2UXBL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxbL00
4QGUA 5GQOA 2IX0A 1PH8A 3U4VA 4A3BG 2KENA 4GS3A 1W2BA 1M90C 2AHOB 5FLMH 1XNRL 4JI0L 4HJ8A 1A63A 2E2JH 2VNUD 3PIOA 4DR6L 4X66Q 5IWAL 5C3EH 1JJCB 4DNIA 4B3SQ 1Y1VG 2UXBL 2E5LQ 4BA2I 2UU9Q 3J81c 4LF8L 4LF7L 4DR3L 2R7ZG 4HIMA 4LFCQ 1XMQQ 1UE7A 4A3GG 1CKMA 1QVFA 2F4VQ 4DR4L 2EXDA 3HOWG 2WB1E 2YTXA 1K8AC 4JI0Q 3BZKA 2VUMG 2ZTCA 2ZM6L 4POFA 1E24A 3RLNA 4X66L 3RZDH 1NTGA 4A3FH 4IOAA 3GTQH 4KHPL 2XTIA 4LUVA 1NE3A 4LUZA 4X64L 3H15A 2B63H 1Q12A 1SROA 4OX9L 2BH2A 1S3OA 1CSQA 4DV1L 4A3CG 2JA7H 4A3JH 3PF4A 3ER0A 5BR8L 4DR3Q 3PCOB 1VQ7A 2ASBA 1WCMH 4LFBQ 1N32Q 3M4QA 1LYLA 3L7ZC 3NBHB 3F2BA 3KF6A 5LMUL 4OO1I 1AH9A 2FXQA 4PZ8A 3PUYA 4JCVE 3K8AA 4JI2Q 1YI2A 4OO1G 2UXCL 5IP7H 1XPUA 2ZJPA 3J7ZC 1SE8A 1Y1WH 1JJGA 1L1OC 3Q8DA 3RR5A 1X65A 1IZ6A 2MO0A 1E3PA 2CCZA 4QY7A 3TEHB 2YYZA 2R7FA 4OX9Q 1DGSA 3CCMA 1VQLA 3ULPA 2I5MX 1LTLA 3I7FA 1WJJA 4GN5A 4JI6Q 4L5QA 2OCEA 4X65Q 2LXJA 1JB7A 5C4XG 1D7QA 5C4XH 5C0XJ 1XJVA 3U4ZA 3HKZG 1G51A 3CCUA 5ELNA 3E9HA 4HIDA 1XNQL 4DKAC 3HOVG 4DV7L 1Q46A 3PO3H 1O7IA 1NMGA 4JV5Q 3JAMc 5C0XI 4HIOA 2ZTEA 1HNZQ 2K14A 3PUZA 1J5EL 5EAYA 1OXSC 1HR0L 2D0OA 1OTCA 2E2HH 5FJ8G 2JEBI 2RHSB 3F2CA 1I94Q 5J3BA 2HHHL 2A8VA 1X6OA 4X65L 3G71A 4DK3C 3WWVA 4DV2L 4JBMA 1VQKA 2YTYA 3AFPA 5JJIA 4YCWA 3BU2A 1PHJA 4DR6Q 3CF5A 3TRZA 3OTOQ 4JI5Q 1UWVA 3GO5A 1Q81C 1PH6A 3KOJA 1VQCA 2AMCB 3AQQA 2MO1A 5C44G 3A74A 5M3FH 4HJ9A 1YJNA 1PV4A 4BA1I 1IXRA 1CKNA 2CKZB 1KL9A 2N3SA 4PG3A 2CWPA 4LFCL 4X62Q 5DLQE 3I56A 3JAMi 1YITA 3GTLH 2UXBQ 1Q86C 2Z0SA 1T9HA 3W1BA 5M5YH 2UU9L 4NXNQ 4A3KG 1YEZA 1YHBA 4IPDA 3PF5A 3PUXA 2ID0A 3FKIG 4JC0A 3CPWA 2OTJA 2VY3A 4LF4Q 4O0AA 1VQIA 2E2IH 4DUYL 1EIFA 2UXDQ 1I6HH 3AFQA 4AQYQ 4DV0Q 4HJ5A 2JJQA 4AYBE 2QGQA 4Y52H 4R1JA 2JQOA 4GKKL 4ME3A 4DV4Q 3L2PA 4DR5L 1JMCA 4B3RL 1VS0A 1N36L 3UE0A 4JI3Q 4POGA 2GN5A 4DV6Q 2F52A 2JA8H 4YCUA 1X54A 3HOZG 4MTNA 4A3IH 2JA9A 3PO2G 4YCVA 5IYCH 1TWHH 4DAMA 4JYAL 3LGJA 1W3SA 4YHHQ 1HJPA 1HNXL 3H3VH 3H0GH 4J15A 4JI2L 5LMUQ 3UE1A 2KBNA 3HKZE 4EX5A 2YV5A 2AKWB 3GTGH 2KCMA 4AQYL 1YIJA 3M4OH 1GD7A 1TWCH 1VQ4A 4A3MG 1EOVA 4GKKQ 4GNXB 1PH7A 3M3YH 3GTOH 3CCVA 1PH5A 2JEAI 2PMZE 3CMAA 4A3LG 4JBJA 5IP9H 5FJ8H 3I4OA 3S15H 4MNOA 4DUZQ 4KHPQ 1V43A 3M7NA 3ULJA 4B3TQ 5M5WH 3J81j 3B6YA 1HNWL 2QA4A 1CKNB 1WCMG 1XTDA 2VW9A 4UY8C 1XPOA 1A62A 1JT8A 1QUQA 2RF4A 3CCLA 1FGUA 3G6EA 3F8TA 4A4IA 1PH3A 5IYDH 1HZ9A 3T1YL 3STBC 4R4OA 4BXXH 2NVQH 4B3RQ 3OYYA 2D0PA 4JI5L 3OTOL 4DV3Q 1VQHA 3ULLA 2VQEQ 3F2DA 2Z6KC 2JA5G 2IX1A 4R4IA 2PI2E 1X9NA 3S2DH 2B29A 1J6QA 1VQPA 2PI2A 1IBLL 3GTMH 3A5ZB 4OWWB 2ZM6Q 5M5XH 1NJIC 4C3JH 4BBRG 3G48A 4DR4Q 5GAHC 4A3EH 1UE5A 1MJCA 3CC2A 1X56A 4DR7L 2L15A 5K36G 2I0QA 4O2DA 5GROA 4GNXC 2HIVA 2ZJQA 2OTLA 3FHWA 2WAQG 1IBML 4XTCS 1K9MC 2R7DA 5C4JH 3UDFA 2PQAA 4RMFA 4LF6L 2MQHA 1QZGA 4B3ML 3E0EA 4Y7NH 3KDFB 3HOUG 4GKJL 3M4PA 4IOCA 3S1RH 4UPAA 4MZ9A 1KQSA 2YTVA 1BBUA 4A3JG 4LF9L 2HT1A 1WYDA 1XNRQ 4YWMA 1Z47A 4DPGA 5M3MH 3L0OA 3RN2A 4KHZA 1PH9A 1N36Q 2HQLA 4JI3L 2KHJA 1S72A 4A3BH 2E8GA 2H5XA 4DV0L 1WOCA 2K52A 4P75A 3DM3A 3CMEA 1IYJB 1Z9FA 2MNAA 1ASYA 3H3VI 3HOWH 3S17H 2UXCQ 2NN6I 1B8AA 2GVBA 2NVXH 3NENA 4ALPA 1HR0Q 2NZOA 1SLJA 2N49A 2Y0SE 5GADC 2VUMH 3RZOH 1OXXK 4LF9Q 3HOYG 1BKBA 3GTKH 3CD6A 2B3GA 4YY3L 2D62A 2DGYA 1CUKA 2N78A 3PV0A 4AYBG 4JYAQ 4C2MH 1P8LA 1HNXQ 2CQOA 3I4NG 4BBSH 3J80c 4DR1Q 1YHQA 4JI8Q 2AWNA 3SGIA 4DR2L 3ICEA 1OXVA 1L1OB 3S1NH 2KHIA 4QL5A 1YZ6A 3TS2A 2Y0SG 2F3IA 1KHIA 1UE6A 1IBKQ 4A3DG 1IL2A 2A1AA 1G6PA 3PO3G 2JA6G 3HOVH 3KJPA 2UUCQ 1K83H 2EQSA 5C0XG 3K7AH 4DV5L 4A3MH 1A8VA 1Q8KA 1N33L 1U5KA 2K75A 4IJLA 4WJ3M 3A5UA 1V1QA 4GKJQ 1AE3A 1SR3A 1TWAH 2RCNA 2JA5H 1VQMA 1YHAA 3CC7A 4LF4L 1K3RA 3CW2C 1K0RA 3STBD 1N9WA 4APVA 3CAMA 3J80i 1PH4A 4LF5L 1KRTA 1PFSA 2WP8J 4P73A 1PYBA 4P71A 4UP9A 1EYGA 3J7A5 2YU9H 4LNQA 3UDXA 4NPSA 5E7NA 3KDFA 1NMFA 5IP7G 1IBLQ 4X64Q 1A0IA 1I3QH 3NEMA 4LUOA 1GM5A 2VQFQ 3HOZH 1D8LA 4K0KL 2ZTDA 2IY5B 3TQYA 2N8NA 3S1MH 2R6GA 2XGTA 1I5FA 4DK6C 4BY1G 4JI1Q 2JE6I 4GN4B 4NXMQ 2BA0A 3I4NH 4A3CH 3W5OA 3OW2A 3K81C 1U0LA 1KIXA 4JV5L 1QVCA 1HNZL 2JA7G 1GO3E 1WI5A 3UDIA 2NVTH 1XNQQ 4A3FG 2R92H 4JI4L 1HNWQ 2E5LL 2PNHA 3JC66 3H0GG 1IBMQ 4B3SL 3F1ZA 1VQOA 4YHHL 4AIMA 1X3FA 2A19A 2K50A 5AJ3Q 4L5RC 4DV6L 2BH8A 4UP8A 5M3MG 1QVGA 4L5TA 1XPRA 4GLVB 4TVAB 3CCEA 1FJGL 4NB3A 2WB1G 3DLLA 1LM0A 3TREA 2HIXA 4R4CA 3KJOA 2VS1A 1EQQA 1VQGA 2Q2IA 3E9IA 1VQBA 4R4TA 3CPFA 3EIVA 4PMWA 4HIKA 3M9BA 2VZAA 3U58A 1VQFA 2IHEA 5AJ3L 1Q82C 1FL0A 3PGZA 4BY7H 1E1OA 5BR8Q 4YY3Q 5FLMG 1VQJA 1B7YB 3S14H 2DUDA 3HFZB 3I2ZA 2NN6G 1TWFH 4IPHA 1KAWA 1YJ9A 3NELA 4JI1L 4L5SA 3UDGA 1LUZA 4LW1A 4A93G 1TWGH 4QJFA 4DV4L 4DR5Q 4B3TL 2OQKA 3FP9A 1E7ZA 1FJGQ 5IWAQ 1VQEA 3S24A 3EN2A 4IJHA 5H1SE 4YWLA 5IYDG 5HGQA 3I55A 2UUCL 4YWKA 1JJ2A 1Y1WG 3CCSA 1KXLA 4LF5Q 2K4KA 4JBKA 3KFUA 4H02A 1NY4A 5LMNW 4WJ4A 1C7YA 3RLOA 5GAGC 2MFIA 1K73C 1EUJA 4DR7Q 1PYSB 3ZJYC 3CCQA 4GOPC 1Q7YC 4JOIC 5IYBH 1L1OA 5IP9G 1E22A 1KC8C 4BBRH 5FLXc 2R93H 1WFQA 3S1QH 3PIPA 2UUBQ 1HH2P 1VQ8A 3HKSA 3RLFA 4DUZL 3HOXG 4IFDI 3HOXH 4C3IH 1K8GA 4OWXB 3D31A 4DV2Q 4K0KQ 4EQ5A 5JJKA 1YJWA 5LMNL 4BXXG 1VQNA 1V9PA 2CWAA 4JG2A 5IYBG 4PZ7A 1E1TA 1EWIA 4IFDJ 4DR1L 3ERSX 3T1YQ 2JA8G 2K5HA 1UEBA 3G4SA 4OONA 4JI7Q 3S2HH 1L0WA 5IYCG 1QUQB 3CXCA 1MJEA 3PO2H 1CSPA 1FVIA 2R7ZH 3A0JA 4NXNL 1NBWA 3GD7A 2VL6A 3I4MG 4BBSG 4QQBX 2CFMA 4TQUS 4JI4Q 2UUAL 2ATWA 4KI0A 4QIWE 2KCTA 3KF8B 1N33Q 1Q1BA 1BVSA 5IY0A 3HOYH 1EQRA 4GOPB 5JEAJ 4JBWA 3MEFA 2AWOA 1R9TH 1YBYA 2WAQE 3CCRA 1IBKL 3KF6B 3U50C 4LFAL 3K0XA 2OQ0A 2UXDL 3IRBA 4DUYQ 1GKHA 1QZHA 1MKHA 1ASZA 1VQ9A 1HZCA 3T1HQ 2UUAQ 3RNUA 5ELOA 2Q2TA 4B3MQ 4LF6Q 4A93H 3KLWA 1EIYB 4IO9A 5HY6A 3CQZH 2UUBL 2Q2HA 2LXKA 3GTPH 2ZJRA 4GOPA 1C9OA 1J5EQ 3AEVA 2R92G 1XMQL 2ALYB 1SFOH 1I50H 2F4VL 4GLAC 4BY7G 1M1KC 3CC4A 1Q1EA 4A3GH 1PVOA 1HZBA 3BZCA 5C44H 5M3FG 1SN8A 4GLXA 4BY1H 5LMNQ 1VCIA 4LF7Q 3GDEA 4LF8Q 3HOUH 4A76A 4X62L 3CP0A 4NXML 2NVYH 1SMXA 5C3EG 4A75A 4IPGA 2C35B 1HZAA 1Y1VH 1VQDA 3K7UC 3T1HL 4JOIA 2IT1A 1P16A 3EBEA 4LFAQ 5IT9c 4DV3L 1JE5A 2VQFL 3I4MH 3GTJH 2K5VA 2K5NA 3MXNB 4GN3B 2VQEL 3S16H 4A3LH 4RG1A 3FKIH 1YVCA 3W1GA 3PUVA 4A3EG 1S40A 1VQ6A 5JJLA 1VQAA 1VQ5A 3TS0A 1X3GA 1X55A 1UE1A 3CCJA 1OXTA 1RL2A 4JI8L 1B70B 4DR2Q 1I94L 1HR0W 2HHHQ 4LWCA 1Y14B 1TXYA 1YNXA 2QEXA 2NZHA 4IFDG 4FDBA 5GAEC 2EIFA 1G291 2JK8A 4KLKA 1XMOL 4R4QA 4LFBL 1N32L 2R93G 2IHFA 4DV5Q 2LSSA 2BA1A 4A3IG 1X3EA 2Q2UA 4HJ7A 3RN5A 2ES2A 4A3DH 4P74A 1KRSA 4JI6L 1GVPA 2WFWA 2I5HA 3BJUA 2PQAB 2JA6H 3D0FA 4X6AH 2V1CC 1N34Q 1SRUA 2Z6KA 4OXPA 4AH6A 1H95A 5JEAG 3PSIA 4XIGS 1EFWA 1L2FA 1KD1C 4OWTB 4DV7Q 4IPCA 4HJAA 1PH1A 3AYHB 2OWOA 4JI7L 1XMOQ 2I5LX 3PUWA 2B63G 4A3KH 3J81i 1BBWA 4GNXA 1C0AA 4DV1Q 2GVAA 3K80C 1PA6A 1PH2A 1AE2A 1RIPA 5IE8A 4PZ6A 1MIUA 4P72A 4UP7A 1N34L 1CKOA 1OXUA 3M85A 2RHQB 3VDYA 4DAYB 3KYHC 4C3HH 1N8RC
chains in the Genus database with same CATH superfamily
5GQOA 3J7AV 2IX0A 5IGGA 2KENA 2PNRC 1PTOC 1LTAD 5FLMH 3TN2A 1KTKA 4X66Q 5C3EH 4MHEA 1JJCB 4DNIA 4B3SQ 4F88A 2E5LQ 2UU9Q 4DU9A 2L55A 1XWEA 5JOBA 4LFCQ 1UE7A 4LMQD 3HOWG 2L1BA 2YTXA 2KCCA 1K8AC 4JI0Q 1D5ZC 2O5JC 5BN3A 4JK1C 4KHPL 4LUVA 4KJOA 1STAA 2B63H 4ZLTF 1SROA 2M2LA 1CSQA 2RSOA 4A3JH 3Q6SA 3PF4A 1SNOA 5LMUL 4PZ8A 4JI2Q 3K8AA 1ZEQX 5T1IA 2F0TA 1O78A 1X3PA 2SNSA 4HN7A 1F2MA 3SK5A 1QE6A 3Q8DA 3RR5A 2MO0A 2R7FA 2K5DA 4JI6Q 4V0BA 1UNSA 2OCEA 3VYUA 1D7QA 1IKMA 3RD4A 3N6RA 1XJVA 5AFWA 4XT1B 3HKZG 4HIDA 1C8CA 4DXFA 3HOVG 4DV7L 3PO3H 2K01A 2XWJB 2ZTEA 1J5EL 1K3BC 4XQJA 2JEBI 2RHSB 3F2CA 4ME5A 1X6OA 1AZQA 2ZT9C 3CF5A 3TRZA 2PZUA 4KK7A 2C9OA 3BS1A 1O80A 2RSNA 1KL9A 2CWPA 3NTIA 2R7ZB 2FHTA 1QJOA 5A2QL 1YITA 3JAMi 1HA6A 2RDGA 2E2IB 1T9HA 5C4ZA 1D2BA 1B4OA 1YEZA 1SFOB 1ZXTA 3PUXA 5HURA 3CPWA 2VY3A 5G3LF 4LF4Q 4ZAIA 4IQZA 2M00A 4A3JB 4K6LA 2UXDQ 1QILA 2QGQA 3L2PA 1N36L 1ILQA 3NHHA 4POGA 1X54A 3HOZG 4BWGB 4C3IB 1RODA 4A3IH 4A3BB 4FF1A 3S14B 4JYAL 1V8QA 5A2QE 1HJPA 4JI2L 5DEHA 3UE1A 1SXTA 2B2TC 4ZYSA 2WB1B 4EX5A 2AKWB 1NAPA 5E3FA 5CV4A 1PLFA 2BCOA 5FKAC 4GNXB 1PH5A 2JEAI 3PO3B 2Z6BA 4JBJA 5IP9H 5FO9B 3TBIB 4KHPQ 4B3TQ 4DA2A 5M5WH 3A54A 1HNWL 1SYCA 1YNNC 4X3UA 1DOKA 4XQQA 2RF4A 1A6XA 3HZXA 3G6EA 3HGBA 1PH3A 4TKOB 1B44D 3T1YL 2HD3A 1C4QA 4B3RQ 3L9AX 5M9OA 5C6AA 3ULLA 2VQEQ 3CU7A 3TSSA 3D4WA 2K5QA 2PI2E 3S2DH 1KDCA 2PI2A 1IBLL 1UEAB 3GTMH 4OWWB 4C3JH 4BBRG 4K2LA 1H9SA 5K36G 1KNEA 4O2DA 5GROA 2I0QA 3E5SA 3G7LA 1SNDA 4XTCS 1K9MC 2PQAA 4LF6L 5C4HA 1QB5D 4B3ML 3E0EA 3L3OC 3M4PA 4LK1C 1KQSA 2HT1A 3EJIA 1EY5A 2AUJD 3C2PA 5T1GA 3MWYW 1PH9A 2HQLA 4JI3L 2F0SA 2FFKB 4A3BH 2K05A 4F87A 4KKUA 2K52A 3CRKC 4P75A 1IYJB 1JQYD 1SNMA 1TKWB 1Z9FA 2EYMA 3CMEA 3H3VI 5M5XB 3RZOH 1HR0Q 2N49A 5GADC 5DM73 2B3GA 2DGYA 5E4XA 3PV0A 4AYBG 3TP7A 3SK8A 4JYAQ 4I7AA 1IL8A 2EE1A 4C2MH 4FF4A 1RJTA 3MXGA 3SGIA 4DR2L 1L1OB 5JEAH 2A68D 2Y0SG 2Z4HA 3J7AF 1G6PA 2JA5B 3HOVH 2EXZA 2EQSA 5C0XG 2XSCA 2A6HD 1A8VA 1E0BA 1Q8KA 4ZQ3A 1VMPA 4GKJQ 1LTGD 3M4YA 4IUQA 3DWPA 2D9UA 2WINB 1K3RA 3H09A 3T4AC 4APVA 3BDOA 3J80i 4RKBA 3QR8A 1PFSA 1LTBD 4UP9A 4KN4C 5E7NA 1NMFA 2F3WA 4Z9CB 4C3JB 1A0IA 3GTLB 4ZKBB 1NUCA 3D6WA 2ZTDA 4K5VA 1HTLD 1B2TA 2RKSA 3WOFA 2HUGA 2K04A 3W5OA 5CV6A 2JA7G 1A15A 3UDIA 2NVTH 1HNWQ 1CK1A 3JC66 4N9PA 