2UXBM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxbM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxbM02
4JI5M 1PJIA 2UU9M 1N32M 1XNRM 4DV4M 1L2BA 1EE8A 4LFCM 3U6CA 1L1TA 3J80S 1Q3CA 5LMUM 4AQYM 3U6EA 2ZBKB 4G4QA 1L2CA 1IBKM 2EA0A 2HHHM 4DR6M 1HNXM 4NXMM 1Q3BA 3TWMA 3GPYA 5ITYA 4X65M 4KHPM 4DV1M 4LF5M 4NRWA 1Q39A 1PJJA 4NRVA 5A2QS 4JYAM 3GQ5A 4DV6M 1KFVA 1N36M 3J7AS 4DV2M 4MB7A 3SBJA 4B3TM 1L1ZA 3U6MA 4DR4M 2XZUA 2UUBM 4PDGA 2VQFM 4JI8M 1Z59A 1R2YA 1HNWM 2Q2EB 1Z5CA 2F5PA 4LF6M 2UXDM 4DV7M 2F5SA 4JI3M 3VK7A 4DR7M 3A45A 5ITXA 2OQ4A 3A46A 1XMQM 3A42A 2F5OA 4GKKM 2UXBM 2E5LM 1IBLM 3SARA 3U6DA 3SAUA 3C58A 4DR2M 1FJGM 1Z5BA 3GQ3A 2F4VM 3SAVA 1TDZA 1MX0A 4DV0M 4PD2A 4YY3M 1HR0M 2F5NA 4OX9M 1XC8A 3T1YM 5ITUA 4DV3M 5ITRA 3U6PA 1R2ZA 4B3MM 5ITXE 4NXNM 1N33M 2VQEM 1K82A 4G4RA 5LMNM 4LF8M 4PCZA 5FLXS 3JAMS 4CISA 3OTOM 4K0KM 4LF7M 1Z5AA 5IWAM 1TDHA 3U6QA 1NNJA 2F5QA 4ITQA 3GQ4A 1MU5A 1K3XA 4LFBM 3GP1A 5ITQA 4DV5M 4JI1M 4JI0M 1I94M 1XNQM 4LF9M 4YHHM 3TWKA 3VK8A 3TWLA 4DR1M 5ITTA 4G4NA 5IT9S 4DUYM 2UUAM 4X62M 4DR5M 1IBMM 1PM5A 4JI7M 4B3RM 3U6SA 4X66M 3GO8A 4JI6M 4JI4M 3W0FA 4X64M 3GPUA 3T1HM 4B3SM 3SASA 1J5EM 3U6OA 4G4OA 4GKJM 3JR5A 3SAWA 2XZFA 2UXCM 2OPFA 3GPXA 3JR4A 1L2DA 2ZM6M 3DOAA 4JV5M 4DR3M 5BR8M 2UUCM 3U6LA 4JI2M 4LFAM 1N34M 3J81S 4LF4M 3SATA 1K3WA 2HKJA 1HNZM 3GPPA 4DUZM 4PDIA 1XMOM
chains in the Genus database with same CATH superfamily
4NC6A 3SHFA 2EUCA 4GHAA 1XHBA 3WHKA 4Z6YA 4EIWA 1XXHA 3M6AA 2JNHA 3RGPA 5KPZA 4ANRA 4IBIA 3VKGA 3U6CA 5IREB 2DXIA 2LVAA 1Q3CA 2ZTDA 3LVVA 3B7NA 4L16A 3U60A 2OOBA 1L2CA 2B3TA 1NY5A 3DZDA 2R45A 1D2NA 3KSJA 4Y28F 3GPYA 3KP1E 5F3WA 1N78A 2KRUA 2KZSA 4NRWA 2Y0TA 3EIHA 4LRSA 1EIJA 2CWBA 3PFIA 3GQ5A 2LWXA 2KEBA 3L28A 4RKUF 3V76A 3K9OA 2AHMA 4F1IA 2JWSA 5DNYA 1JR3D 2R18A 4MB7A 4B7HA 1LV7A 2MGWA 1L1ZA 2GNOA 1N75A 1D0LA 1IFYA 2L09A 2RGOA 3HU2A 3BBZA 2JUJA 3J7BA 4MGKE 3R9XB 2FNAA 3SFZA 4HL4A 2Q2EB 1Z5CA 4I5SA 2UXDM 4DV7M 1G3IA 4LCBA 2KRKA 1E94E 1ZV1A 3VK7A 4DR7M 3GLIB 2DHYA 2YFQA 3VDUA 2OQ4A 3AOGA 2E5LM 1Y8GA 2KNVA 1VG5A 3FUVA 5KO3A 3U6DA 3U61B 1TH4A 4KO8A 3BOSA 2R6FA 2F4VM 3ZH9B 2VIIA 2Y21A 2LHGA 3E46A 1MX0A 4IBDA 4JXJA 2C9OA 2K0BX 3CF2A 3J2PB 3FTFA 3T1YM 4M0DA 3U6PA 2BWEA 1A5TA 1QUTA 4NXNM 2L4FA 2Y20A 5ITXE 2VQEM 3KOXE 3K8ZA 4M0WA 3T6PA 4W5WA 3LMMA 3Q8GA 3KS8A 1IN7A 3K9PA 5FLXS 1HT1E 2JY8A 1QANA 1DGBA 2L2DA 4I8OA 3I4VA 3JAMS 4LF7M 4K0KM 2ERCA 3HHYA 3U5ZA 3UZUA 2DWNA 1YUBA 3FD9A 1NNJA 2F5QA 1TF0B 3ILKA 4QNMA 1MU5A 1SXJD 2HAKA 2XLJA 3IHPA 2O01F 2KXEA 2JXNA 1DGFA 1DGHB 1IN4A 1KYIA 3I01M 3NBXX 1OKSA 2LVQD 2Z4SA 2ZANA 4FWGA 4FVMA 4R7GA 2K6BA 2DAKA 3GRVA 1NSFA 3TWKA 3KW6A 3HX3A 3LCVB 1JB0F 5IT9S 4AG6A 1SG9A 4DUYM 4B3RM 4DR5M 2VF7A 2DWMA 1F4IA 3RE8A 3AL0C 4MM3B 1DO0A 3U6SA 3IECA 2BWBA 3M7GA 2LXEA 4XK8F 3W0FA 2BNKA 1G41A 3GPUA 4B3SM 5JI2E 2O25A 2XF3A 3K92A 2Y0QA 3R8FA 4WW0A 2DENA 1W5TA 4LJ7A 3B9PA 3HHWA 2DZLA 3JR4A 3L27A 4D82A 2ZM6M 4JV5M 2H1RA 4DR3M 2C5RA 1GLNA 4IBGA 2HKJA 2QBYA 2MH8A 2R44A 4DUZM 1OIZA 1NJGA 4GH9A 4JI5M 2QZ4A 2JA2A 4I81A 3KDSE 4QOZC 1L2BA 3WHLA 5FTLA 2Z3XA 1DO2A 1IXZA 4D81A 5H37D 5LMUM 3FUTA 4ZPXA 2ZBKB 4G4QA 1G59A 3AOEC 2YQZA 1LTMA 3LQQA 4DR6M 4QOSA 1Q3BA 1OTRA 3TWMA 3CGWA 4X65M 1WR1B 1G71A 4LF5M 3HZJA 4QHSA 1QDTA 1PJJA 2QP9X 4JYAM 2KW0A 1R4GA 2ZTCA 1VDLA 2FE8A 1WIVA 4R71A 2FS1A 2Z4RA 3GRYA 2EO2A 1HQCA 2DVWB 2CV0A 3HKPA 3SBJA 2X49A 4B3TM 4B7GA 4KT0F 1IXSB 3MK6A 4M9XA 5E6JA 4TUWA 1YSYA 2HL7A 4GIPA 1XXHB 1OAIA 1GL6A 4QHTA 1Z59A 1R2YA 3BXWA 3SYLA 2DAIA 2L7IA 5EP1A 4AZFA 2X4AA 1Z6TA 3U60B 2MR9A 3PNYA 3FTCA 1NY6A 1GJSA 2FOIC 2G5GX 3K1JA 2M5ZA 5ITXA 3TQSA 3GLGB 4LJ4A 3A42A 4FD2A 3W68A 4GKKM 2QPAA 1QDRA 2DNAA 4LJ6A 3SMPA 4AKGA 1QAOA 4S12A 3UK6A 3C58A 2YR0A 1NNUC 1E9SA 1C1KA 1Z5BA 3AJIB 1GL7A 3RGSA 1T43A 2CRUA 4DV0M 1HR0M 5DYIA 4GMQA 1SXJE 4DV3M 4OVZA 5ITRA 4GITA 2C96A 4NSOB 4IBEA 2XSZA 4D80A 3GLFB 5LMNM 