0A 3KF8A 4P2CB 2AQ3B 1I50B 2K03A 2KQ3A 1TQOA 1LT4D 4JW0A 1N34Q 3NBHB 3VYSA 3CP0A 3TP7A 1VCIA 1LT5D 2R61A 4X66L 4XTCS 3KJOA 2VB2X 1B9MA 3RN5A 3X3MA 4JC0A 1W6JA 2XSCA 5LMUL 2PO4A 5ELDA 4C3IB 1ASZA 1U4PA 1WTVA 1AH9A 3STBD 1OXUA 1PH3A 4V190 3KOJA 1CZGA 1H9MA 4OIKA 4DK1A 4Q5VA 4MZ9A 1WD1A 4BWGB 2NN6G 3ONAB 1JORA 4JI7L 2VQFQ 1EYDA 2A6HC 4FNFA 4Y7NH 1GOZA 1CM9A 3H0GB 2E2JH 4A3BB 1FVIA 3J81E 3MFGA 2AKWB 3VA5A 1EZ6A 5M5XH 3NSWA 5FOBB 3HKZG 1YIJA 1A15A 1L1OA 2B2YA 3MAQA 5KEEA 3HOVH 3S1NB 5C0XI 3JAME 1KNEA 2B2WA 1VQLA 1DONA 3DWPA 1QOHA 2ENBA 2F0PA 2F0OA 2KCMA 4BY1G 2NWGA 5JOBA 2L1BA 2E8GA 5D3IB 2Q8IB 2YTVA 1EZ8A 2OTLA 4PZ7A 4KD4A 2RBMA 2EXDA 4DAMA 4K0KL 4DFAA 2D5DA 5EBCA 4XT1B 3I4MB 3S9WA 5JEAH 4BY7G 1E7ZA 3NQTA 1PDQA 4PZ6A 3WWVA 4LF9Q 3FKIH 1PH6A 3B6YA 1TWGH 1LTBD 4XQQA 1K83B 2YTXA 4A76A 5IODA 1GUOA 4PMBA 4KY7A 2AHOB 4X64L 1X56A 4GOPB 3S2DH 1AZQA 5KNCA 4U68A 2LFNA 2KEEA 1SROA 2L4NA 3E9IA 4A3GH 2UUCQ 2SOBA 1AZPA 4JV5Q 1KTKA 2WKDA 3J7ZC 4LF7L 1SNDA 4A3FG 1JOQA 1C9OA 4C3HB 4GOPC 2K50A 4YHHL 2R93H 1N33Q 3I2ZA 5IGCA 1JB7A 4JI3Q 4JBJA 4JI8L 2A6EC 5I9PA 1TKWB 1TVXA 3E9HA 4JOIC 2UXCL 4A3CH 1TXYA 2EYHA 3X3NA 4CDEC 5JVG3 1CQVA 3DEPA 1TT2A 2B2TC 3ITPA 4JI5Q 3D4WA 1EQQA 3VYTA 1I4RA 4JI2Q 1SXTA 2VQEL 3VDYA 1GUWA 3NK9A 3S16H 1FGBD 1CT1D 1PFBA 3NP8A 5C5LA 3BS1A 2NVYB 1VQ7A 1UE6A 1QB5D 4KHZA 1YNXA 2NYZD 3F2BA 4UP7A 1WJJA 3T56B 5IGEA 2JA7B 1C4QA 5FLMG 2PI2A 3U58A 4KTAA 3D4DA 5ELOA 1UE5A 1C7YA 4GNXB 3WDNA 5BN3A 4OELB 1JQYD 2WB1E 1HFNA 2A6HD 1K8MA 1S5DD 4QIWB 3H3VH 5IGDA 3BZKA 5M3MB 5FO7B 2H5XA 1DZ1A 1A3TA 5IIFA 2F0KA 2Z8LA 3K5NA 4FXDA 1JWMD 5M3FB 3PF5A 2K6AA 3P7JA 1Y8NB 5ELCA 1I50H 1A2TA 2D0OA 4B3TL 4GZYC 3P1HA 1MSHA 3FDTA 1K3BC 3NXWA 4JPBW 1I4XA 1PHJA 3N6RA 3VA7A 2JA8B 4XQJA 5C6AA 2R7ZG 1FL0A 4A3LH 2A5HA 1Y1VG 4ME5A 4RHRA 2UUAL 3CMAA 1P16A 2H4OA 3T1YL 5JEAJ 4IURA 1L0YB 1PYWD 1FR3A 4DAYA 1GD7A 1NY4A 1DD2A 2HIVA 2L5TA 4K5XA 5G3LD 4IQZA 3A7AB 1S5FD 1B2TA 3DLLA 4C3JB 3H94A 1BR9A 4DK6C 5CV6A 2Z1CA 1VQOA 3PO3B 1C0AA 1DOKA 4JI4L 3VYUA 2VS1A 2Q2TA 4H13C 4OX9L 1VQNA 2EJFC 2L0CA 4YCWA 3H0GH 4A3JH 4YCUA 1A2UA 4A3BH 2DUDA 5ELFA 3K81C 3J7AV 4JYAQ 1K9MC 4X3UA 3BVZA 1GUSA 3HOXG 2PQEA 4DR7L 2XIWA 3GTPB 2EE1A 1SDFA 1G2SA 1O80A 2HCCA 2MUYA 4K5WA 5EJWA 3VR2A 1BCPC 1EY0A 1VF5C 5EQ0A 3G6EA 3S1NH 1KLGD 3D4RA 1VQFA 4FVMA 2K4KA 3EA6A 4IALA 1FGUA 2A6ED 1YZ6A 4F7XA 5C4JB 4WFN3 3IFTA 1RDPD 4JI1L 4XQNA 3HOWG 1SSOA 5IGFA 2CWPA 3L3OC 1I6HB 3SK5A 3I73A 3OWFA 2E2DC 2E75C 2R3ZA 5C44G 1FJGQ 1EIGA 3I4MH 3K7AB 3NELA 3CCJA 5C4XB 3J7A5 3KLSX 4Y52H 2JP1A 3Q0AA 2I0QA 1FNUA 1EU4A 1K83H 1XTCD 1RTNA 3CCEA 1Q46A 2PZWA 4XT3B 1U4LA 4A4IA 3RZOB 4C56C 2ES2A 3K8AA 4DK3C 3OW7A 4JI7Q 4B08A 4UDUC 2K5WA 2ZT9C 4OL7A 2JA5G 1ZXTA 3HEJA 3PIP3 1DOLA 1X55A 1ENFA 2WV6D 3FPPA 2RSOA 2WINB 3QOLA 4XYQA 1I6VC 2Z6KC 2PMZB 5FLXE 5CORA 2D9UA 1SBBB 2PCFB 4V0BA 2ZTCA 3OTOQ 4C3HH 2K04A 4AQYQ 4RCNA 4ZKBB 2MHVA 2KJXA 5E1FA 2N8NA 1DYQA 3RD4A 1TS5A 1NCVA 3QIAA 3TS0A 2B2UC 2EYLA 1N34L 2PZUA 1GUNA 2OF1A 4QJFA 1X3EA 2XRQD 4I65A 1STGA 3NTKA 3FP9A 1G6PA 2EYJA 1ZKOA 1BXTA 3AQQA 3C1FA 1BKBA 3GTLB 4IFDH 1M90C 2NVYH 3MXUA 3IRBA 1QVFA 4ZLTF 1HQRD 1Q3LA 4CGYB 1PH2A 2JA7H 5C5MA 1A8VA 2VL6A 1EY6A 2OQ0A 4GOPA 1VQMA 4R4CA 4R4QA 2JA9A 2H1EA 5FO8B 2F0QA 2QDLA 5A2QL 4X64Q 4FF4A 2NUCA 1WTHA 4LFAQ 1YEZA 1HCZA 2DJGC 2PZTA 3TDQA 2VQFL 3KBXA 5M3MH 2EQSA 4XDXA 4JCVE 3PIO3 1U5KA 2BDNA 2B2TA 4UPAA 5M3FH 2Z4IA 4J8QA 4UY8C 1E22A 1QG7A 3NBIA 3W1BA 1MBYA 3Q22A 3G71A 4E6IA 1MJCA 2F3WA 4N8FA 1BCPD 1LM0A 4JI8Q 4ZUIA 1Z7TA 3PO2B 2JA8H 1GHJA 3MC0B 2UXCQ 1J8IA 1YNJC 1IKMA 5LMNL 1K8OA 2R7FA 5CBAE 5COYA 3BJUA 4DN4M 2QF7A 3AU7A 3HOVG 2ZXOA 3OIQA 2VQEQ 1J6QA 2M2LA 3CCQA 1VDZA 4C3JH 4RHSA 1RKNA 4H0LC 1WTRA 4BXXH 2Q8RE 3PO3H 1PFSA 4O0AA 4LW1A 4N9TA 3IKJA 1IBLL 1HXYD 1F2YA 2OT2A 4P72A 5JEAG 1ASYA 1IYVA 3M3YB 1KXLA 3R2IA 2SNSA 1X54A 3FKIG 1LV9A 4K5VA 3TS2A 3NQIA 2WAQE 3CCSA 1XX8A 4AIMA 3GTPH 1F2MA 3LWUA 2D62A 1STNA 1Y8OB 5JPNC 2UUCL 4HTHA 4JV5L 4OO1H 1IBMQ 4A3GG 2DY8A 3CRLC 2B63B 3D6CA 4QB4A 1PH8A 3DMUA 1RCVD 2I5HA 3S14B 3DUZA 1X3GA 4KHPL 4IOCA 5C4JH 1HQMC 4JI3L 3V96A 2BH2A 2R93G 3RR5A 3QOJA 3T13A 4X62Q 3KF6A 3HOZB 1I6HH 3HG9A 1UWVA 5DAUA 1SMXA 4RA8A 4ZCKA 2X6GA 3K7AH 4LAAA 1YBYA 1VQCA 4JI5L 4A3CG 3S1QB 2XVSA 5C4XH 1IL2A 4JI2L 1XMOQ 2N49A 4CJ0B 3ND8A 2F3IA 1ZEQX 4KN7C 5FO9B 3MTSA 4P75A 2JK8A 3ERSX 3A7LA 5D14A 4ZQ3A 3RZOH 3DM1A 2KEDA 5FJ8H 4YY3L 3NTHA 1UE1A 3BZDB 3K57A 3GV6A 1STAA 1WTWA 3CAMA 1IYUA 3WOEA 4OHJA 5J1ZA 5A2QE 3W3AA 2E2HB 1G291 3L7ZC 5BN5A 5DEHA 3I72A 5JJZA 4JI0Q 1U0LA 4QY7A 3M4QA 1NNXA 4XYOA 1RTOA 3E3XA 1EL0A 1M8AA 2O2LD 4J1MA 4IJHA 2FMCA 2I07B 3CRKC 1BBUA 4DV5Q 4JVZA 2HD3A 3SK4A 5CMDA 3NUCA 5EPLA 2MO0A 2I5LX 4DV6Q 1VQKA 3K7UC 1PZJD 1IW7D 1E2VA 2JXMB 1YNJD 1CKNA 2F0SA 3UDXA 1AP0A 3GTLH 1JWSD 5KGUA 2K01A 4A3LG 5CV4A 2LKVA 2NZHA 2YYZA 2CKZB 2Z6KA 2RCFA 2I46A 3EROA 4DNTB 3DHQA 1JE4A 2DGYA 5IYDH 1KC8C 1AEXA 3I7FA 1E3PA 3AB9A 1BQQT 3H6MA 5JAVA 1LT6D 1PTOB 3SXHA 2B2UA 1H9JA 4X3SA 3OW2A 3CCLA 2A8VA 1CUKA 1F9RA 3QWNA 1IL8A 4DR4Q 2XRSD 1B3AA 3DWQA 3GQBA 4HJ7A 4HJ5A 2D2CC 3QR8A 3Q8DA 1XXGA 1B4OA 3KLSA 2EYOA 2V4DA 3A8KE 4A3JG 2VUMB 4A3BG 4QL5A 4IO9A 5HGTA 2NVXB 1NSNS 1KABA 1MKHA 4M8AA 1FYCA 1DCZA 5K5PA 3K5LA 1N8RC 2PQAB 3PQIA 3VR4A 3P20A 1O7ZA 5KIXA 3PO2H 1QVGA 3QJYA 1EQVA 4AYBE 1K0RA 2SEBD 1PVOA 3H3VC 1BO0A 3K0YA 2A69C 2PYKA 3QO2A 4GKKQ 1KAWA 2HQEA 5DLQE 2K5DA 2NBFA 1TWAB 3BVGA 2R7DA 3CPFA 1FJGL 4N8X1 4X65L 4WORA 1L0WA 4A93B 4KKSA 1I4QA 4YWMA 1S72A 1HFGA 3GTGB 1B70B 1BVSA 3I4MG 4POGA 4HSVA 2PI2E 3KUPA 1HNWQ 1LTID 3M3YH 2CVRA 5CC4A 1X3PA 3G4SA 5JJLA 1S5ED 3PUZA 2QA4A 1K73C 5E3FA 1X32A 3L9AX 3HRZC 2RHQB 3DWAA 4GS3A 1VQEA 4A3MB 2Z9HA 1WD0A 1X9NA 4LWCA 3OTOL 3EFXD 3ICEA 5CV8A 1QUQA 3RZDB 1EFID 5I2XA 4AQYL 4A3EB 1GUGA 3C46A 2B63H 5FK9C 3S14H 1TY2A 1OXTA 1RODA 4OGQC 4C3HG 4L5RC 2F3VA 4TSSA 5LMNQ 1HZBA 3HOZH 4FF1A 3BU2A 2B39A 2WB1B 3EN2A 3PCOB 3PUXA 4RWSC 3CC7A 2RCNA 3I3CA 3G7LA 3GTMB 4KV6A 2BA1A 5LMNW 3S1QH 3SDZA 3M9BA 4UP8A 3CCMA 2K52A 2Y0SE 1S40A 3GTKB 1UAPA 4IFDG 1H9SB 2SDFA 1IBLQ 1K0SA 2F0NA 3KDFA 2OQKA 4O42A 2JA7G 5HY6A 4OONA 1I94L 4R4IA 2IT1A 3CW2C 4PNYA 4LFAL 3FEWX 2XNAC 2R92B 1JJCB 4QF4A 3TP6A 4APVA 1N32Q 1G91A 1IBKL 5M3MG 3PV0A 1H9RA 1Y14B 3GO5A 1NE3A 2F0HA 4CJ1B 5KYIA 4RGTA 3CCUA 2CQAA 3C1EA 5M3FG 5IGBA 2HQLA 1LTAD 4L5SA 4NXNQ 1ICFB 2A73B 3H3VI 3N52A 5GROA 1CKOA 4KJOA 4KHPQ 2ZJQA 4K6LA 1RJTA 1BOSA 1TIID 2SNMA 4L5TA 2NVQB 1VQPA 5J3BA 2A69D 4ABNA 2XN9C 2JA8G 2PW7A 5GADC 1PRTF 2QEXA 1KHIA 5C3EB 1M1KC 4LJZC 5EPKA 1HRJA 4R1JA 3ZJYC 4LUZA 1EYGA 1KRSA 2EY6A 3E6ZX 4IPDA 3TQYA 4Z9CB 4C3JG 1JE5A 4ZRZA 4CKEA 3AMUA 4YY3Q 4BBSB 1PTOH 4BXXG 1MIUA 1XWEA 3PO3G 2E74C 4OXPA 4K2KA 4IZ8A 2F4VQ 5K36H 1WFQA 5CBEE 4IOAA 2VUMH 2VW9A 5A35A 1KNAA 1XNQQ 3EVQA 2NVXH 1EWCA 3TZDA 4M1UB 4H44C 1HNXQ 4GNXC 4F88A 1V43A 3A0JA 3BG3A 4ZAIA 3MXNA 5CV5A 1SYGA 3S1RB 1HZ9A 1TS3A 4TRDA 1IBML 2JSOA 3OWEB 3CC4A 2O5JC 4OO1G 5ISRA 4A3IB 2QILA 3GTJB 5CV9A 1Y1WG 4MHEA 3I90A 2K33A 1PXUA 2ZJPA 1HH2P 3SVMA 1EY9A 4X62L 1TWAH 1CK1A 4X3TA 4HMJA 4C3IH 2XWJB 1IHZA 2M9VA 3OYYA 4A93H 5EKLA 2FHTA 3GTGH 1XMOL 1XJVA 1CHQD 1RL2A 2ATWA 3C3LA 1PLFA 1ESRA 5C4XG 3GTQB 1HR0Q 1YJWA 1D5MC 5IWAQ 2GN5A 4PZ8A 1B50A 1HPCA 1TS4A 1QILA 4RFBA 4NDXA 1QWYA 2NN6I 1P8LA 4KMUC 3RUZA 3H91A 3HKZE 4G7ZC 1O78A 5FJ8G 4A3MH 2RHSB 4DF7A 4J15A 2F0MA 1IYJB 2RQXA 3KK7A 1YITA 4CDDC 1EEFD 1NR2A 2KA7A 5GAGC 4JI0L 4O2DA 1SYFA 3J80L 3RZDH 3FVQA 3AFPA 4A3EH 3NBHA 4K6DA 2F0EA 4DV5L 5E4XA 1JWUD 1C8CA 1EY5A 4CKCA 4DV6L 1LTGD 1HTPA 3CMEA 4BS9A 4KJNA 3GTMH 1AW7A 3SGIA 1F9PA 3UE1A 4MN3A 1KDAA 2ASBA 4ILWA 1W3SA 3NWSA 4X65Q 4U673 4TKOB 1S4ZA 4DR1Q 1LABA 3GTKH 1DGSA 1SFOB 4IUVA 2LMCB 3BZCA 2Z6BA 5ELEA 3I4NB 1V1PB 3RN2A 3UDGA 4IFDI 1RD9D 4B9WA 2N55A 1I4GA 1S5BD 5IYDG 5KNBA 2UXBQ 2AQ2B 5H1SE 4DV7L 5I4DA 4FP5D 1Q86C 3MEFA 2R92H 2WP8J 1VQHA 3A8IE 4GLXA 4DR4L 3A56A 1II3A 1MGSA 1SLJA 2M00A 4DV1L 4JI6Q 1SYEA 1V1QA 5NUCA 2AWNA 2BDOA 2JA6B 2Z0SA 4PG3A 1O7IA 4DV3Q 1CZWA 4CBVA 4HIDA 3F2UA 4B3MQ 4WJ4A 2IW3A 3QB3A 4POFA 3PUVA 2Z4HA 5JJKA 1E0BA 2NVQH 2C9OA 2QW7A 4L8JA 1JC7A 3HGBA 2F03A 2WIIB 3T51B 3PO2G 