1X3QA 4AIMA 1KDAA 1G6ZA 2BDNA 2DJGC 4GLVB 4NB3A 4DGZA 5FOBB 1SJED 2WB1G 1LM0A 2L11A 4R4CA 3KJOA 4R4TA 5K36H 3M9BA 3U58A 5BR8Q 3FDTA 1B7YB 1H9MA 2DUDA 3D3RA 2F4IA 3C3LA 1TWFH 5ELFA 4JI1L 4IUUA 1F9QA 1LUZA 1S5FD 4B3TL 4KD3A 3FP9A 1E7ZA 2QEJC 3KBXA 1VDZA 1DOLA 1WTRA 3EN2A 2FJ2A 3I91A 1SYEA 1RTNA 2KA7A 3T16A 4L8JA 4JBKA 3RLOA 5GAGC 1QNUA 2F3VA 1PXUA 2MFIA 4K14A 4A3FB 1WTVA 3OOCA 2VXWA 3CCQA 3GTQB 4BY7B 1L1OA 3PIO3 5FLXc 1TVXA 1WFQA 5IOCA 3S1QH 2NYZD 3SK6A 2O4XA 2RVLA 2UUBQ 2NVQB 3HKSA 4DUZL 3HOXG 4IFDI 4C3IH 1K8GA 4K6DA 4OWXB 4ZK9B 1EIGA 5JJKA 1YJWA 4BXXG 1V9PA 4JG2A 1EEFD 5IYBG 2C5CA 4IFDJ 4EVOA 3T1YQ 4JI7Q 4OONA 1DONA 2IL8A 1UAPA 3A8JE 1LT4D 5EKIA 1SE2A 2VL6A 3I4MG 1AP0A 3UI2A 2VB2X 3A55A 5IGDA 4K8IA 2KCTA 1Q1BA 1BVSA 4HMJA 1EQRA 2F0EA 4H7BA 4ILWA 2MPMA 4JBWA 4QF4A 2AWOA 1IBKL 3KBGA 3K0XA 2F0LA 2MP1A 3O13A 3IRBA 3OMCA 5C5LA 1HZCA 2Q2TA 4IUTA 1EIYB 4IO9A 1QWYA 2F0OA 3S2HB 2ALYB 1Y1VB 4CBVA 5BN4A 1A3VA 1Q1EA 1A3UA 4A3GH 1PVOA 3I90A 1HZBA 1QCBD 3OWEB 4WORA 5IT9E 2F0GA 1HFGA 1YNJD 3KLRA 2C35B 4OIJA 1GXDC 5IT9L 2IT1A 1P16A 3J7YW 1YNJC 5IT9c 4DV3L 1JE5A 4OGQC 4C3JG 4A3LH 2JYOA 3FKIH 3PUVA 3NTKA 1PZKD 1VQ5A 1LTRD 3J81E 3CCJA 1UE1A 1EU4A 1HQMC 1OXTA 1RL2A 4DR2Q 1I94L 3GTJB 2CH4W 1TXYA 2QEXA 2H4OA 1I6HB 2EYFA 5GAEC 4I7ZC 1TS2A 1N32L 2RBMA 1IYUA 2BA1A 3RMHA 4A3DH 4P74A 4JI6L 3RZDB 2WFWA 2JA6H 4X6AH 4AH6A 4OO1H 1GUSA 4CJ2C 1L2FA 2Z4IA 1JC7A 2OWOA 1EL0A 2I5LX 3PUWA 1I4RA 2B63G 2CW0D 1CA5A 3HOVB 1C0AA 4LJZC 3NBIA 2K28A 4P72A 1CKOA 1OXUA 4DAYB 1J9OA 1PH8A 1GUNA 2KJXA 3LNNA 3OW7A 4JI0L 4DAPA 1PYWD 1SYDA 2F0HA 4A3GB 4QMGA 3HKZB 1JICA 4IUNA 4OELB 2VUMB 2PMZB 1LTTD 2EY1A 4LF8L 5EQ0A 2NTSA 1WD0A 2K33A 2ENBA 1BOSA 3I72A 2E76C 4A3GG 4DR4L 2D2CC 2VUMG 1E24A 4QUFA 1NE3A 4HSVA 1I4HA 3H15A 1Q12A 2M9VA 4OX9L 1G2TA 3NWTA 1RCVD 1S3OA 3W3AA 3PQIA 2E2DC 1F2LA 1ESRA 4RGNA 1VQ7A 2ASBA 1QOHA 4KKSA 3F2BA 1AH9A 1STGA 2ZJPA 4NP5A 1TU2B 4JW0A 2R92B 1D1IA 2CCZA 4F8MA 4OX9Q 3H94A 5M3FB 3CCMA 1LTLA 3I7FA 5C4XG 4KY6A 2E74C 3U4ZA 1RD9D 3E9HA 1CFMA 1Q46A 3IFDA 1IYVA 1NMGA 4JV5Q 3JAMc 1HNZQ 4HIOA 1SE3A 2Q8TA 1I94Q 3H0GB 2SDFA 2KEEA 4X65L 1BNZA 1PFNA 4DV2L 2YTYA 4CJ0B 5I2YA 4N8X1 5JJIA 1I4GA 5DAUA 3HOYB 3SDZA 3OTOQ 3GO5A 4JI5Q 1O7ZA 1VQCA 2AMCB 3AQQA 1IXRA 1SNCA 2MUYA 4PMBA 5EBCA 4LFCL 3S1QB 4UHVA 2UXBQ 4M8AA 5M5YH 4FXKC 2XVSA 4A3KG 3DXJC 1SNQA 2ID0A 3FKIG 4NKLA 2EYLA 5ELDA 1F9PA 5IODA 1I6VC 2JN4A 4DUYL 3GTOB 3NQTA 1SBBB 4AQYQ 3TZUA 3DM1A 4Y52H 1PTOH 1VS0A 4DF7A 3SR1A 3UE0A 2J0TD 2LFNA 4G4KA 2FINB 4MTNA 2JA9A 3PO2G 2I46A 1TWHH 5IYCH 1GUWA 3E3XA 3R2IA 4YHHQ 1PDQA 1IW7C 3BVZA 5CGKA 3M3YB 3K5LA 2KBNA 2SNMA 3GTGH 4AQYL 3M4OH 1F9RA 4A3MG 1DD2A 1EOVA 1PH7A 1WVLA 1FGBD 2N88A 5FJ8H 1EY8A 1V43A 3MXNA 1A2UA 3NE5B 1WCMG 1XTDA 4PQXA 4KV6A 1XPOA 1A62A 4UY8C 1QUQA 2PW5A 3OMGA 3ZYYX 3F8TA 1BQQT 2QDBA 1HZ9A 2EJFC 3BG3A 3STBC 1PMRA 2B2WA 4R4OA 4BXXH 2D0PA 4BBSB 3IKJA 2QILA 4DV3Q 4A3DB 1LACA 4RCNA 2JA6B 4R4IA 1HUNA 3N52A 1EFID 4C3HB 5C44B 1J6QA 2EY5A 1I3QB 2WKCA 4DR4Q 3RUZA 3GTKB 3PO2B 4DR7L 3A7LA 2V4DA 4QUCA 2ZJQA 2OTLA 3FHWA 1SMYC 2WAQG 1J8IA 4BS9A 3OHXC 5C4JH 3Q22A 4RMFA 1QZGA 4Y7NH 3HOUG 3S1RH 4UPAA 4HCSA 4A3JG 1CQFA 1WYDA 2F0PA 1Z47A 4A3MB 1N36Q 4DNRB 1S72A 1MSHA 2H5XA 1WOCA 2XIWA 1ASYA 4WJWA 3DWAA 3S17H 1DYQA 1B8AA 2VUMH 1SLJA 1D6EC 1OXXK 4LF9Q 1I50B 5FLXE 1JOKA 5J22A 2O5IC 2LKVA 1CUKA 2ICIA 1BCPF 2ZXRA 5JAVA 2CQOA 3I4NG 4KKTA 4DR1Q 4JI8Q 1G2SA 4EQPA 3ICEA 1OXVA 3S1NH 2KHIA 2F03A 1TIID 2F3IA 2EY6A 3PO3G 1STBA 4DV5L 3I4NB 5KNCA 4DXGA 5CV5A 3Q24A 1B3QA 1U5KA 2K75A 1V1QA 4CDCC 1YHAA 5KEEA 3CW2C 3QOLA 4CKCA 1BO0A 4LF5L 2E2JB 4P73A 5HGTA 1Z6HA 4P71A 1EYGA 1PTOF 5EPJA 3AB9A 1ZYRD 3A8KE 1IBLQ 1BXTA 5CC4A 1I3QH 2VQFQ 1D8LA 1C48A 2IY5B 1ZKOA 1JB3A 1ZYRC 5E4WC 3S1MH 4UAIA 4BY1G 4DK6C 3AMUA 2JE6I 4Y7NB 1KIXA 4JV5L 2KVMA 1HNZL 2RCFA 5I4DA 1XNQQ 2L0CA 2R92H 3FRPB 4IFDH 2E5LL 1EY4A 1IBMQ 4B9WA 3F1ZA 2EZVA 2K50A 4L5RC 5CV8A 4XYOA 2BH8A 3EFXD 1MI2A 3ONAB 2FMMA 1EOTA 3DLLA 4KMUC 3TREA 3GV6A 2VS1A 1VF7A 1VQGA 4PMWA 4HIKA 2VZAA 3TP8A 2CHBD 2B8FA 5AJ3L 3PGZA 1RKNA 1LO5D 4G57A 1I4PA 4YY3Q 1DZ1A 1VQJA 1A3TA 3S14H 2NVTB 2OF1A 5D3IB 1KAWA 4A93G 1TWGH 2A74C 3C1FA 4KN7C 1V1OA 1VQEA 3S24A 1LABA 3MVVA 4BY1B 5HGQA 4WRDA 4N9TA 3OIPA 3DUZA 1U4PA 1JJ2A 1Z7TA 3T51B 1NY4A 1MHWC 1K73C 3P1HA 3MFGA 4R9WA 5CBEE 5C3XA 4JOIC 1Y1WB 5IYBH 1E22A 3A56A 2F0MA 3OIQA 2R93H 3PIPA 1ENFA 3CKIB 4J8QA 1TS3A 4EQ5A 1BDOA 3NPPA 5LMNL 3VR2A 1II3A 1E1TA 2MHVA 4Q5VA 2AUKA 1D5XC 2K5HA 3G4SA 2JA8G 5IYCG 1QUQB 1MJEA 1O7YA 1BF4A 1FVIA 1OO9B 2KEDA 4HTHA 2CFMA 2LS01 4JI4Q 3RZOB 1N33Q 3MC0B 5IY0A 3BYYB 1M8AA 4GOPB 4IZ8A 2CVRA 1YBYA 1CZWA 3QIAA 1PRTB 3U50C 2QDLA 4LFAL 2OQ0A 2UXDL 3D4RA 4JPBW 1PRTF 2EYJA 1MKHA 4LF6Q 2UUAQ 2PCFB 4B3MQ 3D8GA 4R8NA 2UUBL 3HOUB 1HHVA 2NVYB 3CHBD 3HP3A 1J5EQ 2R92G 3CRLC 2EOTA 5C44H 1AN8A 3V05A 5M3FG 2B2VC 4BY1H 4CDFC 4LF7Q 3GDEA 4A76A 4X62L 1FYCA 4NXML 1SMXA 5I6WA 4A75A 4IPGA 4QB4A 4DNTB 3FEWX 5EKLA 3T1HL 4JOIA 4LFAQ 2PPBC 1D5MC 1CZGA 4GN3B 3MZ5A 1SEBD 3F2UA 1Y8OB 2EYPA 3TS0A 2R93B 5KYIA 1EQVA 2F0WA 2HCCA 3S16B 1YNXA 3HG9A 3R2TA 1SSOA 4KLKA 1G291 1XMOL 4LFBL 4CKBA 3TZDA 2IHFA 4A3IG 4HJ7A 3RN5A 2JXMB 1GVPA 3BJUA 1EQTA 3ERQA 1H95A 1MGSA 3MEHA 1TT2A 3FKIB 3TP5A 1KD1C 4IPCA 3A7AB 1AFPA 1PH1A 3AYHB 3DMUA 1XMOQ 4A3KH 3LWEA 5KNBA 4GNXA 4DV1Q 3K80C 1PA6A 1RHPA 1LV9A 2RDHA 4CDEC 2LY7A 2EYHA 3M85A 2RHQB 4RKLA 5C3EB 1JR0D 4QGUA 2KOLA 3U4VA 4GS3A 4KD4A 1W2BA 2AHOB 1M90C 2K6AA 1XNRL 4RGOS 4HJ8A 3NQIA 3ND9A 2E2JH 4DR6L 3URYA 5IWAL 1TY0A 3HOWB 2B2TA 1Y1VG 2UXBL 1JORA 3DEOA 3J81c 2O2LD 2IW3A 4HIMA 1XMQQ 1CKMA 2EXDA 3A8IE 4XYQA 1K8MA 3BZKA 5M3MB 1BCPC 3RZDH 4IUVA 1NTGA 4A3FH 3GTQH 3ND8A 4LAAA 5K5PA 4LUZA 1BCPD 1ONLA 2BH2A 4A3CG 5JVH3 3PCOB 1N32Q 5LHY1 3M4QA 1LYLA 2F0KA 3L7ZC 3NBHB 3KF6A 4OO1I 1XXGA 3PUYA 1YI2A 4OO1G 2X69A 2JA8B 4OEMB 5IP7H 1E2ZA 5CR3A 2XRSD 1L1OC 1IZ6A 3K58A 4QY7A 3TEHB 4C1NK 2L5TA 4HCEA 3Q0AA 3DHQA 4GN5A 1WJJA 4X65Q 2LXJA 5C0XJ 1BR9A 1G51A 3CCUA 5ELNA 1XNQL 2WACA 4DKAC 1D1KA 3J81L 1O7IA 1EY6A 1SYFA 5C0XI 1OTCA 2K14A 2F1MA 1HR0L 1OXSC 5FJ8G 2A8VA 5J3BA 4CHTB 3G71A 1ICWA 1PTOD 4JBMA 4WFN3 1F9SA 4YCWA 2R61A 5CYUA 1PHJA 1S5BD 4PMCA 3NSWA 2OXPA 3KOJA 5C44G 2MO1A 3OPOA 3A74A 5M3FH 4HJ9A 1MD2D 1CM9A 1CKNA 2CKZB 2IPKD 2N3SA 1EEID 1UUPA 1SDFA 4X62Q 3FVQA 5DLQE 2G9HD 3I56A 2EDGA 1Q86C 3W1BA 5FO8B 2L12A 2NN6H 1DXMA 1YHBA 4IPDA 3PF5A 2A73B 5LL6S 1JOQA 1H9KA 2OTJA 3I73A 2E2IH 1AZPA 1G91A 4RGTA 1I6HH 3AFQA 1STHA 4DV0Q 2JJQA 4AYBE 4R8IA 4R1JA 4DV4Q 4DR5L 1JMCA 2HDMA 3U9SA 2GN5A 4DV6Q 2F52A 3QJYA 3SHLA 4YCUA 2JA8H 4XT3B 2OEOA 4YCVA 1I4QA 3QG1A 3VR4A 1HNXL 3H0GH 4J15A 2AQ2B 2AQ3B 1L0XB 3KLSA 3HKZE 1GHJA 2YV5A 1DOMA 3GV3A 4OHJA 1TWCH 1VQ4A 4GZYC 1EY0A 2CQAA 4KHVA 3GTOH 1FR3A 3HOXB 2PMZE 4A3LG 3VR6A 1LT5D 3I4OA 4MNOA 3ULJA 4TSSA 1CT1D 4H13C 2QA4A 4O1NA 3NXWA 2MJ8A 4RHRA 1STEA 3CCLA 1TWHB 5IYDH 3NUCA 2X6LA 4JI5L 3OTOL 1VQHA 2MGSA 3F2DA 1CHQD 5I6YA 1W6JA 3MAQA 1VQPA 3A5ZB 1SJHD 2ZM6Q 4DK0A 3VYSA 4A3EH 3HOZB 2B2WC 1MJCA 5EPKA 4GNXC 4A3KB 1IBML 3GTPB 2R7DA 1WTWA 2MQHA 2NUCA 3KDFB 4IOCA 1HUMA 4LF9L 4MZ9A 1BBUA 1E2WA 2IJ0A 2XNAC 1XNRQ 4YWMA 2DY8A 3L0OA 2RQXA 2XWBB 1Q3LA 2KHJA 3MXUA 4K5WA 5ISRA 2E8GA 4DV0L 3H6MA 2KECA 3GP7A 3HOWH 4C2MB 2NN6I 1ENAA 3NENA 2NZOA 2PO4A 4FF3A 3J80E 3HOYG 1BKBA 3NBHA 2RA4A 4YY3L 3GTKH 2D62A 1PRTD 1R4QB 2N78A 1AW7A 1P8LA 1HNXQ 4BBSH 3BZDB 3J80c 2AQ1B 1YHQA 2AWNA 3MXPA 4QL5A 4K8JA 1YZ6A 3TS2A 4A3DG 1IBKQ 4AYBB 3FPPA 4A93B 5ELCA 2JA6G 1KNAA 1K83H 4A3MH 3K7AH 3C46A 3K5MA 1WTOA 3NTHA 4IJLA 4U673 2KHSA 5D3DA 4ODGA 2OT2A 1IKLA 2RCNA 2G9DA 2JA5H 4H0LC 3OSOA 3CC7A 4LF4L 4RA8A 4IURA 1EWHA 2WP8J 4EQOA 2KQ3A 1PYBA 3H3VC 1EY7A 2YU9H 5C5MA 3UDXA 5A35A 5LL6X 1HTPA 4LNQA 5IP7G 3KUPA 3NEMA 4LUOA 1GM5A 4N8FA 4A3EB 3HOZH 3TQYA 3V96A 2R6GA 2XGTA 1I5FA 3S17B 5IGEA 4FYDA 3I4NH 4A3CH 2BA0A 1NR4A 1U0LA 2XN9C 4HEDA 3T53B 1QVCA 1GO3E 2DY7A 1M4VA 4JI4L 4B3SL 1A2TA 1VQOA 3OWFA 2QW7A 1VF5C 1WCMB 5AJ3Q 3D6CA 4DV6L 4UP8A 4XQNA 1QVGA 4L5TA 1XPRA 2TMPA 1FJGL 1HQRD 1EQQA 2FMCA 2Q2IA 1VQBA 3CPFA 4Q0FA 1B3AA 1VQFA 2IHEA 1Q82C 1KDBA 4XXEA 3X3MA 1EU3A 1X32A 3HFZB 2N55A 2NN6G 4IPHA 4XDXA 1YJ9A 3NELA 1T5EA 4L5SA 4LW1A 5C3WA 5E1FA 1FNWA 4FO2A 2A6HC 1V1PB 3S1MB 1FJGQ 3SK4A 5IWAQ 2E2HB 4C3IG 5IYDG 2UUCL 1U4RA 3I8ZA 1EWCA 4LF5Q 2K4KA 4CKEA 4QCLA 5C4XB 4H02A 3VA7A 5LMNW 1C7YA 1NNXA 1EUJA 4GOPC 3IFTA 1Q7YC 4YIJA 3DWQA 1O7LA 2A6EC 4TRDA 4S3SA 4BBRH 1KC8C 1S5DD 2EVBA 1JWUD 1ILPA 1HH2P 5DM63 2EJMA 5C4JB 3HOXH 3P75A 2Z1CA 3D31A 4DV2Q 5JVG3 4K0KQ 1U4LA 4H44C 1VQNA 2CWAA 2NTTA 3SEBA 2EYOA 2X6GA 4MIUA 5FK9C 3PO2H 2B39A 3A0JA 5J39A 1U9RA 1TWCB 3GD7A 3I4LA 1ESFA 5KNDA 2UUAL 2ATWA 4KI0A 4QIWE 1ET9A 2CW0C 3EA6A 3I3CA 3TDQA 3S1RB 4EGVA 3I4MB 1LT3D 1R9TH 1K0SA 4ULLA 3W2DA 2JSOA 3G6JB 1AEXA 3KLSX 4M1UB 3T1HQ 1ASZA 1VQ9A 3KLWA 2HDLA 5HY6A 3GTPH 2Q2HA 4GOPA 1C9OA 1XMQL 1SFOH 1I50H 4GLAC 4BY7G 1IW7D 3CC4A 2F0NA 3BZCA 1SN8A 5LMNQ 3C1EA 1Y8PB 5C3EG 1HZAA 1H9JA 1VQDA 1Y1VH 3K7UC 5CBAE 3EBEA 2LMCB 3QB3A 2HCIA 1Q8IA 5IGBA 3GTJH 4OL7A 2K5VA 2K5NA 4RG1A 3W1GA 4A3EG 1S40A 5JJLA 1VQAA 1X3GA 2DJFC 1X55A 4HAEA 1GUTA 4JI8L 1B70B 2HHHQ 1Y14B 4FDBA 1WTHA 1F2ZA 2DNCA 2JK8A 2JA7B 4C1NI 4R4QA 4U68A 2Z8LA 1H9SB 2A68C 2LSSA 3LWUA 1X3EA 2Q2UA 5NUCA 3EROA 5JJZA 1RTOA 3R8BA 4FNFA 2PQAB 