3FYDA 2LBCA 3VDPA 4FCTA 2C98A 5FTJA 3CF0A 3OTOM 3AKZA 2P5TA 2CHVA 4CHTB 1OFHA 1TDHA 3LQRA 5EJCA 1CUKA 4IJFA 3F92A 1DV0A 3GQ4A 1TH3A 2CHQA 2XFTA 3E21A 2OO9A 3GLHB 1HJPA 1K3XA 2EKKA 3GP1A 4DV5M 2LH0A 1C7YA 2ZAMA 1H6UA 1QQWA 2I7PA 2N35A 4JI0M 1I94M 2L4EA 4L6V6 4LF9M 2R0IA 4IBBA 2MJ5B 2CUZA 1VDDA 8CATA 3UJNA 2KDLA 4AKHA 2G3QA 2JY7A 2X8AA 3VK8A 3TWLA 1QYRA 4G4NA 2LNHC 1TTEA 1GJTA 1HT2E 5C18A 2KNZA 3FTDA 1OFIA 2QCUA 2V1UA 2D7HA 1RU3A 5DFLA 2NQ8C 1MJGM 5EP2A 5KPRA 1WHCA 3T1HM 1UFZA 1VQ1A 4NOOB 1JR3A 3U61A 2DAGA 3JR5A 1ZMUA 2XZFA 3GPXA 4FWHA 3I4YA 1UM8A 3DOAA 4LZJA 3U6LA 3C3EA 3RFWA 1S3SA 4GEWA 3E4RA 4LF4M 5FSWA 2XGNA 1HNZM 3MMPA 2DAEA 1BVSA 3KOYE 4GC9A 4B7FA 1WGLA 1ZQ9A 4A3VB 4JN6A 2UU9M 2DHRA 3HHZA 1XNRM 4DV4M 2Z8YM 1KSFX 1VEKA 3AV0A 1Q02A 4LFCM 4L8RC 1L1TA 3J80S 4AQYM 4CGYB 2H5XA 2QNJA 3U6EA 1IBKM 1GABA 4F2LA 1TH2A 1TR8A 2V1CA 3CF6E 1HNXM 3KS4A 1QAMA 1AIPC 4MGZE 3B7QA 4DV1M 5EXXA 2G8LA 3T15A 1Q39A 2YNMD 5A2QS 4IJEA 1T3TA 2WSCF 1N36M 1NHWC 3K2LA 1IN6A 3GRUA 3M0EA 3UGJA 1V34A 2BJWA 4DV2M 2QBYB 5FTMA 2CV2A 4LJ9A 3HY5A 3I51A 1XMOM 1GO5A 2XZUA 3HGIA 1QUSA 1L2DA 4PDGA 2K47A 2UUBM 3LW5F 1YLAA 3GLIE 4B08A 4FCWA 4FCVA 2VQFM 1NJFA 4JI8M 4G3OA 1IY1A 2JZ1A 3E9SA 1QZMA 1JR3E 1VEGA 2F5PA 4CJ6A 2D7EA 3FRHA 4LJAA 3THGA 1SXJA 2XEPA 4WURA 2OOAA 1R5LA 4IBCA 4L15A 3A45A 3AOEA 3PXGA 3A46A 2F5OA 4R3DA 1V92A 2UXBM 1IBLM 4MH0E 4WP2A 2EJSA 2QSFX 3SAUA 4KLNA 3L2AA 1TDZA 4PD2A 5IZ7D 3TPZA 4YY3M 4MGIE 1JQJC 3VLFB 4B3MM 1R2ZA 5KQ8A 3Q8XA 3L26A 1N33M 4AI6A 3B89A 2FH0A 1W5SA 2O5RA 4G4RA 1NO1A 4LF8M 4PCZA 2JZ0A 1D0MA 3SC3A 3FTEA 4HLQA 2K9DA 1FNNA 4LZZA 2DZNB 1WXQA 2WSFF 1L8QA 1QAQA 5JI3E 3PVSA 5EXTA 4ITQA 1WJ7A 3KSXA 1I4WA 3H4JA 2DWZB 3FE3A 3TE6A 1YE9A 2V6ZM 4NL4H 4LFBM 3ZQJA 1OIPA 3KVWA 1GVNA 3NWLA 2HWJA 4OVZB 4RNAA 4I4LA 5KQDA 2LHCA 3FUUA 1AUAA 3IG8A 2LTUA 1IXSA 1IY2A 4IBJA 3W67A 2WZJA 4DR1M 1E9RA 2VF8A 1V33A 2JP7A 4MGHA 4JI7M 3KP0E 1IBMM 1PJTA 3NBIA 2I7NA 4IBKA 4OW0A 1GKIA 4X66M 4LGMA 3GO8A 4JI6M 4RF0A 3D8BA 3J27B 3QYEA 4X64M 4NSRA 4BBAA 1IY0A 3GLGA 4LY6A 1WGNA 3SASA 3HHXA 3U6OA 4GKJM 1R6BX 4LG2A 2XH9A 4LGYA 3C9PA 3MHVC 3I04M 4LRTA 3W0LB 2QQ8A 5KPTA 2OPFA 5L8RF 3QYBA 2CE7A 1G4AE 4AG5A 5BR8M 1DGGA 1P3QQ 4DBGB 3J81S 3SATA 2QHOB 2RRUA 1K3WA 1NHGC 2CEAA 1OAOC 4L4UA 1T6OA 3GPPA 4PDIA 3EIEA 1PGYA 2R62A 3AFHA 5EXPA 3GLFA 1PJIA 1N32M 3L29A 3SHGB 1EE8A 1X37A 1NV9A 3KOWE 1XB2B 3HWSA 3U5ZB 3FRIA 1PJSA 3PNVA 2A5YB 2QENA 2RGHA 4GC5A 3HJ8A 5EXSA 2EA0A 2HHHM 4NXMM 2R4JA 3GLIA 3C3DA 5ITYA 1ZMWA 4KHPM 2CHGA 3SMSA 5EP3A 4NRVA 2J7NA 2R46A 3KXEC 4P16A 4AKIA 1XXHE 4L78A 3GLHA 4DV6M 1KFVA 2CV1A 3J7AS 1G8PA 1PJQA 3HJSA 3U6MA 4DR4M 2LVNC 2KA6B 4IBFA 4LJ5A 4REZA 1E32A 3GLGE 1D0KA 5FTKA 1HNWM 4HEOA 4LF6M 3VFDA 1IXRC 3FUXA 4P17A 2F5SA 4JI3M 4G6ZA 4BLCA 2EKFA 5FTNA 4QNRA 2C9CA 3VKHA 1XMQM 3HU1A 3SARA 3H4MA 3A98B 4AW4A 4II7A 1ZMVA 4DR2M 1FJGM 1TGUA 2DI0A 3GQ3A 3QAUA 1ORYB 5E26A 4FW9A 4MGYE 3SYKA 3GLFE 3D8LA 4Q7JA 3HU3A 4OU7A 3SAVA 1DGHA 2F5NA 4OX9M 1XC8A 4XBOA 3LVWA 3T38A 5BPVA 5ITUA 1QVRA 2C99A 1HQYE 4M9ZA 2GQFA 3L25A 2R65A 1K82A 2LVPC 2DZOB 4IIWA 4UN2B 4BB9A 2JY6B 2RKOA 1IQPA 7CATA 1SXJB 2WSEF 3GRRA 2DWLA 4CISA 1Z5AA 3IG5A 3GLHE 2CFOA 2KHHA 2XFSA 5C1BA 3LCUA 5IWAM 4GHLA 2FFJA 3QWLA 2KZUA 2R4EA 1IN8A 3U6QA 1OJLA 3DFZA 1PRBA 5EQTA 4CIZA 4GRIA 2BJVA 1R7RA 4FWDA 2D7GA 5DYGA 3CTWB 5ITQA 4JI1M 3ZCBB 1J09A 1VEJA 4LJ8A 1XNQM 2MROB 2W82A 4YHHM 2CP8A 3MJ5A 1J7KA 2JY5A 1QZEA 2M60A 3B7ZA 4Z8XA 3DA1A 5ITTA 1IM2A 1OQYA 3FUWA 2UUAM 3FYCA 1NV8A 1SXJC 2LVOC 2VDBB 4XGIA 4X62M 1PM5A 2DKLA 2KNAA 1XWIA 2XSZD 1IN5A 4RF1A 4JI4M 1NVMA 2L7HA 5EP4A 3KOZE 4KODA 3KFUG 1ZAEA 2ZAOA 2J5YA 2APLA 2J7OA 3FKEA 1N77A 1J5EM 1MN3A 4G4OA 3UMMA 5GKNA 3SAWA 2UXCM 2HCBA 3B74A 4M9SA 4JI2M 2UUCM 4PT5A 3HJQA 2L6OA 4LFAM 1N34M 2DAMA 2Z7JA 3TL4X 3ZC7B 1EFUB
chains in the Genus database with same CATH topology