3C2PA 2CW0C 5C3EH 1KAAA 2MQHA 1LTSD 2WAQB 4RG1A 2EXZA 5LHY1 4GKKL 1TWCB 2K28A 4IUTA 1SNQA 1A0IA 1QJOA 5IT9L 1Q8IA 3A55A 1K8GA 5IP7H 1XYIA 3SK6A 2E2IB 3HOWB 3KF8B 2MJ8A 4IPHA 1S3OA 3I55A 4BBSH 1EY7A 2KHJA 3ULLA 2EPBA 3ULPA 2IX3A 1OXXK 1VMCA 1I94Q 1HNWL 2EDGA 1NJIC 2P5ZX 2VB3X 1O7YA 4G57A 1BUVT 4JOIA 4G7OC 3T1HQ 1A62A 4DR6L 1WI5A 2CQOA 5HGQA 3I4LA 3M4YA 1STHA 4QCLA 1IBKQ 2A68C 3S17B 1YHQA 2F0JA 3PUYA 4HJAA 4NP5A 4JBKA 3S1RH 1SMYC 2JA5B 4LK1C 2NVTB 3I56A 4KN4C 1PH9A 1ET6A 3I70A 4A3IH 2GVAA 3GTJH 1G6ZA 1IW7C 1ML0D 3VYRA 2Q2UA 1N36Q 4IUQA 1ET9A 4OO1I 2JYOA 2YU9B 2B63G 1D1KA 2K5HA 3LWEA 2AMCB 2NTSA 3J80c 4GKJQ 1X3QA 4LF8Q 3VR6A 1D2BA 5G3LF 5CGKA 3L0OA 3RNUA 2UU9Q 4PMCA 3HOZG 5E4WC 4P73A 4RGMA 4JK1C 1PRTB 1EUJA 4G7HC 2IJ0A 1PV4A 4HJ8A 3GTQH 1Z9FA 4GNXA 4DR5Q 2F0TA 2XTIA 3J80i 4RMFA 5AFWA 4ZK9B 3F1ZA 1L1OB 1JT8A 2B2VC 3MHBA 1OXSC 4DNRB 1XPOA 1B1ZA 1FNWA 1SNCA 3D3RA 3GTOB 1EOVA 1RF2D 2F0VA 2QEJC 4A3DB 1STBA 4K2LA 1MSGA 2L9HA 2FXQA 2LXKA 2EYFA 1RHPA 2JE6I 5L37A 3FHWA 1DJRD 4EQ5A 4PV1C 5J39A 1N32L 5KYLA 1H9KA 1WTQA 4ODGA 3MXGA 2K5QA 4NXNL 2FFKB 5IE8A 3H09A 3AYHB 2DY7A 4IFDJ 2A74C 1HJPA 1F2ZA 2UUBL 4OWTB 3EBEA 2CW0D 4IUNA 2IPKD 2IWHA 1H95A 2A19A 3Q23A 4AH6A 1SFOH 1F9QA 2E76C 3MXPA 4HSPA 2CCZA 1X6OA 2PNRC 1NR4A 3I4NH 2CH4W 2CH4A 1G8ZD 3TSSA 4F8MA 2HUGA 2EZVA 1XTDA 4AYBB 1TS2A 5I6WA 3NE5B 4DUYQ 3OMCA 3MFYA 2WACA 2DN8A 1Z47A 5IT9c 4N9PA 2J4XA 3H15A 2F4VL 4L63B 2XWBB 2AQ1B 3DXJC 1PZID 1KQSA 4MTKA 3S1MB 3P75A 1DOMA 3HOUB 1XNQL 2JA6H 5K36G 2A68D 2RVLA 1A3UA 2Q8TA 1OTCA 3R93A 4ZUJA 3J7YW 1SMYD 2VUMG 1HNXL 1VQ4A 1EIHA 1F9SA 2C35B 2KOLA 3RLOA 1YI2A 1G51A 2RA4A 1SR3A 1D1IA 3W5OA 1PFNA 2EJMA 3U4VA 1Q12A 5DM73 2K5VA 2KHIA 4CHTB 1TWCH 2HCIA 2K14A 5I9OA 4DV2L 4CDCC 1D5XC 4DXFA 3PF4A 1Q90A 4BBRB 1U4MA 1UEBA 1E2WA 3JAML 1KDBA 4R8IA 4DU9A 5AJ3L 5JPMC 2E2IH 4C3IG 4X3KA 1HUMA 2BA0A 1U9RA 2BH8A 1A63A 3R2TA 3U4ZA 4IUUA 4GN3B 4A93G 2GA4B 1LACA 1EU3A 1CHPD 2LS01 1HR0L 3CXCA 1SJHD 2B3GA 3E5SA 5IWAL 4DV7Q 2EY5A 3KLWA 2E5LQ 5IGGA 3J7AF 4NXMQ 1OO9B 2G9DA 3E0EA 4DUZQ 4K14A 1UNSA 1VQGA 3ZYYX 1LO5D 4DAYB 4DV1Q 3BYTB 3S17H 1T5EA 3VR3A 3H0GG 5LL6X 2FINB 2QDBA 2JA5H 2NVTH 1VQ5A 1YJ9A 1PTOC 2Y0SB 4A3MG 1B8AA 1DM0B 3KYHC 1BCPF 1HA6A 3T53B 4DA2A 1SE2A 4DV0L 1Q82C 4UP9A 1PH1A 2WFWA 1VS0A 2YU9H 4A3EG 4KKUA 1Q1BA 1QE6A 2KCTA 2K1BA 4DPGA 5GQOA 1HZAA 2K05A 5I6YA 2CFMA 3JC66 3FRPB 1BF4A 1XNRQ 3PGZA 1PH4A 4HIMA 2WB1G 2ALYB 3Q6SA 2VY3A 2EYPA 4FO2A 4JG2A 2O4XA 2K7VA 3UI2A 4B9XA 3G48A 4DR1L 2JEAI 4DAPA 3S15B 1MD2D 4DV4L 3HOYB 2F0WA 4XIGS 1KIXA 1EWHA 4R4TA 2KCNA 5CV7A 1HNZQ 3GTOH 1WYDA 4A3DH 1WCMB 2MNAA 5D3DA 1I4PA 1NTGA 3TP5A 4DR6Q 2UXBL 3CQZB 2IHEA 3M85A 2L55A 1M4VA 2C5CA 3CC2A 1JCKB 1Y69U 3M4OB 3LGJA 2NZ1D 1PZKD 2X69A 4A3KB 2F0UA 2R92G 2K32A 4JI6L 4FF3A 2HT1A 3K5MA 2KBNA 1LTTD 1WTXA 2OWOA 2B29A 2CHBD 4DV3L 1Q1EA 4X6AH 2WKCA 2KCCA 1CA6A 2CWAA 4CJ2C 4A3JB 4B3ML 3GDEA 3MEHA 4KY6A 3S24A 3HFZB 2B2VA 1STEA 1V1OA 3IL8A 1VQ6A 4MTNA 2DJFC 4HR7B 2EIFA 1EFWA 1LLRD 2MFIA 2EY2A 5JVH3 2FJ2A 3K0XA 2F0IA 1AE3A 2A1AA 4LF6Q 2F0FA 1EQTA 3J81c 1E24A 3DEOA 2JJQA 4RGNA 3S2HB 3RMHA 5DNFA 5C3EG 1I5FA 2NTTA 1YHBA 5IYCH 5IYBH 2YTYA 4JBMA 5CYUA 4R4OA 2L15A 3TRZA 1EY8A 3J81i 5BN4A 5IP7G 1J9OA 4DR3Q 2N78A 4GN4B 4GN5A 3GV3A 3JAMc 4BBSG 1SYCA 3DM3A 2ZM6L 2E2HH 2BE5C 3T1HL 1SYBA 3S1MH 4EX5A 4I7AA 4H7BA 4RKLA 3HOUH 1JJ2A 3PUWA 4FDBA 2QCPX 3KFUA 1UE7A 1GJXA 3OPOA 1KL9A 4PMWA 4P71A 1LYLA 2LXJA 3LX0A 2F0GA 2L11A 1PTOD 3JAMi 4IPGA 3FPUB 5ELNA 5TSSA 2OXPA 3ULJA 1SYDA 2G9HD 1HHVA 1XMQQ 4LFCQ 3SEBA 2VXWA 1HUNA 2MP1A 1SNOA 1IZ6A 1YHAA 1KDCA 1WTPA 2UUBQ 1N36L 1TWFB 4A3IG 2OCEA 4BBRH 3HKZB 4EQNA 1NAPA 1LTLA 4QGUA 5C0XH 4GKJL 1GXDC 4LF8L 2EOTA 3U9OA 1BDOA 1X65A 3M4PA 3OIPA 4TQUS 2UU9L 2X6LA 3WOFA 2FMMA 3F2DA 3OOCA 4BY1B 4Q0FA 3MWYW 2UXDQ 1B44D 5BR8Q 3A5UA 3BYYB 3T16A 3O13A 4DR5L 1EEID 3GP7A 1CTMA 1SRUA 4EQPA 1K3RA 2F52A 3K6OA 3CD6A 2AUKA 1ICWA 4ME3A 1N9WA 4BY7B 4YIJA 4J6HA 3SR1A 3K80C 4LFBL 3NPPA 1EYAA 4FXGC 2QGQA 5IY0A 3BDLA 4GLVB 2JN4A 3D0FA 1BBWA 3T4AC 4TVAB 3HP3A 2KUMA 3W1GA 1FD7D 3OHXC 5T1GA 5C3WA 1AN8A 1JMCA 5ELBA 5FLXL 2ICIA 3M7GA 3OMGA 4A3FB 4DV2Q 1F77A 4OIJA 5IP9H 5FKAC 3U50C 1GKHA 2HHHQ 5EGTA 1QVCA 5HURA 2DNEA 1SAPA 3MA2B 1V9PA 1VQIA 5AJ3Q 3S15H 1YVCA 1A6XA 3HOYH 4LF5Q 1D8LA 1HZCA 3PMFA 2RDHA 4RKBA 1WCMH 1PYBA 4KY5A 4DR2L 1XPRA 4R8NA 1ENAA 1RIPA 1KRTA 5KNDA 3CQZH 1W6KA 2IX1A 3I4NG 1I3QB 3D8GA 4C1NK 4DUYL 3TMEA 2ZJRA 1HR0W 3W2DA 2PW5A 2MO1A 3KF6B 5C4ZA 3M4OH 5JJIA 2BE5D 4S3SA 3NENA 1ENCA 4JBWA 1E1OA 4A3KH 4QUCA 2PQAA 2GVBA 3ND9A 4B3SQ 5GAEC 2F0LA 1YNNC 4HN7A 3F2CA 4DV0Q 3K59A 3RLFA 1CI3M 2YV5A 2JA6G 4C2MB 5C0XJ 1BCPB 1L0XB 2IL8A 1LUZA 5I2YA 1EIFA 3PIPA 1LTRD 1JR0D 4EVOA 2BOSA 1J5EQ 3UE0A 2ZXRA 4PQXA 1A3VA 4GLAC 3S2HH 1QNUA 1U4RA 3U9SA 1SE3A 4HCEA 4CDFC 2F0DA 2WAQG 2HDMA 2BCOA 1Y1WB 1STYA 4B3RL 5C3XA 2R7ZB 3I8ZA 3E0JA 1Y1VB 4DV4Q 1EYCA 4ALPA 3V2TA 1BBXC 2JEBI 4X66Q 3A8JE 4MIUA 1XPUA 4QUFA 1GVPA 1B53A 4L6TB 5IOCA 5LMUQ 1R4QB 3URYA 2B8GA 4QIWE 3CCRA 1O7LA 1VQDA 2E5LL 5M5YB 4LF4L 1CKNB 1PYSB 2K75A 4NXML 4FYDA 4OWXB 2RDGA 4LUOA 4DUZL 1WOCA 1R9TB 2PPBC 2RSNA 4H02A 2NN6H 1SEBD 1PTOF 1T9HA 3A5ZB 3EIVA 2EJGC 2QKIC 3M7NA 1EQRA 5M5WB 3ER0A 2R6GA 1PH7A 1JB3A 1X3FA 3HOXB 4C1NI 1TWFH 3NTIA 4HIOA 1SE8A 1QNKA 2MGSA 3PIOA 4DK0A 1B3QA 1KLUD 1FNVA 3G6JB 3GD7A 1XNRL 1NMFA 2ID0A 4IUPA 4BY1H 1H9SA 4BA2I 3FMCA 5FLXc 4KLKA 4ZKCB 1HA5A 5F2DA 4NPSA 3SHLA 3CPWA 2XGTA 3BVMA 1SN8A 3VR5A 2LSSA 5C44B 3CCVA 1Z6HA 1CSQA 1YJNA 1JJGA 4LUVA 5T1IA 1AFPA 1EWIA
chains in the Genus database with same CATH topology
1HNZL 2ZM6Q 1KQSA 4BY7H 4AQYL 1K8AC 2B63H 2R7ZG 4K0KQ 1FL0A 3TEHB 4A3LH 1GO3E 3S14H 1XNQL 1Y1VG 2JA6H 5K36G 2UUAL 1OXTA 1OTCA 3CMAA 1P16A 4L5RC 3T1YL 5JEAJ 1HNXL 2VUMG 5LMNQ 4A3DG 1HZBA 1GD7A 1VQ4A 4OWWB 3HOZH 1NY4A 3BU2A 3PCOB 2HIVA 3EN2A 3PUXA 4DNIA 5E7NA 2C35B 3CC7A 3RLOA 1YI2A 3DLLA 1G51A 1SR3A 2RCNA 5LMNW 2BA1A 3S1QH 4DK6C 4IPCA 3W5OA 1PH5A 3U4VA 1VQOA 1Q12A 1C0AA 4JI4L 4LNQA 2K5VA 2KHIA 3AEVA 1TWCH 2K14A 2VS1A 2Q2TA 4DV2L 3M9BA 4UP8A 3CCMA 2K52A 3PF4A 2Y0SE 3TREA 4A3FH 1S40A 4OX9L 1VQNA 4YCWA 1UEBA 2AWOA 4IFDG 3H0GH 4A3JH 4YCUA 1NMGA 1IBLQ 4A3BH 2DUDA 1NBWA 1AE2A 3NEMA 1GM5A 4LF7Q 3K81C 3KDFA 2OQKA 5AJ3L 2E2IH 4JYAQ 1K9MC 2JA7G 5HY6A 2BA0A 4OONA 4DKAC 4YHHQ 1I94L 2BH8A 4R4IA 1A63A 2I5MX 2IT1A 3HOXG 4LF6L 3U4ZA 4DR7L 1VQBA 4GN3B 4A93G 3CW2C 1W2BA 4LFAL 2VNUD 1HR0L 3CXCA 4YWKA 2B3GA 5IWAL 1QUQB 4WJ3M 4DV7Q 3KLWA 1JJCB 2E5LQ 4A75A 4NXMQ 3G6EA 3E0EA 4DUZQ 3UDIA 4APVA 4IJLA 1IBKL 3S1NH 1N32Q 1VQGA 5M3MG 1I3QH 1VQFA 3PV0A 2K4KA 1Y14B 1FGUA 3GO5A 1NE3A 4DAYB 5IYCG 4DV1Q 3CCUA 3S17H 5IYBG 4DR3L 1YZ6A 3H0GG 4AYBG 5M3FG 2HQLA 4NXNQ 4L5SA 3H3VI 2PMZE 5FLMH 5GROA 2JA5H 2NVTH 2IY5B 4JI1L 4LFBQ 1VQ5A 5GAHC 1CKOA 3HOWG 4KHPQ 1YJ9A 2ZJQA 2CWPA 4A3MG 1B8AA 3KYHC 4L5TA 5C44G 1FJGQ 1L1OC 1VQPA 3I4MH 4DV0L 5J3BA 4LF9L 3NELA 1Q82C 4UP9A 2IHFA 1PH1A 2WFWA 2Q2IA 3CCJA 1VS0A 3J7A5 2YU9H 2JA8G 4A3EG 5GADC 4Y52H 2QEXA 3HOUG 1KHIA 1M1KC 1CSPA 1Q1BA 4C2MH 2I0QA 2KCTA 4DPGA 5GQOA 1K83H 1HZAA 3J81j 3CCEA 1Q46A 3KDFB 2CFMA 3JC66 4LFCL 4R1JA 4A4IA 3PGZA 3K8AA 3ZJYC 4BA1I 4DK3C 4LUZA 2WB1G 2ALYB 4HIMA 1PH4A 1EYGA 4JI7Q 1KRSA 2VY3A 4IPDA 4JG2A 3TQYA 2JA5G 1JE5A 2K5NA 3RLNA 4YY3Q 4BXXG 1MIUA 1X55A 3G48A 4DR1L 2JEAI 3PO3G 4OO1I 4OXPA 4DV4L 2Z6KC 1Y1WH 2R7ZH 4B3TQ 4XIGS 4BBRG 1Y1VH 2ZTCA 3OTOQ 1KIXA 2F4VQ 2PNHA 1WFQA 4R4TA 5C0XG 1N33L 4C3HH 1HNZQ 4IOAA 2Q2HA 1QZHA 4AQYQ 2VW9A 1WYDA 2VUMH 3GTOH 4A3DH 2MNAA 2UXDL 1Q7YC 1NTGA 2N8NA 5BR8L 2NVXH 1XNQQ 4DR6Q 2UUAQ 2IHEA 3M85A 4DR2Q 2UXBL 2JQOA 3T1YQ 1HNXQ 1VQ9A 4GNXC 3CC2A 1V43A 3A0JA 3D31A 1PA6A 3TS0A 2RF4A 5M5YH 1N34L 3L2PA 1HZ9A 3LGJA 1IBML 2D0PA 1R9TH 3HKSA 1X3EA 4QJFA 2R92G 4JI6L 2HT1A 3CC4A 2KBNA 3STBC 4OO1G 3FP9A 1G6PA 2OWOA 3AQQA 1Y1WG 2B29A 4JI4Q 1BKBA 1VQAA 2ZTDA 1Q1EA 4DV3L 1M90C 2ZJPA 4X6AH 1HH2P 2CWAA 2NVYH 4YWLA 3IRBA 4X62L 1TWAH 4B3ML 3GDEA 4OX9Q 1QVFA 5M5WH 3S24A 4C3IH 1L2FA 3HFZB 1PH2A 2JA7H 1VQ6A 1A8VA 4MTNA 3HOXH 2EIFA 1EFWA 2VL6A 3I4OA 2Y0SG 1OXVA 2OQ0A 3OYYA 1QZGA 4A93H 4GOPA 1CKMA 2MFIA 1VQMA 4R4CA 4R4QA 2JA9A 3GTGH 3K0XA 1XMOL 1XJVA 