2Z6KA 2B8GA 5EBDA 1SAPA 4CJ1B 2K5WA 5JEAG 3PSIA 1FNVA 5J1ZA 3VA5A 4OWTB 5I9OA 3IAYA 4J6HA 4HJAA 4C56C 1Y8NB 4E6IA 1B9MA 2XRQD 1RDPD 3J81i 1K83B 1KAAA 2GVAA 1PH2A 2SOBA 4PZ6A 1N34L 1CI3M 1I4XA 3VDYA 1TS5A 3KYHC 3S2DB 5M5WB 1SYBA 2B63B 3GTMB 4A3BG 4IALA 5IGCA 2EY2A 3AU7A 1A63A 2VNUD 3PIOA 1PZID 4RHSA 3VYRA 5JPMC 2YU9B 4RFBA 4BA2I 1CHPD 1BUVT 2ZXPA 4LF7L 4DR3L 4PNYA 2R7ZG 1STNA 1H9RA 4ZKCB 2KCNA 3HS0C 1TWAB 2F4VQ 2RDFA 2WIIB 2WB1E 4DK1A 1V1PA 2ZTCA 2ZM6L 4POFA 3Q23A 3RLNA 4X66L 3K5NA 2IWHA 1NSNS 4IOAA 2XTIA 4NW2A 4X64L 2BDOA 1LLRD 5CV9A 1EYCA 4DV1L 1MSGA 2JA7H 4KY7A 5FO7B 2KUMA 3ER0A 1T5XD 5BR8L 3PIP3 4DR3Q 1WCMH 4LFBQ 3VR5A 4KJNA 1PRTC 1GUOA 2FXQA 4JCVE 1XX8A 3E0JA 2UXCL 5F2DA 4RGMA 1EY9A 4G7HC 1XPUA 3J7ZC 1SE8A 4ID6A 1Y1WH 4OIKA 1EIHA 1JJGA 5CV7A 4HSPA 1HCZA 1B50A 3R3OA 1X65A 1E3PA 2F0JA 2YYZA 2NZ1D 2QF7A 1DGSA 4IUPA 1VQLA 3ULPA 1HXYD 2I5MX 2Q8RE 4L5QA 1JB7A 5C4XH 1PFMA 2B2YA 4DFAA 3P7JA 1B1ZA 3S15B 3PUZA 5I9PA 2E2HH 5EAYA 2D0OA 2HHHL 2B2YC 4DK3C 3WWVA 1VQKA 4RAUC 3AFPA 3BU2A 4DR6Q 1UWVA 1Q81C 1PH6A 2F0UA 3R93A 1YJNA 1PV4A 4A3IB 4BA1I 4CDDC 1EZ6A 4PG3A 1IHZA 4BBRB 4KY5A 5ELEA 4NDXA 1K8OA 3GTLH 1BBXC 2Z0SA 2UU9L 1JCKB 3EVQA 4NXNQ 1SE4A 1CQVA 2NB0A 4DN4M 1SMYD 4JC0A 2K32A 4MN3A 2E75C 4O0AA 1K28A 1VQIA 1S5CD 1EIFA 5M5YB 5D14A 4HJ5A 2EJGC 2JQOA 4GKKL 4ME3A 4B3RL 1L0YB 4JI3Q 2F0QA 2CH4A 1KABA 3K6OA 3NP8A 4DAMA 3BYTB 2JP1A 3JAME 3LGJA 1W3SA 1F77A 4X3KA 4X3SA 3H3VH 5KGUA 5LMUQ 2DN8A 5KRUA 2KCMA 1YIJA 1GD7A 1S4ZA 2NWGA 4P2CB 5C0XH 1HFNA 4GKKQ 3KK7A 3M3YH 3CCVA 3CMAA 1KLGD 4PV1C 3S15H 4DUZQ 1SNPA 4FF2A 2B2UC 3M7NA 1FD7D 3J81j 3B6YA 3HEJA 1CKNB 5DNFA 1STYA 2VW9A 1JT8A 1FGUA 3HRZC 4A4IA 1NCVA 2A6ED 4FXDA 2NVQH 3OYYA 3V2TA 2Y0SB 4G7ZC 2Z6KC 2JA5G 2IX1A 2PW7A 1EYAA 1X9NA 3K0YA 2B29A 2SEBD 5M5XH 1XYIA 1NJIC 3G48A 5GAHC 5EJWA 1UE5A 2L9HA 3CC2A 1X56A 2L15A 3D4DA 3I70A 2HIVA 5EGTA 3CQZB 1ML0D 1MBYA 3UDFA 2WKDA 1BCPB 4GKJL 3VYTA 2YTVA 2PZWA 2DNEA 4DPGA 2WAQB 5M3MH 1ENCA 2NBFA 3RN2A 2Z9HA 4KHZA 1QG7A 1CTMA 3BDLA 5ELBA 1LTSD 1SYGA 3DM3A 2MNAA 1NR2A 2UXCQ 5FLXL 2GVBA 1WTXA 2NVXH 4ALPA 1WD1A 2Y0SE 3SE0A 1JOOA 2R3ZA 5D65A 3CD6A 4K2KA 4IN3A 4B08A 4ZUIA 2BE5C 3K59A 1KLUD 3S9WA 3TMEA 4ABNA 2BE5D 4RWSC 4HR7B 1KHIA 1UE6A 1EZ8A 1IL2A 2A1AA 3IL8A 4C3HG 3KJPA 2UUCQ 3K5OA 1Q90A 5TSSA 2J4XA 1VMCA 3S1NB 1N33L 4WJ3M 3A5UA 2J7ZA 1JWSD 4FVMA 2B2UA 1AE3A 1SR3A 1TWAH 2P5ZX 1VQMA 1K0RA 1PFBA 3STBD 1N9WA 3SXHA 3CAMA 1PH4A 5BN5A 1KRTA 2HQEA 4O42A 1PZJD 1F2YA 4EQNA 3J7A5 4NPSA 5IIFA 3KDFA 2A69D 1TWFB 4X64Q 1FNUA 3KF8A 4K0KL 2A69C 2N8NA 2BOSA 3P20A 1S5ED 4JI1Q 3K7AB 4GN4B 4NXMQ 5L37A 3OW2A 3K81C 2ZXOA 4FP5D 1WI5A 5COYA 4A3FG 1QNKA 3QOJA 2QKIC 2PNHA 5G3LD 4KTAA 3H0GG 4YHHL 3FPUB 3H91A 3TP6A 1X3FA 2A19A 2GA4B 5JPNC 3LX0A 2NVXB 5M3MG 4ZUJA 1LTID 3FMCA 4TVAB 3CCEA 1CA6A 2F0VA 1DM0B 1HA5A 3ITPA 1LT6D 3NK9A 2HIXA 1TR5A 1U4MA 3E9IA 3EIVA 4NMZA 1ICFB 1FL0A 2K1BA 3J80L 4BY7H 1E1OA 5EPLA 5FLMG 2F0IA 2F0FA 3I2ZA 3UDGA 1JWMD 3M7GA 4L63B 4QJFA 2F0DA 4QIWB 4DV4L 4DR5Q 2OQKA 1JE4A 3BDCA 4IJHA 5H1SE 4YWLA 1XTCD 2QCPX 3PMFA 1G8ZD 3WDNA 3I55A 1TWGB 4YWKA 5IGFA 3SVMA 4X3TA 5CORA 1Y1WG 1B53A 4F7XA 5I2XA 3CCSA 3KFUA 1YNND 1KXLA 5EKKA 2B2VA 4FXGC 2Q8IB 4WJ4A 4JVZA 4DR7Q 1PYSB 3ZJYC 1HPCA 5IP9G 4V190 4MTKA 1VQ8A 3RLFA 3BVGA 3MA2B 4PZ7A 1EWIA 2K7VA 4DR1L 3ERSX 5KIXA 3S2HH 1UEBA 4UDUC 1L0WA 3CXCA 1CSPA 2R7ZH 4NXNL 1NBWA 2EPBA 1TS4A 4BBSG 4QQBX 4TQUS 3GQBA 3KF8B 3VR3A 1B9NA 3HOYH 4B9XA 1TQOA 1WTQA 2L4NA 3QO2A 5JEAJ 1GJXA 3MEFA 3QWNA 3E6ZX 1GHKA 4CGYB 2WAQE 3CCRA 3KF6B 3MTSA 1GUGA 4DUYQ 1GKHA 1QZHA 4A93H 3RNUA 5ELOA 3BVMA 1WTPA 4G7OC 1R4PB 3CQZH 3T13A 2LXKA 2ZJRA 3AEVA 2I07B 2D5DA 3T56B 2F4VL 1M1KC 4ZCKA 4GLXA 1HRJA 1VCIA 2G5DA 4LF8Q 3HOUH 3MHBA 3DEPA 3CP0A 2NVYH 1ET6A 3MFYA 4HMIA 2VQFL 3I4MH 2VQEL 4K5XA 3MXNB 3S16H 1TY2A 1R9TB 1YVCA 5CMDA 3NWSA 1VQ6A 2IX3A 1RF2D 1W6KA 4J1MA 1HR0W 1QVFA 4IFDG 4LWCA 2VB3X 1DJRD 2NZHA 3X3NA 3K57A 2EIFA 2PQEA 1PTOB 2ICEC 2PZTA 4L6TB 1EYDA 3U9OA 3GTGB 2R93G 3M4OB 1DCZA 4DAVA 4DV5Q 2ES2A 1KRSA 2I5HA 4DAYA 4ZRZA 2K03A 3D0FA 4I65A 2PYKA 2V1CC 1N34Q 1SRUA 4OXPA 4XIGS 1EFWA 1Y69U 1E2VA 4DV7Q 3EQLC 4JI7L 3JAML 4RH6A 2A5HA 3WOEA 2WV6D 1BBWA 2TSSA 4RCOA 1AE2A 1RIPA 2H1EA 5IE8A 1MIUA 4UP7A 5KYLA 1GOZA 4C3HH 1N8RC
chains in the Genus database with same CATH topology
4QGUA 5GQOA 2IX0A 1PH8A 3U4VA 4A3BG 2KENA 4GS3A 1W2BA 1M90C 2AHOB 5FLMH 1XNRL 4JI0L 4HJ8A 1A63A 2E2JH 2VNUD 3PIOA 4DR6L 4X66Q 5IWAL 5C3EH 1JJCB 4DNIA 4B3SQ 1Y1VG 2UXBL 2E5LQ 4BA2I 2UU9Q 3J81c 4LF8L 4LF7L 4DR3L 2R7ZG 4HIMA 4LFCQ 1XMQQ 1UE7A 4A3GG 1CKMA 1QVFA 2F4VQ 4DR4L 2EXDA 3HOWG 2WB1E 2YTXA 1K8AC 4JI0Q 3BZKA 2VUMG 2ZTCA 2ZM6L 4POFA 1E24A 3RLNA 4X66L 3RZDH 1NTGA 4A3FH 4IOAA 3GTQH 4KHPL 2XTIA 4LUVA 1NE3A 4LUZA 4X64L 3H15A 2B63H 1Q12A 1SROA 4OX9L 2BH2A 1S3OA 1CSQA 4DV1L 4A3CG 2JA7H 4A3JH 3PF4A 3ER0A 5BR8L 4DR3Q 3PCOB 1VQ7A 2ASBA 1WCMH 4LFBQ 1N32Q 3M4QA 1LYLA 3L7ZC 3NBHB 3F2BA 3KF6A 5LMUL 4OO1I 1AH9A 2FXQA 4PZ8A 3PUYA 4JCVE 3K8AA 4JI2Q 1YI2A 4OO1G 2UXCL 5IP7H 1XPUA 2ZJPA 3J7ZC 1SE8A 1Y1WH 1JJGA 1L1OC 3Q8DA 3RR5A 1X65A 1IZ6A 2MO0A 1E3PA 2CCZA 4QY7A 3TEHB 2YYZA 2R7FA 4OX9Q 1DGSA 3CCMA 1VQLA 3ULPA 2I5MX 1LTLA 3I7FA 1WJJA 4GN5A 4JI6Q 4L5QA 2OCEA 4X65Q 2LXJA 1JB7A 5C4XG 1D7QA 5C4XH 5C0XJ 1XJVA 3U4ZA 3HKZG 1G51A 3CCUA 5ELNA 3E9HA 4HIDA 1XNQL 4DKAC 3HOVG 4DV7L 1Q46A 3PO3H 1O7IA 1NMGA 4JV5Q 3JAMc 5C0XI 4HIOA 2ZTEA 1HNZQ 2K14A 3PUZA 1J5EL 5EAYA 1OXSC 1HR0L 2D0OA 1OTCA 2E2HH 5FJ8G 2JEBI 2RHSB 3F2CA 1I94Q 5J3BA 2HHHL 2A8VA 1X6OA 4X65L 3G71A 4DK3C 3WWVA 4DV2L 4JBMA 1VQKA 2YTYA 3AFPA 5JJIA 4YCWA 3BU2A 1PHJA 4DR6Q 3CF5A 3TRZA 3OTOQ 4JI5Q 1UWVA 3GO5A 1Q81C 1PH6A 3KOJA 1VQCA 2AMCB 3AQQA 2MO1A 5C44G 3A74A 5M3FH 4HJ9A 1YJNA 1PV4A 4BA1I 1IXRA 1CKNA 2CKZB 1KL9A 2N3SA 4PG3A 2CWPA 4LFCL 4X62Q 5DLQE 3I56A 3JAMi 1YITA 3GTLH 2UXBQ 1Q86C 2Z0SA 1T9HA 3W1BA 5M5YH 2UU9L 4NXNQ 4A3KG 1YEZA 1YHBA 4IPDA 3PF5A 3PUXA 2ID0A 3FKIG 4JC0A 3CPWA 2OTJA 2VY3A 4LF4Q 4O0AA 1VQIA 2E2IH 4DUYL 1EIFA 2UXDQ 1I6HH 3AFQA 4AQYQ 4DV0Q 4HJ5A 2JJQA 4AYBE 2QGQA 4Y52H 4R1JA 2JQOA 4GKKL 4ME3A 4DV4Q 3L2PA 4DR5L 1JMCA 4B3RL 1VS0A 1N36L 3UE0A 4JI3Q 4POGA 2GN5A 4DV6Q 2F52A 2JA8H 4YCUA 1X54A 3HOZG 4MTNA 4A3IH 2JA9A 3PO2G 4YCVA 5IYCH 1TWHH 4DAMA 4JYAL 3LGJA 1W3SA 4YHHQ 1HJPA 1HNXL 3H3VH 3H0GH 4J15A 4JI2L 5LMUQ 3UE1A 2KBNA 3HKZE 4EX5A 2YV5A 2AKWB 3GTGH 2KCMA 4AQYL 1YIJA 3M4OH 1GD7A 1TWCH 1VQ4A 4A3MG 1EOVA 4GKKQ 4GNXB 1PH7A 3M3YH 3GTOH 3CCVA 1PH5A 2JEAI 2PMZE 3CMAA 4A3LG 4JBJA 5IP9H 5FJ8H 3I4OA 3S15H 4MNOA 4DUZQ 4KHPQ 1V43A 3M7NA 3ULJA 4B3TQ 5M5WH 3J81j 3B6YA 1HNWL 2QA4A 1CKNB 1WCMG 1XTDA 2VW9A 4UY8C 1XPOA 1A62A 1JT8A 1QUQA 2RF4A 3CCLA 1FGUA 3G6EA 3F8TA 4A4IA 1PH3A 5IYDH 1HZ9A 3T1YL 3STBC 4R4OA 4BXXH 2NVQH 4B3RQ 3OYYA 2D0PA 4JI5L 3OTOL 4DV3Q 1VQHA 3ULLA 2VQEQ 3F2DA 2Z6KC 2JA5G 2IX1A 4R4IA 2PI2E 1X9NA 3S2DH 2B29A 1J6QA 1VQPA 2PI2A 1IBLL 3GTMH 3A5ZB 4OWWB 2ZM6Q 5M5XH 1NJIC 4C3JH 4BBRG 3G48A 4DR4Q 5GAHC 4A3EH 1UE5A 1MJCA 3CC2A 1X56A 4DR7L 2L15A 5K36G 2I0QA 4O2DA 5GROA 4GNXC 2HIVA 2ZJQA 2OTLA 3FHWA 2WAQG 1IBML 4XTCS 1K9MC 2R7DA 5C4JH 3UDFA 2PQAA 4RMFA 4LF6L 2MQHA 1QZGA 4B3ML 3E0EA 4Y7NH 3KDFB 3HOUG 4GKJL 3M4PA 4IOCA 3S1RH 4UPAA 4MZ9A 1KQSA 2YTVA 1BBUA 4A3JG 4LF9L 2HT1A 1WYDA 1XNRQ 4YWMA 1Z47A 4DPGA 5M3MH 3L0OA 3RN2A 4KHZA 1PH9A 1N36Q 2HQLA 4JI3L 2KHJA 1S72A 4A3BH 2E8GA 2H5XA 4DV0L 1WOCA 2K52A 4P75A 3DM3A 3CMEA 1IYJB 1Z9FA 2MNAA 1ASYA 3H3VI 3HOWH 3S17H 2UXCQ 2NN6I 1B8AA 2GVBA 2NVXH 3NENA 4ALPA 1HR0Q 2NZOA 1SLJA 2N49A 2Y0SE 5GADC 2VUMH 3RZOH 1OXXK 4LF9Q 3HOYG 1BKBA 3GTKH 3CD6A 2B3GA 4YY3L 2D62A 2DGYA 1CUKA 2N78A 3PV0A 4AYBG 4JYAQ 4C2MH 1P8LA 1HNXQ 2CQOA 3I4NG 4BBSH 3J80c 4DR1Q 1YHQA 4JI8Q 2AWNA 3SGIA 4DR2L 3ICEA 1OXVA 1L1OB 3S1NH 2KHIA 4QL5A 1YZ6A 3TS2A 2Y0SG 2F3IA 1KHIA 1UE6A 1IBKQ 4A3DG 1IL2A 2A1AA 1G6PA 3PO3G 2JA6G 3HOVH 3KJPA 2UUCQ 1K83H 2EQSA 5C0XG 3K7AH 4DV5L 4A3MH 1A8VA 1Q8KA 1N33L 1U5KA 2K75A 4IJLA 4WJ3M 3A5UA 1V1QA 4GKJQ 1AE3A 1SR3A 1TWAH 2RCNA 2JA5H 1VQMA 1YHAA 3CC7A 4LF4L 1K3RA 3CW2C 1K0RA 3STBD 1N9WA 4APVA 3CAMA 3J80i 1PH4A 4LF5L 1KRTA 1PFSA 2WP8J 4P73A 1PYBA 4P71A 4UP9A 1EYGA 3J7A5 2YU9H 4LNQA 3UDXA 4NPSA 5E7NA 3KDFA 1NMFA 5IP7G 1IBLQ 4X64Q 1A0IA 1I3QH 3NEMA 4LUOA 1GM5A 2VQFQ 3HOZH 1D8LA 4K0KL 2ZTDA 2IY5B 3TQYA 2N8NA 3S1MH 2R6GA 2XGTA 1I5FA 4DK6C 4BY1G 4JI1Q 2JE6I 4GN4B 4NXMQ 2BA0A 3I4NH 4A3CH 3W5OA 3OW2A 3K81C 1U0LA 1KIXA 4JV5L 1QVCA 1HNZL 2JA7G 1GO3E 1WI5A 3UDIA 2NVTH 1XNQQ 4A3FG 2R92H 4JI4L 1HNWQ 2E5LL 2PNHA 3JC66 3H0GG 1IBMQ 4B3SL 3F1ZA 1VQOA 4YHHL 4AIMA 1X3FA 2A19A 2K50A 5AJ3Q 4L5RC 4DV6L 2BH8A 4UP8A 5M3MG 1QVGA 4L5TA 1XPRA 4GLVB 4TVAB 3CCEA 1FJGL 4NB3A 2WB1G 3DLLA 1LM0A 3TREA 2HIXA 4R4CA 3KJOA 2VS1A 1EQQA 1VQGA 2Q2IA 3E9IA 1VQBA 4R4TA 3CPFA 3EIVA 4PMWA 4HIKA 3M9BA 2VZAA 3U58A 1VQFA 2IHEA 5AJ3L 1Q82C 1FL0A 3PGZA 4BY7H 1E1OA 5BR8Q 4YY3Q 5FLMG 1VQJA 1B7YB 3S14H 2DUDA 3HFZB 3I2ZA 2NN6G 1TWFH 4IPHA 1KAWA 1YJ9A 3NELA 4JI1L 4L5SA 3UDGA 1LUZA 4LW1A 4A93G 1TWGH 4QJFA 4DV4L 4DR5Q 4B3TL 2OQKA 3FP9A 1E7ZA 1FJGQ 5IWAQ 1VQEA 3S24A 3EN2A 4IJHA 5H1SE 4YWLA 5IYDG 5HGQA 3I55A 2UUCL 4YWKA 1JJ2A 1Y1WG 3CCSA 1KXLA 4LF5Q 2K4KA 4JBKA 3KFUA 4H02A 1NY4A 5LMNW 4WJ4A 1C7YA 3RLOA 5GAGC 2MFIA 1K73C 1EUJA 4DR7Q 1PYSB 3ZJYC 3CCQA 4GOPC 1Q7YC 4JOIC 5IYBH 1L1OA 5IP9G 1E22A 1KC8C 4BBRH 5FLXc 