2UXBM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxbM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxbM02
1XNRM 4JI3M 2ZM6M 3OTOM 2UUCM 4LFBM 1HNXM 3TWMA 2UUAM 1IBKM 4DR3M 5ITTA 2F5SA 5FLXS 2XZFA 4B3SM 3C58A 4YHHM 3U6PA 1L1TA 2E5LM 3U6DA 4DR2M 4B3TM 4LF5M 1XMOM 4JI2M 5IWAM 4DR7M 4DV7M 3T1HM 4X65M 3DOAA 1PJIA 2F5OA 1MX0A 4DV1M 1HNZM 4GKKM 4NXMM 4X66M 3TWKA 1L2DA 3U6CA 5LMNM 1K3WA 4G4RA 1J5EM 4JI4M 4G4QA 4KHPM 3GPUA 3A46A 2VQEM 3VK8A 4DV6M 2F5QA 5ITRA 1I94M 5ITQA 4G4OA 1IBLM 3GPXA 5BR8M 5ITYA 4JI6M 1Z59A 3SAWA 3GPYA 2HKJA 3GP1A 3GQ3A 1XC8A 1N32M 2F4VM 4X64M 4PDGA 3J81S 4AQYM 1Q39A 3J80S 3U6MA 2Q2EB 4JI5M 1TDHA 4PDIA 4CISA 1R2ZA 3U6QA 4JI8M 4LF6M 2F5PA 4LF9M 4LF4M 4B3RM 2HHHM 2OPFA 4LFAM 4GKJM 2UXBM 1Q3CA 4PD2A 3GO8A 3SBJA 4DR5M 2UXCM 3SASA 4JI7M 1N36M 1HNWM 4DR6M 1Q3BA 1KFVA 4DV0M 4ITQA 1N34M 3U6OA 5IT9S 4MB7A 1Z5AA 4DUYM 4JYAM 2VQFM 1K3XA 3GQ4A 3JR5A 1HR0M 1R2YA 4LF8M 2XZUA 1Z5BA 4JI0M 4DUZM 1L1ZA 4B3MM 3J7AS 3GPPA 4DV4M 4OX9M 4JI1M 3SARA 4DR1M 4DV3M 4G4NA 3GQ5A 3A42A 1TDZA 4DV5M 3SATA 3W0FA 1NNJA 3U6EA 5ITXA 4YY3M 4DR4M 1XNQM 4NXNM 3JAMS 1FJGM 3U6LA 4NRVA 1PM5A 4PCZA 5ITXE 4JV5M 4LFCM 4X62M 2UXDM 1EE8A 1IBMM 4LF7M 1N33M 3SAVA 3VK7A 2EA0A 2F5NA 5ITUA 3TWLA 2ZBKB 1K82A 3JR4A 1XMQM 1Z5CA 3A45A 3SAUA 5LMUM 2UUBM 2UU9M 3U6SA 4K0KM 4DV2M 1L2BA 3T1YM 1L2CA 4NRWA 2OQ4A 5A2QS 1MU5A 1PJJA
chains in the Genus database with same CATH superfamily
2CV1A 5DYGA 3TWMA 2UUAM 3HY5A 4KLNA 5ITTA 1OAIA 5FLXS 4QHTA 4S12A 2KHHA 4JXJA 3U6DA 2VF8A 5BPVA 2LVOC 3KDSE 2GQFA 4LRTA 4I81A 1XMOM 2DAKA 3L29A 4DV7M 4KODA 3CF2A 4JI2M 2F5OA 1VDLA 1TR8A 4FCVA 1KSFX 2ZTCA 2HAKA 4M9XA 4GKKM 5DYIA 4NXMM 5FTLA 4LRSA 3TWKA 3U6CA 3K8ZA 3E4RA 5LMNM 1MN3A 1J5EM 1NNUC 4JI4M 5KPTA 3U60A 4KO8A 2V1CA 1LTMA 1SXJE 4HEOA 2V1UA 5IZ7D 1LV7A 1HQCA 2MJ5B 4G4OA 4CGYB 1V34A 4GH9A 5EQTA 2XFSA 1NJGA 3K92A 3GQ3A 5EXXA 1XC8A 1PJQA 3QAUA 1TGUA 2CRUA 3J80S 1T3TA 3U6MA 2R6FA 3HGIA 2H1RA 3FKEA 4LF6M 2BJWA 4IBKA 4B3RM 4RF0A 3AOEC 2OPFA 1F4IA 3FTEA 1HQYE 1Q3CA 3GLIE 1QZEA 2K9DA 3GRRA 3IECA 2V6ZM 1C1KA 3SYKA 3W68A 3GO8A 1N77A 3MHVC 3SBJA 2D7GA 4RNAA 5FTMA 3VKHA 4DBGB 1HNWM 1QZMA 1Q3BA 2O01F 5EP4A 3T15A 3B7QA 2Z7JA 3I04M 1PRBA 3U6OA 4GC5A 1OQYA 2L2DA 5E6JA 4F1IA 2VQFM 2KXEA 3KOYE 3GQ4A 4GHLA 1N78A 1DO2A 2KDLA 4QHSA 2A5YB 4MGIE 4IBDA 2XZUA 2J7NA 1Z5BA 1IN5A 5EP1A 3SFZA 4DUZM 1GABA 3J2PB 3GPPA 4DV4M 4OX9M 4DR1M 5KQ8A 1VG5A 1QQWA 1E9SA 2XLJA 2XGNA 1HT1E 2DKLA 2Z4RA 1OIZA 2RKOA 2FH0A 4R3DA 3K9PA 1HJPA 3H4JA 4YY3M 1ZMWA 2DENA 3JAMS 4BBAA 4GMQA 3A98B 5KPRA 4HLQA 4NC6A 1QUSA 1IN6A 1GLNA 4OVZA 3KS8A 2MR9A 3HU3A 3PNVA 2EUCA 2ZTDA 3Q8GA 3RGPA 4AW4A 4RKUF 3SHFA 5C1BA 1G59A 3E21A 5EXTA 3QWLA 3MMPA 4RF1A 3D8LA 1D0KA 3M7GA 5L8RF 2UXDM 2X49A 3GRYA 5C18A 2J5YA 1NSFA 3GLHE 3GLFA 2QBYB 1HT2E 1IQPA 2MGWA 3VK7A 3F92A 3HJQA 2YFQA 4GRIA 4MGHA 4AZFA 3QYBA 3LVWA 3KOXE 1K82A 4GHAA 1GO5A 2KZSA 2N35A 3U5ZA 1IN8A 3B74A 4AKHA 2ZAMA 3W67A 4NSOB 4B7HA 4EIWA 2UU9M 4ZPXA 2VDBB 1G4AE 3FRIA 3U6SA 4K0KM 1L2BA 1WIVA 2CP8A 1L2CA 2EKKA 1MU5A 2ZAOA 2ZM6M 1G8PA 1TF0B 3B89A 3OTOM 2HL7A 4DR3M 2BJVA 1Y8GA 2DZNB 4I5SA 3HX3A 2L6OA 4B3SM 2E5LM 3LQQA 4II7A 3U6PA 3GLIA 2P5TA 1L1TA 4DR2M 1VEKA 1OJLA 5EP3A 5IWAM 3K1JA 4CJ6A 3T1HM 3KP1E 1PJIA 2RRUA 2DWNA 1ZMUA 4B7FA 4P17A 4MM3B 1OFHA 3FUWA 3W0LB 2CE7A 2HCBA 3FYDA 3K9OA 1R7RA 1E32A 1X37A 3VK8A 5ITRA 1I94M 2JY7A 1NHWC 1TH3A 1SXJA 1G3IA 2CEAA 3NWLA 2KNAA 4WP2A 4IBBA 3CF0A 3I4YA 1N32M 2LWXA 1TTEA 1ZV1A 2CFOA 2CUZA 2DZOB 5KQDA 3J81S 4L8RC 2QHOB 2D7HA 2Q2EB 1E94E 2QENA 2XSZA 2XSZD 4L4UA 4PDIA 2G5GX 3WHLA 3GLGA 2DWLA 2FNAA 4LY6A 4JI8M 4LF9M 2F5PA 3LW5F 1DGFA 4R71A 4LZZA 1QVRA 3GRVA 1VQ1A 2WSFF 1QYRA 3TPZA 3HKPA 1JR3E 2UXBM 4PD2A 2QZ4A 2OOAA 3BXWA 2DZLA 1AUAA 1V33A 2FOIC 2CV0A 2OO9A 1QAMA 3IG5A 3SASA 4LJ9A 4JI7M 4DR6M 1KFVA 2KRUA 4W5WA 4DV0M 2XF3A 4ITQA 3KVWA 1N34M 2G3QA 1XXHA 