3SHFA 2EUCA 4GHAA 1XHBA 3WHKA 4Z6YA 4EIWA 1XXHA 3M6AA 3RGPA 5KPZA 4IBIA 3VKGA 3U6CA 5IREB 2DXIA 1Q3CA 3LVVA 4L16A 3U60A 1L2CA 1NY5A 3DZDA 2R45A 1D2NA 3KSJA 3GPYA 1N78A 3KP1E 5F3WA 2KRUA 2KZSA 4NRWA 2Y0TA 3EIHA 4LRSA 3PFIA 3GQ5A 2LWXA 2KEBA 3L28A 2AHMA 5DNYA 1JR3D 2R18A 4MB7A 4B7HA 1LV7A 1L1ZA 1N75A 2L09A 2RGOA 3HU2A 3J7BA 4MGKE 3R9XB 2FNAA 3SFZA 4HL4A 2Q2EB 1Z5CA 4I5SA 2UXDM 4DV7M 1G3IA 4LCBA 2KRKA 1E94E 3VK7A 4DR7M 3GLIB 2YFQA 3VDUA 2OQ4A 3AOGA 2E5LM 3U61B 3FUVA 5KO3A 3U6DA 1TH4A 4KO8A 3BOSA 2F4VM 3ZH9B 2VIIA 2Y21A 1MX0A 4IBDA 4JXJA 2C9OA 3CF2A 3J2PB 3FTFA 3T1YM 4M0DA 3U6PA 5ITXE 4NXNM 2Y20A 2VQEM 3KOXE 3K8ZA 4M0WA 4W5WA 3LMMA 3KS8A 1IN7A 5FLXS 1HT1E 4I8OA 1QANA 1DGBA 3JAMS 4K0KM 3I4VA 4LF7M 2ERCA 3HHYA 3U5ZA 3UZUA 2DWNA 1YUBA 3FD9A 1NNJA 2F5QA 3ILKA 4QNMA 1MU5A 1SXJD 2XLJA 2KXEA 1DGFA 1DGHB 1IN4A 1KYIA 4FWGA 2Z4SA 2ZANA 4FVMA 4R7GA 3GRVA 1NSFA 3TWKA 3KW6A 5IT9S 4AG6A 4DUYM 4B3RM 4DR5M 2DWMA 3RE8A 3AL0C 4MM3B 1DO0A 3U6SA 3M7GA 2LXEA 3W0FA 2BNKA 1G41A 3GPUA 4B3SM 5JI2E 2XF3A 3K92A 2Y0QA 3R8FA 4WW0A 4LJ7A 1W5TA 3B9PA 3HHWA 3JR4A 3L27A 4D82A 2ZM6M 4JV5M 2H1RA 4DR3M 2C5RA 1GLNA 4IBGA 2HKJA 2QBYA 4DUZM 1NJGA 4GH9A 4JI5M 2QZ4A 2JA2A 4I81A 3KDSE 4QOZC 1L2BA 3WHLA 5FTLA 2Z3XA 1DO2A 1IXZA 4D81A 5H37D 5LMUM 3FUTA 4ZPXA 2ZBKB 4G4QA 1G59A 3AOEC 2YQZA 3LQQA 4DR6M 4QOSA 1Q3BA 3TWMA 4X65M 4LF5M 4QHSA 1PJJA 2QP9X 4JYAM 2KW0A 2FE8A 2Z4RA 3GRYA 2EO2A 1HQCA 2DVWB 2CV0A 3HKPA 3SBJA 2X49A 4B3TM 4B7GA 4M9XA 1IXSB 3MK6A 5E6JA 4TUWA 1YSYA 2HL7A 4GIPA 1XXHB 1GL6A 4QHTA 1Z59A 1R2YA 3SYLA 2L7IA 5EP1A 4AZFA 2X4AA 1Z6TA 3U60B 3PNYA 3FTCA 1NY6A 2FOIC 2G5GX 3K1JA 2M5ZA 5ITXA 3TQSA 3GLGB 4LJ4A 3A42A 4FD2A 4GKKM 4AKGA 2QPAA 4LJ6A 3SMPA 1QAOA 4S12A 3UK6A 3C58A 2YR0A 1NNUC 1E9SA 1C1KA 1Z5BA 3AJIB 1GL7A 3RGSA 4DV0M 1HR0M 5DYIA 4GMQA 1SXJE 4DV3M 4OVZA 5ITRA 4GITA 2C96A 4NSOB 4IBEA 2XSZA 4D80A 3GLFB 5LMNM 3FYDA 3VDPA 4FCTA 2C98A 5FTJA 3CF0A 3OTOM 3AKZA 2P5TA 2CHVA 4CHTB 1OFHA 1TDHA 3LQRA 5EJCA 4IJFA 3GQ4A 1TH3A 2CHQA 2XFTA 1K3XA 3GLHB 3GP1A 4DV5M 2LH0A 2ZAMA 1H6UA 1QQWA 2I7PA 4JI0M 1I94M 4LF9M 4IBBA 2CUZA 1VDDA 8CATA 3UJNA 4AKHA 3VK8A 2X8AA 3TWLA 1QYRA 4G4NA 2LNHC 1HT2E 5C18A 3FTDA 1OFIA 2QCUA 2V1UA 2D7HA 2NQ8C 5EP2A 5KPRA 3T1HM 4NOOB 1JR3A 3U61A 3JR5A 2XZFA 3GPXA 4FWHA 3I4YA 1UM8A 3DOAA 4LZJA 3U6LA 3RFWA 1S3SA 3E4RA 4LF4M 5FSWA 2XGNA 1HNZM 3KOYE 4GC9A 4B7FA 1ZQ9A 4A3VB 4JN6A 2UU9M 2DHRA 3HHZA 1XNRM 4DV4M 1KSFX 3AV0A 4LFCM 4L8RC 1L1TA 3J80S 4AQYM 4CGYB 3U6EA 1IBKM 1TH2A 2V1CA 3CF6E 1HNXM 3KS4A 1QAMA 4MGZE 4DV1M 5EXXA 2G8LA 3T15A 1Q39A 2YNMD 5A2QS 4IJEA 1T3TA 1N36M 1NHWC 3K2LA 1IN6A 3GRUA 3M0EA 3UGJA 2BJWA 4DV2M 2QBYB 5FTMA 2CV2A 4LJ9A 3I51A 2XZUA 3HGIA 2UUBM 4PDGA 2K47A 2VQFM 4B08A 4FCWA 4FCVA 1NJFA 4JI8M 1IY1A 3E9SA 1QZMA 2F5PA 2D7EA 4LJAA 3THGA 1SXJA 2XEPA 4WURA 4IBCA 4L15A 3A45A 3AOEA 3PXGA 3A46A 2F5OA 4R3DA 2UXBM 1IBLM 4MH0E 3SAUA 4KLNA 3L2AA 1TDZA 4PD2A 5IZ7D 3TPZA 4YY3M 4MGIE 1JQJC 3VLFB 4B3MM 1R2ZA 5KQ8A 3Q8XA 3L26A 1N33M 4AI6A 1W5SA 2O5RA 4G4RA 4LF8M 4PCZA 3SC3A 3FTEA 4HLQA 1FNNA 4LZZA 2DZNB 1WXQA 1L8QA 1QAQA 5JI3E 3PVSA 5EXTA 4ITQA 3KSXA 1I4WA 2DWZB 3TE6A 1YE9A 2V6ZM 4NL4H 4LFBM 3KVWA 1GVNA 3NWLA 4OVZB 4RNAA 4I4LA 5KQDA 3FUUA 3IG8A 1IY2A 4IBJA 4DR1M 1E9RA 4MGHA 4JI7M 3KP0E 1IBMM 3NBIA 2I7NA 4IBKA 4OW0A 1GKIA 4X66M 4LGMA 3GO8A 4JI6M 4RF0A 3D8BA 3J27B 4X64M 3GLGA 4NSRA 4BBAA 1IY0A 4LY6A 3SASA 3HHXA 3U6OA 4GKJM 1R6BX 4LG2A 2XH9A 4LGYA 3MHVC 4LRTA 5KPTA 3W0LB 2OPFA 1L2DA 3KFUG 4AG5A 2CE7A 1G4AE 5BR8M 1DGGA 3J81S 3SATA 1K3WA 1NHGC 2CEAA 3GPPA 4L4UA 4PDIA 3EIEA 2R62A 3AFHA 5EXPA 3GLFA 1PJIA 1N32M 3L29A 3SHGB 1EE8A 1X37A 3KOWE 3HWSA 3U5ZB 3PNVA 2A5YB 2QENA 2RGHA 4GC5A 3HJ8A 5EXSA 2EA0A 2HHHM 4NXMM 2R4JA 3GLIA 5ITYA 4KHPM 2CHGA 3SMSA 5EP3A 4NRVA 2J7NA 2R46A 3KXEC 4P16A 4AKIA 4DV6M 4L78A 3GLHA 1KFVA 2CV1A 3J7AS 1G8PA 3HJSA 3U6MA 4DR4M 2KA6B 4IBFA 4LJ5A 4REZA 1E32A 5FTKA 1HNWM 4LF6M 3VFDA 1IXRC 3FUXA 2F5SA 4JI3M 