2R93H 1WFQA 3S1QH 3PIPA 2UUBQ 1HH2P 1VQ8A 3HKSA 3RLFA 4DUZL 3HOXG 4IFDI 3HOXH 4C3IH 1K8GA 4OWXB 3D31A 4DV2Q 4K0KQ 4EQ5A 5JJKA 1YJWA 5LMNL 4BXXG 1VQNA 1V9PA 2CWAA 4JG2A 5IYBG 4PZ7A 1E1TA 1EWIA 4IFDJ 4DR1L 3ERSX 3T1YQ 2JA8G 2K5HA 1UEBA 3G4SA 4OONA 4JI7Q 3S2HH 1L0WA 5IYCG 1QUQB 3CXCA 1MJEA 3PO2H 1CSPA 1FVIA 2R7ZH 3A0JA 4NXNL 1NBWA 3GD7A 2VL6A 3I4MG 4BBSG 4QQBX 2CFMA 4TQUS 4JI4Q 2UUAL 2ATWA 4KI0A 4QIWE 2KCTA 3KF8B 1N33Q 1Q1BA 1BVSA 5IY0A 3HOYH 1EQRA 4GOPB 5JEAJ 4JBWA 3MEFA 2AWOA 1R9TH 1YBYA 2WAQE 3CCRA 1IBKL 3KF6B 3U50C 4LFAL 3K0XA 2OQ0A 2UXDL 3IRBA 4DUYQ 1GKHA 1QZHA 1MKHA 1ASZA 1VQ9A 1HZCA 3T1HQ 2UUAQ 3RNUA 5ELOA 2Q2TA 4B3MQ 4LF6Q 4A93H 3KLWA 1EIYB 4IO9A 5HY6A 3CQZH 2UUBL 2Q2HA 2LXKA 3GTPH 2ZJRA 4GOPA 1C9OA 1J5EQ 3AEVA 2R92G 1XMQL 2ALYB 1SFOH 1I50H 2F4VL 4GLAC 4BY7G 1M1KC 3CC4A 1Q1EA 4A3GH 1PVOA 1HZBA 3BZCA 5C44H 5M3FG 1SN8A 4GLXA 4BY1H 5LMNQ 1VCIA 4LF7Q 3GDEA 4LF8Q 3HOUH 4A76A 4X62L 3CP0A 4NXML 2NVYH 1SMXA 5C3EG 4A75A 4IPGA 2C35B 1HZAA 1Y1VH 1VQDA 3K7UC 3T1HL 4JOIA 2IT1A 1P16A 3EBEA 4LFAQ 5IT9c 4DV3L 1JE5A 2VQFL 3I4MH 3GTJH 2K5VA 2K5NA 3MXNB 4GN3B 2VQEL 3S16H 4A3LH 4RG1A 3FKIH 1YVCA 3W1GA 3PUVA 4A3EG 1S40A 1VQ6A 5JJLA 1VQAA 1VQ5A 3TS0A 1X3GA 1X55A 1UE1A 3CCJA 1OXTA 1RL2A 4JI8L 1B70B 4DR2Q 1I94L 1HR0W 2HHHQ 4LWCA 1Y14B 1TXYA 1YNXA 2QEXA 2NZHA 4IFDG 4FDBA 5GAEC 2EIFA 1G291 2JK8A 4KLKA 1XMOL 4R4QA 4LFBL 1N32L 2R93G 2IHFA 4DV5Q 2LSSA 2BA1A 4A3IG 1X3EA 2Q2UA 4HJ7A 3RN5A 2ES2A 4A3DH 4P74A 1KRSA 4JI6L 1GVPA 2WFWA 2I5HA 3BJUA 2PQAB 2JA6H 3D0FA 4X6AH 2V1CC 1N34Q 1SRUA 2Z6KA 4OXPA 4AH6A 1H95A 5JEAG 3PSIA 4XIGS 1EFWA 1L2FA 1KD1C 4OWTB 4DV7Q 4IPCA 4HJAA 1PH1A 3AYHB 2OWOA 4JI7L 1XMOQ 2I5LX 3PUWA 2B63G 4A3KH 3J81i 1BBWA 4GNXA 1C0AA 4DV1Q 2GVAA 3K80C 1PA6A 1PH2A 1AE2A 1RIPA 5IE8A 4PZ6A 1MIUA 4P72A 4UP7A 1N34L 1CKOA 1OXUA 3M85A 2RHQB 3VDYA 4DAYB 3KYHC 4C3HH 1N8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGU A;  5GQO A;  2IX0 A;  1PH8 A;  3U4V A;  4A3B G;  2KEN A;  4GS3 A;  1W2B A;  1M90 C;  2AHO B;  5FLM H;  1XNR L;  4JI0 L;  4HJ8 A;  1A63 A;  2E2J H;  2VNU D;  3PIO A;  4DR6 L;  4X66 Q;  5IWA L;  5C3E H;  1JJC B;  4DNI A;  4B3S Q;  1Y1V G;  2UXB L;  2E5L Q;  4BA2 I;  2UU9 Q;  3J81 c;  4LF8 L;  4LF7 L;  4DR3 L;  2R7Z G;  4HIM A;  4LFC Q;  1XMQ Q;  1UE7 A;  4A3G G;  1CKM A;  1QVF A;  2F4V Q;  4DR4 L;  2EXD A;  3HOW G;  2WB1 E;  2YTX A;  1K8A C;  4JI0 Q;  3BZK A;  2VUM G;  2ZTC A;  2ZM6 L;  4POF A;  1E24 A;  3RLN A;  4X66 L;  3RZD H;  1NTG A;  4A3F H;  4IOA A;  3GTQ H;  4KHP L;  2XTI A;  4LUV A;  1NE3 A;  4LUZ A;  4X64 L;  3H15 A;  2B63 H;  1Q12 A;  1SRO A;  4OX9 L;  2BH2 A;  1S3O A;  1CSQ A;  4DV1 L;  4A3C G;  2JA7 H;  4A3J H;  3PF4 A;  3ER0 A;  5BR8 L;  4DR3 Q;  3PCO B;  1VQ7 A;  2ASB A;  1WCM H;  4LFB Q;  1N32 Q;  3M4Q A;  1LYL A;  3L7Z C;  3NBH B;  3F2B A;  3KF6 A;  5LMU L;  4OO1 I;  1AH9 A;  2FXQ A;  4PZ8 A;  3PUY A;  4JCV E;  3K8A A;  4JI2 Q;  1YI2 A;  4OO1 G;  2UXC L;  5IP7 H;  1XPU A;  2ZJP A;  3J7Z C;  1SE8 A;  1Y1W H;  1JJG A;  1L1O C;  3Q8D A;  3RR5 A;  1X65 A;  1IZ6 A;  2MO0 A;  1E3P A;  2CCZ A;  4QY7 A;  3TEH B;  2YYZ A;  2R7F A;  4OX9 Q;  1DGS A;  3CCM A;  1VQL A;  3ULP A;  2I5M X;  1LTL A;  3I7F A;  1WJJ A;  4GN5 A;  4JI6 Q;  4L5Q A;  2OCE A;  4X65 Q;  2LXJ A;  1JB7 A;  5C4X G;  1D7Q A;  5C4X H;  5C0X J;  1XJV A;  3U4Z A;  3HKZ G;  1G51 A;  3CCU A;  5ELN A;  3E9H A;  4HID A;  1XNQ L;  4DKA C;  3HOV G;  4DV7 L;  1Q46 A;  3PO3 H;  1O7I A;  1NMG A;  4JV5 Q;  3JAM c;  5C0X I;  4HIO A;  2ZTE A;  1HNZ Q;  2K14 A;  3PUZ A;  1J5E L;  5EAY A;  1OXS C;  1HR0 L;  2D0O A;  1OTC A;  2E2H H;  5FJ8 G;  2JEB I;  2RHS B;  3F2C A;  1I94 Q;  5J3B A;  2HHH L;  2A8V A;  1X6O A;  4X65 L;  3G71 A;  4DK3 C;  3WWV A;  4DV2 L;  4JBM A;  1VQK A;  2YTY A;  3AFP A;  5JJI A;  4YCW A;  3BU2 A;  1PHJ A;  4DR6 Q;  3CF5 A;  3TRZ A;  3OTO Q;  4JI5 Q;  1UWV A;  3GO5 A;  1Q81 C;  1PH6 A;  3KOJ A;  1VQC A;  2AMC B;  3AQQ A;  2MO1 A;  5C44 G;  3A74 A;  5M3F H;  4HJ9 A;  1YJN A;  1PV4 A;  4BA1 I;  1IXR A;  1CKN A;  2CKZ B;  1KL9 A;  2N3S A;  4PG3 A;  2CWP A;  4LFC L;  4X62 Q;  5DLQ E;  3I56 A;  3JAM i;  1YIT A;  3GTL H;  2UXB Q;  1Q86 C;  2Z0S A;  1T9H A;  3W1B A;  5M5Y H;  2UU9 L;  4NXN Q;  4A3K G;  1YEZ A;  1YHB A;  4IPD A;  3PF5 A;  3PUX A;  2ID0 A;  3FKI G;  4JC0 A;  3CPW A;  2OTJ A;  2VY3 A;  4LF4 Q;  4O0A A;  1VQI A;  2E2I H;  4DUY L;  1EIF A;  2UXD Q;  1I6H H;  3AFQ A;  4AQY Q;  4DV0 Q;  4HJ5 A;  2JJQ A;  4AYB E;  2QGQ A;  4Y52 H;  4R1J A;  2JQO A;  4GKK L;  4ME3 A;  4DV4 Q;  3L2P A;  4DR5 L;  1JMC A;  4B3R L;  1VS0 A;  1N36 L;  3UE0 A;  4JI3 Q;  4POG A;  2GN5 A;  4DV6 Q;  2F52 A;  2JA8 H;  4YCU A;  1X54 A;  3HOZ G;  4MTN A;  4A3I H;  2JA9 A;  3PO2 G;  4YCV A;  5IYC H;  1TWH H;  4DAM A;  4JYA L;  3LGJ A;  1W3S A;  4YHH Q;  1HJP A;  1HNX L;  3H3V H;  3H0G H;  4J15 A;  4JI2 L;  5LMU Q;  3UE1 A;  2KBN A;  3HKZ E;  4EX5 A;  2YV5 A;  2AKW B;  3GTG H;  2KCM A;  4AQY L;  1YIJ A;  3M4O H;  1GD7 A;  1TWC H;  1VQ4 A;  4A3M G;  1EOV A;  4GKK Q;  4GNX B;  1PH7 A;  3M3Y H;  3GTO H;  3CCV A;  1PH5 A;  2JEA I;  2PMZ E;  3CMA A;  4A3L G;  4JBJ A;  5IP9 H;  5FJ8 H;  3I4O A;  3S15 H;  4MNO A;  4DUZ Q;  4KHP Q;  1V43 A;  3M7N A;  3ULJ A;  4B3T Q;  5M5W H;  3J81 j;  3B6Y A;  1HNW L;  2QA4 A;  1CKN B;  1WCM G;  1XTD A;  2VW9 A;  4UY8 C;  1XPO A;  1A62 A;  1JT8 A;  1QUQ A;  2RF4 A;  3CCL A;  1FGU A;  3G6E A;  3F8T A;  4A4I A;  1PH3 A;  5IYD H;  1HZ9 A;  3T1Y L;  3STB C;  4R4O A;  4BXX H;  2NVQ H;  4B3R Q;  3OYY A;  2D0P A;  4JI5 L;  3OTO L;  4DV3 Q;  1VQH A;  3ULL A;  2VQE Q;  3F2D A;  2Z6K C;  2JA5 G;  2IX1 A;  4R4I A;  2PI2 E;  1X9N A;  3S2D H;  2B29 A;  1J6Q A;  1VQP A;  2PI2 A;  1IBL L;  3GTM H;  3A5Z B;  4OWW B;  2ZM6 Q;  5M5X H;  1NJI C;  4C3J H;  4BBR G;  3G48 A;  4DR4 Q;  5GAH C;  4A3E H;  1UE5 A;  1MJC A;  3CC2 A;  1X56 A;  4DR7 L;  2L15 A;  5K36 G;  2I0Q A;  4O2D A;  5GRO A;  4GNX C;  2HIV A;  2ZJQ A;  2OTL A;  3FHW A;  2WAQ G;  1IBM L;  4XTC S;  1K9M C;  2R7D A;  5C4J H;  3UDF A;  2PQA A;  4RMF A;  4LF6 L;  2MQH A;  1QZG A;  4B3M L;  3E0E A;  4Y7N H;  3KDF B;  3HOU G;  4GKJ L;  3M4P A;  4IOC A;  3S1R H;  4UPA A;  4MZ9 A;  1KQS A;  2YTV A;  1BBU A;  4A3J G;  4LF9 L;  2HT1 A;  1WYD A;  1XNR Q;  4YWM A;  1Z47 A;  4DPG A;  5M3M H;  3L0O A;  3RN2 A;  4KHZ A;  1PH9 A;  1N36 Q;  2HQL A;  4JI3 L;  2KHJ A;  1S72 A;  4A3B H;  2E8G A;  2H5X A;  4DV0 L;  1WOC A;  2K52 A;  4P75 A;  3DM3 A;  3CME A;  1IYJ B;  1Z9F A;  2MNA A;  1ASY A;  3H3V I;  3HOW H;  3S17 H;  2UXC Q;  2NN6 I;  1B8A A;  2GVB A;  2NVX H;  3NEN A;  4ALP A;  1HR0 Q;  2NZO A;  1SLJ A;  2N49 A;  2Y0S E;  5GAD C;  2VUM H;  3RZO H;  1OXX K;  4LF9 Q;  3HOY G;  1BKB A;  3GTK H;  3CD6 A;  2B3G A;  4YY3 L;  2D62 A;  2DGY A;  1CUK A;  2N78 A;  3PV0 A;  4AYB G;  4JYA Q;  4C2M H;  1P8L A;  1HNX Q;  2CQO A;  3I4N G;  4BBS H;  3J80 c;  4DR1 Q;  1YHQ A;  4JI8 Q;  2AWN A;  3SGI A;  4DR2 L;  3ICE A;  1OXV A;  1L1O B;  3S1N H;  2KHI A;  4QL5 A;  1YZ6 A;  3TS2 A;  2Y0S G;  2F3I A;  1KHI A;  1UE6 A;  1IBK Q;  4A3D G;  1IL2 A;  2A1A A;  1G6P A;  3PO3 G;  2JA6 G;  3HOV H;  3KJP A;  2UUC Q;  1K83 H;  2EQS A;  5C0X G;  3K7A H;  4DV5 L;  4A3M H;  1A8V A;  1Q8K A;  1N33 L;  1U5K A;  2K75 A;  4IJL A;  4WJ3 M;  3A5U A;  1V1Q A;  4GKJ Q;  1AE3 A;  1SR3 A;  1TWA H;  2RCN A;  2JA5 H;  1VQM A;  1YHA A;  3CC7 A;  4LF4 L;  1K3R A;  3CW2 C;  1K0R A;  3STB D;  1N9W A;  4APV A;  3CAM A;  3J80 i;  1PH4 A;  4LF5 L;  1KRT A;  1PFS A;  2WP8 J;  4P73 A;  1PYB A;  4P71 A;  4UP9 A;  1EYG A;  3J7A 5;  2YU9 H;  4LNQ A;  3UDX A;  4NPS A;  5E7N A;  3KDF A;  1NMF A;  5IP7 G;  1IBL Q;  4X64 Q;  1A0I A;  1I3Q H;  3NEM A;  4LUO A;  1GM5 A;  2VQF Q;  3HOZ H;  1D8L A;  4K0K L;  2ZTD A;  2IY5 B;  3TQY A;  2N8N A;  3S1M H;  2R6G A;  2XGT A;  1I5F A;  4DK6 C;  4BY1 G;  4JI1 Q;  2JE6 I;  4GN4 B;  4NXM Q;  2BA0 A;  3I4N H;  4A3C H;  3W5O A;  3OW2 A;  3K81 C;  1U0L A;  1KIX A;  4JV5 L;  1QVC A;  1HNZ L;  2JA7 G;  1GO3 E;  1WI5 A;  3UDI A;  2NVT H;  1XNQ Q;  4A3F G;  2R92 H;  4JI4 L;  1HNW Q;  2E5L L;  2PNH A;  3JC6 6;  3H0G G;  1IBM Q;  4B3S L;  3F1Z A;  1VQO A;  4YHH L;  4AIM A;  1X3F A;  2A19 A;  2K50 A;  5AJ3 Q;  4L5R C;  4DV6 L;  2BH8 A;  4UP8 A;  5M3M G;  1QVG A;  4L5T A;  1XPR A;  4GLV B;  4TVA B;  3CCE A;  1FJG L;  4NB3 A;  2WB1 G;  3DLL A;  1LM0 A;  3TRE A;  2HIX A;  4R4C A;  3KJO A;  2VS1 A;  1EQQ A;  1VQG A;  2Q2I A;  3E9I A;  1VQB A;  4R4T A;  3CPF A;  3EIV A;  4PMW A;  4HIK A;  3M9B A;  2VZA A;  3U58 A;  1VQF A;  2IHE A;  5AJ3 L;  1Q82 C;  1FL0 A;  3PGZ A;  4BY7 H;  1E1O A;  5BR8 Q;  4YY3 Q;  5FLM G;  1VQJ A;  1B7Y B;  3S14 H;  2DUD A;  3HFZ B;  3I2Z A;  2NN6 G;  1TWF H;  4IPH A;  1KAW A;  1YJ9 A;  3NEL A;  4JI1 L;  4L5S A;  3UDG A;  1LUZ A;  4LW1 A;  4A93 G;  1TWG H;  4QJF A;  4DV4 L;  4DR5 Q;  4B3T L;  2OQK A;  3FP9 A;  1E7Z A;  1FJG Q;  5IWA Q;  1VQE A;  3S24 A;  3EN2 A;  4IJH A;  5H1S E;  4YWL A;  5IYD G;  5HGQ A;  3I55 A;  2UUC L;  4YWK A;  1JJ2 A;  1Y1W G;  3CCS A;  1KXL A;  4LF5 Q;  2K4K A;  4JBK A;  3KFU A;  4H02 A;  1NY4 A;  5LMN W;  4WJ4 A;  1C7Y A;  3RLO A;  5GAG C;  2MFI A;  1K73 C;  1EUJ A;  4DR7 Q;  1PYS B;  3ZJY C;  3CCQ A;  4GOP