2R44A 2DAGA 2JY8A 3AJIB 3BBZA 4UN2B 4ANRA 4DUYM 7CATA 2DNAA 3C9PA 1HR0M 1R2YA 4LF8M 1J09A 2R46A 3C3DA 4B3MM 2R65A 1QDTA 2YQZA 3MK6A 4P16A 3TL4X 4LGYA 4JI1M 3SARA 1IM2A 3UZUA 1DGHB 3GLFB 3PFIA 2QBYA 3FUTA 3THGA 4M0WA 1SXJB 1NVMA 2LVQD 3VFDA 4GC9A 2I7NA 2KW0A 4QNRA 3U6EA 2C98A 2OOBA 1L8QA 4DR4M 2L09A 5FTJA 4QOZC 4D82A 4L16A 4NXNM 1IXSA 3HJSA 1IXZA 1FJGM 3AFHA 3U6LA 2L4FA 4NRVA 1PM5A 3U61A 4PCZA 1OIPA 1XWIA 4OVZB 4IBGA 1W5TA 3HU1A 3PXGA 2C5RA 3UK6A 1Z6TA 2JY5A 3SMSA 1IBMM 3R9XB 4LF7M 1N33M 1VEJA 1XXHB 3NBIA 2JZ1A 3SAVA 2EA0A 2F5NA 5ITUA 1A5TA 1GL7A 2Z4SA 3KOWE 2QCUA 2MROB 3V76A 1JQJC 2JA2A 2ZBKB 2LVAA 4LZJA 4PT5A 1WR1B 4FCWA 1SG9A 3JR4A 4AKGA 4AKIA 3FRHA 2LH0A 3I51A 3GRUA 4G6ZA 3LVVA 3L25A 1TH2A 2C99A 4FW9A 4L6V6 4DV2M 4FCTA 3T1YM 3EIEA 4B7GA 2OQ4A 2LBCA 2Y0QA 2DVWB 2JWSA 2ZANA 3L28A 4JI3M 1XNRM 1EFUB 1OKSA 2M5ZA 3KSJA 2XZFA 2F5SA 1YE9A 2KNZA 3HHYA 4WW0A 3KOZE 4B3TM 3AOEA 2J7OA 4XK8F 5F3WA 1D0MA 4AI6A 4I4LA 3KP0E 2K6BA 4IBIA 2DWZB 4DR7M 1GJTA 2MH8A 3DOAA 3J7BA 1NV9A 1FNNA 2QNJA 1MX0A 3M6AA 1HNZM 1H6UA 3CF6E 1PJSA 4X66M 4FWHA 1L2DA 1CUKA 2QPAA 1K3WA 4MGZE 4G4QA 3GPUA 3AV0A 1IY0A 2VQEM 2F5QA 2FS1A 3K2LA 4DV6M 2WZJA 4NL4H 4LJAA 1WXQA 4LGMA 2D7EA 2HKJA 3GP1A 3GPYA 2R4JA 2GNOA 4GEWA 4PDGA 2EJSA 3B7NA 1Q39A 4D80A 4X64M 2F4VM 2X8AA 1IY2A 4JI5M 3E46A 2CHQA 3B7ZA 4MGYE 1YUBA 4CISA 3U5ZB 1R2ZA 4IJEA 2YR0A 2EO2A 2EKFA 4LFAM 2QP9X 2JZ0A 2JP7A 4FWDA 3UJNA 3HHXA 1R6BX 2LHGA 3CGWA 3I4VA 1TH4A 3KSXA 1ORYB 4CHTB 1YSYA 2R0IA 1XXHE 2B3TA 5EJCA 2R4EA 1NHGC 5KO3A 1DO0A 2DAMA 2R18A 1UFZA 3SMPA 1R4GA 1NV8A 1IXRC 3AL0C 1PJTA 3HHWA 5IT9S 4A3VB 1Z5AA 3U61B 2KRKA 4JYAM 3H4MA 1K3XA 2YNMD 3JR5A 3DA1A 1JR3A 2QSFX 2Y21A 2LNHC 3J7AS 2X4AA 5EP2A 3FD9A 3PNYA 5H37D 2BWBA 3IHPA 3GLGE 4XBOA 4DV3M 2CV2A 4M9ZA 3A42A 3L27A 1TDZA 1GJSA 3SATA 2L7IA 1MJGM 1XB2B 3MJ5A 3W0FA 3FTDA 5DNYA 5ITXA 2C9OA 1QDRA 4LG2A 1XNQM 3ZQJA 4IBFA 2DXIA 3NBXX 2Z3XA 2RGHA 4F2LA 4QOSA 4M0DA 1C7YA 2LVNC 1D0LA 1QUTA 1ZQ9A 2K47A 3SHGB 5ITXE 4M9SA 2FFJA 5GKNA 3SC3A 3FUUA 4G3OA 2VIIA 1RU3A 1IN7A 5EXPA 4X62M 4REZA 3PVSA 2APLA 3FTFA 4IBCA 1WGNA 1WJ7A 2XEPA 4WURA 1ZAEA 2KNVA 1GVNA 4LJ4A 4D81A 5EXSA 4IBEA 4I8OA 1XMQM 4OW0A 3A45A 2C96A 2LTUA 5JI3E 1QAQA 3L2AA 3HJ8A 4GITA 3FUVA 1YLAA 4IBJA 2XFTA 2LXEA 4NRWA 2Y20A 2M60A 1PJJA 3UMMA 4LFBM 2Z8YM 1E9RA 4R7GA 4BLCA 1WGLA 4MH0E 5JI2E 1IBKM 1HNXM 2UUCM 1W5SA 1V92A 3C58A 1N75A 4YHHM 2NQ8C 4Y28F 3KS4A 2R62A 1WHCA 3I01M 4LF5M 4LJ8A 3FYCA 3WHKA 3DFZA 3GLHA 4IJFA 3GLFE 4TUWA 1IXSB 4X65M 2RGOA 2JNHA 1AIPC 2CWBA 4DV1M 2CHVA 1G41A 2QQ8A 2O5RA 1Q02A 1S3SA 5A2QS 2KZUA 4G4RA 4KHPM 2VF7A 4FVMA 2K0BX 1IFYA 2G8LA 3IG8A 3J27B 3A46A 3LMMA 1DGGA 5FTKA 2DAIA 2WSEF 1T6OA 4LCBA 5ITQA 1IBLM 3UGJA 4L15A 3GPXA 2H5XA 5ITYA 5BR8M 3BOSA 1Z59A 3FUXA 3B9PA 4LJ5A 4AG6A 3SAWA 4JI6M 1T43A 4CIZA 4MGKE 4AQYM 4NSRA 1JR3D 2W82A 3RGSA 4HL4A 1TDHA 4L78A 2DAEA 4B08A 3U6QA 4LF4M 2HHHM 2ERCA 3VKGA 1XHBA 4GKJM 2Y0TA 1NO1A 2DHRA 1OFIA 3U60B 3ZH9B 1VEGA 1DGBA 2UXCM 4DR5M 1NY6A 3HHZA 1IN4A 3HZJA 4FWGA 1R5LA 3ZCBB 5FSWA 1I4WA 1NJFA 2JY6B 4IIWA 1N36M 3R8FA 3GLGB 1NY5A 1DV0A 1G71A 2I7PA 4NOOB 1IY1A 1P3QQ 1QAOA 3T38A 3RE8A 4MB7A 2BWEA 4LJ6A 4Q7JA 3ILKA 3AKZA 3L26A 1SXJC 3HU2A 3FE3A 3AOGA 3GLIB 2DI0A 3DZDA 4GIPA 4BB9A 1UM8A 4QNMA 3TQSA 1VDDA 4JI0M 3FTCA 2JXNA 3LCUA 4G4NA 3GQ5A 5E26A 3ZC7B 4DV5M 3E9SA 2O25A 1NNJA 2WSCF 2LHCA 3TE6A 2FE8A 1EIJA 3KFUG 4Z6YA 1SXJD 1DGHA 1ZMVA 3C3EA 1BVSA 3HWSA 2JUJA 5FTNA 4FD2A 2HWJA 3Q8XA 5DFLA 4OU7A 2XH9A 2LVPC 4KT0F 1OAOC 3T6PA 2L7HA 4JV5M 1KYIA 8CATA 4LFCM 3VLFB 3GLHB 3VDUA 3SYLA 2C9CA 1EE8A 1D2NA 2KEBA 3D8BA 1JB0F 2DHYA 1GL6A 4Z8XA 2AHMA 3QYEA 5KPZA 2DWMA 2R45A 1GKIA 2BNKA 3EIHA 3KW6A 3LCVB 3TWLA 3RFWA 3CTWB 1J7KA 3M0EA 2L4EA 1Z5CA 2CHGA 4LJ7A 3KXEC 1PGYA 3VDPA 5IREB 4JN6A 5LMUM 3SAUA 2UUBM 4XGIA 1QANA 1OTRA 3LQRA 4AG5A 2KA6B 1L1ZA
chains in the Genus database with same CATH topology