1AE3A 2A1AA 4LF6Q 4DR7Q 1RL2A 2ATWA 4X64Q 3J81c 1E24A 2JJQA 5C4XG 2HIXA 1YEZA 4LFAQ 1HR0Q 2ZTEA 1YJWA 5C3EG 2VQFL 5IWAQ 2GN5A 4PZ8A 1I5FA 5M3MH 4L5QA 2EQSA 4JCVE 1YHBA 3A74A 5IYCH 1Q8KA 1U5KA 2HHHL 5IYBH 2YTYA 4UPAA 5M3FH 4JBMA 4B3RQ 2NN6I 1P8LA 4R4OA 2L15A 5IP9G 4UY8C 3TRZA 1E22A 3HKZE 3HOWH 3CF5A 5FJ8G 3MXNB 3J81i 4A3MH 5IP7G 2RHSB 2VZAA 3W1BA 4J15A 4DR3Q 2N78A 1IYJB 4GN4B 3G71A 1YITA 4LF5L 5C44H 4GN5A 2NZOA 3JAMc 1MJCA 1Q81C 3DM3A 5GAGC 2ZM6L 4JI1Q 1KD1C 1VQJA 4JI0L 4QQBX 2N3SA 2E2HH 4O2DA 3F8TA 1LM0A 4YCVA 4JI8Q 3RZDH 3T1HL 3AFPA 4EX5A 4A3EH 3AFQA 2JA8H 3HOYG 3S1MH 1VQ8A 2UXCQ 3HOUH 1JJ2A 3PUWA 4FDBA 4LF4Q 3KFUA 1UE7A 5LMNL 3PSIA 2R7FA 4KI0A 1KL9A 4PMWA 4DV5L 4P71A 1LYLA 2LXJA 1IXRA 3BJUA 1WCMG 4P74A 1D7QA 3HOVG 3UDFA 4DV6L 3JAMi 4IPGA 1E1TA 3CMEA 5ELNA 1J6QA 2VQEQ 3CCQA 4C3JH 3ULJA 3GTMH 1B7YB 1XMQQ 4LFCQ 3SGIA 3UE1A 4BXXH 3KJPA 4B3SL 1IZ6A 4A3KG 1YHAA 3PO3H 2ASBA 1PFSA 4O0AA 4NB3A 1W3SA 2UUBQ 1N36L 2V1CC 4X65Q 4LW1A 2OTJA 1TWHH 4A3IG 2OCEA 4BBRH 4DR1Q 4HIKA 1IBLL 3GTKH 1LTLA 1DGSA 4QGUA 4GKJL 1ASYA 5JEAG 4P72A 1MJEA 4LF8L 1KXLA 4HJ9A 1X65A 4JYAL 1X54A 3M4PA 3BZCA 3FKIG 4TQUS 2UU9L 1EIYB 3TS2A 2KENA 3RN2A 3UDGA 3F2DA 1J5EL 4IFDI 4MNOA 2WAQE 3CCSA 2UXDQ 4AIMA 3GTPH 5BR8Q 5IYDG 5EAYA 3A5UA 2UXBQ 2D62A 2IX0A 5H1SE 4DV7L 4DR5L 1Q86C 2UUCL 3MEFA 2R92H 2WP8J 1VQHA 4GLXA 1N34Q 4DR4L 4JV5L 1SRUA 3NBHB 1IBMQ 1K3RA 1SLJA 2F52A 4A3GG 3CP0A 3CD6A 1VCIA 4DV1L 4JI6Q 4ME3A 1N9WA 4X66L 1V1QA 4XTCS 3KJOA 1PH8A 2AWNA 2I5HA 3RN5A 3K80C 1X3GA 2Z0SA 4JC0A 1O7IA 4PG3A 4LFBL 4KHPL 4IOCA 5C4JH 5LMUL 4JI3L 4DV3Q 4HIDA 2BH2A 2R93G 2QGQA 3RR5A 5IY0A 4X62Q 4B3MQ 4GLVB 1ASZA 4WJ4A 3KF6A 1I6HH 4POFA 3PUVA 1AH9A 5JJKA 2NVQH 1UWVA 1OXUA 3STBD 3D0FA 1PH3A 1BBWA 1SMXA 4TVAB 3K7AH 1YBYA 1VQCA 4JI5L 4A3CG 3W1GA 3KOJA 5C4XH 3PO2G 1IL2A 4JI2L 1XMOQ 2N49A 5C3EH 1JMCA 2MQHA 4MZ9A 4RG1A 4GKKL 2F3IA 2NN6G 4P75A 2JK8A 3ERSX 4JI7L 2VQFQ 1A0IA 4DV2Q 3RZOH 4Y7NH 5IP9H 2E2JH 1K8GA 5FJ8H 1FVIA 3U50C 1GKHA 5IP7H 4YY3L 2HHHQ 1QVCA 2AKWB 1UE1A 3KF8B 1XNRQ 4IPHA 1S3OA 3I55A 1V9PA 4BBSH 1VQIA 2KHJA 5AJ3Q 5M5XH 3CAMA 3ULLA 3S15H 3ULPA 1HNWL 1OXXK 1YVCA 1I94Q 1NJIC 3HOYH 4LF5Q 1G291 3L7ZC 1D8LA 1HZCA 4JI0Q 3HKZG 1YIJA 1U0LA 4JOIA 4QY7A 1XMQL 3T1HQ 1A62A 1L1OA 3M4QA 4DR6L 1WCMH 1PYBA 4DR2L 1WI5A 1XPRA 2CQOA 5HGQA 4IJHA 3HOVH 1RIPA 1KRTA 3I4NG 3CQZH 2IX1A 5C0XI 1BBUA 4DV5Q 1VQLA 4DUYL 2ZJRA 4BY1G 2KCMA 1IBKQ 1HR0W 2MO0A 3PUYA 4HJAA 2MO1A 2I5LX 3KF6B 1YHQA 4JBKA 3M4OH 4DV6Q 3S1RH 1VQKA 2E8GA 3K7UC 5JJIA 2YTVA 2OTLA 3NENA 4JBWA 4PZ7A 1E1OA 3I56A 4A3KH 2PQAA 1PH9A 2GVBA 2EXDA 1CKNA 4A3IH 2GVAA 4DAMA 3UDXA 4K0KL 3GTJH 5GAEC 4B3SQ 3GTLH 2Q2UA 3F2CA 1N36Q 4BY7G 1E7ZA 3WWVA 4PZ6A 4DV0Q 3RLFA 4LF9Q 3FKIH 1PH6A 2B63G 2K5HA 4A3LG 3B6YA 2NZHA 1TWGH 2YV5A 2YYZA 2JA6G 2AMCB 2CKZB 2Z6KA 3J80c 4GKJQ 2YTXA 5C0XJ 4A76A 4LF8Q 3L0OA 3RNUA 1LUZA 2UU9Q 1EIFA 2DGYA 2AHOB 3PIPA 5IYDH 1KC8C 3HOZG 3I7FA 1E3PA 1J5EQ 3UE0A 1X56A 4X64L 4GOPB 4P73A 3S2DH 1EUJA 4GLAC 1PV4A 3S2HH 4HJ8A 3GTQH 1Z9FA 4GNXA 1SROA 2XTIA 4DR5Q 3E9IA 3J80i 4A3GH 2UUCQ 4RMFA 3OW2A 2WAQG 3CCLA 2A8VA 3F1ZA 1L1OB 1CUKA 4DR4Q 4JV5Q 1JT8A 4B3RL 1OXSC 3J7ZC 4HJ7A 4HJ5A 4LF7L 1XPOA 4DV4Q 4A3FG 4ALPA 3Q8DA 4BBSG 1C9OA 4GOPC 2JEBI 1EOVA 2K50A 4X66Q 4YHHL 4A3JG 4A3BG 2R93H 1XPUA 4QL5A 1N33Q 1GVPA 4IO9A 2FXQA 3I2ZA 1MKHA 1JB7A 2LXKA 5LMUQ 4JI3Q 4JBJA 4JI8L 2JE6I 4QIWE 3CCRA 1N8RC 3E9HA 3FHWA 4JOIC 2PQAB 2UXCL 4A3CH 1VQDA 2E5LL 4LF4L 1CKNB 4EQ5A 1QVGA 3PO2H 1PYSB 1TXYA 2K75A 4NXML 4OWXB 4AYBE 4LUOA 4DUZL 1N32L 1WOCA 1K0RA 4JI5Q 1EQQA 1PVOA 4H02A 4JI2Q 2VQEL 3VDYA 4NXNL 1T9HA 4GKKQ 1KAWA 3A5ZB 3EIVA 3S16H 5IE8A 5DLQE 3M7NA 1VQ7A 1UE6A 4KHZA 1EQRA 1YNXA 3AYHB 2R7DA 3F2BA 3ER0A 3CPFA 1HJPA 4IFDJ 4UP7A 1WJJA 2R6GA 1PH7A 1FJGL 5FLMG 2UUBL 2PI2A 4OWTB 1X3FA 4X65L 3EBEA 3U58A 1L0WA 5ELOA 1UE5A 1S72A 1C7YA 1TWFH 2A19A 4YWMA 4GNXB 1H95A 4HIOA 1SE8A 1B70B 1BVSA 3I4MG 4POGA 4AH6A 2WB1E 3PIOA 1HNWQ 2PI2E 1SFOH 3M3YH 3GD7A 2CCZA 1X6OA 3G4SA 5JJLA 1XNRL 3I4NH 3H3VH 3PUZA 2QA4A 1K73C 3BZKA 1NMFA 2H5XA 2ID0A 4BY1H 4BA2I 1XTDA 5FLXc 3PF5A 4KLKA 2RHQB 4NPSA 4DUYQ 4GS3A 1I50H 1VQEA 3CPWA 2XGTA 1SN8A 2D0OA 2ES2A 1Z47A 2LSSA 5IT9c 3CCVA 1X9NA 4B3TL 1CSQA 4LWCA 3H15A 2F4VL 3OTOL 1YJNA 3ICEA 4LUVA 1JJGA 1PHJA 1QUQA 1EWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ L;  2ZM6 Q;  1KQS A;  4BY7 H;  4AQY L;  1K8A C;  2B63 H;  2R7Z G;  4K0K Q;  1FL0 A;  3TEH B;  4A3L H;  1GO3 E;  3S14 H;  1XNQ L;  1Y1V G;  2JA6 H;  5K36 G;  2UUA L;  1OXT A;  1OTC A;  3CMA A;  1P16 A;  4L5R C;  3T1Y L;  5JEA J;  1HNX L;  2VUM G;  5LMN Q;  4A3D G;  1HZB A;  1GD7 A;  1VQ4 A;  4OWW B;  3HOZ H;  1NY4 A;  3BU2 A;  3PCO B;  2HIV A;  3EN2 A;  3PUX A;  4DNI A;  5E7N A;  2C35 B;  3CC7 A;  3RLO A;  1YI2 A;  3DLL A;  1G51 A;  1SR3 A;  2RCN A;  5LMN W;  2BA1 A;  3S1Q H;  4DK6 C;  4IPC A;  3W5O A;  1PH5 A;  3U4V A;  1VQO A;  1Q12 A;  1C0A A;  4JI4 L;  4LNQ A;  2K5V A;  2KHI A;  3AEV A;  1TWC H;  2K14 A;  2VS1 A;  2Q2T A;  4DV2 L;  3M9B A;  4UP8 A;  3CCM A;  2K52 A;  3PF4 A;  2Y0S E;  3TRE A;  4A3F H;  1S40 A;  4OX9 L;  1VQN A;  4YCW A;  1UEB A;  2AWO A;  4IFD G;  3H0G H;  4A3J H;  4YCU A;  1NMG A;  1IBL Q;  4A3B H;  2DUD A;  1NBW A;  1AE2 A;  3NEM A;  1GM5 A;  4LF7 Q;  3K81 C;  3KDF A;  2OQK A;  5AJ3 L;  2E2I H;  4JYA Q;  1K9M C;  2JA7 G;  5HY6 A;  2BA0 A;  4OON A;  4DKA C;  4YHH Q;  1I94 L;  2BH8 A;  4R4I A;  1A63 A;  2I5M X;  2IT1 A;  3HOX G;  4LF6 L;  3U4Z A;  4DR7 L;  1VQB A;  4GN3 B;  4A93 G;  3CW2 C;  1W2B A;  4LFA L;  2VNU D;  1HR0 L;  3CXC A;  4YWK A;  2B3G A;  5IWA L;  1QUQ B;  4WJ3 M;  4DV7 Q;  3KLW A;  1JJC B;  2E5L Q;  4A75 A;  4NXM Q;  3G6E A;  3E0E A;  4DUZ Q;  3UDI A;  4APV A;  4IJL A;  1IBK L;  3S1N H;  1N32 Q;  1VQG A;  5M3M G;  1I3Q H;  1VQF A;  3PV0 A;  2K4K A;  1Y14 B;  1FGU A;  3GO5 A;  1NE3 A;  4DAY B;  5IYC G;  4DV1 Q;  3CCU A;  3S17 H;  5IYB G;  4DR3 L;  1YZ6 A;  3H0G G;  4AYB G;  5M3F G;  2HQL A;  4NXN Q;  4L5S A;  3H3V I;  2PMZ E;  5FLM H;  5GRO A;  2JA5 H;  2NVT H;  2IY5 B;  4JI1 L;  4LFB Q;  1VQ5 A;  5GAH C;  1CKO A;  3HOW G;  4KHP Q;  1YJ9 A;  2ZJQ A;  2CWP A;  4A3M G;  1B8A A;  3KYH C;  4L5T A;  5C44 G;  1FJG Q;  1L1O C;  1VQP A;  3I4M H;  4DV0 L;  5J3B A;  4LF9 L;  3NEL A;  1Q82 C;  4UP9 A;  2IHF A;  1PH1 A;  2WFW A;  2Q2I A;  3CCJ A;  1VS0 A;  3J7A 5;  2YU9 H;  2JA8 G;  4A3E G;  5GAD C;  4Y52 H;  2QEX A;  3HOU G;  1KHI A;  1M1K C;  1CSP A;  1Q1B A;  4C2M H;  2I0Q A;  2KCT A;  4DPG A;  5GQO A;  1K83 H;  1HZA A;  3J81 j;  3CCE A;  1Q46 A;  3KDF B;  2CFM A;  3JC6 6;  4LFC L;  4R1J A;  4A4I A;  3PGZ A;  3K8A A;  3ZJY C;  4BA1 I;  4DK3 C;  4LUZ A;  2WB1 G;  2ALY B;  4HIM A;  1PH4 A;  1EYG A;  4JI7 Q;  1KRS A;  2VY3 A;  4IPD A;  4JG2 A;  3TQY A;  2JA5 G;  1JE5 A;  2K5N A;  3RLN A;  4YY3 Q;  4BXX G;  1MIU A;  1X55 A;  3G48 A;  4DR1 L;  2JEA I;  3PO3 G;  4OO1 I;  4OXP A;  4DV4 L;  2Z6K C;  1Y1W H;  2R7Z H;  4B3T Q;  4XIG S;  4BBR G;  1Y1V H;  2ZTC A;  3OTO Q;  1KIX A;  2F4V Q;  2PNH A;  1WFQ A;  4R4T A;  5C0X G;  1N33 L;  4C3H H;  1HNZ Q;  4IOA A;  2Q2H A;  1QZH A;  4AQY Q;  2VW9 A;  1WYD A;  2VUM H;  3GTO H;  4A3D H;  2MNA A;  2UXD L;  1Q7Y C;  1NTG A;  2N8N A;  5BR8 L;  2NVX H;  1XNQ Q;  4DR6 Q;  2UUA Q;  2IHE A;  3M85 A;  4DR2 Q;  2UXB L;  2JQO A;  3T1Y Q;  1HNX Q;  1VQ9 A;  4GNX C;  3CC2 A;  1V43 A;  3A0J A;  3D31 A;  1PA6 A;  3TS0 A;  2RF4 A;  5M5Y H;  1N34 L;  3L2P A;  1HZ9 A;  3LGJ A;  1IBM L;  2D0P A;  1R9T H;  3HKS A;  1X3E A;  4QJF A;  2R92 G;  4JI6 L;  2HT1 A;  3CC4 A;  2KBN A;  3STB C;  4OO1 G;  3FP9 A;  1G6P A;  2OWO A;  3AQQ A;  1Y1W G;  2B29 A;  4JI4 Q;  1BKB A;  1VQA A;  2ZTD A;  1Q1E A;  4DV3 L;  1M90 C;  2ZJP A;  4X6A H;  1HH2 P;  2CWA A;  2NVY H;  4YWL A;  3IRB A;  4X62 L;  1TWA H;  4B3M L;  3GDE A;  4OX9 Q;  1QVF A;  5M5W H;  3S24 A;  4C3I H;  1L2F A;  3HFZ B;  1PH2 A;  2JA7 H;  1VQ6 A;  1A8V A;  4MTN A;  3HOX H;  2EIF A;  1EFW A;  2VL6 A;  3I4O A;  2Y0S G;  1OXV A;  2OQ0 A;  3OYY A;  1QZG A;  4A93 H;  4GOP A;  1CKM A;  2MFI A;  1VQM A;  4R4C A;  4R4Q A;  2JA9 A;  3GTG H;  3K0X