4G6ZA 4BLCA 5FTNA 4QNRA 2C9CA 3VKHA 1XMQM 3HU1A 3SARA 3H4MA 3A98B 4AW4A 4II7A 4DR2M 1FJGM 1TGUA 3GQ3A 3QAUA 1ORYB 5E26A 4FW9A 4MGYE 3SYKA 3SAVA 3D8LA 4OU7A 3HU3A 2F5NA 1DGHA 4OX9M 1XC8A 4XBOA 3LVWA 3T38A 5BPVA 5ITUA 1QVRA 2C99A 1HQYE 4M9ZA 3L25A 2R65A 1K82A 4BB9A 2DZOB 4IIWA 2RKOA 1IQPA 7CATA 1SXJB 3GRRA 2DWLA 4CISA 1Z5AA 3IG5A 2CFOA 5C1BA 2XFSA 5IWAM 4GHLA 2FFJA 3QWLA 2KZUA 2R4EA 1IN8A 3U6QA 1OJLA 3DFZA 5EQTA 4GRIA 2BJVA 1R7RA 4FWDA 2D7GA 5DYGA 3CTWB 5ITQA 4JI1M 3ZCBB 1J09A 4LJ8A 1XNQM 2W82A 4YHHM 3MJ5A 1J7KA 2M60A 4Z8XA 3DA1A 5ITTA 1IM2A 3FUWA 2UUAM 3FYCA 4X62M 1SXJC 1PM5A 4XGIA 1XWIA 2XSZD 1IN5A 4RF1A 4JI4M 1NVMA 2L7HA 5EP4A 3KOZE 4KODA 1ZAEA 2ZAOA 3FKEA 1N77A 2J7OA 1J5EM 4G4OA 3UMMA 5GKNA 3SAWA 2UXCM 2HCBA 4M9SA 4JI2M 2UUCM 4PT5A 3HJQA 2L6OA 4LFAM 1N34M 2Z7JA 3TL4X 3ZC7B 1XMOM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 M;  1PJI A;  2UU9 M;  1N32 M;  1XNR M;  4DV4 M;  1L2B A;  1EE8 A;  4LFC M;  3U6C A;  1L1T A;  3J80 S;  1Q3C A;  5LMU M;  4AQY M;  3U6E A;  2ZBK B;  4G4Q A;  1L2C A;  1IBK M;  2EA0 A;  2HHH M;  4DR6 M;  1HNX M;  4NXM M;  1Q3B A;  3TWM A;  3GPY A;  5ITY A;  4X65 M;  4KHP M;  4DV1 M;  4LF5 M;  4NRW A;  1Q39 A;  1PJJ A;  4NRV A;  5A2Q S;  4JYA M;  3GQ5 A;  4DV6 M;  1KFV A;  1N36 M;  3J7A S;  4DV2 M;  4MB7 A;  3SBJ A;  4B3T M;  1L1Z A;  3U6M A;  4DR4 M;  2XZU A;  2UUB M;  4PDG A;  2VQF M;  4JI8 M;  1Z59 A;  1R2Y A;  1HNW M;  2Q2E B;  1Z5C A;  2F5P A;  4LF6 M;  2UXD M;  4DV7 M;  2F5S A;  4JI3 M;  3VK7 A;  4DR7 M;  3A45 A;  5ITX A;  2OQ4 A;  3A46 A;  1XMQ M;  3A42 A;  2F5O A;  4GKK M;  2UXB M;  2E5L M;  1IBL M;  3SAR A;  3U6D A;  3SAU A;  3C58 A;  4DR2 M;  1FJG M;  1Z5B A;  3GQ3 A;  2F4V M;  3SAV A;  1TDZ A;  1MX0 A;  4DV0 M;  4PD2 A;  4YY3 M;  1HR0 M;  2F5N A;  4OX9 M;  1XC8 A;  3T1Y M;  5ITU A;  4DV3 M;  5ITR A;  3U6P A;  1R2Z A;  4B3M M;  5ITX E;  4NXN M;  1N33 M;  2VQE M;  1K82 A;  4G4R A;  5LMN M;  4LF8 M;  4PCZ A;  5FLX S;  3JAM S;  4CIS A;  3OTO M;  4K0K M;  4LF7 M;  1Z5A A;  5IWA M;  1TDH A;  3U6Q A;  1NNJ A;  2F5Q A;  4ITQ A;  3GQ4 A;  1MU5 A;  1K3X A;  4LFB M;  3GP1 A;  5ITQ A;  4DV5 M;  4JI1 M;  4JI0 M;  1I94 M;  1XNQ M;  4LF9 M;  4YHH M;  3TWK A;  3VK8 A;  3TWL A;  4DR1 M;  5ITT A;  4G4N A;  5IT9 S;  4DUY M;  2UUA M;  4X62 M;  4DR5 M;  1IBM M;  1PM5 A;  4JI7 M;  4B3R M;  3U6S A;  4X66 M;  3GO8 A;  4JI6 M;  4JI4 M;  3W0F A;  4X64 M;  3GPU A;  3T1H M;  4B3S M;  3SAS A;  1J5E M;  3U6O A;  4G4O A;  4GKJ M;  3JR5 A;  3SAW A;  2XZF A;  2UXC M;  2OPF A;  3GPX A;  3JR4 A;  1L2D A;  2ZM6 M;  3DOA A;  4JV5 M;  4DR3 M;  5BR8 M;  2UUC M;  3U6L A;  4JI2 M;  4LFA M;  1N34 M;  3J81 S;  4LF4 M;  3SAT A;  1K3W A;  2HKJ A;  1HNZ M;  3GPP A;  4DUZ M;  4PDI A;  1XMO M; 
#chains in the Genus database with same CATH topology
 4NC6 A;  3SHF A;  2EUC A;  4GHA A;  1XHB A;  3WHK A;  4Z6Y A;  4EIW A;  1XXH A;  3M6A A;  2JNH A;  3RGP A;  5KPZ A;  4ANR A;  4IBI A;  3VKG A;  3U6C A;  5IRE B;  2DXI A;  2LVA A;  1Q3C A;  2ZTD A;  3LVV A;  3B7N A;  4L16 A;  3U60 A;  2OOB A;  1L2C A;  2B3T A;  1NY5 A;  3DZD A;  2R45 A;  1D2N A;  3KSJ A;  4Y28 F;  3GPY A;  3KP1 E;  5F3W A;  1N78 A;  2KRU A;  2KZS A;  4NRW A;  2Y0T A;  3EIH A;  4LRS A;  1EIJ A;  2CWB A;  3PFI A;  3GQ5 A;  2LWX A;  2KEB A;  3L28 A;  4RKU F;  3V76 A;  3K9O A;  2AHM A;  4F1I A;  2JWS A;  5DNY A;  1JR3 D;  2R18 A;  4MB7 A;  4B7H A;  1LV7 A;  2MGW A;  1L1Z A;  2GNO A;  1N75 A;  1D0L A;  1IFY A;  2L09 A;  2RGO A;  3HU2 A;  3BBZ A;  2JUJ A;  3J7B A;  4MGK E;  3R9X B;  2FNA A;  3SFZ A;  4HL4 A;  2Q2E B;  1Z5C A;  4I5S A;  2UXD M;  4DV7 M;  1G3I A;  4LCB A;  2KRK A;  1E94 E;  1ZV1 A;  3VK7 A;  4DR7 M;  3GLI B;  2DHY A;  2YFQ A;  3VDU A;  2OQ4 A;  3AOG A;  2E5L M;  1Y8G A;  2KNV A;  1VG5 A;  3FUV A;  5KO3 A;  3U6D A;  3U61 B;  1TH4 A;  4KO8 A;  3BOS A;  2R6F A;  2F4V M;  3ZH9 B;  