2CV1A 5DYGA 3TWMA 2UUAM 4KLNA 5ITTA 5FLXS 4QHTA 4S12A 4JXJA 3U6DA 5BPVA 1XMOM 3KDSE 4LRTA 4JI2M 4I81A 3L29A 4DV7M 4KODA 3CF2A 2F5OA 4FCVA 1KSFX 4M9XA 4GKKM 5DYIA 4NXMM 5FTLA 4LRSA 3TWKA 3U6CA 3K8ZA 3E4RA 5LMNM 4JI4M 1J5EM 1NNUC 5KPTA 3U60A 4KO8A 2V1CA 1SXJE 2V1UA 5IZ7D 1LV7A 1HQCA 4G4OA 4CGYB 4GH9A 5EQTA 2XFSA 1NJGA 3K92A 3GQ3A 5EXXA 1XC8A 3QAUA 1TGUA 3J80S 1T3TA 3U6MA 3HGIA 2H1RA 3FKEA 4LF6M 2BJWA 4IBKA 4B3RM 4RF0A 3AOEC 2OPFA 3FTEA 1HQYE 1Q3CA 1N77A 3GRRA 3GO8A 2V6ZM 1C1KA 3SYKA 3MHVC 3SBJA 2D7GA 4RNAA 5FTMA 3VKHA 1HNWM 1QZMA 1Q3BA 5EP4A 3T15A 2Z7JA 3U6OA 4GC5A 5E6JA 2VQFM 2KXEA 3KOYE 3GQ4A 4GHLA 1N78A 1DO2A 4QHSA 2A5YB 4MGIE 4IBDA 2XZUA 2J7NA 1Z5BA 1IN5A 5EP1A 3SFZA 4DUZM 3J2PB 3GPPA 4DV4M 4OX9M 4DR1M 5KQ8A 1QQWA 1E9SA 2XLJA 2XGNA 1HT1E 2Z4RA 2RKOA 4R3DA 4YY3M 3JAMS 4BBAA 4GMQA 3A98B 5KPRA 4HLQA 1IN6A 1GLNA 4OVZA 3KS8A 3HU3A 3PNVA 2EUCA 4AW4A 3RGPA 3SHFA 5C1BA 1G59A 5EXTA 3QWLA 4RF1A 3D8LA 3M7GA 2UXDM 2X49A 3GRYA 5C18A 1NSFA 3GLFA 2QBYB 1HT2E 1IQPA 3VK7A 3HJQA 2YFQA 4GRIA 4MGHA 4AZFA 3LVWA 3KOXE 1K82A 4GHAA 2KZSA 3U5ZA 1IN8A 4AKHA 2ZAMA 4NSOB 4B7HA 4EIWA 2UU9M 4ZPXA 3U6SA 1G4AE 4K0KM 1L2BA 1L2CA 2ZAOA 1MU5A 2ZM6M 1G8PA 3OTOM 2HL7A 4DR3M 2BJVA 2DZNB 4I5SA 2L6OA 4B3SM 2E5LM 3LQQA 4II7A 3U6PA 3GLIA 2P5TA 1L1TA 4DR2M 1OJLA 5EP3A 5IWAM 3K1JA 3T1HM 3KP1E 1PJIA 2DWNA 4B7FA 4MM3B 1OFHA 3FUWA 3W0LB 2CE7A 2HCBA 3FYDA 1R7RA 1E32A 1X37A 3VK8A 5ITRA 1I94M 1NHWC 1TH3A 1SXJA 1G3IA 2CEAA 3NWLA 4IBBA 3CF0A 3I4YA 1N32M 2LWXA 2CFOA 2CUZA 2DZOB 5KQDA 3J81S 4L8RC 2XSZA 2D7HA 2Q2EB 1E94E 2QENA 4L4UA 2XSZD 5A2QS 4PDIA 2G5GX 3WHLA 3GLGA 2DWLA 2FNAA 4LY6A 4JI8M 4LF9M 2F5PA 1DGFA 4LZZA 1QVRA 3GRVA 1QYRA 3TPZA 3HKPA 2UXBM 4PD2A 2QZ4A 2FOIC 2CV0A 3SASA 1QAMA 3IG5A 4LJ9A 4JI7M 4DR6M 1KFVA 2KRUA 4W5WA 4DV0M 2XF3A 4ITQA 3KVWA 1N34M 1XXHA 3AJIB 4DUYM 7CATA 1HR0M 1R2YA 4LF8M 1J09A 2R46A 4B3MM 2R65A 2YQZA 3MK6A 4P16A 3TL4X 4LGYA 4JI1M 3SARA 1IM2A 3UZUA 1DGHB 3GLFB 3PFIA 2QBYA 3FUTA 3THGA 4M0WA 1SXJB 1NVMA 3VFDA 4GC9A 2I7NA 2KW0A 4QNRA 3U6EA 2C98A 1L8QA 4DR4M 2L09A 5FTJA 4QOZC 4D82A 4L16A 4NXNM 3HJSA 1IXZA 1FJGM 3AFHA 3U6LA 4NRVA 1PM5A 3U61A 4PCZA 1XWIA 4OVZB 4IBGA 1W5TA 3HU1A 3PXGA 2C5RA 3UK6A 1Z6TA 3SMSA 1IBMM 3R9XB 4LF7M 1N33M 1XXHB 3NBIA 3SAVA 2EA0A 2F5NA 5ITUA 1GL7A 2Z4SA 3KOWE 2QCUA 1JQJC 2JA2A 2ZBKB 4LZJA 4PT5A 3JR4A 4FCWA 4AKGA 4AKIA 3I51A 2LH0A 3GRUA 4G6ZA 3LVVA 3L25A 1TH2A 2C99A 4FW9A 4DV2M 3T1YM 4FCTA 3EIEA 4B7GA 2OQ4A 2Y0QA 2DVWB 2ZANA 3L28A 4JI3M 1XNRM 2F5SA 2M5ZA 3KSJA 2XZFA 1YE9A 3HHYA 4WW0A 3KOZE 4B3TM 3AOEA 2J7OA 4AI6A 5F3WA 4I4LA 3KP0E 4IBIA 4DR7M 2DWZB 3DOAA 3J7BA 1FNNA 1MX0A 3M6AA 1HNZM 1H6UA 3CF6E 4X66M 4FWHA 1L2DA 2QPAA 1K3WA 4MGZE 4G4QA 3GPUA 3AV0A 1IY0A 2VQEM 2F5QA 4DV6M 3K2LA 4NL4H 4LJAA 1WXQA 4LGMA 2D7EA 2HKJA 3GP1A 3GPYA 2R4JA 2F4VM 4X64M 4PDGA 1Q39A 4D80A 2X8AA 1IY2A 4JI5M 2CHQA 4MGYE 1YUBA 4CISA 3U5ZB 1R2ZA 4IJEA 2YR0A 2EO2A 4LFAM 2QP9X 4FWDA 3UJNA 3HHXA 1R6BX 3I4VA 1TH4A 3KSXA 1ORYB 4CHTB 1YSYA 5EJCA 2R4EA 1NHGC 5KO3A 1DO0A 3SMPA 2R18A 1IXRC 3AL0C 3HHWA 5IT9S 4A3VB 1Z5AA 3U61B 2KRKA 4JYAM 3H4MA 1K3XA 2YNMD 3JR5A 3DA1A 1JR3A 2Y21A 2LNHC 3J7AS 2X4AA 5EP2A 3FD9A 3PNYA 5H37D 4XBOA 4DV3M 2CV2A 4M9ZA 3A42A 3L27A 1TDZA 3SATA 2L7IA 3MJ5A 3W0FA 3FTDA 5DNYA 5ITXA 2C9OA 4LG2A 1XNQM 4IBFA 2DXIA 2Z3XA 2RGHA 4QOSA 4M0DA 1ZQ9A 2K47A 3SHGB 5ITXE 4M9SA 2FFJA 5GKNA 3SC3A 3FUUA 2VIIA 1IN7A 5EXPA 4X62M 4REZA 3PVSA 3FTFA 4IBCA 2XEPA 4WURA 1ZAEA 1GVNA 4LJ4A 4D81A 5EXSA 4IBEA 4I8OA 1XMQM 4OW0A 3A45A 2C96A 5JI3E 1QAQA 3L2AA 3HJ8A 4GITA 3FUVA 4IBJA 2XFTA 2LXEA 4NRWA 2Y20A 2M60A 1PJJA 3UMMA 4LFBM 4R7GA 1E9RA 4BLCA 5JI2E 1HNXM 4MH0E 1IBKM 2UUCM 1W5SA 3C58A 1N75A 4YHHM 2NQ8C 3KS4A 2R62A 4LF5M 4LJ8A 3FYCA 3WHKA 3DFZA 3GLHA 4IJFA 4TUWA 1IXSB 4X65M 2RGOA 4DV1M 2CHVA 1G41A 2O5RA 1S3SA 2KZUA 4G4RA 4KHPM 4FVMA 2G8LA 3IG8A 3J27B 