A;  1XMO L;  1XJV A;  1AE3 A;  2A1A A;  4LF6 Q;  4DR7 Q;  1RL2 A;  2ATW A;  4X64 Q;  3J81 c;  1E24 A;  2JJQ A;  5C4X G;  2HIX A;  1YEZ A;  4LFA Q;  1HR0 Q;  2ZTE A;  1YJW A;  5C3E G;  2VQF L;  5IWA Q;  2GN5 A;  4PZ8 A;  1I5F A;  5M3M H;  4L5Q A;  2EQS A;  4JCV E;  1YHB A;  3A74 A;  5IYC H;  1Q8K A;  1U5K A;  2HHH L;  5IYB H;  2YTY A;  4UPA A;  5M3F H;  4JBM A;  4B3R Q;  2NN6 I;  1P8L A;  4R4O A;  2L15 A;  5IP9 G;  4UY8 C;  3TRZ A;  1E22 A;  3HKZ E;  3HOW H;  3CF5 A;  5FJ8 G;  3MXN B;  3J81 i;  4A3M H;  5IP7 G;  2RHS B;  2VZA A;  3W1B A;  4J15 A;  4DR3 Q;  2N78 A;  1IYJ B;  4GN4 B;  3G71 A;  1YIT A;  4LF5 L;  5C44 H;  4GN5 A;  2NZO A;  3JAM c;  1MJC A;  1Q81 C;  3DM3 A;  5GAG C;  2ZM6 L;  4JI1 Q;  1KD1 C;  1VQJ A;  4JI0 L;  4QQB X;  2N3S A;  2E2H H;  4O2D A;  3F8T A;  1LM0 A;  4YCV A;  4JI8 Q;  3RZD H;  3T1H L;  3AFP A;  4EX5 A;  4A3E H;  3AFQ A;  2JA8 H;  3HOY G;  3S1M H;  1VQ8 A;  2UXC Q;  3HOU H;  1JJ2 A;  3PUW A;  4FDB A;  4LF4 Q;  3KFU A;  1UE7 A;  5LMN L;  3PSI A;  2R7F A;  4KI0 A;  1KL9 A;  4PMW A;  4DV5 L;  4P71 A;  1LYL A;  2LXJ A;  1IXR A;  3BJU A;  1WCM G;  4P74 A;  1D7Q A;  3HOV G;  3UDF A;  4DV6 L;  3JAM i;  4IPG A;  1E1T A;  3CME A;  5ELN A;  1J6Q A;  2VQE Q;  3CCQ A;  4C3J H;  3ULJ A;  3GTM H;  1B7Y B;  1XMQ Q;  4LFC Q;  3SGI A;  3UE1 A;  4BXX H;  3KJP A;  4B3S L;  1IZ6 A;  4A3K G;  1YHA A;  3PO3 H;  2ASB A;  1PFS A;  4O0A A;  4NB3 A;  1W3S A;  2UUB Q;  1N36 L;  2V1C C;  4X65 Q;  4LW1 A;  2OTJ A;  1TWH H;  4A3I G;  2OCE A;  4BBR H;  4DR1 Q;  4HIK A;  1IBL L;  3GTK H;  1LTL A;  1DGS A;  4QGU A;  4GKJ L;  1ASY A;  5JEA G;  4P72 A;  1MJE A;  4LF8 L;  1KXL A;  4HJ9 A;  1X65 A;  4JYA L;  1X54 A;  3M4P A;  3BZC A;  3FKI G;  4TQU S;  2UU9 L;  1EIY B;  3TS2 A;  2KEN A;  3RN2 A;  3UDG A;  3F2D A;  1J5E L;  4IFD I;  4MNO A;  2WAQ E;  3CCS A;  2UXD Q;  4AIM A;  3GTP H;  5BR8 Q;  5IYD G;  5EAY A;  3A5U A;  2UXB Q;  2D62 A;  2IX0 A;  5H1S E;  4DV7 L;  4DR5 L;  1Q86 C;  2UUC L;  3MEF A;  2R92 H;  2WP8 J;  1VQH A;  4GLX A;  1N34 Q;  4DR4 L;  4JV5 L;  1SRU A;  3NBH B;  1IBM Q;  1K3R A;  1SLJ A;  2F52 A;  4A3G G;  3CP0 A;  3CD6 A;  1VCI A;  4DV1 L;  4JI6 Q;  4ME3 A;  1N9W A;  4X66 L;  1V1Q A;  4XTC S;  3KJO A;  1PH8 A;  2AWN A;  2I5H A;  3RN5 A;  3K80 C;  1X3G A;  2Z0S A;  4JC0 A;  1O7I A;  4PG3 A;  4LFB L;  4KHP L;  4IOC A;  5C4J H;  5LMU L;  4JI3 L;  4DV3 Q;  4HID A;  2BH2 A;  2R93 G;  2QGQ A;  3RR5 A;  5IY0 A;  4X62 Q;  4B3M Q;  4GLV B;  1ASZ A;  4WJ4 A;  3KF6 A;  1I6H H;  4POF A;  3PUV A;  1AH9 A;  5JJK A;  2NVQ H;  1UWV A;  1OXU A;  3STB D;  3D0F A;  1PH3 A;  1BBW A;  1SMX A;  4TVA B;  3K7A H;  1YBY A;  1VQC A;  4JI5 L;  4A3C G;  3W1G A;  3KOJ A;  5C4X H;  3PO2 G;  1IL2 A;  4JI2 L;  1XMO Q;  2N49 A;  5C3E H;  1JMC A;  2MQH A;  4MZ9 A;  4RG1 A;  4GKK L;  2F3I A;  2NN6 G;  4P75 A;  2JK8 A;  3ERS X;  4JI7 L;  2VQF Q;  1A0I A;  4DV2 Q;  3RZO H;  4Y7N H;  5IP9 H;  2E2J H;  1K8G A;  5FJ8 H;  1FVI A;  3U50 C;  1GKH A;  5IP7 H;  4YY3 L;  2HHH Q;  1QVC A;  2AKW B;  1UE1 A;  3KF8 B;  1XNR Q;  4IPH A;  1S3O A;  3I55 A;  1V9P A;  4BBS H;  1VQI A;  2KHJ A;  5AJ3 Q;  5M5X H;  3CAM A;  3ULL A;  3S15 H;  3ULP A;  1HNW L;  1OXX K;  1YVC A;  1I94 Q;  1NJI C;  3HOY H;  4LF5 Q;  1G29 1;  3L7Z C;  1D8L A;  1HZC A;  4JI0 Q;  3HKZ G;  1YIJ A;  1U0L A;  4JOI A;  4QY7 A;  1XMQ L;  3T1H Q;  1A62 A;  1L1O A;  3M4Q A;  4DR6 L;  1WCM H;  1PYB A;  4DR2 L;  1WI5 A;  1XPR A;  2CQO A;  5HGQ A;  4IJH A;  3HOV H;  1RIP A;  1KRT A;  3I4N G;  3CQZ H;  2IX1 A;  5C0X I;  1BBU A;  4DV5 Q;  1VQL A;  4DUY L;  2ZJR A;  4BY1 G;  2KCM A;  1IBK Q;  1HR0 W;  2MO0 A;  3PUY A;  4HJA A;  2MO1 A;  2I5L X;  3KF6 B;  1YHQ A;  4JBK A;  3M4O H;  4DV6 Q;  3S1R H;  1VQK A;  2E8G A;  3K7U C;  5JJI A;  2YTV A;  2OTL A;  3NEN A;  4JBW A;  4PZ7 A;  1E1O A;  3I56 A;  4A3K H;  2PQA A;  1PH9 A;  2GVB A;  2EXD A;  1CKN A;  4A3I H;  2GVA A;  4DAM A;  3UDX A;  4K0K L;  3GTJ H;  5GAE C;  4B3S Q;  3GTL H;  2Q2U A;  3F2C A;  1N36 Q;  4BY7 G;  1E7Z A;  3WWV A;  4PZ6 A;  4DV0 Q;  3RLF A;  4LF9 Q;  3FKI H;  1PH6 A;  2B63 G;  2K5H A;  4A3L G;  3B6Y A;  2NZH A;  1TWG H;  2YV5 A;  2YYZ A;  2JA6 G;  2AMC B;  2CKZ B;  2Z6K A;  3J80 c;  4GKJ Q;  2YTX A;  5C0X J;  4A76 A;  4LF8 Q;  3L0O A;  3RNU A;  1LUZ A;  2UU9 Q;  1EIF A;  2DGY A;  2AHO B;  3PIP A;  5IYD H;  1KC8 C;  3HOZ G;  3I7F A;  1E3P A;  1J5E Q;  3UE0 A;  1X56 A;  4X64 L;  4GOP B;  4P73 A;  3S2D H;  1EUJ A;  4GLA C;  1PV4 A;  3S2H H;  4HJ8 A;  3GTQ H;  1Z9F A;  4GNX A;  1SRO A;  2XTI A;  4DR5 Q;  3E9I A;  3J80 i;  4A3G H;  2UUC Q;  4RMF A;  3OW2 A;  2WAQ G;  3CCL A;  2A8V A;  3F1Z A;  1L1O B;  1CUK A;  4DR4 Q;  4JV5 Q;  1JT8 A;  4B3R L;  1OXS C;  3J7Z C;  4HJ7 A;  4HJ5 A;  4LF7 L;  1XPO A;  4DV4 Q;  4A3F G;  4ALP A;  3Q8D A;  4BBS G;  1C9O A;  4GOP C;  2JEB I;  1EOV A;  2K50 A;  4X66 Q;  4YHH L;  4A3J G;  4A3B G;  2R93 H;  1XPU A;  4QL5 A;  1N33 Q;  1GVP A;  4IO9 A;  2FXQ A;  3I2Z A;  1MKH A;  1JB7 A;  2LXK A;  5LMU Q;  4JI3 Q;  4JBJ A;  4JI8 L;  2JE6 I;  4QIW E;  3CCR A;  1N8R C;  3E9H A;  3FHW A;  4JOI C;  2PQA B;  2UXC L;  4A3C H;  1VQD A;  2E5L L;  4LF4 L;  1CKN B;  4EQ5 A;  1QVG A;  3PO2 H;  1PYS B;  1TXY A;  2K75 A;  4NXM L;  4OWX B;  4AYB E;  4LUO A;  4DUZ L;  1N32 L;  1WOC A;  1K0R A;  4JI5 Q;  1EQQ A;  1PVO A;  4H02 A;  4JI2 Q;  2VQE L;  3VDY A;  4NXN L;  1T9H A;  4GKK Q;  1KAW A;  3A5Z B;  3EIV A;  3S16 H;  5IE8 A;  5DLQ E;  3M7N A;  1VQ7 A;  1UE6 A;  4KHZ A;  1EQR A;  1YNX A;  3AYH B;  2R7D A;  3F2B A;  3ER0 A;  3CPF A;  1HJP A;  4IFD J;  4UP7 A;  1WJJ A;  2R6G A;  1PH7 A;  1FJG L;  5FLM G;  2UUB L;  2PI2 A;  4OWT B;  1X3F A;  4X65 L;  3EBE A;  3U58 A;  1L0W A;  5ELO A;  1UE5 A;  1S72 A;  1C7Y A;  1TWF H;  2A19 A;  4YWM A;  4GNX B;  1H95 A;  4HIO A;  1SE8 A;  1B70 B;  1BVS A;  3I4M G;  4POG A;  4AH6 A;  2WB1 E;  3PIO A;  1HNW Q;  2PI2 E;  1SFO H;  3M3Y H;  3GD7 A;  2CCZ A;  1X6O A;  3G4S A;  5JJL A;  1XNR L;  3I4N H;  3H3V H;  3PUZ A;  2QA4 A;  1K73 C;  3BZK A;  1NMF A;  2H5X A;  2ID0 A;  4BY1 H;  4BA2 I;  1XTD A;  5FLX c;  3PF5 A;  4KLK A;  2RHQ B;  4NPS A;  4DUY Q;  4GS3 A;  1I50 H;  1VQE A;  3CPW A;  2XGT A;  1SN8 A;  2D0O A;  2ES2 A;  1Z47 A;  2LSS A;  5IT9 c;  3CCV A;  1X9N A;  4B3T L;  1CSQ A;  4LWC A;  3H15 A;  2F4V L;  3OTO L;  1YJN A;  3ICE A;  4LUV A;  1JJG A;  1PHJ A;  1QUQ A;  1EWI A; 
#chains in the Genus database with same CATH topology
 1HNZ L;  1R4P B;  2ZM6 Q;  4EQO A;  4BY7 H;  3TP8 A;  1K8A C;  4WJW A;  3TEH B;  4K0K Q;  3KBG A;  1GO3 E;  1ILP A;  5M9O A;  2N88 A;  5DM6 3;  1V8Q A;  2NB0 A;  4A3D G;  4HAE A;  4OWW B;  5J22 A;  4HED A;  4DNI A;  1WVL A;  5E7N A;  3QG1 A;  2DNC A;  4IPC A;  1YNN D;  1PH5 A;  4UAI A;  3J80 E;  4LNQ A;  3AEV A;  4OEM B;  1JOO A;  1TWH B;  3OSO A;  3TRE A;  4A3F H;  4LMQ D;  4HCS A;  2L12 A;  2AWO A;  3EQL C;  1NMG A;  1NBW A;  1AE2 A;  2ZXP A;  3NEM A;  4O1N A;  1GM5 A;  4CKB A;  4LF7 Q;  4DKA C;  4YHH Q;  2I5M X;  1D5Z C;  4LF6 L;  1TY0 A;  2O5I C;  1VQB A;  3NHH A;  1W2B A;  2VNU D;  1JOK A;  4YWK A;  1SNP A;  2KVM A;  1QUQ B;  4WJ3 M;  4KK7 A;  4A75 A;  3BDC A;  3UDI A;  4IJL A;  1D6E C;  1I3Q H;  4KHV A;  5IYC G;  1ESF A;  5IYB G;  4DR3 L;  4AYB G;  2EYM A;  2PMZ E;  1PRT C;  3R8B A;  5FLM H;  2IY5 B;  4LFB Q;  5GAH C;  1ZYR C;  3KLR A;  3R3O A;  4DXG A;  3K58 A;  2HDL A;  2B8F A;  4WRD A;  5EKI A;  1L1O C;  2B2Y C;  1K28 A;  4LF9 L;  2EY1 A;  2IHF A;  5C4H A;  2Q2I A;  1B9N A;  2B2W C;  1EY4 A;  3HOU G;  1CSP A;  4C2M H;  2G5D A;  1WTO A;  3J81 j;  1Y8P B;  3KDF B;  4ID6 A;  1LT3 D;  1CQF A;  1QCB D;  4LFC L;  4BA1 I;  1XMQ L;  4Y7N B;  3A54 A;  2E2J B;  4HMI A;  2TMP A;  1UEA B;  2K5N A;  3RLN A;  4NMZ A;  4QMG A;  1DXM A;  2OEO A;  1CA5 A;  5M5X B;  4ULL A;  1EOT A;  2TSS A;  1G2T A;  1Y1W H;  2R7Z H;  3NWT A;  4B3T Q;  5EKK A;  2F4I A;  4BBR G;  1Y1V H;  1PMR A;  2PNH A;  5C0X G;  2KEC A;  1N33 L;  2Q2H A;  1QZH A;  3TZU A;  1PFM A;  2ICE C;  4NW2 A;  1HTL D;  2UXD L;  1Q7Y C;  5BR8 L;  3HOV B;  