2VII A;  2Y21 A;  2LHG A;  3E46 A;  1MX0 A;  4IBD A;  4JXJ A;  2C9O A;  2K0B X;  3CF2 A;  3J2P B;  3FTF A;  3T1Y M;  4M0D A;  3U6P A;  2BWE A;  1A5T A;  1QUT A;  4NXN M;  2L4F A;  2Y20 A;  5ITX E;  2VQE M;  3KOX E;  3K8Z A;  4M0W A;  3T6P A;  4W5W A;  3LMM A;  3Q8G A;  3KS8 A;  1IN7 A;  3K9P A;  5FLX S;  1HT1 E;  2JY8 A;  1QAN A;  1DGB A;  2L2D A;  4I8O A;  3I4V A;  3JAM S;  4LF7 M;  4K0K M;  2ERC A;  3HHY A;  3U5Z A;  3UZU A;  2DWN A;  1YUB A;  3FD9 A;  1NNJ A;  2F5Q A;  1TF0 B;  3ILK A;  4QNM A;  1MU5 A;  1SXJ D;  2HAK A;  2XLJ A;  3IHP A;  2O01 F;  2KXE A;  2JXN A;  1DGF A;  1DGH B;  1IN4 A;  1KYI A;  3I01 M;  3NBX X;  1OKS A;  2LVQ D;  2Z4S A;  2ZAN A;  4FWG A;  4FVM A;  4R7G A;  2K6B A;  2DAK A;  3GRV A;  1NSF A;  3TWK A;  3KW6 A;  3HX3 A;  3LCV B;  1JB0 F;  5IT9 S;  4AG6 A;  1SG9 A;  4DUY M;  4B3R M;  4DR5 M;  2VF7 A;  2DWM A;  1F4I A;  3RE8 A;  3AL0 C;  4MM3 B;  1DO0 A;  3U6S A;  3IEC A;  2BWB A;  3M7G A;  2LXE A;  4XK8 F;  3W0F A;  2BNK A;  1G41 A;  3GPU A;  4B3S M;  5JI2 E;  2O25 A;  2XF3 A;  3K92 A;  2Y0Q A;  3R8F A;  4WW0 A;  2DEN A;  1W5T A;  4LJ7 A;  3B9P A;  3HHW A;  2DZL A;  3JR4 A;  3L27 A;  4D82 A;  2ZM6 M;  4JV5 M;  2H1R A;  4DR3 M;  2C5R A;  1GLN A;  4IBG A;  2HKJ A;  2QBY A;  2MH8 A;  2R44 A;  4DUZ M;  1OIZ A;  1NJG A;  4GH9 A;  4JI5 M;  2QZ4 A;  2JA2 A;  4I81 A;  3KDS E;  4QOZ C;  1L2B A;  3WHL A;  5FTL A;  2Z3X A;  1DO2 A;  1IXZ A;  4D81 A;  5H37 D;  5LMU M;  3FUT A;  4ZPX A;  2ZBK B;  4G4Q A;  1G59 A;  3AOE C;  2YQZ A;  1LTM A;  3LQQ A;  4DR6 M;  4QOS A;  1Q3B A;  1OTR A;  3TWM A;  3CGW A;  4X65 M;  1WR1 B;  1G71 A;  4LF5 M;  3HZJ A;  4QHS A;  1QDT A;  1PJJ A;  2QP9 X;  4JYA M;  2KW0 A;  1R4G A;  2ZTC A;  1VDL A;  2FE8 A;  1WIV A;  4R71 A;  2FS1 A;  2Z4R A;  3GRY A;  2EO2 A;  1HQC A;  2DVW B;  2CV0 A;  3HKP A;  3SBJ A;  2X49 A;  4B3T M;  4B7G A;  4KT0 F;  1IXS B;  3MK6 A;  4M9X A;  5E6J A;  4TUW A;  1YSY A;  2HL7 A;  4GIP A;  1XXH B;  1OAI A;  1GL6 A;  4QHT A;  1Z59 A;  1R2Y A;  3BXW A;  3SYL A;  2DAI A;  2L7I A;  5EP1 A;  4AZF A;  2X4A A;  1Z6T A;  3U60 B;  2MR9 A;  3PNY A;  3FTC A;  1NY6 A;  1GJS A;  2FOI C;  2G5G X;  3K1J A;  2M5Z A;  5ITX A;  3TQS A;  3GLG B;  4LJ4 A;  3A42 A;  4FD2 A;  3W68 A;  4GKK M;  2QPA A;  1QDR A;  2DNA A;  4LJ6 A;  3SMP A;  4AKG A;  1QAO A;  4S12 A;  3UK6 A;  3C58 A;  2YR0 A;  1NNU C;  1E9S A;  1C1K A;  1Z5B A;  3AJI B;  1GL7 A;  3RGS A;  1T43 A;  2CRU A;  4DV0 M;  1HR0 M;  5DYI A;  4GMQ A;  1SXJ E;  4DV3 M;  4OVZ A;  5ITR A;  4GIT A;  2C96 A;  4NSO B;  4IBE A;  2XSZ A;  4D80 A;  3GLF B;  5LMN M;  3FYD A;  2LBC A;  3VDP A;  4FCT A;  2C98 A;  5FTJ A;  3CF0 A;  3OTO M;  3AKZ A;  2P5T A;  2CHV A;  4CHT B;  1OFH A;  1TDH A;  3LQR A;  5EJC A;  1CUK A;  4IJF A;  3F92 A;  1DV0 A;  3GQ4 A;  1TH3 A;  2CHQ A;  2XFT A;  3E21 A;  2OO9 A;  3GLH B;  1HJP A;  1K3X A;  2EKK A;  3GP1 A;  4DV5 M;  2LH0 A;  1C7Y A;  2ZAM A;  1H6U A;  1QQW A;  2I7P A;  2N35 A;  4JI0 M;  1I94 M;  2L4E A;  4L6V 6;  4LF9 M;  2R0I A;  4IBB A;  2MJ5 B;  2CUZ A;  1VDD A;  8CAT A;  3UJN A;  2KDL A;  4AKH A;  2G3Q A;  2JY7 A;  2X8A A;  3VK8 A;  3TWL A;  1QYR A;  4G4N A;  2LNH C;  1TTE A;  1GJT A;  1HT2 E;  5C18 A;  2KNZ A;  3FTD A;  1OFI A;  2QCU A;  2V1U A;  2D7H A;  1RU3 A;  5DFL A;  2NQ8 C;  1MJG M;  5EP2 A;  5KPR A;  1WHC A;  3T1H M;  1UFZ A;  1VQ1 A;  4NOO B;  1JR3 A;  3U61 A;  2DAG A;  3JR5 A;  1ZMU A;  2XZF A;  3GPX A;  4FWH A;  3I4Y A;  1UM8 A;  3DOA A;  4LZJ A;  3U6L A;  3C3E A;  3RFW A;  1S3S A;  4GEW A;  3E4R A;  4LF4 M;  5FSW A;  2XGN A;  1HNZ M;  3MMP A;  2DAE A;  1BVS A;  3KOY E;  4GC9 A;  4B7F A;  1WGL A;  1ZQ9 A;  4A3V B;  4JN6 A;  2UU9 M;  2DHR A;  3HHZ A;  1XNR M;  4DV4 M;  2Z8Y M;  1KSF X;  1VEK A;  3AV0 A;  1Q02 A;  4LFC M;  4L8R C;  1L1T A;  3J80 S;  4AQY M;  4CGY B;  2H5X A;  2QNJ A;  3U6E A;  1IBK M;  1GAB A;  