3A46A 3LMMA 1DGGA 5FTKA 4LCBA 5ITQA 1IBLM 3UGJA 4L15A 3GPXA 5ITYA 5BR8M 3BOSA 1Z59A 3FUXA 3B9PA 4LJ5A 4AG6A 3SAWA 4JI6M 4AQYM 4MGKE 4NSRA 1JR3D 2W82A 3RGSA 4HL4A 1TDHA 4L78A 4B08A 3U6QA 4LF4M 2HHHM 2ERCA 3VKGA 1XHBA 4GKJM 2Y0TA 2DHRA 1OFIA 3U60B 3ZH9B 1DGBA 2UXCM 4DR5M 1NY6A 3HHZA 1IN4A 4FWGA 3ZCBB 5FSWA 1I4WA 1NJFA 4IIWA 1N36M 3R8FA 3GLGB 1NY5A 2I7PA 4NOOB 1IY1A 1QAOA 3T38A 3RE8A 4MB7A 3L26A 4LJ6A 3GLIB 3ILKA 3AKZA 1SXJC 3HU2A 3AOGA 3DZDA 4GIPA 4BB9A 1UM8A 4QNMA 3TQSA 1VDDA 4JI0M 3FTCA 4G4NA 3GQ5A 5E26A 3ZC7B 4DV5M 3E9SA 1NNJA 3TE6A 2FE8A 3KFUG 4Z6YA 1SXJD 1DGHA 3HWSA 5FTNA 4FD2A 3Q8XA 4OU7A 2XH9A 2L7HA 4JV5M 1KYIA 8CATA 4LFCM 3VLFB 3GLHB 3VDUA 3SYLA 2C9CA 1EE8A 1D2NA 2KEBA 3D8BA 4Z8XA 5KPZA 1GL6A 2AHMA 2DWMA 2R45A 1GKIA 2BNKA 3EIHA 3KW6A 3TWLA 3RFWA 3CTWB 1J7KA 3M0EA 1Z5CA 2CHGA 4LJ7A 3KXEC 3VDPA 5IREB 4JN6A 5LMUM 3SAUA 2UUBM 4XGIA 1QANA 3LQRA 4AG5A 2KA6B 1L1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR M;  4JI3 M;  2ZM6 M;  3OTO M;  2UUC M;  4LFB M;  1HNX M;  3TWM A;  2UUA M;  1IBK M;  4DR3 M;  5ITT A;  2F5S A;  5FLX S;  2XZF A;  4B3S M;  3C58 A;  4YHH M;  3U6P A;  1L1T A;  2E5L M;  3U6D A;  4DR2 M;  4B3T M;  4LF5 M;  1XMO M;  4JI2 M;  5IWA M;  4DR7 M;  4DV7 M;  3T1H M;  4X65 M;  3DOA A;  1PJI A;  2F5O A;  1MX0 A;  4DV1 M;  1HNZ M;  4GKK M;  4NXM M;  4X66 M;  3TWK A;  1L2D A;  3U6C A;  5LMN M;  1K3W A;  4G4R A;  1J5E M;  4JI4 M;  4G4Q A;  4KHP M;  3GPU A;  3A46 A;  2VQE M;  3VK8 A;  4DV6 M;  2F5Q A;  5ITR A;  1I94 M;  5ITQ A;  4G4O A;  1IBL M;  3GPX A;  5BR8 M;  5ITY A;  4JI6 M;  1Z59 A;  3SAW A;  3GPY A;  2HKJ A;  3GP1 A;  3GQ3 A;  1XC8 A;  1N32 M;  2F4V M;  4X64 M;  4PDG A;  3J81 S;  4AQY M;  1Q39 A;  3J80 S;  3U6M A;  2Q2E B;  4JI5 M;  1TDH A;  4PDI A;  4CIS A;  1R2Z A;  3U6Q A;  4JI8 M;  4LF6 M;  2F5P A;  4LF9 M;  4LF4 M;  4B3R M;  2HHH M;  2OPF A;  4LFA M;  4GKJ M;  2UXB M;  1Q3C A;  4PD2 A;  3GO8 A;  3SBJ A;  4DR5 M;  2UXC M;  3SAS A;  4JI7 M;  1N36 M;  1HNW M;  4DR6 M;  1Q3B A;  1KFV A;  4DV0 M;  4ITQ A;  1N34 M;  3U6O A;  5IT9 S;  4MB7 A;  1Z5A A;  4DUY M;  4JYA M;  2VQF M;  1K3X A;  3GQ4 A;  3JR5 A;  1HR0 M;  1R2Y A;  4LF8 M;  2XZU A;  1Z5B A;  4JI0 M;  4DUZ M;  1L1Z A;  4B3M M;  3J7A S;  3GPP A;  4DV4 M;  4OX9 M;  4JI1 M;  3SAR A;  4DR1 M;  4DV3 M;  4G4N A;  3GQ5 A;  3A42 A;  1TDZ A;  4DV5 M;  3SAT A;  3W0F A;  1NNJ A;  3U6E A;  5ITX A;  4YY3 M;  4DR4 M;  1XNQ M;  4NXN M;  3JAM S;  1FJG M;  3U6L A;  4NRV A;  1PM5 A;  4PCZ A;  5ITX E;  4JV5 M;  4LFC M;  4X62 M;  2UXD M;  1EE8 A;  1IBM M;  4LF7 M;  1N33 M;  3SAV A;  3VK7 A;  2EA0 A;  2F5N A;  5ITU A;  3TWL A;  2ZBK B;  1K82 A;  3JR4 A;  1XMQ M;  1Z5C A;  3A45 A;  3SAU A;  5LMU M;  2UUB M;  2UU9 M;  3U6S A;  4K0K M;  4DV2 M;  1L2B A;  3T1Y M;  1L2C A;  4NRW A;  2OQ4 A;  5A2Q S;  1MU5 A;  1PJJ A; 
#chains in the Genus database with same CATH topology
 2CV1 A;  5DYG A;  3TWM A;  2UUA M;  3HY5 A;  4KLN A;  5ITT A;  1OAI A;  5FLX S;  4QHT A;  4S12 A;  2KHH A;  4JXJ A;  3U6D A;  2VF8 A;  5BPV A;  2LVO C;  3KDS E;  2GQF A;  4LRT A;  4I81 A;  1XMO M;  2DAK A;  3L29 A;  4DV7 M;  4KOD A;  3CF2 A;  4JI2 M;  2F5O A;  1VDL A;  1TR8 A;  4FCV A;  1KSF X;  2ZTC A;  2HAK A;  4M9X A;  4GKK M;  5DYI A;  4NXM M;  5FTL A;  4LRS A;  3TWK A;  3U6C A;  3K8Z A;  3E4R A;  5LMN M;  1MN3 A;  1J5E M;  1NNU C;  4JI4 M;  5KPT A;  3U60 A;  4KO8 A;  2V1C A;  1LTM A;  1SXJ E;  4HEO A;  2V1U A;  5IZ7 D;  1LV7 A;  1HQC A;  2MJ5 B;  4G4O A;  4CGY B;  1V34 A;  4GH9 A;  5EQT A;  2XFS A;  1NJG A;  3K92 A;  3GQ3 A;  5EXX A;  1XC8 A;  1PJQ A;  3QAU A;  1TGU A;  2CRU A;  3J80 S;  1T3T A;  3U6M A;  2R6F A;  3HGI A;  2H1R A;  3FKE A;  4LF6 M;  2BJW A;  4IBK A;  4B3R M;  4RF0 A;  3AOE C;  2OPF A;  1F4I A;  3FTE A;  1HQY E;  1Q3C A;  3GLI E;  1QZE A;  2K9D A;  3GRR A;  3IEC A;  2V6Z M;  1C1K