5D65 A;  5IT9 E;  1ONL A;  2UUA Q;  3ERQ A;  4DR2 Q;  1UUP A;  2JQO A;  3T1Y Q;  1VQ9 A;  3D31 A;  1PA6 A;  3LNN A;  2RF4 A;  5M5Y H;  3IAY A;  3L2P A;  4NKL A;  3Q24 A;  2D0P A;  1R9T H;  3HKS A;  2RKS A;  1GHK A;  4RCO A;  3STB C;  4FF2 A;  4FXK C;  3SE0 A;  3TN2 A;  1VMP A;  4JI4 Q;  3CU7 A;  1VQA A;  2ZTD A;  5EBD A;  5LL6 S;  2MPM A;  3CKI B;  3FKI B;  4YWL A;  1MHW C;  4OX9 Q;  1TWG B;  5M5W H;  1L2F A;  1TU2 B;  3HOX H;  3J81 L;  3I4O A;  2Y0S G;  1OXV A;  2F1M A;  3TBI B;  1QZG A;  3D6W A;  5KRU A;  1CKM A;  1F2L A;  3S2D B;  4DR7 Q;  1VF7 A;  4KD3 A;  2HIX A;  2EVB A;  2ZTE A;  4A3G B;  4UHV A;  1SNM A;  2AUJ D;  4F87 A;  4L5Q A;  3A74 A;  1Q8K A;  4R9W A;  2HHH L;  4B3R Q;  4G4K A;  1V1P A;  5IP9 G;  3HOW H;  3CF5 A;  2R93 B;  3MXN B;  2VZA A;  1BNZ A;  4LF5 L;  4K8I A;  5C44 H;  1KD1 C;  2NZO A;  1Q81 C;  4QQB X;  4JI1 Q;  1VQJ A;  4XXE A;  2N3S A;  1NUC A;  3F8T A;  4DAV A;  4YCV A;  3HOY G;  3AFQ A;  1VQ8 A;  4RGO S;  1TR5 A;  4LF4 Q;  3BDO A;  3PSI A;  1IKL A;  4KI0 A;  4RAU C;  3V05 A;  4I7Z C;  1PRT D;  1IXR A;  1WCM G;  3MZ5 A;  4P74 A;  1D7Q A;  4KKT A;  1ZYR D;  3UDF A;  4IN3 A;  3SK8 A;  1E1T A;  3S16 B;  2J7Z A;  4RH6 A;  3EJI A;  1B7Y B;  3K5O A;  3CHB D;  1ILQ A;  3KJP A;  4B3S L;  3HS0 C;  1E2Z A;  5EPJ A;  4A3K G;  4NB3 A;  2RDF A;  2V1C C;  1CFM A;  2OTJ A;  1TWH H;  4K8J A;  4HIK A;  4ZYS A;  1C48 A;  3I91 A;  1MJE A;  3HZX A;  4HJ9 A;  4JYA L;  3IFD A;  1I4H A;  5CR3 A;  4DGZ A;  1JIC A;  1EIY B;  2KHS A;  2KEN A;  1J5E L;  3MVV A;  2LY7 A;  1GUT A;  2J0T D;  4EGV A;  4MNO A;  1SE4 A;  1T5X D;  1S5C D;  5EAY A;  1SJE D;  1MI2 A;  2IX0 A;  3KF8 A;  4P2C B;  2AQ3 B;  1I50 B;  2K03 A;  2KQ3 A;  1TQO A;  1LT4 D;  4JW0 A;  1N34 Q;  3NBH B;  3VYS A;  3CP0 A;  3TP7 A;  1VCI A;  1LT5 D;  2R61 A;  4X66 L;  4XTC S;  3KJO A;  2VB2 X;  1B9M A;  3RN5 A;  3X3M A;  4JC0 A;  1W6J A;  2XSC A;  5LMU L;  2PO4 A;  5ELD A;  4C3I B;  1ASZ A;  1U4P A;  1WTV A;  1AH9 A;  3STB D;  1OXU A;  1PH3 A;  4V19 0;  3KOJ A;  1CZG A;  1H9M A;  4OIK A;  4DK1 A;  4Q5V A;  4MZ9 A;  1WD1 A;  4BWG B;  2NN6 G;  3ONA B;  1JOR A;  4JI7 L;  2VQF Q;  1EYD A;  2A6H C;  4FNF A;  4Y7N H;  1GOZ A;  1CM9 A;  3H0G B;  2E2J H;  4A3B B;  1FVI A;  3J81 E;  3MFG A;  2AKW B;  3VA5 A;  1EZ6 A;  5M5X H;  3NSW A;  5FOB B;  3HKZ G;  1YIJ A;  1A15 A;  1L1O A;  2B2Y A;  3MAQ A;  5KEE A;  3HOV H;  3S1N B;  5C0X I;  3JAM E;  1KNE A;  2B2W A;  1VQL A;  1DON A;  3DWP A;  1QOH A;  2ENB A;  2F0P A;  2F0O A;  2KCM A;  4BY1 G;  2NWG A;  5JOB A;  2L1B A;  2E8G A;  5D3I B;  2Q8I B;  2YTV A;  1EZ8 A;  2OTL A;  4PZ7 A;  4KD4 A;  2RBM A;  2EXD A;  4DAM A;  4K0K L;  4DFA A;  2D5D A;  5EBC A;  4XT1 B;  3I4M B;  3S9W A;  5JEA H;  4BY7 G;  1E7Z A;  3NQT A;  1PDQ A;  4PZ6 A;  3WWV A;  4LF9 Q;  3FKI H;  1PH6 A;  3B6Y A;  1TWG H;  1LTB D;  4XQQ A;  1K83 B;  2YTX A;  4A76 A;  5IOD A;  1GUO A;  4PMB A;  4KY7 A;  2AHO B;  4X64 L;  1X56 A;  4GOP B;  3S2D H;  1AZQ A;  5KNC A;  4U68 A;  2LFN A;  2KEE A;  1SRO A;  2L4N A;  3E9I A;  4A3G H;  2UUC Q;  2SOB A;  1AZP A;  4JV5 Q;  1KTK A;  2WKD A;  3J7Z C;  4LF7 L;  1SND A;  4A3F G;  1JOQ A;  1C9O A;  4C3H B;  4GOP C;  2K50 A;  4YHH L;  2R93 H;  1N33 Q;  3I2Z A;  5IGC A;  1JB7 A;  4JI3 Q;  4JBJ A;  4JI8 L;  2A6E C;  5I9P A;  1TKW B;  1TVX A;  3E9H A;  4JOI C;  2UXC L;  4A3C H;  1TXY A;  2EYH A;  3X3N A;  4CDE C;  5JVG 3;  1CQV A;  3DEP A;  1TT2 A;  2B2T C;  3ITP A;  4JI5 Q;  3D4W A;  1EQQ A;  3VYT A;  1I4R A;  4JI2 Q;  1SXT A;  2VQE L;  3VDY A;  1GUW A;  3NK9 A;  3S16 H;  1FGB D;  1CT1 D;  1PFB A;  3NP8 A;  5C5L A;  3BS1 A;  2NVY B;  1VQ7 A;  1UE6 A;  1QB5 D;  4KHZ A;  1YNX A;  2NYZ D;  3F2B A;  4UP7 A;  1WJJ A;  3T56 B;  5IGE A;  2JA7 B;  1C4Q A;  5FLM G;  2PI2 A;  3U58 A;  4KTA A;  3D4D A;  5ELO A;  1UE5 A;  1C7Y A;  4GNX B;  3WDN A;  5BN3 A;  4OEL B;  1JQY D;  2WB1 E;  1HFN A;  2A6H D;  1K8M A;  1S5D D;  4QIW B;  3H3V H;  5IGD A;  3BZK A;  5M3M B;  5FO7 B;  2H5X A;  1DZ1 A;  1A3T A;  5IIF A;  2F0K A;  2Z8L A;  3K5N A;  4FXD A;  1JWM D;  5M3F B;  3PF5 A;  2K6A A;  3P7J A;  1Y8N B;  5ELC A;  1I50 H;  1A2T A;  2D0O A;  4B3T L;  4GZY C;  3P1H A;  1MSH A;  3FDT A;  1K3B C;  3NXW A;  4JPB W;  1I4X A;  1PHJ A;  3N6R A;  3VA7 A;  2JA8 B;  4XQJ A;  5C6A A;  2R7Z G;  1FL0 A;  4A3L H;  2A5H A;  1Y1V G;  4ME5 A;  4RHR A;  2UUA L;  3CMA A;  1P16 A;  2H4O A;  3T1Y L;  5JEA J;  4IUR A;  1L0Y B;  1PYW D;  1FR3 A;  4DAY A;  1GD7 A;  1NY4 A;  1DD2 A;  2HIV A;  2L5T A;  4K5X A;  5G3L D;  4IQZ A;  3A7A B;  1S5F D;  1B2T A;  3DLL A;  4C3J B;  3H94 A;  1BR9 A;  4DK6 C;  5CV6 A;  2Z1C A;  1VQO A;  3PO3 B;  1C0A A;  1DOK A;  4JI4 L;  3VYU A;  2VS1 A;  2Q2T A;  4H13 C;  4OX9 L;  1VQN A;  2EJF C;  2L0C A;  4YCW A;  3H0G H;  4A3J H;  4YCU A;  1A2U A;  4A3B H;  2DUD A;  5ELF A;  3K81 C;  3J7A V;  4JYA Q;  1K9M C;  4X3U A;  3BVZ A;  1GUS A;  3HOX G;  2PQE A;  4DR7 L;  2XIW A;  3GTP B;  2EE1 A;  1SDF A;  1G2S A;  1O80 A;  2HCC A;  2MUY A;  4K5W A;  5EJW A;  3VR2 A;  1BCP C;  1EY0 A;  1VF5 C;  5EQ0 A;  3G6E A;  3S1N H;  1KLG D;  3D4R A;  1VQF A;  4FVM A;  2K4K A;  3EA6 A;  4IAL A;  1FGU A;  2A6E D;  1YZ6 A;  4F7X A;  5C4J B;  4WFN 3;  3IFT A;  1RDP D;  4JI1 L;  4XQN A;  3HOW G;  1SSO A;  5IGF A;  2CWP A;  3L3O C;  1I6H B;  3SK5 A;  3I73 A;  3OWF A;  2E2D C;  2E75 C;  2R3Z A;  5C44 G;  1FJG Q;  1EIG A;  3I4M H;  3K7A B;  3NEL A;  3CCJ A;  5C4X B;  3J7A 5;  3KLS X;  4Y52 H;  2JP1 A;  3Q0A A;  2I0Q A;  1FNU A;  1EU4 A;  1K83 H;  1XTC D;  1RTN A;  3CCE A;  1Q46 A;  2PZW A;  4XT3 B;  1U4L A;  4A4I A;  3RZO B;  4C56 C;  2ES2 A;  3K8A A;  4DK3 C;  3OW7 A;  4JI7 Q;  4B08 A;  4UDU C;  2K5W A;  2ZT9 C;  4OL7 A;  2JA5 G;  1ZXT A;  3HEJ A;  3PIP 3;  1DOL A;  1X55 A;  1ENF A;  2WV6 D;  3FPP A;  2RSO A;  2WIN B;  3QOL A;  4XYQ A;  1I6V C;  2Z6K C;  2PMZ B;  5FLX E;  5COR A;  2D9U A;  1SBB B;  2PCF B;  4V0B A;  2ZTC A;  3OTO Q;  4C3H H;  2K04 A;  4AQY Q;  4RCN A;  4ZKB B;  2MHV A;  2KJX A;  5E1F A;  2N8N A;  1DYQ A;  3RD4 A;  1TS5 A;  1NCV A;  3QIA A;  3TS0 A;  2B2U C;  2EYL A;  1N34 L;  2PZU A;  1GUN A;  2OF1 A;  4QJF A;  1X3E A;  2XRQ D;  4I65 A;  1STG A;  3NTK A;  3FP9 A;  1G6P A;  2EYJ A;  1ZKO A;  1BXT A;  3AQQ A;  3C1F A;  1BKB A;  3GTL B;  4IFD H;  1M90 C;  2NVY H;  3MXU A;  3IRB A;  1QVF A;  4ZLT F;  1HQR D;  1Q3L A;  4CGY B;  1PH2 A;  2JA7 H;  5C5M A;  1A8V A;  2VL6 A;  1EY6 A;  2OQ0 A;  4GOP A;  1VQM A;  4R4C A;  4R4Q A;  2JA9 A;  2H1E A;  5FO8 B;  2F0Q A;  2QDL A;  5A2Q L;  4X64 Q;  4FF4 A;  2NUC A;  1WTH A;  4LFA Q;  1YEZ A;  1HCZ A;  2DJG C;  2PZT A;  3TDQ A;  2VQF L;  3KBX A;  5M3M H;  2EQS A;  4XDX A;  4JCV E;  3PIO 3;  1U5K A;  2BDN A;  2B2T A;  4UPA A;  5M3F H;  2Z4I A;  4J8Q A;  4UY8 C;  1E22 A;  1QG7 A;  3NBI A;  3W1B A;  1MBY A;  3Q22 A;  3G71 A;  4E6I A;  1MJC A;  2F3W A;  4N8F A;  1BCP D;  1LM0 A;  4JI8 Q;  4ZUI A;  1Z7T A;  3PO2 B;  2JA8 H;  1GHJ A;  3MC0 B;  2UXC Q;  1J8I A;  1YNJ C;  1IKM A;  5LMN L;  1K8O A;  2R7F A;  5CBA E;  5COY A;  3BJU A;  4DN4 M;  2QF7 A;  3AU7 A;  3HOV G;  2ZXO A;  3OIQ A;  2VQE Q;  1J6Q A;  2M2L A;  3CCQ A;  1VDZ A;  4C3J H;  4RHS A;  1RKN A;  4H0L C;  1WTR A;  4BXX H;  2Q8R E;  3PO3 H;  1PFS A;  4O0A A;  4LW1 A;  4N9T A;  3IKJ A;  1IBL L;  1HXY D;  1F2Y A;  2OT2 A;  4P72 A;  5JEA G;  1ASY A;  1IYV A;  3M3Y B;  1KXL A;  3R2I A;  2SNS A;  1X54 A;  3FKI G;  1LV9 A;  4K5V A;  3TS2 A;  3NQI A;  2WAQ E;  3CCS A;  1XX8 A;  4AIM A;  3GTP H;  1F2M A;  3LWU A;  2D62 A;  1STN A;  1Y8O B;  5JPN C;  2UUC L;  4HTH A;  4JV5 L;  4OO1 H;  1IBM Q;  4A3G G;  2DY8 A;  3CRL C;  2B63 B;  3D6C A;  4QB4 A;  1PH8 A;  3DMU A;  1RCV D;  2I5H A;  3S14 B;  3DUZ A;  1X3G A;  4KHP L;  4IOC A;  5C4J H;  1HQM C;  4JI3 L;  3V96 A;  2BH2 A;  2R93 G;  3RR5 A;  3QOJ A;  3T13 A;  4X62 Q;  3KF6 A;  3HOZ B;  1I6H H;  3HG9 A;  1UWV A;  5DAU A;  1SMX A;  4RA8 A;  4ZCK A;  2X6G A;  3K7A H;  4LAA A;  1YBY A;  1VQC A;  4JI5 L;  4A3C G;  3S1Q B;  2XVS A;  5C4X H;  1IL2 A;  4JI2 L;  1XMO Q;  2N49 A;  4CJ0 