C;  1Q7Y C;  4JOI C;  5IYB H;  1L1O A;  5IP9 G;  1E22 A;  1KC8 C;  4BBR H;  5FLX c;  2R93 H;  1WFQ A;  3S1Q H;  3PIP A;  2UUB Q;  1HH2 P;  1VQ8 A;  3HKS A;  3RLF A;  4DUZ L;  3HOX G;  4IFD I;  3HOX H;  4C3I H;  1K8G A;  4OWX B;  3D31 A;  4DV2 Q;  4K0K Q;  4EQ5 A;  5JJK A;  1YJW A;  5LMN L;  4BXX G;  1VQN A;  1V9P A;  2CWA A;  4JG2 A;  5IYB G;  4PZ7 A;  1E1T A;  1EWI A;  4IFD J;  4DR1 L;  3ERS X;  3T1Y Q;  2JA8 G;  2K5H A;  1UEB A;  3G4S A;  4OON A;  4JI7 Q;  3S2H H;  1L0W A;  5IYC G;  1QUQ B;  3CXC A;  1MJE A;  3PO2 H;  1CSP A;  1FVI A;  2R7Z H;  3A0J A;  4NXN L;  1NBW A;  3GD7 A;  2VL6 A;  3I4M G;  4BBS G;  4QQB X;  2CFM A;  4TQU S;  4JI4 Q;  2UUA L;  2ATW A;  4KI0 A;  4QIW E;  2KCT A;  3KF8 B;  1N33 Q;  1Q1B A;  1BVS A;  5IY0 A;  3HOY H;  1EQR A;  4GOP B;  5JEA J;  4JBW A;  3MEF A;  2AWO A;  1R9T H;  1YBY A;  2WAQ E;  3CCR A;  1IBK L;  3KF6 B;  3U50 C;  4LFA L;  3K0X A;  2OQ0 A;  2UXD L;  3IRB A;  4DUY Q;  1GKH A;  1QZH A;  1MKH A;  1ASZ A;  1VQ9 A;  1HZC A;  3T1H Q;  2UUA Q;  3RNU A;  5ELO A;  2Q2T A;  4B3M Q;  4LF6 Q;  4A93 H;  3KLW A;  1EIY B;  4IO9 A;  5HY6 A;  3CQZ H;  2UUB L;  2Q2H A;  2LXK A;  3GTP H;  2ZJR A;  4GOP A;  1C9O A;  1J5E Q;  3AEV A;  2R92 G;  1XMQ L;  2ALY B;  1SFO H;  1I50 H;  2F4V L;  4GLA C;  4BY7 G;  1M1K C;  3CC4 A;  1Q1E A;  4A3G H;  1PVO A;  1HZB A;  3BZC A;  5C44 H;  5M3F G;  1SN8 A;  4GLX A;  4BY1 H;  5LMN Q;  1VCI A;  4LF7 Q;  3GDE A;  4LF8 Q;  3HOU H;  4A76 A;  4X62 L;  3CP0 A;  4NXM L;  2NVY H;  1SMX A;  5C3E G;  4A75 A;  4IPG A;  2C35 B;  1HZA A;  1Y1V H;  1VQD A;  3K7U C;  3T1H L;  4JOI A;  2IT1 A;  1P16 A;  3EBE A;  4LFA Q;  5IT9 c;  4DV3 L;  1JE5 A;  2VQF L;  3I4M H;  3GTJ H;  2K5V A;  2K5N A;  3MXN B;  4GN3 B;  2VQE L;  3S16 H;  4A3L H;  4RG1 A;  3FKI H;  1YVC A;  3W1G A;  3PUV A;  4A3E G;  1S40 A;  1VQ6 A;  5JJL A;  1VQA A;  1VQ5 A;  3TS0 A;  1X3G A;  1X55 A;  1UE1 A;  3CCJ A;  1OXT A;  1RL2 A;  4JI8 L;  1B70 B;  4DR2 Q;  1I94 L;  1HR0 W;  2HHH Q;  4LWC A;  1Y14 B;  1TXY A;  1YNX A;  2QEX A;  2NZH A;  4IFD G;  4FDB A;  5GAE C;  2EIF A;  1G29 1;  2JK8 A;  4KLK A;  1XMO L;  4R4Q A;  4LFB L;  1N32 L;  2R93 G;  2IHF A;  4DV5 Q;  2LSS A;  2BA1 A;  4A3I G;  1X3E A;  2Q2U A;  4HJ7 A;  3RN5 A;  2ES2 A;  4A3D H;  4P74 A;  1KRS A;  4JI6 L;  1GVP A;  2WFW A;  2I5H A;  3BJU A;  2PQA B;  2JA6 H;  3D0F A;  4X6A H;  2V1C C;  1N34 Q;  1SRU A;  2Z6K A;  4OXP A;  4AH6 A;  1H95 A;  5JEA G;  3PSI A;  4XIG S;  1EFW A;  1L2F A;  1KD1 C;  4OWT B;  4DV7 Q;  4IPC A;  4HJA A;  1PH1 A;  3AYH B;  2OWO A;  4JI7 L;  1XMO Q;  2I5L X;  3PUW A;  2B63 G;  4A3K H;  3J81 i;  1BBW A;  4GNX A;  1C0A A;  4DV1 Q;  2GVA A;  3K80 C;  1PA6 A;  1PH2 A;  1AE2 A;  1RIP A;  5IE8 A;  4PZ6 A;  1MIU A;  4P72 A;  4UP7 A;  1N34 L;  1CKO A;  1OXU A;  3M85 A;  2RHQ B;  3VDY A;  4DAY B;  3KYH C;  4C3H H;  1N8R C; 
#chains in the Genus database with same CATH topology
 5GQO A;  3J7A V;  2IX0 A;  5IGG A;  2KEN A;  2PNR C;  1PTO C;  1LTA D;  5FLM H;  3TN2 A;  1KTK A;  4X66 Q;  5C3E H;  4MHE A;  1JJC B;  4DNI A;  4B3S Q;  4F88 A;  2E5L Q;  2UU9 Q;  4DU9 A;  2L55 A;  1XWE A;  5JOB A;  4LFC Q;  1UE7 A;  4LMQ D;  3HOW G;  2L1B A;  2YTX A;  2KCC A;  1K8A C;  4JI0 Q;  1D5Z C;  2O5J C;  5BN3 A;  4JK1 C;  4KHP L;  4LUV A;  4KJO A;  1STA A;  2B63 H;  4ZLT F;  1SRO A;  2M2L A;  1CSQ A;  2RSO A;  4A3J H;  3Q6S A;  3PF4 A;  1SNO A;  5LMU L;  4PZ8 A;  4JI2 Q;  3K8A A;  1ZEQ X;  5T1I A;  2F0T A;  1O78 A;  1X3P A;  2SNS A;  4HN7 A;  1F2M A;  3SK5 A;  1QE6 A;  3Q8D A;  3RR5 A;  2MO0 A;  2R7F A;  2K5D A;  4JI6 Q;  4V0B A;  1UNS A;  2OCE A;  3VYU A;  1D7Q A;  1IKM A;  3RD4 A;  3N6R A;  1XJV A;  5AFW A;  4XT1 B;  3HKZ G;  4HID A;  1C8C A;  4DXF A;  3HOV G;  4DV7 L;  3PO3 H;  2K01 A;  2XWJ B;  2ZTE A;  1J5E L;  1K3B C;  4XQJ A;  2JEB I;  2RHS B;  3F2C A;  4ME5 A;  1X6O A;  1AZQ A;  2ZT9 C;  3CF5 A;  3TRZ A;  2PZU A;  4KK7 A;  2C9O A;  3BS1 A;  1O80 A;  2RSN A;  1KL9 A;  2CWP A;  3NTI A;  2R7Z B;  2FHT A;  1QJO A;  5A2Q L;  1YIT A;  3JAM i;  1HA6 A;  2RDG A;  2E2I B;  1T9H A;  5C4Z A;  1D2B A;  1B4O A;  1YEZ A;  1SFO B;  1ZXT A;  3PUX A;  5HUR A;  3CPW A;  2VY3 A;  5G3L F;  4LF4 Q;  4ZAI A;  4IQZ A;  2M00 A;  4A3J B;  4K6L A;  2UXD Q;  1QIL A;  2QGQ A;  3L2P A;  1N36 L;  1ILQ A;  3NHH A;  4POG A;  1X54 A;  3HOZ G;  4BWG B;  4C3I B;  1ROD A;  4A3I H;  4A3B B;  4FF1 A;  3S14 B;  4JYA L;  1V8Q A;  5A2Q E;  1HJP A;  4JI2 L;  5DEH A;  3UE1 A;  1SXT A;  2B2T C;  4ZYS A;  2WB1 B;  4EX5 A;  2AKW B;  1NAP A;  5E3F A;  5CV4 A;  1PLF A;  2BCO A;  5FKA C;  4GNX B;  1PH5 A;  2JEA I;  3PO3 B;  2Z6B A;  4JBJ A;  5IP9 H;  5FO9 B;  3TBI B;  4KHP Q;  4B3T Q;  4DA2 A;  5M5W H;  3A54 A;  1HNW L;  1SYC A;  1YNN C;  4X3U A;  1DOK A;  4XQQ A;  2RF4 A;  1A6X A;  3HZX A;  3G6E A;  3HGB A;  1PH3 A;  4TKO B;  1B44 D;  3T1Y L;  2HD3 A;  1C4Q A;  4B3R Q;  3L9A X;  5M9O A;  5C6A A;  3ULL A;  2VQE Q;  3CU7 A;  3TSS A;  3D4W A;  2K5Q A;  2PI2 E;  3S2D H;  1KDC A;  2PI2 A;  1IBL L;  1UEA B;  3GTM H;  4OWW B;  4C3J H;  4BBR G;  4K2L A;  1H9S A;  5K36 G;  1KNE A;  4O2D A;  5GRO A;  2I0Q A;  3E5S A;  3G7L A;  1SND A;  4XTC S;  1K9M C;  2PQA A;  4LF6 L;  5C4H A;  1QB5 D;  4B3M L;  3E0E A;  3L3O C;  3M4P A;  4LK1 C;  1KQS A;  2HT1 A;  3EJI A;  1EY5 A;  2AUJ D;  3C2P A;  5T1G A;  3MWY W;  1PH9 A;  2HQL A;  4JI3 L;  2F0S A;  2FFK B;  4A3B H;  2K05 A;  4F87 A;  4KKU A;  2K52 A;  3CRK C;  4P75 A;  1IYJ B;  1JQY D;  1SNM A;  1TKW B;  1Z9F A;  2EYM A;  3CME A;  3H3V I;  5M5X B;  3RZO H;  1HR0 Q;  2N49 A;  5GAD C;  5DM7 3;  2B3G A;  2DGY A;  5E4X A;  3PV0 A;  4AYB G;  3TP7 A;  3SK8 A;  4JYA Q;  4I7A A;  1IL8 A;  2EE1 A;  4C2M H;  4FF4 A;  1RJT A;  3MXG A;  3SGI A;  4DR2 L;  1L1O B;  5JEA H;  2A68 D;  2Y0S G;  2Z4H A;  3J7A F;  1G6P A;  2JA5 B;  3HOV H;  2EXZ A;  2EQS A;  5C0X G;  2XSC A;  2A6H D;  1A8V A;  1E0B A;  1Q8K A;  4ZQ3 A;  1VMP A;  4GKJ Q;  1LTG D;  3M4Y A;  4IUQ A;  3DWP A;  2D9U A;  2WIN B;  1K3R A;  3H09 A;  3T4A C;  4APV A;  3BDO A;  3J80 i;  4RKB A;  3QR8 A;  1PFS A;  1LTB D;  4UP9 A;  4KN4 C;  5E7N A;  1NMF A;  2F3W A;  4Z9C B;  4C3J B;  1A0I A;  3GTL B;  4ZKB B;  1NUC A;  3D6W A;  2ZTD A;  4K5V A;  1HTL D;  1B2T A;  2RKS A;  3WOF A;  2HUG A;  2K04 A;  3W5O A;  5CV6 A;  2JA7 G;  1A15 A;  3UDI A;  2NVT H;  1HNW Q;  1CK1 A;  3JC6 6;  4N9P A;  1X3Q A;  4AIM A;  1KDA A;  1G6Z A;  2BDN A;  2DJG C;  4GLV B;  4NB3 A;  4DGZ A;  5FOB B;  1SJE D;  2WB1 G;  1LM0 A;  2L11 A;  4R4C A;  3KJO A;  4R4T A;  5K36 H;  3M9B A;  3U58 A;  5BR8 Q;  3FDT A;  1B7Y B;  1H9M A;  2DUD A;  3D3R A;  2F4I A;  3C3L A;  1TWF H;  5ELF A;  4JI1 L;  4IUU A;  1F9Q A;  1LUZ A;  1S5F D;  4B3T L;  4KD3 A;  3FP9 A;  1E7Z A;  2QEJ C;  3KBX A;  1VDZ A;  1DOL A;  1WTR A;  3EN2 A;  2FJ2 A;  3I91 A;  1SYE A;  1RTN A;  2KA7 A;  3T16 A;  4L8J A;  4JBK A;  3RLO A;  5GAG C;  1QNU A;  2F3V A;  1PXU A;  2MFI A;  4K14 A;  4A3F B;  1WTV A;  3OOC A;  2VXW A;  3CCQ A;  3GTQ B;  4BY7 B;  1L1O A;  3PIO 3;  5FLX c;  1TVX A;  1WFQ A;  5IOC A;  3S1Q H;  2NYZ D;  3SK6 A;  2O4X A;  2RVL A;  2UUB Q;  2NVQ B;  3HKS A;  4DUZ L;  3HOX G;  4IFD I;  4C3I H;  1K8G A;  4K6D A;  4OWX B;  4ZK9 B;  1EIG A;  5JJK A;  1YJW A;  4BXX G;  1V9P A;  4JG2 A;  1EEF D;  5IYB G;  2C5C A;  4IFD J;  4EVO A;  3T1Y Q;  4JI7 Q;  4OON A;  1DON A;  2IL8 A;  1UAP A;  3A8J E;  1LT4 D;  5EKI A;  1SE2 A;  2VL6 A;  3I4M G;  1AP0 A;  3UI2 A;  2VB2 X;  3A55 A;  5IGD A;  4K8I A;  2KCT A;  1Q1B A;  1BVS A;  4HMJ A;  1EQR A;  2F0E A;  4H7B A;  4ILW A;  2MPM A;  4JBW A;  4QF4 A;  2AWO A;  1IBK L;  3KBG A;  3K0X A;  2F0L A;  2MP1 A;  3O13 A;  3IRB A;  3OMC A;  5C5L A;  1HZC A;  2Q2T A;  4IUT A;  1EIY B;  4IO9 A;  1QWY A;  2F0O A;  3S2H B;  2ALY B;  1Y1V B;  4CBV A;  5BN4 A;  1A3V A;  1Q1E A;  1A3U A;  4A3G H;  1PVO A;  3I90 A;  1HZB A;  1QCB D;  3OWE B;  4WOR A;  5IT9 E;  2F0G A;  1HFG A;  1YNJ D;  3KLR A;  2C35 B;  4OIJ A;  1GXD C;  5IT9 L;  2IT1 A;  1P16 A;  3J7Y W;  1YNJ C;  5IT9 c;  4DV3 L;  1JE5 A;  4OGQ C;  4C3J G;  4A3L H;  2JYO A;  3FKI H;  3PUV A;  3NTK A;  1PZK D;  1VQ5 A;  1LTR D;  3J81 E;  3CCJ A;  1UE1 A;  1EU4 A;  1HQM C;  1OXT A;  1RL2 A;  4DR2 Q;  1I94 L;  3GTJ B;  2CH4 W;  1TXY A;  2QEX A;  2H4O A;  1I6H B;  2EYF A;  5GAE C;  4I7Z C;  1TS2 A;  1N32 L;  2RBM A;  1IYU A;  2BA1 A;  3RMH A;  4A3D H;  4P74 A;  4JI6 L;  3RZD B;  2WFW A;  2JA6 H;  4X6A H;  4AH6 A;  4OO1 H;  1GUS A;  4CJ2 C;  1L2F A;  2Z4I A;  1JC7 A;  2OWO A;  1EL0 A;  2I5L X;  3PUW A;  1I4R A;  2B63 G;  2CW0 D;  1CA5 A;  3HOV B;  1C0A A;  4LJZ C;  3NBI A;  2K28 A;  4P72 A;  1CKO A;  1OXU A;  4DAY B;  1J9O A;  1PH8 A;  1GUN A;  2KJX A;  3LNN A;  3OW7 A;  4JI0 L;  4DAP A;  1PYW D;  1SYD A;  2F0H A;  4A3G B;  4QMG A;  3HKZ B;  1JIC A;  4IUN A;  4OEL B;  2VUM B;  2PMZ B;  1LTT D;  2EY1 A;  4LF8 L;  5EQ0 A;  2NTS A;  1WD0 A;  2K33 A;  2ENB A;  1BOS A;  3I72 A;  2E76 C;  4A3G G;  4DR4 L;  2D2C C;  2VUM G;  1E24 A;  4QUF A;  1NE3 A;  4HSV A;  1I4H A;  3H15 A;  1Q12 A;  2M9V A;  4OX9 L;  1G2T A;  3NWT A;  1RCV D;  1S3O A;  3W3A A;  3PQI A;  2E2D C;  1F2L A;  1ESR A;  4RGN A;  1VQ7 A;  2ASB A;  1QOH A;  4KKS A;  