A;  3SYK A;  3W68 A;  3GO8 A;  1N77 A;  3MHV C;  3SBJ A;  2D7G A;  4RNA A;  5FTM A;  3VKH A;  4DBG B;  1HNW M;  1QZM A;  1Q3B A;  2O01 F;  5EP4 A;  3T15 A;  3B7Q A;  2Z7J A;  3I04 M;  1PRB A;  3U6O A;  4GC5 A;  1OQY A;  2L2D A;  5E6J A;  4F1I A;  2VQF M;  2KXE A;  3KOY E;  3GQ4 A;  4GHL A;  1N78 A;  1DO2 A;  2KDL A;  4QHS A;  2A5Y B;  4MGI E;  4IBD A;  2XZU A;  2J7N A;  1Z5B A;  1IN5 A;  5EP1 A;  3SFZ A;  4DUZ M;  1GAB A;  3J2P B;  3GPP A;  4DV4 M;  4OX9 M;  4DR1 M;  5KQ8 A;  1VG5 A;  1QQW A;  1E9S A;  2XLJ A;  2XGN A;  1HT1 E;  2DKL A;  2Z4R A;  1OIZ A;  2RKO A;  2FH0 A;  4R3D A;  3K9P A;  1HJP A;  3H4J A;  4YY3 M;  1ZMW A;  2DEN A;  3JAM S;  4BBA A;  4GMQ A;  3A98 B;  5KPR A;  4HLQ A;  4NC6 A;  1QUS A;  1IN6 A;  1GLN A;  4OVZ A;  3KS8 A;  2MR9 A;  3HU3 A;  3PNV A;  2EUC A;  2ZTD A;  3Q8G A;  3RGP A;  4AW4 A;  4RKU F;  3SHF A;  5C1B A;  1G59 A;  3E21 A;  5EXT A;  3QWL A;  3MMP A;  4RF1 A;  3D8L A;  1D0K A;  3M7G A;  5L8R F;  2UXD M;  2X49 A;  3GRY A;  5C18 A;  2J5Y A;  1NSF A;  3GLH E;  3GLF A;  2QBY B;  1HT2 E;  1IQP A;  2MGW A;  3VK7 A;  3F92 A;  3HJQ A;  2YFQ A;  4GRI A;  4MGH A;  4AZF A;  3QYB A;  3LVW A;  3KOX E;  1K82 A;  4GHA A;  1GO5 A;  2KZS A;  2N35 A;  3U5Z A;  1IN8 A;  3B74 A;  4AKH A;  2ZAM A;  3W67 A;  4NSO B;  4B7H A;  4EIW A;  2UU9 M;  4ZPX A;  2VDB B;  1G4A E;  3FRI A;  3U6S A;  4K0K M;  1L2B A;  1WIV A;  2CP8 A;  1L2C A;  2EKK A;  1MU5 A;  2ZAO A;  2ZM6 M;  1G8P A;  1TF0 B;  3B89 A;  3OTO M;  2HL7 A;  4DR3 M;  2BJV A;  1Y8G A;  2DZN B;  4I5S A;  3HX3 A;  2L6O A;  4B3S M;  2E5L M;  3LQQ A;  4II7 A;  3U6P A;  3GLI A;  2P5T A;  1L1T A;  4DR2 M;  1VEK A;  1OJL A;  5EP3 A;  5IWA M;  3K1J A;  4CJ6 A;  3T1H M;  3KP1 E;  1PJI A;  2RRU A;  2DWN A;  1ZMU A;  4B7F A;  4P17 A;  4MM3 B;  1OFH A;  3FUW A;  3W0L B;  2CE7 A;  2HCB A;  3FYD A;  3K9O A;  1R7R A;  1E32 A;  1X37 A;  3VK8 A;  5ITR A;  1I94 M;  2JY7 A;  1NHW C;  1TH3 A;  1SXJ A;  1G3I A;  2CEA A;  3NWL A;  2KNA A;  4WP2 A;  4IBB A;  3CF0 A;  3I4Y A;  1N32 M;  2LWX A;  1TTE A;  1ZV1 A;  2CFO A;  2CUZ A;  2DZO B;  5KQD A;  3J81 S;  4L8R C;  2QHO B;  2D7H A;  2Q2E B;  1E94 E;  2QEN A;  2XSZ A;  2XSZ D;  4L4U A;  4PDI A;  2G5G X;  3WHL A;  3GLG A;  2DWL A;  2FNA A;  4LY6 A;  4JI8 M;  4LF9 M;  2F5P A;  3LW5 F;  1DGF A;  4R71 A;  4LZZ A;  1QVR A;  3GRV A;  1VQ1 A;  2WSF F;  1QYR A;  3TPZ A;  3HKP A;  1JR3 E;  2UXB M;  4PD2 A;  2QZ4 A;  2OOA A;  3BXW A;  2DZL A;  1AUA A;  1V33 A;  2FOI C;  2CV0 A;  2OO9 A;  1QAM A;  3IG5 A;  3SAS A;  4LJ9 A;  4JI7 M;  4DR6 M;  1KFV A;  2KRU A;  4W5W A;  4DV0 M;  2XF3 A;  4ITQ A;  3KVW A;  1N34 M;  2G3Q A;  1XXH A;  2R44 A;  2DAG A;  2JY8 A;  3AJI B;  3BBZ A;  4UN2 B;  4ANR A;  4DUY M;  7CAT A;  2DNA A;  3C9P A;  1HR0 M;  1R2Y A;  4LF8 M;  1J09 A;  2R46 A;  3C3D A;  4B3M M;  2R65 A;  1QDT A;  2YQZ A;  3MK6 A;  4P16 A;  3TL4 X;  4LGY A;  4JI1 M;  3SAR A;  1IM2 A;  3UZU A;  1DGH B;  3GLF B;  3PFI A;  2QBY A;  3FUT A;  3THG A;  4M0W A;  1SXJ B;  1NVM A;  2LVQ D;  3VFD A;  4GC9 A;  2I7N A;  2KW0 A;  4QNR A;  3U6E A;  2C98 A;  2OOB A;  1L8Q A;  4DR4 M;  2L09 A;  5FTJ A;  4QOZ C;  4D82 A;  4L16 A;  4NXN M;  1IXS A;  3HJS A;  1IXZ A;  1FJG M;  3AFH A;  3U6L A;  2L4F A;  4NRV A;  1PM5 A;  3U61 A;  4PCZ A;  1OIP A;  1XWI A;  4OVZ B;  4IBG A;  1W5T A;  3HU1 A;  3PXG A;  2C5R A;  3UK6 A;  1Z6T A;  2JY5 A;  3SMS A;  1IBM M;  3R9X B;  4LF7 M;  1N33 M;  1VEJ A;  1XXH B;  3NBI A;  2JZ1 A;  3SAV A;  2EA0 A;  2F5N A;  5ITU A;  1A5T A;  1GL7 A;  2Z4S A;  3KOW E;  2QCU A;  2MRO B;  3V76 A;  1JQJ C;  2JA2 A;  2ZBK B;  2LVA A;  4LZJ A;  4PT5 A;  1WR1 B;  4FCW A;  1SG9 A;  3JR4 A;  4AKG A;  4AKI A;  3FRH A;  2LH0 A;  3I51 A;  3GRU A;  4G6Z A;  3LVV A;  3L25 A;  1TH2 A;  2C99 A;  4FW9 A;  4L6V 6;  4DV2 M;  4FCT A;  3T1Y M;  3EIE A;  4B7G A;  2OQ4 