B;  3ND8 A;  2F3I A;  1ZEQ X;  4KN7 C;  5FO9 B;  3MTS A;  4P75 A;  2JK8 A;  3ERS X;  3A7L A;  5D14 A;  4ZQ3 A;  3RZO H;  3DM1 A;  2KED A;  5FJ8 H;  4YY3 L;  3NTH A;  1UE1 A;  3BZD B;  3K57 A;  3GV6 A;  1STA A;  1WTW A;  3CAM A;  1IYU A;  3WOE A;  4OHJ A;  5J1Z A;  5A2Q E;  3W3A A;  2E2H B;  1G29 1;  3L7Z C;  5BN5 A;  5DEH A;  3I72 A;  5JJZ A;  4JI0 Q;  1U0L A;  4QY7 A;  3M4Q A;  1NNX A;  4XYO A;  1RTO A;  3E3X A;  1EL0 A;  1M8A A;  2O2L D;  4J1M A;  4IJH A;  2FMC A;  2I07 B;  3CRK C;  1BBU A;  4DV5 Q;  4JVZ A;  2HD3 A;  3SK4 A;  5CMD A;  3NUC A;  5EPL A;  2MO0 A;  2I5L X;  4DV6 Q;  1VQK A;  3K7U C;  1PZJ D;  1IW7 D;  1E2V A;  2JXM B;  1YNJ D;  1CKN A;  2F0S A;  3UDX A;  1AP0 A;  3GTL H;  1JWS D;  5KGU A;  2K01 A;  4A3L G;  5CV4 A;  2LKV A;  2NZH A;  2YYZ A;  2CKZ B;  2Z6K A;  2RCF A;  2I46 A;  3ERO A;  4DNT B;  3DHQ A;  1JE4 A;  2DGY A;  5IYD H;  1KC8 C;  1AEX A;  3I7F A;  1E3P A;  3AB9 A;  1BQQ T;  3H6M A;  5JAV A;  1LT6 D;  1PTO B;  3SXH A;  2B2U A;  1H9J A;  4X3S A;  3OW2 A;  3CCL A;  2A8V A;  1CUK A;  1F9R A;  3QWN A;  1IL8 A;  4DR4 Q;  2XRS D;  1B3A A;  3DWQ A;  3GQB A;  4HJ7 A;  4HJ5 A;  2D2C C;  3QR8 A;  3Q8D A;  1XXG A;  1B4O A;  3KLS A;  2EYO A;  2V4D A;  3A8K E;  4A3J G;  2VUM B;  4A3B G;  4QL5 A;  4IO9 A;  5HGT A;  2NVX B;  1NSN S;  1KAB A;  1MKH A;  4M8A A;  1FYC A;  1DCZ A;  5K5P A;  3K5L A;  1N8R C;  2PQA B;  3PQI A;  3VR4 A;  3P20 A;  1O7Z A;  5KIX A;  3PO2 H;  1QVG A;  3QJY A;  1EQV A;  4AYB E;  1K0R A;  2SEB D;  1PVO A;  3H3V C;  1BO0 A;  3K0Y A;  2A69 C;  2PYK A;  3QO2 A;  4GKK Q;  1KAW A;  2HQE A;  5DLQ E;  2K5D A;  2NBF A;  1TWA B;  3BVG A;  2R7D A;  3CPF A;  1FJG L;  4N8X 1;  4X65 L;  4WOR A;  1L0W A;  4A93 B;  4KKS A;  1I4Q A;  4YWM A;  1S72 A;  1HFG A;  3GTG B;  1B70 B;  1BVS A;  3I4M G;  4POG A;  4HSV A;  2PI2 E;  3KUP A;  1HNW Q;  1LTI D;  3M3Y H;  2CVR A;  5CC4 A;  1X3P A;  3G4S A;  5JJL A;  1S5E D;  3PUZ A;  2QA4 A;  1K73 C;  5E3F A;  1X32 A;  3L9A X;  3HRZ C;  2RHQ B;  3DWA A;  4GS3 A;  1VQE A;  4A3M B;  2Z9H A;  1WD0 A;  1X9N A;  4LWC A;  3OTO L;  3EFX D;  3ICE A;  5CV8 A;  1QUQ A;  3RZD B;  1EFI D;  5I2X A;  4AQY L;  4A3E B;  1GUG A;  3C46 A;  2B63 H;  5FK9 C;  3S14 H;  1TY2 A;  1OXT A;  1ROD A;  4OGQ C;  4C3H G;  4L5R C;  2F3V A;  4TSS A;  5LMN Q;  1HZB A;  3HOZ H;  4FF1 A;  3BU2 A;  2B39 A;  2WB1 B;  3EN2 A;  3PCO B;  3PUX A;  4RWS C;  3CC7 A;  2RCN A;  3I3C A;  3G7L A;  3GTM B;  4KV6 A;  2BA1 A;  5LMN W;  3S1Q H;  3SDZ A;  3M9B A;  4UP8 A;  3CCM A;  2K52 A;  2Y0S E;  1S40 A;  3GTK B;  1UAP A;  4IFD G;  1H9S B;  2SDF A;  1IBL Q;  1K0S A;  2F0N A;  3KDF A;  2OQK A;  4O42 A;  2JA7 G;  5HY6 A;  4OON A;  1I94 L;  4R4I A;  2IT1 A;  3CW2 C;  4PNY A;  4LFA L;  3FEW X;  2XNA C;  2R92 B;  1JJC B;  4QF4 A;  3TP6 A;  4APV A;  1N32 Q;  1G91 A;  1IBK L;  5M3M G;  3PV0 A;  1H9R A;  1Y14 B;  3GO5 A;  1NE3 A;  2F0H A;  4CJ1 B;  5KYI A;  4RGT A;  3CCU A;  2CQA A;  3C1E A;  5M3F G;  5IGB A;  2HQL A;  1LTA D;  4L5S A;  4NXN Q;  1ICF B;  2A73 B;  3H3V I;  3N52 A;  5GRO A;  1CKO A;  4KJO A;  4KHP Q;  2ZJQ A;  4K6L A;  1RJT A;  1BOS A;  1TII D;  2SNM A;  4L5T A;  2NVQ B;  1VQP A;  5J3B A;  2A69 D;  4ABN A;  2XN9 C;  2JA8 G;  2PW7 A;  5GAD C;  1PRT F;  2QEX A;  1KHI A;  5C3E B;  1M1K C;  4LJZ C;  5EPK A;  1HRJ A;  4R1J A;  3ZJY C;  4LUZ A;  1EYG A;  1KRS A;  2EY6 A;  3E6Z X;  4IPD A;  3TQY A;  4Z9C B;  4C3J G;  1JE5 A;  4ZRZ A;  4CKE A;  3AMU A;  4YY3 Q;  4BBS B;  1PTO H;  4BXX G;  1MIU A;  1XWE A;  3PO3 G;  2E74 C;  4OXP A;  4K2K A;  4IZ8 A;  2F4V Q;  5K36 H;  1WFQ A;  5CBE E;  4IOA A;  2VUM H;  2VW9 A;  5A35 A;  1KNA A;  1XNQ Q;  3EVQ A;  2NVX H;  1EWC A;  3TZD A;  4M1U B;  4H44 C;  1HNX Q;  4GNX C;  4F88 A;  1V43 A;  3A0J A;  3BG3 A;  4ZAI A;  3MXN A;  5CV5 A;  1SYG A;  3S1R B;  1HZ9 A;  1TS3 A;  4TRD A;  1IBM L;  2JSO A;  3OWE B;  3CC4 A;  2O5J C;  4OO1 G;  5ISR A;  4A3I B;  2QIL A;  3GTJ B;  5CV9 A;  1Y1W G;  4MHE A;  3I90 A;  2K33 A;  1PXU A;  2ZJP A;  1HH2 P;  3SVM A;  1EY9 A;  4X62 L;  1TWA H;  1CK1 A;  4X3T A;  4HMJ A;  4C3I H;  2XWJ B;  1IHZ A;  2M9V A;  3OYY A;  4A93 H;  5EKL A;  2FHT A;  3GTG H;  1XMO L;  1XJV A;  1CHQ D;  1RL2 A;  2ATW A;  3C3L A;  1PLF A;  1ESR A;  5C4X G;  3GTQ B;  1HR0 Q;  1YJW A;  1D5M C;  5IWA Q;  2GN5 A;  4PZ8 A;  1B50 A;  1HPC A;  1TS4 A;  1QIL A;  4RFB A;  4NDX A;  1QWY A;  2NN6 I;  1P8L A;  4KMU C;  3RUZ A;  3H91 A;  3HKZ E;  4G7Z C;  1O78 A;  5FJ8 G;  4A3M H;  2RHS B;  4DF7 A;  4J15 A;  2F0M A;  1IYJ B;  2RQX A;  3KK7 A;  1YIT A;  4CDD C;  1EEF D;  1NR2 A;  2KA7 A;  5GAG C;  4JI0 L;  4O2D A;  1SYF A;  3J80 L;  3RZD H;  3FVQ A;  3AFP A;  4A3E H;  3NBH A;  4K6D A;  2F0E A;  4DV5 L;  5E4X A;  1JWU D;  1C8C A;  1EY5 A;  4CKC A;  4DV6 L;  1LTG D;  1HTP A;  3CME A;  4BS9 A;  4KJN A;  3GTM H;  1AW7 A;  3SGI A;  1F9P A;  3UE1 A;  4MN3 A;  1KDA A;  2ASB A;  4ILW A;  1W3S A;  3NWS A;  4X65 Q;  4U67 3;  4TKO B;  1S4Z A;  4DR1 Q;  1LAB A;  3GTK H;  1DGS A;  1SFO B;  4IUV A;  2LMC B;  3BZC A;  2Z6B A;  5ELE A;  3I4N B;  1V1P B;  3RN2 A;  3UDG A;  4IFD I;  1RD9 D;  4B9W A;  2N55 A;  1I4G A;  1S5B D;  5IYD G;  5KNB A;  2UXB Q;  2AQ2 B;  5H1S E;  4DV7 L;  5I4D A;  4FP5 D;  1Q86 C;  3MEF A;  2R92 H;  2WP8 J;  1VQH A;  3A8I E;  4GLX A;  4DR4 L;  3A56 A;  1II3 A;  1MGS A;  1SLJ A;  2M00 A;  4DV1 L;  4JI6 Q;  1SYE A;  1V1Q A;  5NUC A;  2AWN A;  2BDO A;  2JA6 B;  2Z0S A;  4PG3 A;  1O7I A;  4DV3 Q;  1CZW A;  4CBV A;  4HID A;  3F2U A;  4B3M Q;  4WJ4 A;  2IW3 A;  3QB3 A;  4POF A;  3PUV A;  2Z4H A;  5JJK A;  1E0B A;  2NVQ H;  2C9O A;  2QW7 A;  4L8J A;  1JC7 A;  3HGB A;  2F03 A;  2WII B;  3T51 B;  3PO2 G;  3C2P A;  2CW0 C;  5C3E H;  1KAA A;  2MQH A;  1LTS D;  2WAQ B;  4RG1 A;  2EXZ A;  5LHY 1;  4GKK L;  1TWC B;  2K28 A;  4IUT A;  1SNQ A;  1A0I A;  1QJO A;  5IT9 L;  1Q8I A;  3A55 A;  1K8G A;  5IP7 H;  1XYI A;  3SK6 A;  2E2I B;  3HOW B;  3KF8 B;  2MJ8 A;  4IPH A;  1S3O A;  3I55 A;  4BBS H;  1EY7 A;  2KHJ A;  3ULL A;  2EPB A;  3ULP A;  2IX3 A;  1OXX K;  1VMC A;  1I94 Q;  1HNW L;  2EDG A;  1NJI C;  2P5Z X;  2VB3 X;  1O7Y A;  4G57 A;  1BUV T;  4JOI A;  4G7O C;  3T1H Q;  1A62 A;  4DR6 L;  1WI5 A;  2CQO A;  5HGQ A;  3I4L A;  3M4Y A;  1STH A;  4QCL A;  1IBK Q;  2A68 C;  3S17 B;  1YHQ A;  2F0J A;  3PUY A;  4HJA A;  4NP5 A;  4JBK A;  3S1R H;  1SMY C;  2JA5 B;  4LK1 C;  2NVT B;  3I56 A;  4KN4 C;  1PH9 A;  1ET6 A;  3I70 A;  4A3I H;  2GVA A;  3GTJ H;  1G6Z A;  1IW7 C;  1ML0 D;  3VYR A;  2Q2U A;  1N36 Q;  4IUQ A;  1ET9 A;  4OO1 I;  2JYO A;  2YU9 B;  2B63 G;  1D1K A;  2K5H A;  3LWE A;  2AMC B;  2NTS A;  3J80 c;  4GKJ Q;  1X3Q A;  4LF8 Q;  3VR6 A;  1D2B A;  5G3L F;  5CGK A;  3L0O A;  3RNU A;  2UU9 Q;  4PMC A;  3HOZ G;  5E4W C;  4P73 A;  4RGM A;  4JK1 C;  1PRT B;  1EUJ A;  4G7H C;  2IJ0 A;  1PV4 A;  4HJ8 A;  3GTQ H;  1Z9F A;  4GNX A;  4DR5 Q;  2F0T A;  2XTI A;  3J80 i;  4RMF A;  5AFW A;  4ZK9 B;  3F1Z A;  1L1O B;  1JT8 A;  2B2V C;  3MHB A;  1OXS C;  4DNR B;  1XPO A;  1B1Z A;  1FNW A;  1SNC A;  3D3R A;  3GTO B;  1EOV A;  1RF2 D;  2F0V A;  2QEJ C;  4A3D B;  1STB A;  4K2L A;  1MSG A;  2L9H A;  2FXQ A;  2LXK A;  2EYF A;  1RHP A;  2JE6 I;  5L37 A;  3FHW A;  1DJR D;  4EQ5 A;  4PV1 C;  5J39 A;  1N32 L;  5KYL A;  1H9K A;  1WTQ A;  4ODG A;  3MXG A;  2K5Q A;  4NXN L;  2FFK B;  5IE8 A;  3H09 A;  3AYH B;  2DY7 A;  4IFD J;  2A74 C;  1HJP A;  1F2Z A;  2UUB L;  4OWT B;  3EBE A;  2CW0 D;  4IUN A;  2IPK D;  2IWH A;  1H95 A;  2A19 A;  3Q23 A;  4AH6 A;  1SFO H;  1F9Q A;  2E76 C;  3MXP A;  4HSP A;  2CCZ A;  1X6O A;  2PNR C;  1NR4 A;  3I4N H;  2CH4 W;  2CH4 A;  1G8Z D;  3TSS A;  4F8M A;  2HUG A;  2EZV A;  1XTD A;  4AYB B;  1TS2 A;  5I6W A;  3NE5 B;  4DUY Q;  3OMC A;  3MFY A;  2WAC A;  2DN8 A;  1Z47 A;  5IT9 c;  4N9P A;  2J4X A;  3H15 A;  2F4V L;  4L63 B;  2XWB B;  2AQ1 B;  3DXJ C;  1PZI D;  1KQS A;  4MTK A;  3S1M B;  3P75 A;  1DOM A;  3HOU B;  1XNQ L;  2JA6 H;  5K36 G;  2A68 D;  2RVL A;  1A3U A;  2Q8T A;  1OTC A;  3R93 A;  4ZUJ A;  3J7Y W;  1SMY D;  2VUM G;  1HNX