4F2L A;  1TH2 A;  1TR8 A;  2V1C A;  3CF6 E;  1HNX M;  3KS4 A;  1QAM A;  1AIP C;  4MGZ E;  3B7Q A;  4DV1 M;  5EXX A;  2G8L A;  3T15 A;  1Q39 A;  2YNM D;  5A2Q S;  4IJE A;  1T3T A;  2WSC F;  1N36 M;  1NHW C;  3K2L A;  1IN6 A;  3GRU A;  3M0E A;  3UGJ A;  1V34 A;  2BJW A;  4DV2 M;  2QBY B;  5FTM A;  2CV2 A;  4LJ9 A;  3HY5 A;  3I51 A;  1XMO M;  1GO5 A;  2XZU A;  3HGI A;  1QUS A;  1L2D A;  4PDG A;  2K47 A;  2UUB M;  3LW5 F;  1YLA A;  3GLI E;  4B08 A;  4FCW A;  4FCV A;  2VQF M;  1NJF A;  4JI8 M;  4G3O A;  1IY1 A;  2JZ1 A;  3E9S A;  1QZM A;  1JR3 E;  1VEG A;  2F5P A;  4CJ6 A;  2D7E A;  3FRH A;  4LJA A;  3THG A;  1SXJ A;  2XEP A;  4WUR A;  2OOA A;  1R5L A;  4IBC A;  4L15 A;  3A45 A;  3AOE A;  3PXG A;  3A46 A;  2F5O A;  4R3D A;  1V92 A;  2UXB M;  1IBL M;  4MH0 E;  4WP2 A;  2EJS A;  2QSF X;  3SAU A;  4KLN A;  3L2A A;  1TDZ A;  4PD2 A;  5IZ7 D;  3TPZ A;  4YY3 M;  4MGI E;  1JQJ C;  3VLF B;  4B3M M;  1R2Z A;  5KQ8 A;  3Q8X A;  3L26 A;  1N33 M;  4AI6 A;  3B89 A;  2FH0 A;  1W5S A;  2O5R A;  4G4R A;  1NO1 A;  4LF8 M;  4PCZ A;  2JZ0 A;  1D0M A;  3SC3 A;  3FTE A;  4HLQ A;  2K9D A;  1FNN A;  4LZZ A;  2DZN B;  1WXQ A;  2WSF F;  1L8Q A;  1QAQ A;  5JI3 E;  3PVS A;  5EXT A;  4ITQ A;  1WJ7 A;  3KSX A;  1I4W A;  3H4J A;  2DWZ B;  3FE3 A;  3TE6 A;  1YE9 A;  2V6Z M;  4NL4 H;  4LFB M;  3ZQJ A;  1OIP A;  3KVW A;  1GVN A;  3NWL A;  2HWJ A;  4OVZ B;  4RNA A;  4I4L A;  5KQD A;  2LHC A;  3FUU A;  1AUA A;  3IG8 A;  2LTU A;  1IXS A;  1IY2 A;  4IBJ A;  3W67 A;  2WZJ A;  4DR1 M;  1E9R A;  2VF8 A;  1V33 A;  2JP7 A;  4MGH A;  4JI7 M;  3KP0 E;  1IBM M;  1PJT A;  3NBI A;  2I7N A;  4IBK A;  4OW0 A;  1GKI A;  4X66 M;  4LGM A;  3GO8 A;  4JI6 M;  4RF0 A;  3D8B A;  3J27 B;  3QYE A;  4X64 M;  4NSR A;  4BBA A;  1IY0 A;  3GLG A;  4LY6 A;  1WGN A;  3SAS A;  3HHX A;  3U6O A;  4GKJ M;  1R6B X;  4LG2 A;  2XH9 A;  4LGY A;  3C9P A;  3MHV C;  3I04 M;  4LRT A;  3W0L B;  2QQ8 A;  5KPT A;  2OPF A;  5L8R F;  3QYB A;  2CE7 A;  1G4A E;  4AG5 A;  5BR8 M;  1DGG A;  1P3Q Q;  4DBG B;  3J81 S;  3SAT A;  2QHO B;  2RRU A;  1K3W A;  1NHG C;  2CEA A;  1OAO C;  4L4U A;  1T6O A;  3GPP A;  4PDI A;  3EIE A;  1PGY A;  2R62 A;  3AFH A;  5EXP A;  3GLF A;  1PJI A;  1N32 M;  3L29 A;  3SHG B;  1EE8 A;  1X37 A;  1NV9 A;  3KOW E;  1XB2 B;  3HWS A;  3U5Z B;  3FRI A;  1PJS A;  3PNV A;  2A5Y B;  2QEN A;  2RGH A;  4GC5 A;  3HJ8 A;  5EXS A;  2EA0 A;  2HHH M;  4NXM M;  2R4J A;  3GLI A;  3C3D A;  5ITY A;  1ZMW A;  4KHP M;  2CHG A;  3SMS A;  5EP3 A;  4NRV A;  2J7N A;  2R46 A;  3KXE C;  4P16 A;  4AKI A;  1XXH E;  4L78 A;  3GLH A;  4DV6 M;  1KFV A;  2CV1 A;  3J7A S;  1G8P A;  1PJQ A;  3HJS A;  3U6M A;  4DR4 M;  2LVN C;  2KA6 B;  4IBF A;  4LJ5 A;  4REZ A;  1E32 A;  3GLG E;  1D0K A;  5FTK A;  1HNW M;  4HEO A;  4LF6 M;  3VFD A;  1IXR C;  3FUX A;  4P17 A;  2F5S A;  4JI3 M;  4G6Z A;  4BLC A;  2EKF A;  5FTN A;  4QNR A;  2C9C A;  3VKH A;  1XMQ M;  3HU1 A;  3SAR A;  3H4M A;  3A98 B;  4AW4 A;  4II7 A;  1ZMV A;  4DR2 M;  1FJG M;  1TGU A;  2DI0 A;  3GQ3 A;  3QAU A;  1ORY B;  5E26 A;  4FW9 A;  4MGY E;  3SYK A;  3GLF E;  3D8L A;  4Q7J A;  3HU3 A;  4OU7 A;  3SAV A;  1DGH A;  2F5N A;  4OX9 M;  1XC8 A;  4XBO A;  3LVW A;  3T38 A;  5BPV A;  5ITU A;  1QVR A;  2C99 A;  1HQY E;  4M9Z A;  2GQF A;  3L25 A;  2R65 A;  1K82 A;  2LVP C;  2DZO B;  4IIW A;  4UN2 B;  4BB9 A;  2JY6 B;  2RKO A;  1IQP A;  7CAT A;  1SXJ B;  2WSE F;  3GRR A;  2DWL A;  4CIS A;  1Z5A A;  3IG5 A;  3GLH E;  2CFO A;  2KHH A;  2XFS A;  5C1B A;  3LCU A;  5IWA M;  4GHL A;  2FFJ A;  3QWL A;  2KZU A;  2R4E A;  1IN8 A;  3U6Q A;  1OJL A;  3DFZ A;  1PRB A;  5EQT A;  4CIZ A;  4GRI A;  2BJV A;  1R7R A;  4FWD A;  2D7G A;  5DYG A;  3CTW B;  5ITQ A;  4JI1 M;  3ZCB B;  1J09 A;  1VEJ A;  4LJ8 A;  1XNQ M;  2MRO B;  2W82 A;  4YHH M;  2CP8 A;  3MJ5 A;  1J7K A;  2JY5 A;  1QZE A;  2M60 A;  3B7Z A;  4Z8X A;  3DA1 A;  5ITT A;  1IM2 A;  1OQY A;  3FUW A;  2UUA M;  3FYC A;  1NV8 A;  1SXJ C;  2LVO C;  2VDB B;  4XGI A;  4X62 M;  1PM5 A;  2DKL A;  2KNA A;  1XWI A;  2XSZ D;  1IN5 A;  4RF1 A;  4JI4 M;  1NVM A;  2L7H A;  5EP4 A;  3KOZ E;  4KOD A;  3KFU G;  1ZAE A;  2ZAO A;  2J5Y A;  2APL A;  2J7O A;  3FKE A;  1N77 A;  1J5E M;  1MN3 A;  4G4O A;  3UMM A;  5GKN A;  3SAW A;  2UXC M;  2HCB A;  3B74 A;  4M9S A;  4JI2 M;  2UUC M;  4PT5 A;  3HJQ A;  2L6O A;  4LFA M;  1N34 M;  2DAM A;  2Z7J A;  3TL4 X;  3ZC7 B;  1EFU B; 