A;  2LBC A;  2Y0Q A;  2DVW B;  2JWS A;  2ZAN A;  3L28 A;  4JI3 M;  1XNR M;  1EFU B;  1OKS A;  2M5Z A;  3KSJ A;  2XZF A;  2F5S A;  1YE9 A;  2KNZ A;  3HHY A;  4WW0 A;  3KOZ E;  4B3T M;  3AOE A;  2J7O A;  4XK8 F;  5F3W A;  1D0M A;  4AI6 A;  4I4L A;  3KP0 E;  2K6B A;  4IBI A;  2DWZ B;  4DR7 M;  1GJT A;  2MH8 A;  3DOA A;  3J7B A;  1NV9 A;  1FNN A;  2QNJ A;  1MX0 A;  3M6A A;  1HNZ M;  1H6U A;  3CF6 E;  1PJS A;  4X66 M;  4FWH A;  1L2D A;  1CUK A;  2QPA A;  1K3W A;  4MGZ E;  4G4Q A;  3GPU A;  3AV0 A;  1IY0 A;  2VQE M;  2F5Q A;  2FS1 A;  3K2L A;  4DV6 M;  2WZJ A;  4NL4 H;  4LJA A;  1WXQ A;  4LGM A;  2D7E A;  2HKJ A;  3GP1 A;  3GPY A;  2R4J A;  2GNO A;  4GEW A;  4PDG A;  2EJS A;  3B7N A;  1Q39 A;  4D80 A;  4X64 M;  2F4V M;  2X8A A;  1IY2 A;  4JI5 M;  3E46 A;  2CHQ A;  3B7Z A;  4MGY E;  1YUB A;  4CIS A;  3U5Z B;  1R2Z A;  4IJE A;  2YR0 A;  2EO2 A;  2EKF A;  4LFA M;  2QP9 X;  2JZ0 A;  2JP7 A;  4FWD A;  3UJN A;  3HHX A;  1R6B X;  2LHG A;  3CGW A;  3I4V A;  1TH4 A;  3KSX A;  1ORY B;  4CHT B;  1YSY A;  2R0I A;  1XXH E;  2B3T A;  5EJC A;  2R4E A;  1NHG C;  5KO3 A;  1DO0 A;  2DAM A;  2R18 A;  1UFZ A;  3SMP A;  1R4G A;  1NV8 A;  1IXR C;  3AL0 C;  1PJT A;  3HHW A;  5IT9 S;  4A3V B;  1Z5A A;  3U61 B;  2KRK A;  4JYA M;  3H4M A;  1K3X A;  2YNM D;  3JR5 A;  3DA1 A;  1JR3 A;  2QSF X;  2Y21 A;  2LNH C;  3J7A S;  2X4A A;  5EP2 A;  3FD9 A;  3PNY A;  5H37 D;  2BWB A;  3IHP A;  3GLG E;  4XBO A;  4DV3 M;  2CV2 A;  4M9Z A;  3A42 A;  3L27 A;  1TDZ A;  1GJS A;  3SAT A;  2L7I A;  1MJG M;  1XB2 B;  3MJ5 A;  3W0F A;  3FTD A;  5DNY A;  5ITX A;  2C9O A;  1QDR A;  4LG2 A;  1XNQ M;  3ZQJ A;  4IBF A;  2DXI A;  3NBX X;  2Z3X A;  2RGH A;  4F2L A;  4QOS A;  4M0D A;  1C7Y A;  2LVN C;  1D0L A;  1QUT A;  1ZQ9 A;  2K47 A;  3SHG B;  5ITX E;  4M9S A;  2FFJ A;  5GKN A;  3SC3 A;  3FUU A;  4G3O A;  2VII A;  1RU3 A;  1IN7 A;  5EXP A;  4X62 M;  4REZ A;  3PVS A;  2APL A;  3FTF A;  4IBC A;  1WGN A;  1WJ7 A;  2XEP A;  4WUR A;  1ZAE A;  2KNV A;  1GVN A;  4LJ4 A;  4D81 A;  5EXS A;  4IBE A;  4I8O A;  1XMQ M;  4OW0 A;  3A45 A;  2C96 A;  2LTU A;  5JI3 E;  1QAQ A;  3L2A A;  3HJ8 A;  4GIT A;  3FUV A;  1YLA A;  4IBJ A;  2XFT A;  2LXE A;  4NRW A;  2Y20 A;  2M60 A;  1PJJ A;  3UMM A;  4LFB M;  2Z8Y M;  1E9R A;  4R7G A;  4BLC A;  1WGL A;  4MH0 E;  5JI2 E;  1IBK M;  1HNX M;  2UUC M;  1W5S A;  1V92 A;  3C58 A;  1N75 A;  4YHH M;  2NQ8 C;  4Y28 F;  3KS4 A;  2R62 A;  1WHC A;  3I01 M;  4LF5 M;  4LJ8 A;  3FYC A;  3WHK A;  3DFZ A;  3GLH A;  4IJF A;  3GLF E;  4TUW A;  1IXS B;  4X65 M;  2RGO A;  2JNH A;  1AIP C;  2CWB A;  4DV1 M;  2CHV A;  1G41 A;  2QQ8 A;  2O5R A;  1Q02 A;  1S3S A;  5A2Q S;  2KZU A;  4G4R A;  4KHP M;  2VF7 A;  4FVM A;  2K0B X;  1IFY A;  2G8L A;  3IG8 A;  3J27 B;  3A46 A;  3LMM A;  1DGG A;  5FTK A;  2DAI A;  2WSE F;  1T6O A;  4LCB A;  5ITQ A;  1IBL M;  3UGJ A;  4L15 A;  3GPX A;  2H5X A;  5ITY A;  5BR8 M;  3BOS A;  1Z59 A;  3FUX A;  3B9P A;  4LJ5 A;  4AG6 A;  3SAW A;  4JI6 M;  1T43 A;  4CIZ A;  4MGK E;  4AQY M;  4NSR A;  1JR3 D;  2W82 A;  3RGS A;  4HL4 A;  1TDH A;  4L78 A;  2DAE A;  4B08 A;  3U6Q A;  4LF4 M;  2HHH M;  2ERC A;  3VKG A;  1XHB A;  4GKJ M;  2Y0T A;  1NO1 A;  2DHR A;  1OFI A;  3U60 B;  3ZH9 B;  1VEG A;  1DGB A;  2UXC M;  4DR5 M;  1NY6 A;  3HHZ A;  1IN4 A;  3HZJ A;  4FWG A;  1R5L A;  3ZCB B;  5FSW A;  1I4W A;  1NJF A;  2JY6 B;  4IIW A;  1N36 M;  3R8F A;  3GLG B;  1NY5 A;  1DV0 A;  1G71 A;  2I7P A;  4NOO B;  1IY1 A;  1P3Q Q;  1QAO A;  3T38 A;  3RE8 A;  4MB7 A;  2BWE A;  4LJ6 A;  4Q7J A;  3ILK A;  3AKZ A;  3L26 A;  1SXJ C;  3HU2 A;  3FE3 A;  3AOG A;  3GLI B;  2DI0 A;  3DZD A;  4GIP A;  4BB9 A;  1UM8 A;  4QNM A;  3TQS A;  1VDD A;  4JI0 M;  3FTC A;  2JXN A;  3LCU A;  4G4N A;  3GQ5 A;  5E26 A;  3ZC7 B;  4DV5 M;  3E9S A;  2O25 A;  1NNJ A;  2WSC F;  2LHC A;  3TE6 A;  2FE8 