L;  1VQ4 A;  1EIH A;  1F9S A;  2C35 B;  2KOL A;  3RLO A;  1YI2 A;  1G51 A;  2RA4 A;  1SR3 A;  1D1I A;  3W5O A;  1PFN A;  2EJM A;  3U4V A;  1Q12 A;  5DM7 3;  2K5V A;  2KHI A;  4CHT B;  1TWC H;  2HCI A;  2K14 A;  5I9O A;  4DV2 L;  4CDC C;  1D5X C;  4DXF A;  3PF4 A;  1Q90 A;  4BBR B;  1U4M A;  1UEB A;  1E2W A;  3JAM L;  1KDB A;  4R8I A;  4DU9 A;  5AJ3 L;  5JPM C;  2E2I H;  4C3I G;  4X3K A;  1HUM A;  2BA0 A;  1U9R A;  2BH8 A;  1A63 A;  3R2T A;  3U4Z A;  4IUU A;  4GN3 B;  4A93 G;  2GA4 B;  1LAC A;  1EU3 A;  1CHP D;  2LS0 1;  1HR0 L;  3CXC A;  1SJH D;  2B3G A;  3E5S A;  5IWA L;  4DV7 Q;  2EY5 A;  3KLW A;  2E5L Q;  5IGG A;  3J7A F;  4NXM Q;  1OO9 B;  2G9D A;  3E0E A;  4DUZ Q;  4K14 A;  1UNS A;  1VQG A;  3ZYY X;  1LO5 D;  4DAY B;  4DV1 Q;  3BYT B;  3S17 H;  1T5E A;  3VR3 A;  3H0G G;  5LL6 X;  2FIN B;  2QDB A;  2JA5 H;  2NVT H;  1VQ5 A;  1YJ9 A;  1PTO C;  2Y0S B;  4A3M G;  1B8A A;  1DM0 B;  3KYH C;  1BCP F;  1HA6 A;  3T53 B;  4DA2 A;  1SE2 A;  4DV0 L;  1Q82 C;  4UP9 A;  1PH1 A;  2WFW A;  1VS0 A;  2YU9 H;  4A3E G;  4KKU A;  1Q1B A;  1QE6 A;  2KCT A;  2K1B A;  4DPG A;  5GQO A;  1HZA A;  2K05 A;  5I6Y A;  2CFM A;  3JC6 6;  3FRP B;  1BF4 A;  1XNR Q;  3PGZ A;  1PH4 A;  4HIM A;  2WB1 G;  2ALY B;  3Q6S A;  2VY3 A;  2EYP A;  4FO2 A;  4JG2 A;  2O4X A;  2K7V A;  3UI2 A;  4B9X A;  3G48 A;  4DR1 L;  2JEA I;  4DAP A;  3S15 B;  1MD2 D;  4DV4 L;  3HOY B;  2F0W A;  4XIG S;  1KIX A;  1EWH A;  4R4T A;  2KCN A;  5CV7 A;  1HNZ Q;  3GTO H;  1WYD A;  4A3D H;  1WCM B;  2MNA A;  5D3D A;  1I4P A;  1NTG A;  3TP5 A;  4DR6 Q;  2UXB L;  3CQZ B;  2IHE A;  3M85 A;  2L55 A;  1M4V A;  2C5C A;  3CC2 A;  1JCK B;  1Y69 U;  3M4O B;  3LGJ A;  2NZ1 D;  1PZK D;  2X69 A;  4A3K B;  2F0U A;  2R92 G;  2K32 A;  4JI6 L;  4FF3 A;  2HT1 A;  3K5M A;  2KBN A;  1LTT D;  1WTX A;  2OWO A;  2B29 A;  2CHB D;  4DV3 L;  1Q1E A;  4X6A H;  2WKC A;  2KCC A;  1CA6 A;  2CWA A;  4CJ2 C;  4A3J B;  4B3M L;  3GDE A;  3MEH A;  4KY6 A;  3S24 A;  3HFZ B;  2B2V A;  1STE A;  1V1O A;  3IL8 A;  1VQ6 A;  4MTN A;  2DJF C;  4HR7 B;  2EIF A;  1EFW A;  1LLR D;  2MFI A;  2EY2 A;  5JVH 3;  2FJ2 A;  3K0X A;  2F0I A;  1AE3 A;  2A1A A;  4LF6 Q;  2F0F A;  1EQT A;  3J81 c;  1E24 A;  3DEO A;  2JJQ A;  4RGN A;  3S2H B;  3RMH A;  5DNF A;  5C3E G;  1I5F A;  2NTT A;  1YHB A;  5IYC H;  5IYB H;  2YTY A;  4JBM A;  5CYU A;  4R4O A;  2L15 A;  3TRZ A;  1EY8 A;  3J81 i;  5BN4 A;  5IP7 G;  1J9O A;  4DR3 Q;  2N78 A;  4GN4 B;  4GN5 A;  3GV3 A;  3JAM c;  4BBS G;  1SYC A;  3DM3 A;  2ZM6 L;  2E2H H;  2BE5 C;  3T1H L;  1SYB A;  3S1M H;  4EX5 A;  4I7A A;  4H7B A;  4RKL A;  3HOU H;  1JJ2 A;  3PUW A;  4FDB A;  2QCP X;  3KFU A;  1UE7 A;  1GJX A;  3OPO A;  1KL9 A;  4PMW A;  4P71 A;  1LYL A;  2LXJ A;  3LX0 A;  2F0G A;  2L11 A;  1PTO D;  3JAM i;  4IPG A;  3FPU B;  5ELN A;  5TSS A;  2OXP A;  3ULJ A;  1SYD A;  2G9H D;  1HHV A;  1XMQ Q;  4LFC Q;  3SEB A;  2VXW A;  1HUN A;  2MP1 A;  1SNO A;  1IZ6 A;  1YHA A;  1KDC A;  1WTP A;  2UUB Q;  1N36 L;  1TWF B;  4A3I G;  2OCE A;  4BBR H;  3HKZ B;  4EQN A;  1NAP A;  1LTL A;  4QGU A;  5C0X H;  4GKJ L;  1GXD C;  4LF8 L;  2EOT A;  3U9O A;  1BDO A;  1X65 A;  3M4P A;  3OIP A;  4TQU S;  2UU9 L;  2X6L A;  3WOF A;  2FMM A;  3F2D A;  3OOC A;  4BY1 B;  4Q0F A;  3MWY W;  2UXD Q;  1B44 D;  5BR8 Q;  3A5U A;  3BYY B;  3T16 A;  3O13 A;  4DR5 L;  1EEI D;  3GP7 A;  1CTM A;  1SRU A;  4EQP A;  1K3R A;  2F52 A;  3K6O A;  3CD6 A;  2AUK A;  1ICW A;  4ME3 A;  1N9W A;  4BY7 B;  4YIJ A;  4J6H A;  3SR1 A;  3K80 C;  4LFB L;  3NPP A;  1EYA A;  4FXG C;  2QGQ A;  5IY0 A;  3BDL A;  4GLV B;  2JN4 A;  3D0F A;  1BBW A;  3T4A C;  4TVA B;  3HP3 A;  2KUM A;  3W1G A;  1FD7 D;  3OHX C;  5T1G A;  5C3W A;  1AN8 A;  1JMC A;  5ELB A;  5FLX L;  2ICI A;  3M7G A;  3OMG A;  4A3F B;  4DV2 Q;  1F77 A;  4OIJ A;  5IP9 H;  5FKA C;  3U50 C;  1GKH A;  2HHH Q;  5EGT A;  1QVC A;  5HUR A;  2DNE A;  1SAP A;  3MA2 B;  1V9P A;  1VQI A;  5AJ3 Q;  3S15 H;  1YVC A;  1A6X A;  3HOY H;  4LF5 Q;  1D8L A;  1HZC A;  3PMF A;  2RDH A;  4RKB A;  1WCM H;  1PYB A;  4KY5 A;  4DR2 L;  1XPR A;  4R8N A;  1ENA A;  1RIP A;  1KRT A;  5KND A;  3CQZ H;  1W6K A;  2IX1 A;  3I4N G;  1I3Q B;  3D8G A;  4C1N K;  4DUY L;  3TME A;  2ZJR A;  1HR0 W;  3W2D A;  2PW5 A;  2MO1 A;  3KF6 B;  5C4Z A;  3M4O H;  5JJI A;  2BE5 D;  4S3S A;  3NEN A;  1ENC A;  4JBW A;  1E1O A;  4A3K H;  4QUC A;  2PQA A;  2GVB A;  3ND9 A;  4B3S Q;  5GAE C;  2F0L A;  1YNN C;  4HN7 A;  3F2C A;  4DV0 Q;  3K59 A;  3RLF A;  1CI3 M;  2YV5 A;  2JA6 G;  4C2M B;  5C0X J;  1BCP B;  1L0X B;  2IL8 A;  1LUZ A;  5I2Y A;  1EIF A;  3PIP A;  1LTR D;  1JR0 D;  4EVO A;  2BOS A;  1J5E Q;  3UE0 A;  2ZXR A;  4PQX A;  1A3V A;  4GLA C;  3S2H H;  1QNU A;  1U4R A;  3U9S A;  1SE3 A;  4HCE A;  4CDF C;  2F0D A;  2WAQ G;  2HDM A;  2BCO A;  1Y1W B;  1STY A;  4B3R L;  5C3X A;  2R7Z B;  3I8Z A;  3E0J A;  1Y1V B;  4DV4 Q;  1EYC A;  4ALP A;  3V2T A;  1BBX C;  2JEB I;  4X66 Q;  3A8J E;  4MIU A;  1XPU A;  4QUF A;  1GVP A;  1B53 A;  4L6T B;  5IOC A;  5LMU Q;  1R4Q B;  3URY A;  2B8G A;  4QIW E;  3CCR A;  1O7L A;  1VQD A;  2E5L L;  5M5Y B;  4LF4 L;  1CKN B;  1PYS B;  2K75 A;  4NXM L;  4FYD A;  4OWX B;  2RDG A;  4LUO A;  4DUZ L;  1WOC A;  1R9T B;  2PPB C;  2RSN A;  4H02 A;  2NN6 H;  1SEB D;  1PTO F;  1T9H A;  3A5Z B;  3EIV A;  2EJG C;  2QKI C;  3M7N A;  1EQR A;  5M5W B;  3ER0 A;  2R6G A;  1PH7 A;  1JB3 A;  1X3F A;  3HOX B;  4C1N I;  1TWF H;  3NTI A;  4HIO A;  1SE8 A;  1QNK A;  2MGS A;  3PIO A;  4DK0 A;  1B3Q A;  1KLU D;  1FNV A;  3G6J B;  3GD7 A;  1XNR L;  1NMF A;  2ID0 A;  4IUP A;  4BY1 H;  1H9S A;  4BA2 I;  3FMC A;  5FLX c;  4KLK A;  4ZKC B;  1HA5 A;  5F2D A;  4NPS A;  3SHL A;  3CPW A;  2XGT A;  3BVM A;  1SN8 A;  3VR5 A;  2LSS A;  5C44 B;  3CCV A;  1Z6H A;  1CSQ A;  1YJN A;  1JJG A;  4LUV A;  5T1I A;  1AFP A;  1EWI A; 
#chains in the Genus database with same CATH homology
 1HNZ L;  2ZM6 Q;  1KQS A;  4BY7 H;  4AQY L;  1K8A C;  2B63 H;  2R7Z G;  4K0K Q;  1FL0 A;  3TEH B;  4A3L H;  1GO3 E;  3S14 H;  1XNQ L;  1Y1V G;  2JA6 H;  5K36 G;  2UUA L;  1OXT A;  1OTC A;  3CMA A;  1P16 A;  4L5R C;  3T1Y L;  5JEA J;  1HNX L;  2VUM G;  5LMN Q;  4A3D G;  1HZB A;  1GD7 A;  1VQ4 A;  4OWW B;  3HOZ H;  1NY4 A;  3BU2 A;  3PCO B;  2HIV A;  3EN2 A;  3PUX A;  4DNI A;  5E7N A;  2C35 B;  3CC7 A;  3RLO A;  1YI2 A;  3DLL A;  1G51 A;  1SR3 A;  2RCN A;  5LMN W;  2BA1 A;  3S1Q H;  4DK6 C;  4IPC A;  3W5O A;  1PH5 A;  3U4V A;  1VQO A;  1Q12 A;  1C0A A;  4JI4 L;  4LNQ A;  2K5V A;  2KHI A;  3AEV A;  1TWC H;  2K14 A;  2VS1 A;  2Q2T A;  4DV2 L;  3M9B A;  4UP8 A;  3CCM A;  2K52 A;  3PF4 A;  2Y0S E;  3TRE A;  4A3F H;  1S40 A;  4OX9 L;  1VQN A;  4YCW A;  1UEB A;  2AWO A;  4IFD G;  3H0G H;  4A3J H;  4YCU A;  1NMG A;  1IBL Q;  4A3B H;  2DUD A;  1NBW A;  1AE2 A;  3NEM A;  1GM5 A;  4LF7 Q;  3K81 C;  3KDF A;  2OQK A;  5AJ3 L;  2E2I H;  4JYA Q;  1K9M C;  2JA7 G;  5HY6 A;  2BA0 A;  4OON A;  4DKA C;  4YHH Q;  1I94 L;  2BH8 A;  4R4I A;  1A63 A;  2I5M X;  2IT1 A;  3HOX G;  4LF6 L;  3U4Z A;  4DR7 L;  1VQB A;  4GN3 B;  4A93 G;  3CW2 C;  1W2B A;  4LFA L;  2VNU D;  1HR0 L;  3CXC A;  4YWK A;  2B3G A;  5IWA L;  1QUQ B;  4WJ3 M;  4DV7 Q;  3KLW A;  1JJC B;  2E5L Q;  4A75 A;  4NXM Q;  3G6E A;  3E0E A;  4DUZ Q;  3UDI A;  4APV A;  4IJL A;  1IBK L;  3S1N H;  1N32 Q;  1VQG A;  5M3M G;  1I3Q H;  1VQF A;  3PV0 A;  2K4K A;  1Y14 B;  1FGU A;  3GO5 A;  1NE3 A;  4DAY B;  5IYC G;  4DV1 Q;  3CCU A;  3S17 H;  5IYB G;  4DR3 L;  1YZ6 A;  3H0G G;  4AYB G;  5M3F G;  2HQL A;  4NXN Q;  4L5S A;  3H3V I;  2PMZ E;  5FLM H;  5GRO A;  2JA5 H;  2NVT H;  2IY5 B;  4JI1 L;  4LFB Q;  1VQ5 A;  5GAH C;  1CKO A;  3HOW G;  4KHP Q;  1YJ9 A;  2ZJQ A;  2CWP A;  4A3M G;  1B8A A;  3KYH C;  4L5T A;  5C44 G;  1FJG Q;  1L1O C;  1VQP A;  3I4M H;  4DV0 L;  5J3B A;  4LF9 L;  3NEL A;  1Q82 C;  4UP9 A;  2IHF A;  1PH1 A;  2WFW A;  2Q2I A;  3CCJ A;  1VS0 A;  3J7A 5;  2YU9 H;  2JA8 G;  4A3E G;  5GAD C;  4Y52 H;  2QEX A;  3HOU G;  1KHI A;  1M1K C;  1CSP A;  1Q1B A;  4C2M H;  2I0Q A;  2KCT A;  4DPG