#chains in the Genus database with same CATH homology
 3SHF A;  2EUC A;  4GHA A;  1XHB A;  3WHK A;  4Z6Y A;  4EIW A;  1XXH A;  3M6A A;  3RGP A;  5KPZ A;  4IBI A;  3VKG A;  3U6C A;  5IRE B;  2DXI A;  1Q3C A;  3LVV A;  4L16 A;  3U60 A;  1L2C A;  1NY5 A;  3DZD A;  2R45 A;  1D2N A;  3KSJ A;  3GPY A;  1N78 A;  3KP1 E;  5F3W A;  2KRU A;  2KZS A;  4NRW A;  2Y0T A;  3EIH A;  4LRS A;  3PFI A;  3GQ5 A;  2LWX A;  2KEB A;  3L28 A;  2AHM A;  5DNY A;  1JR3 D;  2R18 A;  4MB7 A;  4B7H A;  1LV7 A;  1L1Z A;  1N75 A;  2L09 A;  2RGO A;  3HU2 A;  3J7B A;  4MGK E;  3R9X B;  2FNA A;  3SFZ A;  4HL4 A;  2Q2E B;  1Z5C A;  4I5S A;  2UXD M;  4DV7 M;  1G3I A;  4LCB A;  2KRK A;  1E94 E;  3VK7 A;  4DR7 M;  3GLI B;  2YFQ A;  3VDU A;  2OQ4 A;  3AOG A;  2E5L M;  3U61 B;  3FUV A;  5KO3 A;  3U6D A;  1TH4 A;  4KO8 A;  3BOS A;  2F4V M;  3ZH9 B;  2VII A;  2Y21 A;  1MX0 A;  4IBD A;  4JXJ A;  2C9O A;  3CF2 A;  3J2P B;  3FTF A;  3T1Y M;  4M0D A;  3U6P A;  5ITX E;  4NXN M;  2Y20 A;  2VQE M;  3KOX E;  3K8Z A;  4M0W A;  4W5W A;  3LMM A;  3KS8 A;  1IN7 A;  5FLX S;  1HT1 E;  4I8O A;  1QAN A;  1DGB A;  3JAM S;  4K0K M;  3I4V A;  4LF7 M;  2ERC A;  3HHY A;  3U5Z A;  3UZU A;  2DWN A;  1YUB A;  3FD9 A;  1NNJ A;  2F5Q A;  3ILK A;  4QNM A;  1MU5 A;  1SXJ D;  2XLJ A;  2KXE A;  1DGF A;  1DGH B;  1IN4 A;  1KYI A;  4FWG A;  2Z4S A;  2ZAN A;  4FVM A;  4R7G A;  3GRV A;  1NSF A;  3TWK A;  3KW6 A;  5IT9 S;  4AG6 A;  4DUY M;  4B3R M;  4DR5 M;  2DWM A;  3RE8 A;  3AL0 C;  4MM3 B;  1DO0 A;  3U6S A;  3M7G A;  2LXE A;  3W0F A;  2BNK A;  1G41 A;  3GPU A;  4B3S M;  5JI2 E;  2XF3 A;  3K92 A;  2Y0Q A;  3R8F A;  4WW0 A;  4LJ7 A;  1W5T A;  3B9P A;  3HHW A;  3JR4 A;  3L27 A;  4D82 A;  2ZM6 M;  4JV5 M;  2H1R A;  4DR3 M;  2C5R A;  1GLN A;  4IBG A;  2HKJ A;  2QBY A;  4DUZ M;  1NJG A;  4GH9 A;  4JI5 M;  2QZ4 A;  2JA2 A;  4I81 A;  3KDS E;  4QOZ C;  1L2B A;  3WHL A;  5FTL A;  2Z3X A;  1DO2 A;  1IXZ A;  4D81 A;  5H37 D;  5LMU M;  3FUT A;  4ZPX A;  2ZBK B;  4G4Q A;  1G59 A;  3AOE C;  2YQZ A;  3LQQ A;  4DR6 M;  4QOS A;  1Q3B A;  3TWM A;  4X65 M;  4LF5 M;  4QHS A;  1PJJ A;  2QP9 X;  4JYA M;  2KW0 A;  2FE8 A;  2Z4R A;  3GRY A;  2EO2 A;  1HQC A;  2DVW B;  2CV0 A;  3HKP A;  3SBJ A;  2X49 A;  4B3T M;  4B7G A;  4M9X A;  1IXS B;  3MK6 A;  5E6J A;  4TUW A;  1YSY A;  2HL7 A;  4GIP A;  1XXH B;  1GL6 A;  4QHT A;  1Z59 A;  1R2Y A;  3SYL A;  2L7I A;  5EP1 A;  4AZF A;  2X4A A;  1Z6T A;  3U60 B;  3PNY A;  3FTC A;  1NY6 A;  2FOI C;  2G5G X;  3K1J A;  2M5Z A;  5ITX A;  3TQS A;  3GLG B;  4LJ4 A;  3A42 A;  4FD2 A;  4GKK M;  4AKG A;  2QPA A;  4LJ6 A;  3SMP A;  1QAO A;  4S12 A;  3UK6 A;  3C58 A;  2YR0 A;  1NNU C;  1E9S A;  1C1K A;  1Z5B A;  3AJI B;  1GL7 A;  3RGS A;  4DV0 M;  1HR0 M;  5DYI A;  4GMQ A;  1SXJ E;  4DV3 M;  4OVZ A;  5ITR A;  4GIT A;  2C96 A;  4NSO B;  4IBE A;  2XSZ A;  4D80 A;  3GLF B;  5LMN M;  3FYD A;  3VDP A;  4FCT A;  2C98 A;  5FTJ A;  3CF0 A;  3OTO M;  3AKZ A;  2P5T A;  2CHV A;  4CHT B;  1OFH A;  1TDH A;  3LQR A;  5EJC A;  4IJF A;  3GQ4 A;  1TH3 A;  2CHQ A;  2XFT A;  1K3X A;  3GLH B;  3GP1 A;  4DV5 M;  2LH0 A;  2ZAM A;  1H6U A;  1QQW A;  2I7P A;  4JI0 M;  1I94 M;  4LF9 M;  4IBB A;  2CUZ A;  1VDD A;  8CAT A;  3UJN A;  4AKH A;  3VK8 A;  2X8A A;  3TWL A;  1QYR A;  4G4N A;  2LNH C;  1HT2 E;  5C18 A;  3FTD A;  1OFI A;  2QCU A;  2V1U A;  