3F2B A;  1AH9 A;  1STG A;  2ZJP A;  4NP5 A;  1TU2 B;  4JW0 A;  2R92 B;  1D1I A;  2CCZ A;  4F8M A;  4OX9 Q;  3H94 A;  5M3F B;  3CCM A;  1LTL A;  3I7F A;  5C4X G;  4KY6 A;  2E74 C;  3U4Z A;  1RD9 D;  3E9H A;  1CFM A;  1Q46 A;  3IFD A;  1IYV A;  1NMG A;  4JV5 Q;  3JAM c;  1HNZ Q;  4HIO A;  1SE3 A;  2Q8T A;  1I94 Q;  3H0G B;  2SDF A;  2KEE A;  4X65 L;  1BNZ A;  1PFN A;  4DV2 L;  2YTY A;  4CJ0 B;  5I2Y A;  4N8X 1;  5JJI A;  1I4G A;  5DAU A;  3HOY B;  3SDZ A;  3OTO Q;  3GO5 A;  4JI5 Q;  1O7Z A;  1VQC A;  2AMC B;  3AQQ A;  1IXR A;  1SNC A;  2MUY A;  4PMB A;  5EBC A;  4LFC L;  3S1Q B;  4UHV A;  2UXB Q;  4M8A A;  5M5Y H;  4FXK C;  2XVS A;  4A3K G;  3DXJ C;  1SNQ A;  2ID0 A;  3FKI G;  4NKL A;  2EYL A;  5ELD A;  1F9P A;  5IOD A;  1I6V C;  2JN4 A;  4DUY L;  3GTO B;  3NQT A;  1SBB B;  4AQY Q;  3TZU A;  3DM1 A;  4Y52 H;  1PTO H;  1VS0 A;  4DF7 A;  3SR1 A;  3UE0 A;  2J0T D;  2LFN A;  4G4K A;  2FIN B;  4MTN A;  2JA9 A;  3PO2 G;  2I46 A;  1TWH H;  5IYC H;  1GUW A;  3E3X A;  3R2I A;  4YHH Q;  1PDQ A;  1IW7 C;  3BVZ A;  5CGK A;  3M3Y B;  3K5L A;  2KBN A;  2SNM A;  3GTG H;  4AQY L;  3M4O H;  1F9R A;  4A3M G;  1DD2 A;  1EOV A;  1PH7 A;  1WVL A;  1FGB D;  2N88 A;  5FJ8 H;  1EY8 A;  1V43 A;  3MXN A;  1A2U A;  3NE5 B;  1WCM G;  1XTD A;  4PQX A;  4KV6 A;  1XPO A;  1A62 A;  4UY8 C;  1QUQ A;  2PW5 A;  3OMG A;  3ZYY X;  3F8T A;  1BQQ T;  2QDB A;  1HZ9 A;  2EJF C;  3BG3 A;  3STB C;  1PMR A;  2B2W A;  4R4O A;  4BXX H;  2D0P A;  4BBS B;  3IKJ A;  2QIL A;  4DV3 Q;  4A3D B;  1LAC A;  4RCN A;  2JA6 B;  4R4I A;  1HUN A;  3N52 A;  1EFI D;  4C3H B;  5C44 B;  1J6Q A;  2EY5 A;  1I3Q B;  2WKC A;  4DR4 Q;  3RUZ A;  3GTK B;  3PO2 B;  4DR7 L;  3A7L A;  2V4D A;  4QUC A;  2ZJQ A;  2OTL A;  3FHW A;  1SMY C;  2WAQ G;  1J8I A;  4BS9 A;  3OHX C;  5C4J H;  3Q22 A;  4RMF A;  1QZG A;  4Y7N H;  3HOU G;  3S1R H;  4UPA A;  4HCS A;  4A3J G;  1CQF A;  1WYD A;  2F0P A;  1Z47 A;  4A3M B;  1N36 Q;  4DNR B;  1S72 A;  1MSH A;  2H5X A;  1WOC A;  2XIW A;  1ASY A;  4WJW A;  3DWA A;  3S17 H;  1DYQ A;  1B8A A;  2VUM H;  1SLJ A;  1D6E C;  1OXX K;  4LF9 Q;  1I50 B;  5FLX E;  1JOK A;  5J22 A;  2O5I C;  2LKV A;  1CUK A;  2ICI A;  1BCP F;  2ZXR A;  5JAV A;  2CQO A;  3I4N G;  4KKT A;  4DR1 Q;  4JI8 Q;  1G2S A;  4EQP A;  3ICE A;  1OXV A;  3S1N H;  2KHI A;  2F03 A;  1TII D;  2F3I A;  2EY6 A;  3PO3 G;  1STB A;  4DV5 L;  3I4N B;  5KNC A;  4DXG A;  5CV5 A;  3Q24 A;  1B3Q A;  1U5K A;  2K75 A;  1V1Q A;  4CDC C;  1YHA A;  5KEE A;  3CW2 C;  3QOL A;  4CKC A;  1BO0 A;  4LF5 L;  2E2J B;  4P73 A;  5HGT A;  1Z6H A;  4P71 A;  1EYG A;  1PTO F;  5EPJ A;  3AB9 A;  1ZYR D;  3A8K E;  1IBL Q;  1BXT A;  5CC4 A;  1I3Q H;  2VQF Q;  1D8L A;  1C48 A;  2IY5 B;  1ZKO A;  1JB3 A;  1ZYR C;  5E4W C;  3S1M H;  4UAI A;  4BY1 G;  4DK6 C;  3AMU A;  2JE6 I;  4Y7N B;  1KIX A;  4JV5 L;  2KVM A;  1HNZ L;  2RCF A;  5I4D A;  1XNQ Q;  2L0C A;  2R92 H;  3FRP B;  4IFD H;  2E5L L;  1EY4 A;  1IBM Q;  4B9W A;  3F1Z A;  2EZV A;  2K50 A;  4L5R C;  5CV8 A;  4XYO A;  2BH8 A;  3EFX D;  1MI2 A;  3ONA B;  2FMM A;  1EOT A;  3DLL A;  4KMU C;  3TRE A;  3GV6 A;  2VS1 A;  1VF7 A;  1VQG A;  4PMW A;  4HIK A;  2VZA A;  3TP8 A;  2CHB D;  2B8F A;  5AJ3 L;  3PGZ A;  1RKN A;  1LO5 D;  4G57 A;  1I4P A;  4YY3 Q;  1DZ1 A;  1VQJ A;  1A3T A;  3S14 H;  2NVT B;  2OF1 A;  5D3I B;  1KAW A;  4A93 G;  1TWG H;  2A74 C;  3C1F A;  4KN7 C;  1V1O A;  1VQE A;  3S24 A;  1LAB A;  3MVV A;  4BY1 B;  5HGQ A;  4WRD A;  4N9T A;  3OIP A;  3DUZ A;  1U4P A;  1JJ2 A;  1Z7T A;  3T51 B;  1NY4 A;  1MHW C;  1K73 C;  3P1H A;  3MFG A;  4R9W A;  5CBE E;  5C3X A;  4JOI C;  1Y1W B;  5IYB H;  1E22 A;  3A56 A;  2F0M A;  3OIQ A;  2R93 H;  3PIP A;  1ENF A;  3CKI B;  4J8Q A;  1TS3 A;  4EQ5 A;  1BDO A;  3NPP A;  5LMN L;  3VR2 A;  1II3 A;  1E1T A;  2MHV A;  4Q5V A;  2AUK A;  1D5X C;  2K5H A;  3G4S A;  2JA8 G;  5IYC G;  1QUQ B;  1MJE A;  1O7Y A;  1BF4 A;  1FVI A;  1OO9 B;  2KED A;  4HTH A;  2CFM A;  2LS0 1;  4JI4 Q;  3RZO B;  1N33 Q;  3MC0 B;  5IY0 A;  3BYY B;  1M8A A;  4GOP B;  4IZ8 A;  2CVR A;  1YBY A;  1CZW A;  3QIA A;  1PRT B;  3U50 C;  2QDL A;  4LFA L;  2OQ0 A;  2UXD L;  3D4R A;  4JPB W;  1PRT F;  2EYJ A;  1MKH A;  4LF6 Q;  2UUA Q;  2PCF B;  4B3M Q;  3D8G A;  4R8N A;  2UUB L;  3HOU B;  1HHV A;  2NVY B;  3CHB D;  3HP3 A;  1J5E Q;  2R92 G;  3CRL C;  2EOT A;  5C44 H;  1AN8 A;  3V05 A;  5M3F G;  2B2V C;  4BY1 H;  4CDF C;  4LF7 Q;  3GDE A;  4A76 A;  4X62 L;  1FYC A;  4NXM L;  1SMX A;  5I6W A;  4A75 A;  4IPG A;  4QB4 A;  4DNT B;  3FEW X;  5EKL A;  3T1H L;  4JOI A;  4LFA Q;  2PPB C;  1D5M C;  1CZG A;  4GN3 B;  3MZ5 A;  1SEB D;  3F2U A;  1Y8O B;  2EYP A;  3TS0 A;  2R93 B;  5KYI A;  1EQV A;  2F0W A;  2HCC A;  3S16 B;  1YNX A;  3HG9 A;  3R2T A;  1SSO A;  4KLK A;  1G29 1;  1XMO L;  4LFB L;  4CKB A;  3TZD A;  2IHF A;  4A3I G;  4HJ7 A;  3RN5 A;  2JXM B;  1GVP A;  3BJU A;  1EQT A;  3ERQ A;  1H95 A;  1MGS A;  3MEH A;  1TT2 A;  3FKI B;  3TP5 A;  1KD1 C;  4IPC A;  3A7A B;  1AFP A;  1PH1 A;  3AYH B;  3DMU A;  1XMO Q;  4A3K H;  3LWE A;  5KNB A;  4GNX A;  4DV1 Q;  3K80 C;  1PA6 A;  1RHP A;  1LV9 A;  2RDH A;  4CDE C;  2LY7 A;  2EYH A;  3M85 A;  2RHQ B;  4RKL A;  5C3E B;  1JR0 D;  4QGU A;  2KOL A;  3U4V A;  4GS3 A;  4KD4 A;  1W2B A;  2AHO B;  1M90 C;  2K6A A;  1XNR L;  4RGO S;  4HJ8 A;  3NQI A;  3ND9 A;  2E2J H;  4DR6 L;  3URY A;  5IWA L;  1TY0 A;  3HOW B;  2B2T A;  1Y1V G;  2UXB L;  1JOR A;  3DEO A;  3J81 c;  2O2L D;  2IW3 A;  4HIM A;  1XMQ Q;  1CKM A;  2EXD A;  3A8I E;  4XYQ A;  1K8M A;  3BZK A;  5M3M B;  1BCP C;  3RZD H;  4IUV A;  1NTG A;  4A3F H;  3GTQ H;  3ND8 A;  4LAA A;  5K5P A;  4LUZ A;  1BCP D;  1ONL A;  2BH2 A;  4A3C G;  5JVH 3;  3PCO B;  1N32 Q;  5LHY 1;  3M4Q A;  1LYL A;  2F0K A;  3L7Z C;  3NBH B;  3KF6 A;  4OO1 I;  1XXG A;  3PUY A;  1YI2 A;  4OO1 G;  2X69 A;  2JA8 B;  4OEM B;  5IP7 H;  1E2Z A;  5CR3 A;  2XRS D;  1L1O C;  1IZ6 A;  3K58 A;  4QY7 A;  3TEH B;  4C1N K;  2L5T A;  4HCE A;  3Q0A A;  3DHQ A;  4GN5 A;  1WJJ A;  4X65 Q;  2LXJ A;  5C0X J;  1BR9 A;  1G51 A;  3CCU A;  5ELN A;  1XNQ L;  2WAC A;  4DKA C;  1D1K A;  3J81 L;  1O7I A;  1EY6 A;  1SYF A;  5C0X I;  1OTC A;  2K14 A;  2F1M A;  1HR0 L;  1OXS C;  5FJ8 G;  2A8V A;  5J3B A;  4CHT B;  3G71 A;  1ICW A;  1PTO D;  4JBM A;  4WFN 3;  1F9S A;  4YCW A;  2R61 A;  5CYU A;  1PHJ A;  1S5B D;  4PMC A;  3NSW A;  2OXP A;  3KOJ A;  5C44 G;  2MO1 A;  3OPO A;  3A74 A;  5M3F H;  4HJ9 A;  1MD2 D;  1CM9 A;  1CKN A;  2CKZ B;  2IPK D;  2N3S A;  1EEI D;  1UUP A;  1SDF A;  4X62 Q;  3FVQ A;  5DLQ E;  2G9H D;  3I56 A;  2EDG A;  1Q86 C;  3W1B A;  5FO8 B;  2L12 A;  2NN6 H;  1DXM A;  1YHB A;  4IPD A;  3PF5 A;  2A73 B;  5LL6 S;  1JOQ A;  1H9K A;  2OTJ A;  3I73 A;  2E2I H;  1AZP A;  1G91 A;  4RGT A;  1I6H H;  3AFQ A;  1STH A;  4DV0 Q;  2JJQ A;  4AYB E;  4R8I A;  4R1J A;  4DV4 Q;  4DR5 L;  1JMC A;  2HDM A;  3U9S A;  2GN5 A;  4DV6 Q;  2F52 A;  3QJY A;  3SHL A;  4YCU A;  2JA8 H;  4XT3 B;  2OEO A;  4YCV A;  1I4Q A;  3QG1 A;  3VR4 A;  1HNX L;  3H0G H;  4J15 A;  2AQ2 B;  2AQ3 B;  1L0X B;  3KLS A;  3HKZ E;  1GHJ A;  2YV5 A;  1DOM A;  3GV3 A;  4OHJ A;  1TWC H;  1VQ4 A;  4GZY C;  1EY0 A;  2CQA A;  4KHV A;  3GTO H;  1FR3 A;  3HOX B;  2PMZ E;  4A3L G;  3VR6 A;  1LT5 D;  3I4O A;  4MNO A;  3ULJ A;  4TSS A;  1CT1 D;  4H13 C;  2QA4 A;  4O1N A;  3NXW A;  2MJ8 A;  4RHR A;  1STE A;  3CCL A;  1TWH B;  5IYD H;  3NUC A;  2X6L A;  4JI5 L;  3OTO L;  1VQH A;  2MGS A;  3F2D A;  1CHQ D;  5I6Y A;  1W6J A;  3MAQ A;  1VQP A;  3A5Z B;  1SJH D;  2ZM6 Q;  4DK0 A;  3VYS A;  4A3E H;  3HOZ B;  2B2W C;  1MJC A;  5EPK A;  4GNX C;  4A3K B;  1IBM L;  3GTP B;  2R7D A;  1WTW A;  2MQH A;  2NUC A;  3KDF B;  4IOC A;  1HUM A;  4LF9 L;  4MZ9 A;  1BBU A;  1E2W A;  2IJ0 A;  2XNA C;  1XNR Q;  4YWM A;  2DY8 A;  3L0O A;  2RQX A;  2XWB B;  1Q3L A;  2KHJ A;  3MXU A;  4K5W A;  5ISR A;  2E8G A;  4DV0 L;  3H6M A;  2KEC A;  3GP7 A;  3HOW H;  4C2M B;  2NN6 I;  1ENA A;  3NEN A;  2NZO A;  2PO4 A;  4FF3 A;  3J80 E;  3HOY G;  1BKB A;  3NBH A;  2RA4 A;  4YY3 L;  3GTK H;  2D62 A;  1PRT D;  1R4Q B;  2N78 A;  1AW7 A;  1P8L A;  1HNX Q;  4BBS H;  3BZD B;  3J80 c;  2AQ1 B;  1YHQ A;  2AWN A;  3MXP A;  4QL5 A;  4K8J A;  1YZ6 A;  3TS2 A;  4A3D G;  1IBK Q;  4AYB B;  3FPP A;  4A93 B;  5ELC A;  2JA6 G;  1KNA A;  1K83 H;  4A3M H;  3K7A H;  3C46 A;  3K5M A;  1WTO A;  3NTH A;  4IJL A;  4U67 3;  2KHS A;  5D3D A;  4ODG A;  2OT2 A;  1IKL A;  2RCN A;  2G9D A;  2JA5 H;  4H0L C;  3OSO A;  3CC7 A;  4LF4 L;  4RA8 A;  4IUR A;  1EWH A;  2WP8 J;  4EQO A;  2KQ3 A;  1PYB A;  3H3V C;  1EY7 A;  2YU9 H;  5C5M A;  3UDX A;  5A35 A;  5LL6 X;  1HTP A;  4LNQ A;  5IP7 G;  3KUP A;  3NEM A;  4LUO A;  1GM5 A;  4N8F A;  4A3E B;  3HOZ H;  3TQY A;  3V96 A;  2R6G A;  2XGT A;  1I5F A;  3S17 B;  5IGE A;  4FYD A;  3I4N H;  4A3C H;  2BA0 A;  1NR4 A;  1U0L A;  2XN9 C;  4HED A;  3T53 B;  1QVC A;  1GO3 E;  2DY7 A;  1M4V A;  4JI4 L;  4B3S L;  1A2T A;  1VQO A;  3OWF A;  2QW7 A;  1VF5 C;  1WCM B;  5AJ3 Q;  3D6C A;  4DV6 L;  4UP8 A;  4XQN A;  1QVG A;  4L5T A;  1XPR A;  2TMP A;  1FJG L;  1HQR D;  1EQQ A;  2FMC A;  2Q2I A;  1VQB A;  3CPF A;  4Q0F A;  1B3A A;  1VQF A;  2IHE A;  1Q82 C;  1KDB A;  4XXE A;  3X3M A;  1EU3 A;  1X32 A;  3HFZ B;  2N55 A;  2NN6 G;  4IPH A;  4XDX A;  1YJ9 A;  3NEL A;  1T5E A;  4L5S A;  4LW1 A;  5C3W A;  5E1F A;  1FNW A;  4FO2 A;  2A6H C;  1V1P B;  3S1M B;  1FJG Q;  3SK4 A;  5IWA Q;  2E2H B;  4C3I G;  5IYD G;  2UUC L;  1U4R A;  3I8Z A;  1EWC A;  4LF5 Q;  2K4K A;  4CKE A;  4QCL A;  5C4X B;  4H02 A;  3VA7 A;  5LMN W;  1C7Y A;  1NNX A;  1EUJ A;  4GOP C;  3IFT A;  1Q7Y C;  4YIJ A;  3DWQ A;  1O7L A;  2A6E C;  4TRD A;  4S3S A;  4BBR H;  1KC8 C;  1S5D D;  2EVB A;  1JWU D;  1ILP A;  1HH2 P;  5DM6 3;  2EJM A;  5C4J B;  3HOX H;  3P75 A;  2Z1C A;  3D31 A;  4DV2 Q;  5JVG 3;  4K0K Q;  1U4L A;  4H44 C;  1VQN A;  2CWA A;  2NTT A;  3SEB A;  2EYO A;  2X6G A;  4MIU A;  5FK9 C;  3PO2 H;  2B39 A;  3A0J A;  5J39 A;  1U9R A;  1TWC B;  3GD7 A;  3I4L A;  1ESF A;  5KND A;  2UUA L;  2ATW A;  4KI0 A;  4QIW E;  1ET9 A;  2CW0 C;  3EA6 A;  3I3C A;  3TDQ A;  3S1R B;  4EGV A;  3I4M B;  1LT3 D;  1R9T H;  1K0S A;  4ULL A;  3W2D A;  2JSO A;  3G6J B;  1AEX A;  3KLS X;  4M1U B;  3T1H Q;  1ASZ A;  1VQ9 A;  3KLW A;  2HDL A;  5HY6 A;  3GTP H;  2Q2H A;  4GOP A;  1C9O A;  1XMQ L;  1SFO H;  1I50 H;  4GLA C;  4BY7 G;  1IW7 D;  3CC4 A;  2F0N A;  3BZC A;  1SN8 A;  5LMN Q;  3C1E A;  1Y8P B;  5C3E G;  1HZA A;  1H9J A;  1VQD A;  1Y1V H;  3K7U C;  5CBA E;  3EBE A;  2LMC B;  3QB3 A;  2HCI A;  1Q8I A;  5IGB A;  3GTJ H;  4OL7 A;  2K5V A;  2K5N A;  4RG1 A;  3W1G A;  4A3E G;  1S40 A;  5JJL A;  1VQA A;  1X3G A;  2DJF C;  1X55 A;  4HAE A;  1GUT A;  4JI8 L;  1B70 B;  2HHH Q;  1Y14 B;  4FDB A;  1WTH A;  1F2Z A;  2DNC A;  2JK8 A;  2JA7 B;  4C1N I;  4R4Q A;  4U68 A;  2Z8L A;  1H9S B;  2A68 C;  2LSS A;  3LWU A;  1X3E A;  2Q2U A;  5NUC A;  3ERO A;  5JJZ A;  1RTO A;  3R8B A;  4FNF A;  2PQA B;  2Z6K A;  2B8G A;  5EBD A;  1SAP A;  4CJ1 B;  2K5W A;  5JEA G;  3PSI A;  1FNV A;  5J1Z A;  3VA5 A;  4OWT B;  5I9O A;  3IAY A;  4J6H A;  4HJA A;  4C56 C;  1Y8N B;  4E6I A;  1B9M A;  2XRQ D;  1RDP D;  3J81 i;  1K83 B;  1KAA A;  2GVA A;  1PH2 A;  2SOB A;  4PZ6 A;  1N34 L;  1CI3 M;  1I4X A;  3VDY A;  1TS5 A;  3KYH C;  3S2D B;  5M5W B;  1SYB A;  2B63 B;  3GTM B;  4A3B G;  4IAL A;  5IGC A;  2EY2 A;  3AU7 A;  1A63 A;  2VNU D;  3PIO A;  1PZI D;  4RHS A;  3VYR A;  5JPM C;  2YU9 B;  4RFB A;  4BA2 I;  1CHP D;  1BUV T;  2ZXP A;  4LF7 L;  4DR3 L;  4PNY A;  2R7Z G;  1STN A;  1H9R A;  4ZKC B;  2KCN A;  3HS0 C;  1TWA B;  2F4V Q;  2RDF A;  2WII B;  2WB1 E;  4DK1 A;  1V1P A;  2ZTC A;  2ZM6 L;  4POF A;  3Q23 A;  3RLN A;  4X66 L;  3K5N A;  2IWH A;  1NSN S;  4IOA A;  2XTI A;  4NW2 A;  4X64 L;  2BDO A;  1LLR D;  5CV9 A;  1EYC A;  4DV1 L;  1MSG A;  2JA7 H;  4KY7 A;  5FO7 B;  2KUM A;  3ER0 A;  1T5X D;  5BR8 L;  3PIP 3;  4DR3 Q;  1WCM H;  4LFB Q;  3VR5 A;  4KJN A;  1PRT C;  1GUO A;  2FXQ A;  4JCV E;  1XX8 A;  3E0J A;  2UXC L;  5F2D A;  4RGM A;  1EY9 A;  4G7H C;  1XPU A;  3J7Z C;  1SE8 A;  4ID6 A;  1Y1W H;  4OIK A;  1EIH A;  1JJG A;  5CV7 A;  4HSP A;  1HCZ A;  1B50 A;  3R3O A;  1X65 A;  1E3P A;  2F0J A;  2YYZ A;  2NZ1 D;  2QF7 A;  1DGS A;  4IUP A;  1VQL A;  3ULP A;  1HXY D;  2I5M X;  2Q8R E;  4L5Q A;  1JB7 A;  5C4X H;  1PFM A;  2B2Y A;  4DFA A;  3P7J A;  1B1Z A;  3S15 B;  3PUZ A;  5I9P A;  2E2H H;  5EAY A;  2D0O A;  2HHH L;  2B2Y C;  4DK3 C;  3WWV A;  1VQK A;  4RAU C;  3AFP A;  3BU2 A;  4DR6 Q;  1UWV A;  1Q81 C;  1PH6 A;  2F0U A;  3R93 A;  1YJN A;  1PV4 A;  4A3I B;  4BA1 I;  4CDD C;  1EZ6 A;  4PG3 A;  1IHZ A;  4BBR B;  4KY5 A;  5ELE A;  4NDX A;  1K8O A;  3GTL H;  1BBX C;  2Z0S A;  2UU9 L;  1JCK B;  3EVQ A;  4NXN Q;  1SE4 A;  1CQV A;  2NB0 A;  4DN4 M;  1SMY D;  4JC0 A;  2K32 A;  4MN3 A;  2E75 C;  4O0A A;  1K28 A;  1VQI A;  1S5C D;  1EIF A;  5M5Y B;  5D14 A;  4HJ5 A;  2EJG C;  2JQO A;  4GKK L;  4ME3 A;  4B3R L;  1L0Y B;  4JI3 Q;  2F0Q A;  2CH4 A;  1KAB A;  3K6O A;  3NP8 A;  4DAM A;  3BYT B;  2JP1 A;  3JAM E;  3LGJ A;  1W3S A;  1F77 A;  4X3K A;  4X3S A;  3H3V H;  5KGU A;  5LMU Q;  2DN8 A;  5KRU A;  2KCM A;  1YIJ A;  1GD7 A;  1S4Z A;  2NWG A;  4P2C B;  5C0X H;  1HFN A;  4GKK Q;  3KK7 A;  3M3Y H;  3CCV A;  3CMA A;  1KLG D;  4PV1 C;  3S15 H;  4DUZ Q;  1SNP A;  4FF2 A;  2B2U C;  3M7N A;  1FD7 D;  3J81 j;  3B6Y A;  3HEJ A;  1CKN B;  5DNF A;  1STY A;  2VW9 A;  1JT8 A;  1FGU A;  3HRZ C;  4A4I A;  1NCV A;  2A6E D;  4FXD A;  2NVQ H;  3OYY A;  3V2T A;  2Y0S B;  4G7Z C;  2Z6K C;  2JA5 G;  2IX1 A;  2PW7 A;  1EYA A;  1X9N A;  3K0Y A;  2B29 A;  2SEB D;  5M5X H;  1XYI A;  1NJI C;  3G48 A;  5GAH C;  5EJW A;  1UE5 A;  2L9H A;  3CC2 A;  1X56 A;  2L15 A;  3D4D A;  3I70 A;  2HIV A;  5EGT A;  3CQZ B;  1ML0 D;  1MBY A;  3UDF A;  2WKD A;  1BCP B;  4GKJ L;  3VYT A;  2YTV A;  2PZW A;  2DNE A;  4DPG A;  2WAQ B;  5M3M H;  1ENC A;  2NBF A;  3RN2 A;  2Z9H A;  4KHZ A;  1QG7 A;  1CTM A;  3BDL A;  5ELB A;  1LTS D;  1SYG A;  3DM3 A;  2MNA A;  1NR2 A;  2UXC Q;  5FLX L;  2GVB A;  1WTX A;  2NVX H;  4ALP A;  1WD1 A;  2Y0S E;  3SE0 A;  1JOO A;  2R3Z A;  5D65 A;  3CD6 A;  4K2K A;  4IN3 A;  4B08 A;  4ZUI A;  2BE5 C;  3K59 A;  1KLU D;  3S9W A;  3TME A;  4ABN A;  2BE5 D;  4RWS C;  4HR7 B;  1KHI A;  1UE6 A;  1EZ8 A;  1IL2 A;  2A1A A;  3IL8 A;  4C3H G;  3KJP A;  2UUC Q;  3K5O A;  1Q90 A;  5TSS A;  2J4X A;  1VMC A;  3S1N B;  1N33 L;  4WJ3 M;  3A5U A;  2J7Z A;  1JWS D;  4FVM A;  2B2U A;  1AE3 A;  1SR3 A;  1TWA H;  2P5Z X;  1VQM A;  1K0R A;  1PFB A;  3STB D;  1N9W A;  3SXH A;  3CAM A;  1PH4 A;  5BN5 A;  1KRT A;  2HQE A;  4O42 A;  1PZJ D;  1F2Y A;  4EQN A;  3J7A 5;  4NPS A;  5IIF A;  3KDF A;  2A69 D;  1TWF B;  4X64 Q;  1FNU A;  3KF8 A;  4K0K L;  2A69 C;  2N8N A;  2BOS A;  3P20 A;  1S5E D;  4JI1 Q;  3K7A B;  4GN4 B;  4NXM Q;  5L37 A;  3OW2 A;  3K81 C;  2ZXO A;  4FP5 D;  1WI5 A;  5COY A;  4A3F G;  1QNK A;  3QOJ A;  2QKI C;  2PNH A;  5G3L D;  4KTA A;  3H0G G;  4YHH L;  3FPU B;  3H91 A;  3TP6 A;  1X3F A;  2A19 A;  2GA4 B;  5JPN C;  3LX0 A;  2NVX B;  5M3M G;  4ZUJ A;  1LTI D;  3FMC A;  4TVA B;  3CCE A;  1CA6 A;  2F0V A;  1DM0 B;  1HA5 A;  3ITP A;  1LT6 D;  3NK9 A;  2HIX A;  1TR5 A;  1U4M A;  3E9I A;  3EIV A;  4NMZ A;  1ICF B;  1FL0 A;  2K1B A;  3J80 L;  4BY7 H;  1E1O A;  5EPL A;  5FLM G;  2F0I A;  2F0F A;  3I2Z A;  3UDG A;  1JWM D;  3M7G A;  4L63 B;  4QJF A;  2F0D A;  4QIW B;  4DV4 L;  4DR5 Q;  2OQK A;  1JE4 A;  3BDC A;  4IJH A;  5H1S E;  4YWL A;  1XTC D;  2QCP X;  3PMF A;  1G8Z D;  3WDN A;  3I55 A;  1TWG B;  4YWK A;  5IGF A;  3SVM A;  4X3T A;  5COR A;  1Y1W G;  1B53 A;  4F7X A;  5I2X A;  3CCS A;  3KFU A;  1YNN D;  1KXL A;  5EKK A;  2B2V A;  4FXG C;  2Q8I B;  4WJ4 A;  4JVZ A;  4DR7 Q;  1PYS B;  3ZJY C;  1HPC A;  5IP9 G;  4V19 0;  4MTK A;  1VQ8 A;  3RLF A;  3BVG A;  3MA2 B;  4PZ7 A;  1EWI A;  2K7V A;  4DR1 L;  3ERS X;  5KIX A;  3S2H H;  1UEB A;  4UDU C;  1L0W A;  3CXC A;  1CSP A;  2R7Z H;  4NXN L;  1NBW A;  2EPB A;  1TS4 A;  4BBS G;  4QQB X;  4TQU S;  3GQB A;  3KF8 B;  3VR3 A;  1B9N A;  3HOY H;  4B9X A;  1TQO A;  1WTQ A;  2L4N A;  3QO2 A;  5JEA J;  1GJX A;  3MEF A;  3QWN A;  3E6Z X;  1GHK A;  4CGY B;  2WAQ E;  3CCR A;  3KF6 B;  3MTS A;  1GUG A;  4DUY Q;  1GKH A;  1QZH A;  4A93 H;  3RNU A;  5ELO A;  3BVM A;  1WTP A;  4G7O C;  1R4P B;  3CQZ H;  3T13 A;  2LXK A;  2ZJR A;  3AEV A;  2I07 B;  2D5D A;  3T56 B;  2F4V L;  1M1K C;  4ZCK A;  4GLX A;  1HRJ A;  1VCI A;  2G5D A;  4LF8 Q;  3HOU H;  3MHB A;  3DEP A;  3CP0 A;  2NVY H;  1ET6 A;  3MFY A;  4HMI A;  2VQF L;  3I4M H;  2VQE L;  4K5X A;  3MXN B;  3S16 H;  1TY2 A;  1R9T B;  1YVC A;  5CMD A;  3NWS A;  1VQ6 A;  2IX3 A;  1RF2 D;  1W6K A;  4J1M A;  1HR0 W;  1QVF A;  4IFD G;  4LWC A;  2VB3 X;  1DJR D;  2NZH A;  3X3N A;  3K57 A;  2EIF A;  2PQE A;  1PTO B;  2ICE C;  2PZT A;  4L6T B;  1EYD A;  3U9O A;  3GTG B;  2R93 G;  3M4O B;  1DCZ A;  4DAV A;  4DV5 Q;  2ES2 A;  1KRS A;  2I5H A;  4DAY A;  4ZRZ A;  2K03 A;  3D0F A;  4I65 A;  2PYK A;  2V1C C;  1N34 Q;  1SRU A;  4OXP A;  4XIG S;  1EFW A;  1Y69 U;  1E2V A;  4DV7 Q;  3EQL C;  4JI7 L;  3JAM L;  4RH6 A;  2A5H A;  3WOE A;  2WV6 D;  1BBW A;  2TSS A;  4RCO A;  1AE2 A;  1RIP A;  2H1E A;  5IE8 A;  1MIU A;  4UP7 A;  5KYL A;  1GOZ A;  4C3H H;  1N8R C; 
#chains in the Genus database with same CATH homology