A;  5GQO A;  1K83 H;  1HZA A;  3J81 j;  3CCE A;  1Q46 A;  3KDF B;  2CFM A;  3JC6 6;  4LFC L;  4R1J A;  4A4I A;  3PGZ A;  3K8A A;  3ZJY C;  4BA1 I;  4DK3 C;  4LUZ A;  2WB1 G;  2ALY B;  4HIM A;  1PH4 A;  1EYG A;  4JI7 Q;  1KRS A;  2VY3 A;  4IPD A;  4JG2 A;  3TQY A;  2JA5 G;  1JE5 A;  2K5N A;  3RLN A;  4YY3 Q;  4BXX G;  1MIU A;  1X55 A;  3G48 A;  4DR1 L;  2JEA I;  3PO3 G;  4OO1 I;  4OXP A;  4DV4 L;  2Z6K C;  1Y1W H;  2R7Z H;  4B3T Q;  4XIG S;  4BBR G;  1Y1V H;  2ZTC A;  3OTO Q;  1KIX A;  2F4V Q;  2PNH A;  1WFQ A;  4R4T A;  5C0X G;  1N33 L;  4C3H H;  1HNZ Q;  4IOA A;  2Q2H A;  1QZH A;  4AQY Q;  2VW9 A;  1WYD A;  2VUM H;  3GTO H;  4A3D H;  2MNA A;  2UXD L;  1Q7Y C;  1NTG A;  2N8N A;  5BR8 L;  2NVX H;  1XNQ Q;  4DR6 Q;  2UUA Q;  2IHE A;  3M85 A;  4DR2 Q;  2UXB L;  2JQO A;  3T1Y Q;  1HNX Q;  1VQ9 A;  4GNX C;  3CC2 A;  1V43 A;  3A0J A;  3D31 A;  1PA6 A;  3TS0 A;  2RF4 A;  5M5Y H;  1N34 L;  3L2P A;  1HZ9 A;  3LGJ A;  1IBM L;  2D0P A;  1R9T H;  3HKS A;  1X3E A;  4QJF A;  2R92 G;  4JI6 L;  2HT1 A;  3CC4 A;  2KBN A;  3STB C;  4OO1 G;  3FP9 A;  1G6P A;  2OWO A;  3AQQ A;  1Y1W G;  2B29 A;  4JI4 Q;  1BKB A;  1VQA A;  2ZTD A;  1Q1E A;  4DV3 L;  1M90 C;  2ZJP A;  4X6A H;  1HH2 P;  2CWA A;  2NVY H;  4YWL A;  3IRB A;  4X62 L;  1TWA H;  4B3M L;  3GDE A;  4OX9 Q;  1QVF A;  5M5W H;  3S24 A;  4C3I H;  1L2F A;  3HFZ B;  1PH2 A;  2JA7 H;  1VQ6 A;  1A8V A;  4MTN A;  3HOX H;  2EIF A;  1EFW A;  2VL6 A;  3I4O A;  2Y0S G;  1OXV A;  2OQ0 A;  3OYY A;  1QZG A;  4A93 H;  4GOP A;  1CKM A;  2MFI A;  1VQM A;  4R4C A;  4R4Q A;  2JA9 A;  3GTG H;  3K0X A;  1XMO L;  1XJV A;  1AE3 A;  2A1A A;  4LF6 Q;  4DR7 Q;  1RL2 A;  2ATW A;  4X64 Q;  3J81 c;  1E24 A;  2JJQ A;  5C4X G;  2HIX A;  1YEZ A;  4LFA Q;  1HR0 Q;  2ZTE A;  1YJW A;  5C3E G;  2VQF L;  5IWA Q;  2GN5 A;  4PZ8 A;  1I5F A;  5M3M H;  4L5Q A;  2EQS A;  4JCV E;  1YHB A;  3A74 A;  5IYC H;  1Q8K A;  1U5K A;  2HHH L;  5IYB H;  2YTY A;  4UPA A;  5M3F H;  4JBM A;  4B3R Q;  2NN6 I;  1P8L A;  4R4O A;  2L15 A;  5IP9 G;  4UY8 C;  3TRZ A;  1E22 A;  3HKZ E;  3HOW H;  3CF5 A;  5FJ8 G;  3MXN B;  3J81 i;  4A3M H;  5IP7 G;  2RHS B;  2VZA A;  3W1B A;  4J15 A;  4DR3 Q;  2N78 A;  1IYJ B;  4GN4 B;  3G71 A;  1YIT A;  4LF5 L;  5C44 H;  4GN5 A;  2NZO A;  3JAM c;  1MJC A;  1Q81 C;  3DM3 A;  5GAG C;  2ZM6 L;  4JI1 Q;  1KD1 C;  1VQJ A;  4JI0 L;  4QQB X;  2N3S A;  2E2H H;  4O2D A;  3F8T A;  1LM0 A;  4YCV A;  4JI8 Q;  3RZD H;  3T1H L;  3AFP A;  4EX5 A;  4A3E H;  3AFQ A;  2JA8 H;  3HOY G;  3S1M H;  1VQ8 A;  2UXC Q;  3HOU H;  1JJ2 A;  3PUW A;  4FDB A;  4LF4 Q;  3KFU A;  1UE7 A;  5LMN L;  3PSI A;  2R7F A;  4KI0 A;  1KL9 A;  4PMW A;  4DV5 L;  4P71 A;  1LYL A;  2LXJ A;  1IXR A;  3BJU A;  1WCM G;  4P74 A;  1D7Q A;  3HOV G;  3UDF A;  4DV6 L;  3JAM i;  4IPG A;  1E1T A;  3CME A;  5ELN A;  1J6Q A;  2VQE Q;  3CCQ A;  4C3J H;  3ULJ A;  3GTM H;  1B7Y B;  1XMQ Q;  4LFC Q;  3SGI A;  3UE1 A;  4BXX H;  3KJP A;  4B3S L;  1IZ6 A;  4A3K G;  1YHA A;  3PO3 H;  2ASB A;  1PFS A;  4O0A A;  4NB3 A;  1W3S A;  2UUB Q;  1N36 L;  2V1C C;  4X65 Q;  4LW1 A;  2OTJ A;  1TWH H;  4A3I G;  2OCE A;  4BBR H;  4DR1 Q;  4HIK A;  1IBL L;  3GTK H;  1LTL A;  1DGS A;  4QGU A;  4GKJ L;  1ASY A;  5JEA G;  4P72 A;  1MJE A;  4LF8 L;  1KXL A;  4HJ9 A;  1X65 A;  4JYA L;  1X54 A;  3M4P A;  3BZC A;  3FKI G;  4TQU S;  2UU9 L;  1EIY B;  3TS2 A;  2KEN A;  3RN2 A;  3UDG A;  3F2D A;  1J5E L;  4IFD I;  4MNO A;  2WAQ E;  3CCS A;  2UXD Q;  4AIM A;  3GTP H;  5BR8 Q;  5IYD G;  5EAY A;  3A5U A;  2UXB Q;  2D62 A;  2IX0 A;  5H1S E;  4DV7 L;  4DR5 L;  1Q86 C;  2UUC L;  3MEF A;  2R92 H;  2WP8 J;  1VQH A;  4GLX A;  1N34 Q;  4DR4 L;  4JV5 L;  1SRU A;  3NBH B;  1IBM Q;  1K3R A;  1SLJ A;  2F52 A;  4A3G G;  3CP0 A;  3CD6 A;  1VCI A;  4DV1 L;  4JI6 Q;  4ME3 A;  1N9W A;  4X66 L;  1V1Q A;  4XTC S;  3KJO A;  1PH8 A;  2AWN A;  2I5H A;  3RN5 A;  3K80 C;  1X3G A;  2Z0S A;  4JC0 A;  1O7I A;  4PG3 A;  4LFB L;  4KHP L;  4IOC A;  5C4J H;  5LMU L;  4JI3 L;  4DV3 Q;  4HID A;  2BH2 A;  2R93 G;  2QGQ A;  3RR5 A;  5IY0 A;  4X62 Q;  4B3M Q;  4GLV B;  1ASZ A;  4WJ4 A;  3KF6 A;  1I6H H;  4POF A;  3PUV A;  1AH9 A;  5JJK A;  2NVQ H;  1UWV A;  1OXU A;  3STB D;  3D0F A;  1PH3 A;  1BBW A;  1SMX A;  4TVA B;  3K7A H;  1YBY A;  1VQC A;  4JI5 L;  4A3C G;  3W1G A;  3KOJ A;  5C4X H;  3PO2 G;  1IL2 A;  4JI2 L;  1XMO Q;  2N49 A;  5C3E H;  1JMC A;  2MQH A;  4MZ9 A;  4RG1 A;  4GKK L;  2F3I A;  2NN6 G;  4P75 A;  2JK8 A;  3ERS X;  4JI7 L;  2VQF Q;  1A0I A;  4DV2 Q;  3RZO H;  4Y7N H;  5IP9 H;  2E2J H;  1K8G A;  5FJ8 H;  1FVI A;  3U50 C;  1GKH A;  5IP7 H;  4YY3 L;  2HHH Q;  1QVC A;  2AKW B;  1UE1 A;  3KF8 B;  1XNR Q;  4IPH A;  1S3O A;  3I55 A;  1V9P A;  4BBS H;  1VQI A;  2KHJ A;  5AJ3 Q;  5M5X H;  3CAM A;  3ULL A;  3S15 H;  3ULP A;  1HNW L;  1OXX K;  1YVC A;  1I94 Q;  1NJI C;  3HOY H;  4LF5 Q;  1G29 1;  3L7Z C;  1D8L A;  1HZC A;  4JI0 Q;  3HKZ G;  1YIJ A;  1U0L A;  4JOI A;  4QY7 A;  1XMQ L;  3T1H Q;  1A62 A;  1L1O A;  3M4Q A;  4DR6 L;  1WCM H;  1PYB A;  4DR2 L;  1WI5 A;  1XPR A;  2CQO A;  5HGQ A;  4IJH A;  3HOV H;  1RIP A;  1KRT A;  3I4N G;  3CQZ H;  2IX1 A;  5C0X I;  1BBU A;  4DV5 Q;  1VQL A;  4DUY L;  2ZJR A;  4BY1 G;  2KCM A;  1IBK Q;  1HR0 W;  2MO0 A;  3PUY A;  4HJA A;  2MO1 A;  2I5L X;  3KF6 B;  1YHQ A;  4JBK A;  3M4O H;  4DV6 Q;  3S1R H;  1VQK A;  2E8G A;  3K7U C;  5JJI A;  2YTV A;  2OTL A;  3NEN A;  4JBW A;  4PZ7 A;  1E1O A;  3I56 A;  4A3K H;  2PQA A;  1PH9 A;  2GVB A;  2EXD A;  1CKN A;  4A3I H;  2GVA A;  4DAM A;  3UDX A;  4K0K L;  3GTJ H;  5GAE C;  4B3S Q;  3GTL H;  2Q2U A;  3F2C A;  1N36 Q;  4BY7 G;  1E7Z A;  3WWV A;  4PZ6 A;  4DV0 Q;  3RLF A;  4LF9 Q;  3FKI H;  1PH6 A;  2B63 G;  2K5H A;  4A3L G;  3B6Y A;  2NZH A;  1TWG H;  2YV5 A;  2YYZ A;  2JA6 G;  2AMC B;  2CKZ B;  2Z6K A;  3J80 c;  4GKJ Q;  2YTX A;  5C0X J;  4A76 A;  4LF8 Q;  3L0O A;  3RNU A;  1LUZ A;  2UU9 Q;  1EIF A;  2DGY A;  2AHO B;  3PIP A;  5IYD H;  1KC8 C;  3HOZ G;  3I7F A;  1E3P A;  1J5E Q;  3UE0 A;  1X56 A;  4X64 L;  4GOP B;  4P73 A;  3S2D H;  1EUJ A;  4GLA C;  1PV4 A;  3S2H H;  4HJ8 A;  3GTQ H;  1Z9F A;  4GNX A;  1SRO A;  2XTI A;  4DR5 Q;  3E9I A;  3J80 i;  4A3G H;  2UUC Q;  4RMF A;  3OW2 A;  2WAQ G;  3CCL A;  2A8V A;  3F1Z A;  1L1O B;  1CUK A;  4DR4 Q;  4JV5 Q;  1JT8 A;  4B3R L;  1OXS C;  3J7Z C;  4HJ7 A;  4HJ5 A;  4LF7 L;  1XPO A;  4DV4 Q;  4A3F G;  4ALP A;  3Q8D A;  4BBS G;  1C9O A;  4GOP C;  2JEB I;  1EOV A;  2K50 A;  4X66 Q;  4YHH L;  4A3J G;  4A3B G;  2R93 H;  1XPU A;  4QL5 A;  1N33 Q;  1GVP A;  4IO9 A;  2FXQ A;  3I2Z A;  1MKH A;  1JB7 A;  2LXK A;  5LMU Q;  4JI3 Q;  4JBJ A;  4JI8 L;  2JE6 I;  4QIW E;  3CCR A;  1N8R C;  3E9H A;  3FHW A;  4JOI C;  2PQA B;  2UXC L;  4A3C H;  1VQD A;  2E5L L;  4LF4 L;  1CKN B;  4EQ5 A;  1QVG A;  3PO2 H;  1PYS B;  1TXY A;  2K75 A;  4NXM L;  4OWX B;  4AYB E;  4LUO A;  4DUZ L;  1N32 L;  1WOC A;  1K0R A;  4JI5 Q;  1EQQ A;  1PVO A;  4H02 A;  4JI2 Q;  2VQE L;  3VDY A;  4NXN L;  1T9H A;  4GKK Q;  1KAW A;  3A5Z B;  3EIV A;  3S16 H;  5IE8 A;  5DLQ E;  3M7N A;  1VQ7 A;  1UE6 A;  4KHZ A;  1EQR A;  1YNX A;  3AYH B;  2R7D A;  3F2B A;  3ER0 A;  3CPF A;  1HJP A;  4IFD J;  4UP7 A;  1WJJ A;  2R6G A;  1PH7 A;  1FJG L;  5FLM G;  2UUB L;  2PI2 A;  4OWT B;  1X3F A;  4X65 L;  3EBE A;  3U58 A;  1L0W A;  5ELO A;  1UE5 A;  1S72 A;  1C7Y A;  1TWF H;  2A19 A;  4YWM A;  4GNX B;  1H95 A;  4HIO A;  1SE8 A;  1B70 B;  1BVS A;  3I4M G;  4POG A;  4AH6 A;  2WB1 E;  3PIO A;  1HNW Q;  2PI2 E;  1SFO H;  3M3Y H;  3GD7 A;  2CCZ A;  1X6O A;  3G4S A;  5JJL A;  1XNR L;  3I4N H;  3H3V H;  3PUZ A;  2QA4 A;  1K73 C;  3BZK A;  1NMF A;  2H5X A;  2ID0 A;  4BY1 H;  4BA2 I;  1XTD A;  5FLX c;  3PF5 A;  4KLK A;  2RHQ B;  4NPS A;  4DUY Q;  4GS3 A;  1I50 H;  1VQE A;  3CPW A;  2XGT A;  1SN8 A;  2D0O A;  2ES2 A;  1Z47 A;  2LSS A;  5IT9 c;  3CCV A;  1X9N A;  4B3T L;  1CSQ A;  4LWC A;  3H15 A;  2F4V L;  3OTO L;  1YJN A;  3ICE A;  4LUV A;  1JJG A;  1PHJ A;  1QUQ A;  1EWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...