2D7H A;  2NQ8 C;  5EP2 A;  5KPR A;  3T1H M;  4NOO B;  1JR3 A;  3U61 A;  3JR5 A;  2XZF A;  3GPX A;  4FWH A;  3I4Y A;  1UM8 A;  3DOA A;  4LZJ A;  3U6L A;  3RFW A;  1S3S A;  3E4R A;  4LF4 M;  5FSW A;  2XGN A;  1HNZ M;  3KOY E;  4GC9 A;  4B7F A;  1ZQ9 A;  4A3V B;  4JN6 A;  2UU9 M;  2DHR A;  3HHZ A;  1XNR M;  4DV4 M;  1KSF X;  3AV0 A;  4LFC M;  4L8R C;  1L1T A;  3J80 S;  4AQY M;  4CGY B;  3U6E A;  1IBK M;  1TH2 A;  2V1C A;  3CF6 E;  1HNX M;  3KS4 A;  1QAM A;  4MGZ E;  4DV1 M;  5EXX A;  2G8L A;  3T15 A;  1Q39 A;  2YNM D;  5A2Q S;  4IJE A;  1T3T A;  1N36 M;  1NHW C;  3K2L A;  1IN6 A;  3GRU A;  3M0E A;  3UGJ A;  2BJW A;  4DV2 M;  2QBY B;  5FTM A;  2CV2 A;  4LJ9 A;  3I51 A;  2XZU A;  3HGI A;  2UUB M;  4PDG A;  2K47 A;  2VQF M;  4B08 A;  4FCW A;  4FCV A;  1NJF A;  4JI8 M;  1IY1 A;  3E9S A;  1QZM A;  2F5P A;  2D7E A;  4LJA A;  3THG A;  1SXJ A;  2XEP A;  4WUR A;  4IBC A;  4L15 A;  3A45 A;  3AOE A;  3PXG A;  3A46 A;  2F5O A;  4R3D A;  2UXB M;  1IBL M;  4MH0 E;  3SAU A;  4KLN A;  3L2A A;  1TDZ A;  4PD2 A;  5IZ7 D;  3TPZ A;  4YY3 M;  4MGI E;  1JQJ C;  3VLF B;  4B3M M;  1R2Z A;  5KQ8 A;  3Q8X A;  3L26 A;  1N33 M;  4AI6 A;  1W5S A;  2O5R A;  4G4R A;  4LF8 M;  4PCZ A;  3SC3 A;  3FTE A;  4HLQ A;  1FNN A;  4LZZ A;  2DZN B;  1WXQ A;  1L8Q A;  1QAQ A;  5JI3 E;  3PVS A;  5EXT A;  4ITQ A;  3KSX A;  1I4W A;  2DWZ B;  3TE6 A;  1YE9 A;  2V6Z M;  4NL4 H;  4LFB M;  3KVW A;  1GVN A;  3NWL A;  4OVZ B;  4RNA A;  4I4L A;  5KQD A;  3FUU A;  3IG8 A;  1IY2 A;  4IBJ A;  4DR1 M;  1E9R A;  4MGH A;  4JI7 M;  3KP0 E;  1IBM M;  3NBI A;  2I7N A;  4IBK A;  4OW0 A;  1GKI A;  4X66 M;  4LGM A;  3GO8 A;  4JI6 M;  4RF0 A;  3D8B A;  3J27 B;  4X64 M;  3GLG A;  4NSR A;  4BBA A;  1IY0 A;  4LY6 A;  3SAS A;  3HHX A;  3U6O A;  4GKJ M;  1R6B X;  4LG2 A;  2XH9 A;  4LGY A;  3MHV C;  4LRT A;  5KPT A;  3W0L B;  2OPF A;  1L2D A;  3KFU G;  4AG5 A;  2CE7 A;  1G4A E;  5BR8 M;  1DGG A;  3J81 S;  3SAT A;  1K3W A;  1NHG C;  2CEA A;  3GPP A;  4L4U A;  4PDI A;  3EIE A;  2R62 A;  3AFH A;  5EXP A;  3GLF A;  1PJI A;  1N32 M;  3L29 A;  3SHG B;  1EE8 A;  1X37 A;  3KOW E;  3HWS A;  3U5Z B;  3PNV A;  2A5Y B;  2QEN A;  2RGH A;  4GC5 A;  3HJ8 A;  5EXS A;  2EA0 A;  2HHH M;  4NXM M;  2R4J A;  3GLI A;  5ITY A;  4KHP M;  2CHG A;  3SMS A;  5EP3 A;  4NRV A;  2J7N A;  2R46 A;  3KXE C;  4P16 A;  4AKI A;  4DV6 M;  4L78 A;  3GLH A;  1KFV A;  2CV1 A;  3J7A S;  1G8P A;  3HJS A;  3U6M A;  4DR4 M;  2KA6 B;  4IBF A;  4LJ5 A;  4REZ A;  1E32 A;  5FTK A;  1HNW M;  4LF6 M;  3VFD A;  1IXR C;  3FUX A;  2F5S A;  4JI3 M;  4G6Z A;  4BLC A;  5FTN A;  4QNR A;  2C9C A;  3VKH A;  1XMQ M;  3HU1 A;  3SAR A;  3H4M A;  3A98 B;  4AW4 A;  4II7 A;  4DR2 M;  1FJG M;  1TGU A;  3GQ3 A;  3QAU A;  1ORY B;  5E26 A;  4FW9 A;  4MGY E;  3SYK A;  3SAV A;  3D8L A;  4OU7 A;  3HU3 A;  2F5N A;  1DGH A;  4OX9 M;  1XC8 A;  4XBO A;  3LVW A;  3T38 A;  5BPV A;  5ITU A;  1QVR A;  2C99 A;  1HQY E;  4M9Z A;  3L25 A;  2R65 A;  1K82 A;  4BB9 A;  2DZO B;  4IIW A;  2RKO A;  1IQP A;  7CAT A;  1SXJ B;  3GRR A;  2DWL A;  4CIS A;  1Z5A A;  3IG5 A;  2CFO A;  5C1B A;  2XFS A;  5IWA M;  4GHL A;  2FFJ A;  3QWL A;  2KZU A;  2R4E A;  1IN8 A;  3U6Q A;  1OJL A;  3DFZ A;  5EQT A;  4GRI A;  2BJV A;  1R7R A;  4FWD A;  2D7G A;  5DYG A;  3CTW B;  5ITQ A;  4JI1 M;  3ZCB B;  1J09 A;  4LJ8 A;  1XNQ M;  2W82 A;  4YHH M;  3MJ5 A;  1J7K A;  2M60 A;  4Z8X A;  3DA1 A;  5ITT A;  1IM2 A;  3FUW A;  2UUA M;  3FYC A;  4X62 M;  1SXJ C;  1PM5 A;  4XGI A;  1XWI A;  2XSZ D;  1IN5 A;  4RF1 A;  4JI4 M;  1NVM A;  2L7H A;  5EP4 A;  3KOZ E;  4KOD A;  1ZAE A;  2ZAO A;  3FKE A;  1N77 A;  2J7O A;  1J5E M;  4G4O A;  3UMM A;  5GKN A;  3SAW A;  2UXC M;  2HCB A;  4M9S A;  4JI2 M;  2UUC M;  4PT5 A;  3HJQ A;  2L6O A;  4LFA M;  1N34 M;  2Z7J A;  3TL4 X;  3ZC7 B;  1XMO M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...