 4QGU A;  5GQO A;  2IX0 A;  1PH8 A;  3U4V A;  4A3B G;  2KEN A;  4GS3 A;  1W2B A;  1M90 C;  2AHO B;  5FLM H;  1XNR L;  4JI0 L;  4HJ8 A;  1A63 A;  2E2J H;  2VNU D;  3PIO A;  4DR6 L;  4X66 Q;  5IWA L;  5C3E H;  1JJC B;  4DNI A;  4B3S Q;  1Y1V G;  2UXB L;  2E5L Q;  4BA2 I;  2UU9 Q;  3J81 c;  4LF8 L;  4LF7 L;  4DR3 L;  2R7Z G;  4HIM A;  4LFC Q;  1XMQ Q;  1UE7 A;  4A3G G;  1CKM A;  1QVF A;  2F4V Q;  4DR4 L;  2EXD A;  3HOW G;  2WB1 E;  2YTX A;  1K8A C;  4JI0 Q;  3BZK A;  2VUM G;  2ZTC A;  2ZM6 L;  4POF A;  1E24 A;  3RLN A;  4X66 L;  3RZD H;  1NTG A;  4A3F H;  4IOA A;  3GTQ H;  4KHP L;  2XTI A;  4LUV A;  1NE3 A;  4LUZ A;  4X64 L;  3H15 A;  2B63 H;  1Q12 A;  1SRO A;  4OX9 L;  2BH2 A;  1S3O A;  1CSQ A;  4DV1 L;  4A3C G;  2JA7 H;  4A3J H;  3PF4 A;  3ER0 A;  5BR8 L;  4DR3 Q;  3PCO B;  1VQ7 A;  2ASB A;  1WCM H;  4LFB Q;  1N32 Q;  3M4Q A;  1LYL A;  3L7Z C;  3NBH B;  3F2B A;  3KF6 A;  5LMU L;  4OO1 I;  1AH9 A;  2FXQ A;  4PZ8 A;  3PUY A;  4JCV E;  3K8A A;  4JI2 Q;  1YI2 A;  4OO1 G;  2UXC L;  5IP7 H;  1XPU A;  2ZJP A;  3J7Z C;  1SE8 A;  1Y1W H;  1JJG A;  1L1O C;  3Q8D A;  3RR5 A;  1X65 A;  1IZ6 A;  2MO0 A;  1E3P A;  2CCZ A;  4QY7 A;  3TEH B;  2YYZ A;  2R7F A;  4OX9 Q;  1DGS A;  3CCM A;  1VQL A;  3ULP A;  2I5M X;  1LTL A;  3I7F A;  1WJJ A;  4GN5 A;  4JI6 Q;  4L5Q A;  2OCE A;  4X65 Q;  2LXJ A;  1JB7 A;  5C4X G;  1D7Q A;  5C4X H;  5C0X J;  1XJV A;  3U4Z A;  3HKZ G;  1G51 A;  3CCU A;  5ELN A;  3E9H A;  4HID A;  1XNQ L;  4DKA C;  3HOV G;  4DV7 L;  1Q46 A;  3PO3 H;  1O7I A;  1NMG A;  4JV5 Q;  3JAM c;  5C0X I;  4HIO A;  2ZTE A;  1HNZ Q;  2K14 A;  3PUZ A;  1J5E L;  5EAY A;  1OXS C;  1HR0 L;  2D0O A;  1OTC A;  2E2H H;  5FJ8 G;  2JEB I;  2RHS B;  3F2C A;  1I94 Q;  5J3B A;  2HHH L;  2A8V A;  1X6O A;  4X65 L;  3G71 A;  4DK3 C;  3WWV A;  4DV2 L;  4JBM A;  1VQK A;  2YTY A;  3AFP A;  5JJI A;  4YCW A;  3BU2 A;  1PHJ A;  4DR6 Q;  3CF5 A;  3TRZ A;  3OTO Q;  4JI5 Q;  1UWV A;  3GO5 A;  1Q81 C;  1PH6 A;  3KOJ A;  1VQC A;  2AMC B;  3AQQ A;  2MO1 A;  5C44 G;  3A74 A;  5M3F H;  4HJ9 A;  1YJN A;  1PV4 A;  4BA1 I;  1IXR A;  1CKN A;  2CKZ B;  1KL9 A;  2N3S A;  4PG3 A;  2CWP A;  4LFC L;  4X62 Q;  5DLQ E;  3I56 A;  3JAM i;  1YIT A;  3GTL H;  2UXB Q;  1Q86 C;  2Z0S A;  1T9H A;  3W1B A;  5M5Y H;  2UU9 L;  4NXN Q;  4A3K G;  1YEZ A;  1YHB A;  4IPD A;  3PF5 A;  3PUX A;  2ID0 A;  3FKI G;  4JC0 A;  3CPW A;  2OTJ A;  2VY3 A;  4LF4 Q;  4O0A A;  1VQI A;  2E2I H;  4DUY L;  1EIF A;  2UXD Q;  1I6H H;  3AFQ A;  4AQY Q;  4DV0 Q;  4HJ5 A;  2JJQ A;  4AYB E;  2QGQ A;  4Y52 H;  4R1J A;  2JQO A;  4GKK L;  4ME3 A;  4DV4 Q;  3L2P A;  4DR5 L;  1JMC A;  4B3R L;  1VS0 A;  1N36 L;  3UE0 A;  4JI3 Q;  4POG A;  2GN5 A;  4DV6 Q;  2F52 A;  2JA8 H;  4YCU A;  1X54 A;  3HOZ G;  4MTN A;  4A3I H;  2JA9 A;  3PO2 G;  4YCV A;  5IYC H;  1TWH H;  4DAM A;  4JYA L;  3LGJ A;  1W3S A;  4YHH Q;  1HJP A;  1HNX L;  3H3V H;  3H0G H;  4J15 A;  4JI2 L;  5LMU Q;  3UE1 A;  2KBN A;  3HKZ E;  4EX5 A;  2YV5 A;  2AKW B;  3GTG H;  2KCM A;  4AQY L;  1YIJ A;  3M4O H;  1GD7 A;  1TWC H;  1VQ4 A;  4A3M G;  1EOV A;  4GKK Q;  4GNX B;  1PH7 A;  3M3Y H;  3GTO H;  3CCV A;  1PH5 A;  2JEA I;  2PMZ E;  3CMA A;  4A3L G;  4JBJ A;  5IP9 H;  5FJ8 H;  3I4O A;  3S15 H;  4MNO A;  4DUZ Q;  4KHP Q;  1V43 A;  3M7N A;  3ULJ A;  4B3T Q;  5M5W H;  3J81 j;  3B6Y A;  1HNW L;  2QA4 A;  1CKN B;  1WCM G;  1XTD A;  2VW9 A;  4UY8 C;  1XPO A;  1A62 A;  1JT8 A;  1QUQ A;  2RF4 A;  3CCL A;  1FGU A;  3G6E A;  3F8T A;  4A4I A;  1PH3 A;  5IYD H;  1HZ9 A;  3T1Y L;  3STB C;  4R4O A;  4BXX H;  2NVQ H;  4B3R Q;  3OYY A;  2D0P A;  4JI5 L;  3OTO L;  4DV3 Q;  1VQH A;  3ULL A;  2VQE Q;  3F2D A;  2Z6K C;  2JA5 G;  2IX1 A;  4R4I A;  2PI2 E;  1X9N A;  3S2D H;  2B29 A;  1J6Q A;  1VQP A;  2PI2 A;  1IBL L;  3GTM H;  3A5Z B;  4OWW B;  2ZM6 Q;  5M5X H;  1NJI C;  4C3J H;  4BBR G;  3G48 A;  4DR4 Q;  5GAH C;  4A3E H;  1UE5 A;  1MJC A;  3CC2 A;  1X56 A;  4DR7 L;  2L15 A;  5K36 G;  2I0Q A;  4O2D A;  5GRO A;  4GNX C;  2HIV A;  2ZJQ A;  2OTL A;  3FHW A;  2WAQ G;  1IBM L;  4XTC S;  1K9M C;  2R7D A;  5C4J H;  3UDF A;  2PQA A;  4RMF A;  4LF6 L;  2MQH A;  1QZG A;  4B3M L;  3E0E A;  4Y7N H;  3KDF B;  3HOU G;  4GKJ L;  3M4P A;  4IOC A;  3S1R H;  4UPA A;  4MZ9 A;  1KQS A;  2YTV A;  1BBU A;  4A3J G;  4LF9 L;  2HT1 A;  1WYD A;  1XNR Q;  4YWM A;  1Z47 A;  4DPG A;  5M3M H;  3L0O A;  3RN2 A;  4KHZ A;  1PH9 A;  1N36 Q;  2HQL A;  4JI3 L;  2KHJ A;  1S72 A;  4A3B H;  2E8G A;  2H5X A;  4DV0 L;  1WOC A;  2K52 A;  4P75 A;  3DM3 A;  3CME A;  1IYJ B;  1Z9F A;  2MNA A;  1ASY A;  3H3V I;  3HOW H;  3S17 H;  2UXC Q;  2NN6 I;  1B8A A;  2GVB A;  2NVX H;  3NEN A;  4ALP A;  1HR0 Q;  2NZO A;  1SLJ A;  2N49 A;  2Y0S E;  5GAD C;  2VUM H;  3RZO H;  1OXX K;  4LF9 Q;  3HOY G;  1BKB A;  3GTK H;  3CD6 A;  2B3G A;  4YY3 L;  2D62 A;  2DGY A;  1CUK A;  2N78 A;  3PV0 A;  4AYB G;  4JYA Q;  4C2M H;  1P8L A;  1HNX Q;  2CQO A;  3I4N G;  4BBS H;  3J80 c;  4DR1 Q;  1YHQ A;  4JI8 Q;  2AWN A;  3SGI A;  4DR2 L;  3ICE A;  1OXV A;  1L1O B;  3S1N H;  2KHI A;  4QL5 A;  1YZ6 A;  3TS2 A;  2Y0S G;  2F3I A;  1KHI A;  1UE6 A;  1IBK Q;  4A3D G;  1IL2 A;  2A1A A;  1G6P A;  3PO3 G;  2JA6 G;  3HOV H;  3KJP A;  2UUC Q;  1K83 H;  2EQS A;  5C0X G;  3K7A H;  4DV5 L;  4A3M H;  1A8V A;  1Q8K A;  1N33 L;  1U5K A;  2K75 A;  4IJL A;  4WJ3 M;  3A5U A;  1V1Q A;  4GKJ Q;  1AE3 A;  1SR3 A;  1TWA H;  2RCN A;  2JA5 H;  1VQM A;  1YHA A;  3CC7 A;  4LF4 L;  1K3R A;  3CW2 C;  1K0R A;  3STB D;  1N9W A;  4APV A;  3CAM A;  3J80 i;  1PH4 A;  4LF5 L;  1KRT A;  1PFS A;  2WP8 J;  4P73 A;  1PYB A;  4P71 A;  4UP9 A;  1EYG A;  3J7A 5;  2YU9 H;  4LNQ A;  3UDX A;  4NPS A;  5E7N A;  3KDF A;  1NMF A;  5IP7 G;  1IBL Q;  4X64 Q;  1A0I A;  1I3Q H;  3NEM A;  4LUO A;  1GM5 A;  2VQF Q;  3HOZ H;  1D8L A;  4K0K L;  2ZTD A;  2IY5 B;  3TQY A;  2N8N A;  3S1M H;  2R6G A;  2XGT A;  1I5F A;  4DK6 C;  4BY1 G;  4JI1 Q;  2JE6 I;  4GN4 B;  4NXM Q;  2BA0 A;  3I4N H;  4A3C H;  3W5O A;  3OW2 A;  3K81 C;  1U0L A;  1KIX A;  4JV5 L;  1QVC A;  1HNZ L;  2JA7 G;  1GO3 E;  1WI5 A;  3UDI A;  2NVT H;  1XNQ Q;  4A3F G;  2R92 H;  4JI4 L;  1HNW Q;  2E5L L;  2PNH A;  3JC6 6;  3H0G G;  1IBM Q;  4B3S L;  3F1Z A;  1VQO A;  4YHH L;  4AIM A;  1X3F A;  2A19 A;  2K50 A;  5AJ3 Q;  4L5R C;  4DV6 L;  2BH8 A;  4UP8 A;  5M3M G;  1QVG A;  4L5T A;  1XPR A;  4GLV B;  4TVA B;  3CCE A;  1FJG L;  4NB3 A;  2WB1 G;  3DLL A;  1LM0 A;  3TRE A;  2HIX A;  4R4C A;  3KJO A;  2VS1 A;  1EQQ A;  1VQG A;  2Q2I A;  3E9I A;  1VQB A;  4R4T A;  3CPF A;  3EIV A;  4PMW A;  4HIK A;  3M9B A;  2VZA A;  3U58 A;  1VQF A;  2IHE A;  5AJ3 L;  1Q82 C;  1FL0 A;  3PGZ A;  4BY7 H;  1E1O A;  5BR8 Q;  4YY3 Q;  5FLM G;  1VQJ A;  1B7Y B;  3S14 H;  2DUD A;  3HFZ B;  3I2Z A;  2NN6 G;  1TWF H;  4IPH A;  1KAW A;  1YJ9 A;  3NEL A;  4JI1 L;  4L5S A;  3UDG A;  1LUZ A;  4LW1 A;  4A93 G;  1TWG H;  4QJF A;  4DV4 L;  4DR5 Q;  4B3T L;  2OQK A;  3FP9 A;  1E7Z A;  1FJG Q;  5IWA Q;  1VQE A;  3S24 A;  3EN2 A;  4IJH A;  5H1S E;  4YWL A;  5IYD G;  5HGQ A;  3I55 A;  2UUC L;  4YWK A;  1JJ2 A;  1Y1W G;  3CCS A;  1KXL A;  4LF5 Q;  2K4K A;  4JBK A;  3KFU A;  4H02 A;  1NY4 A;  5LMN W;  4WJ4 A;  1C7Y A;  3RLO A;  5GAG C;  2MFI A;  1K73 C;  1EUJ A;  4DR7 Q;  1PYS B;  3ZJY C;  3CCQ A;  4GOP C;  1Q7Y C;  4JOI C;  5IYB H;  1L1O A;  5IP9 G;  1E22 A;  1KC8 C;  4BBR H;  5FLX c;  2R93 H;  1WFQ A;  3S1Q H;  3PIP A;  2UUB Q;  1HH2 P;  1VQ8 A;  3HKS A;  3RLF A;  4DUZ L;  3HOX G;  4IFD I;  3HOX H;  4C3I H;  1K8G A;  4OWX B;  3D31 A;  4DV2 Q;  4K0K Q;  4EQ5 A;  5JJK A;  1YJW A;  5LMN L;  4BXX G;  1VQN A;  1V9P A;  2CWA A;  4JG2 A;  5IYB G;  4PZ7 A;  1E1T A;  1EWI A;  4IFD J;  4DR1 L;  3ERS X;  3T1Y Q;  2JA8 G;  2K5H A;  1UEB A;  3G4S A;  4OON A;  4JI7 Q;  3S2H H;  1L0W A;  5IYC G;  1QUQ B;  3CXC A;  1MJE A;  3PO2 H;  1CSP A;  1FVI A;  2R7Z H;  3A0J A;  4NXN L;  1NBW A;  3GD7 A;  2VL6 A;  3I4M G;  4BBS G;  4QQB X;  2CFM A;  4TQU S;  4JI4 Q;  2UUA L;  2ATW A;  4KI0 A;  4QIW E;  2KCT A;  3KF8 B;  1N33 Q;  1Q1B A;  1BVS A;  5IY0 A;  3HOY H;  1EQR A;  4GOP B;  5JEA J;  4JBW A;  3MEF A;  2AWO A;  1R9T H;  1YBY A;  2WAQ E;  3CCR A;  1IBK L;  3KF6 B;  3U50 C;  4LFA L;  3K0X A;  2OQ0 A;  2UXD L;  3IRB A;  4DUY Q;  1GKH A;  1QZH A;  1MKH A;  1ASZ A;  1VQ9 A;  1HZC A;  3T1H Q;  2UUA Q;  3RNU A;  5ELO A;  2Q2T A;  4B3M Q;  4LF6 Q;  4A93 H;  3KLW A;  1EIY B;  4IO9 A;  5HY6 A;  3CQZ H;  2UUB L;  2Q2H A;  2LXK A;  3GTP H;  2ZJR A;  4GOP A;  1C9O A;  1J5E Q;  3AEV A;  2R92 G;  1XMQ L;  2ALY B;  1SFO H;  1I50 H;  2F4V L;  4GLA C;  4BY7 G;  1M1K C;  3CC4 A;  1Q1E A;  4A3G H;  1PVO A;  1HZB A;  3BZC A;  5C44 H;  5M3F G;  1SN8 A;  4GLX A;  4BY1 H;  5LMN Q;  1VCI A;  4LF7 Q;  3GDE A;  4LF8 Q;  3HOU H;  4A76 A;  4X62 L;  3CP0 A;  4NXM L;  2NVY H;  1SMX A;  5C3E G;  4A75 A;  4IPG A;  2C35 B;  1HZA A;  1Y1V H;  1VQD A;  3K7U C;  3T1H L;  4JOI A;  2IT1 A;  1P16 A;  3EBE A;  4LFA Q;  5IT9 c;  4DV3 L;  1JE5 A;  2VQF L;  3I4M H;  3GTJ H;  2K5V A;  2K5N A;  3MXN B;  4GN3 B;  2VQE L;  3S16 H;  4A3L H;  4RG1 A;  3FKI H;  1YVC A;  3W1G A;  3PUV A;  4A3E G;  1S40 A;  1VQ6 A;  5JJL A;  1VQA A;  1VQ5 A;  3TS0 A;  1X3G A;  1X55 A;  1UE1 A;  3CCJ A;  1OXT A;  1RL2 A;  4JI8 L;  1B70 B;  4DR2 Q;  1I94 L;  1HR0 W;  2HHH Q;  4LWC A;  1Y14 B;  1TXY A;  1YNX A;  2QEX A;  2NZH A;  4IFD G;  4FDB A;  5GAE C;  2EIF A;  1G29 1;  2JK8 A;  4KLK A;  1XMO L;  4R4Q A;  4LFB L;  1N32 L;  2R93 G;  2IHF A;  4DV5 Q;  2LSS A;  2BA1 A;  4A3I G;  1X3E A;  2Q2U A;  4HJ7 A;  3RN5 A;  2ES2 A;  4A3D H;  4P74 A;  1KRS A;  4JI6 L;  1GVP A;  2WFW A;  2I5H A;  3BJU A;  2PQA B;  2JA6 H;  3D0F A;  4X6A H;  2V1C C;  1N34 Q;  1SRU A;  2Z6K A;  4OXP A;  4AH6 A;  1H95 A;  5JEA G;  3PSI A;  4XIG S;  1EFW A;  1L2F A;  1KD1 C;  4OWT B;  4DV7 Q;  4IPC A;  4HJA A;  1PH1 A;  3AYH B;  2OWO A;  4JI7 L;  1XMO Q;  2I5L X;  3PUW A;  2B63 G;  4A3K H;  3J81 i;  1BBW A;  4GNX A;  1C0A A;  4DV1 Q;  2GVA A;  3K80 C;  1PA6 A;  1PH2 A;  1AE2 A;  1RIP A;  5IE8 A;  4PZ6 A;  1MIU A;  4P72 A;  4UP7 A;  1N34 L;  1CKO A;  1OXU A;  3M85 A;  2RHQ B;  3VDY A;  4DAY B;  3KYH C;  4C3H H;  1N8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...