A;  1EIJ A;  3KFU G;  4Z6Y A;  1SXJ D;  1DGH A;  1ZMV A;  3C3E A;  1BVS A;  3HWS A;  2JUJ A;  5FTN A;  4FD2 A;  2HWJ A;  3Q8X A;  5DFL A;  4OU7 A;  2XH9 A;  2LVP C;  4KT0 F;  1OAO C;  3T6P A;  2L7H A;  4JV5 M;  1KYI A;  8CAT A;  4LFC M;  3VLF B;  3GLH B;  3VDU A;  3SYL A;  2C9C A;  1EE8 A;  1D2N A;  2KEB A;  3D8B A;  1JB0 F;  2DHY A;  1GL6 A;  4Z8X A;  2AHM A;  3QYE A;  5KPZ A;  2DWM A;  2R45 A;  1GKI A;  2BNK A;  3EIH A;  3KW6 A;  3LCV B;  3TWL A;  3RFW A;  3CTW B;  1J7K A;  3M0E A;  2L4E A;  1Z5C A;  2CHG A;  4LJ7 A;  3KXE C;  1PGY A;  3VDP A;  5IRE B;  4JN6 A;  5LMU M;  3SAU A;  2UUB M;  4XGI A;  1QAN A;  1OTR A;  3LQR A;  4AG5 A;  2KA6 B;  1L1Z A; 
#chains in the Genus database with same CATH homology
 2CV1 A;  5DYG A;  3TWM A;  2UUA M;  4KLN A;  5ITT A;  5FLX S;  4QHT A;  4S12 A;  4JXJ A;  3U6D A;  5BPV A;  1XMO M;  3KDS E;  4LRT A;  4JI2 M;  4I81 A;  3L29 A;  4DV7 M;  4KOD A;  3CF2 A;  2F5O A;  4FCV A;  1KSF X;  4M9X A;  4GKK M;  5DYI A;  4NXM M;  5FTL A;  4LRS A;  3TWK A;  3U6C A;  3K8Z A;  3E4R A;  5LMN M;  4JI4 M;  1J5E M;  1NNU C;  5KPT A;  3U60 A;  4KO8 A;  2V1C A;  1SXJ E;  2V1U A;  5IZ7 D;  1LV7 A;  1HQC A;  4G4O A;  4CGY B;  4GH9 A;  5EQT A;  2XFS A;  1NJG A;  3K92 A;  3GQ3 A;  5EXX A;  1XC8 A;  3QAU A;  1TGU A;  3J80 S;  1T3T A;  3U6M A;  3HGI A;  2H1R A;  3FKE A;  4LF6 M;  2BJW A;  4IBK A;  4B3R M;  4RF0 A;  3AOE C;  2OPF A;  3FTE A;  1HQY E;  1Q3C A;  1N77 A;  3GRR A;  3GO8 A;  2V6Z M;  1C1K A;  3SYK A;  3MHV C;  3SBJ A;  2D7G A;  4RNA A;  5FTM A;  3VKH A;  1HNW M;  1QZM A;  1Q3B A;  5EP4 A;  3T15 A;  2Z7J A;  3U6O A;  4GC5 A;  5E6J A;  2VQF M;  2KXE A;  3KOY E;  3GQ4 A;  4GHL A;  1N78 A;  1DO2 A;  4QHS A;  2A5Y B;  4MGI E;  4IBD A;  2XZU A;  2J7N A;  1Z5B A;  1IN5 A;  5EP1 A;  3SFZ A;  4DUZ M;  3J2P B;  3GPP A;  4DV4 M;  4OX9 M;  4DR1 M;  5KQ8 A;  1QQW A;  1E9S A;  2XLJ A;  2XGN A;  1HT1 E;  2Z4R A;  2RKO A;  4R3D A;  4YY3 M;  3JAM S;  4BBA A;  4GMQ A;  3A98 B;  5KPR A;  4HLQ A;  1IN6 A;  1GLN A;  4OVZ A;  3KS8 A;  3HU3 A;  3PNV A;  2EUC A;  4AW4 A;  3RGP A;  3SHF A;  5C1B A;  1G59 A;  5EXT A;  3QWL A;  4RF1 A;  3D8L A;  3M7G A;  2UXD M;  2X49 A;  3GRY A;  5C18 A;  1NSF A;  3GLF A;  2QBY B;  1HT2 E;  1IQP A;  3VK7 A;  3HJQ A;  2YFQ A;  4GRI A;  4MGH A;  4AZF A;  3LVW A;  3KOX E;  1K82 A;  4GHA A;  2KZS A;  3U5Z A;  1IN8 A;  4AKH A;  2ZAM A;  4NSO B;  4B7H A;  4EIW A;  2UU9 M;  4ZPX A;  3U6S A;  1G4A E;  4K0K M;  1L2B A;  1L2C A;  2ZAO A;  1MU5 A;  2ZM6 M;  1G8P A;  3OTO M;  2HL7 A;  4DR3 M;  2BJV A;  2DZN B;  4I5S A;  2L6O A;  4B3S M;  2E5L M;  3LQQ A;  4II7 A;  3U6P A;  3GLI A;  2P5T A;  1L1T A;  4DR2 M;  1OJL A;  5EP3 A;  5IWA M;  3K1J A;  3T1H M;  3KP1 E;  1PJI A;  2DWN A;  4B7F A;  4MM3 B;  1OFH A;  3FUW A;  3W0L B;  2CE7 A;  2HCB A;  3FYD A;  1R7R A;  1E32 A;  1X37 A;  3VK8 A;  5ITR A;  1I94 M;  1NHW C;  1TH3 A;  1SXJ A;  1G3I A;  2CEA A;  3NWL A;  4IBB A;  3CF0 A;  3I4Y A;  1N32 M;  2LWX A;  2CFO A;  2CUZ A;  2DZO B;  5KQD A;  3J81 S;  4L8R C;  2XSZ A;  2D7H A;  2Q2E B;  1E94 E;  2QEN A;  4L4U A;  2XSZ D;  5A2Q S;  4PDI A;  2G5G X;  3WHL A;  3GLG A;  2DWL A;  2FNA A;  4LY6 A;  4JI8 M;  4LF9 M;  2F5P A;  1DGF A;  4LZZ A;  1QVR A;  3GRV A;  1QYR A;  3TPZ A;  3HKP A;  2UXB M;  4PD2 A;  2QZ4 A;  2FOI C;  2CV0 A;  3SAS A;  1QAM A;  3IG5 A;  4LJ9 A;  4JI7 M;  4DR6 M;  1KFV A;  2KRU A;  4W5W A;  4DV0 M;  2XF3 A;  4ITQ A;  3KVW A;  1N34 M;  1XXH A;  3AJI B;  4DUY M;  7CAT A;  1HR0 M;  1R2Y A;  4LF8 M;  1J09 A;  2R46 A;  4B3M M;  2R65 A;  2YQZ A;  3MK6 A;  4P16 A;  3TL4 X;  4LGY A;  4JI1 M;  3SAR A;  1IM2 A;  3UZU A;  1DGH B;  3GLF B;  3PFI A;  2QBY A;  3FUT A;  3THG A;  4M0W A;  1SXJ B;  1NVM A;  3VFD A;  4GC9 A;  2I7N A;  2KW0 A;  4QNR A;  3U6E A;  2C98 A;  1L8Q A;  4DR4 M;  2L09 A;  5FTJ A;  4QOZ C;  4D82 A;  4L16 A;  4NXN M;  3HJS A;  1IXZ A;  1FJG M;  3AFH A;  3U6L A;  4NRV A;  1PM5 A;  3U61 A;  4PCZ A;  1XWI A;  4OVZ B;  4IBG A;  1W5T A;  3HU1 A;  3PXG A;  2C5R A;  3UK6 A;  1Z6T A;  3SMS A;  1IBM M;  3R9X B;  4LF7 M;  1N33 M;  1XXH B;  3NBI A;  3SAV A;  2EA0 A;  2F5N A;  5ITU A;  1GL7 A;  2Z4S A;  3KOW E;  2QCU A;  1JQJ C;  2JA2 A;  2ZBK B;  4LZJ A;  4PT5 A;  3JR4 A;  4FCW A;  4AKG A;  4AKI A;  3I51 A;  2LH0 A;  3GRU A;  4G6Z A;  3LVV A;  3L25 A;  1TH2 A;  2C99 A;  4FW9 A;  4DV2 M;  3T1Y M;  4FCT A;  3EIE A;  4B7G A;  2OQ4 A;  2Y0Q A;  2DVW B;  2ZAN A;  3L28 A;  4JI3 M;  1XNR M;  2F5S A;  2M5Z A;  3KSJ A;  2XZF A;  1YE9 A;  3HHY A;  4WW0 A;  3KOZ E;  4B3T M;  3AOE A;  2J7O A;  4AI6 A;  5F3W A;  4I4L A;  3KP0 E;  4IBI A;  4DR7 M;  2DWZ B;  3DOA A;  3J7B A;  1FNN A;  1MX0 A;  3M6A A;  1HNZ M;  1H6U A;  3CF6 E;  4X66 M;  4FWH A;  1L2D A;  2QPA A;  1K3W A;  4MGZ E;  4G4Q A;  3GPU A;  3AV0 A;  1IY0 A;  2VQE M;  2F5Q A;  4DV6 M;  3K2L A;  4NL4 H;  4LJA A;  1WXQ A;  4LGM A;  2D7E A;  2HKJ A;  3GP1 A;  3GPY A;  2R4J A;  2F4V M;  4X64 M;  4PDG A;  1Q39 A;  4D80 A;  2X8A A;  1IY2 A;  4JI5 M;  2CHQ A;  4MGY E;  1YUB A;  4CIS A;  3U5Z B;  1R2Z A;  4IJE A;  2YR0 A;  2EO2 A;  4LFA M;  2QP9 X;  4FWD A;  3UJN A;  3HHX A;  1R6B X;  3I4V A;  1TH4 A;  3KSX A;  1ORY B;  4CHT B;  1YSY A;  5EJC A;  2R4E A;  1NHG C;  5KO3 A;  1DO0 A;  3SMP A;  2R18 A;  1IXR C;  3AL0 C;  3HHW A;  5IT9 S;  4A3V B;  1Z5A A;  3U61 B;  2KRK A;  4JYA M;  3H4M A;  1K3X A;  2YNM D;  3JR5 A;  3DA1 A;  1JR3 A;  2Y21 A;  2LNH C;  3J7A S;  2X4A A;  5EP2 A;  3FD9 A;  3PNY A;  5H37 D;  4XBO A;  4DV3 M;  2CV2 A;  4M9Z A;  3A42 A;  3L27 A;  1TDZ A;  3SAT A;  2L7I A;  3MJ5 A;  3W0F A;  3FTD A;  5DNY A;  5ITX A;  2C9O A;  4LG2 A;  1XNQ M;  4IBF A;  2DXI A;  2Z3X A;  2RGH A;  4QOS A;  4M0D A;  1ZQ9 A;  2K47 A;  3SHG B;  5ITX E;  4M9S A;  2FFJ A;  5GKN A;  3SC3 A;  3FUU A;  2VII A;  1IN7 A;  5EXP A;  4X62 M;  4REZ A;  3PVS A;  3FTF A;  4IBC A;  2XEP A;  4WUR A;  1ZAE A;  1GVN A;  4LJ4 A;  4D81 A;  5EXS A;  4IBE A;  4I8O A;  1XMQ M;  4OW0 A;  3A45 A;  2C96 A;  5JI3 E;  1QAQ A;  3L2A A;  3HJ8 A;  4GIT A;  3FUV A;  4IBJ A;  2XFT A;  2LXE A;  4NRW A;  2Y20 A;  2M60 A;  1PJJ A;  3UMM A;  4LFB M;  4R7G A;  1E9R A;  4BLC A;  5JI2 E;  1HNX M;  4MH0 E;  1IBK M;  2UUC M;  1W5S A;  3C58 A;  1N75 A;  4YHH M;  2NQ8 C;  3KS4 A;  2R62 A;  4LF5 M;  4LJ8 A;  3FYC A;  3WHK A;  3DFZ A;  3GLH A;  4IJF A;  4TUW A;  1IXS B;  4X65 M;  2RGO A;  4DV1 M;  2CHV A;  1G41 A;  2O5R A;  1S3S A;  2KZU A;  4G4R A;  4KHP M;  4FVM A;  2G8L A;  3IG8 A;  3J27 B;  3A46 A;  3LMM A;  1DGG A;  5FTK A;  4LCB A;  5ITQ A;  1IBL M;  3UGJ A;  4L15 A;  3GPX A;  5ITY A;  5BR8 M;  3BOS A;  1Z59 A;  3FUX A;  3B9P A;  4LJ5 A;  4AG6 A;  3SAW A;  4JI6 M;  4AQY M;  4MGK E;  4NSR A;  1JR3 D;  2W82 A;  3RGS A;  4HL4 A;  1TDH A;  4L78 A;  4B08 A;  3U6Q A;  4LF4 M;  2HHH M;  2ERC A;  3VKG A;  1XHB A;  4GKJ M;  2Y0T A;  2DHR A;  1OFI A;  3U60 B;  3ZH9 B;  1DGB A;  2UXC M;  4DR5 M;  1NY6 A;  3HHZ A;  1IN4 A;  4FWG A;  3ZCB B;  5FSW A;  1I4W A;  1NJF A;  4IIW A;  1N36 M;  3R8F A;  3GLG B;  1NY5 A;  2I7P A;  4NOO B;  1IY1 A;  1QAO A;  3T38 A;  3RE8 A;  4MB7 A;  3L26 A;  4LJ6 A;  3GLI B;  3ILK A;  3AKZ A;  1SXJ C;  3HU2 A;  3AOG A;  3DZD A;  4GIP A;  4BB9 A;  1UM8 A;  4QNM A;  3TQS A;  1VDD A;  4JI0 M;  3FTC A;  4G4N A;  3GQ5 A;  5E26 A;  3ZC7 B;  4DV5 M;  3E9S A;  1NNJ A;  3TE6 A;  2FE8 A;  3KFU G;  4Z6Y A;  1SXJ D;  1DGH A;  3HWS A;  5FTN A;  4FD2 A;  3Q8X A;  4OU7 A;  2XH9 A;  2L7H A;  4JV5 M;  1KYI A;  8CAT A;  4LFC M;  3VLF B;  3GLH B;  3VDU A;  3SYL A;  2C9C A;  1EE8 A;  1D2N A;  2KEB A;  3D8B A;  4Z8X A;  5KPZ A;  1GL6 A;  2AHM A;  2DWM A;  2R45 A;  1GKI A;  2BNK A;  3EIH A;  3KW6 A;  3TWL A;  3RFW A;  3CTW B;  1J7K A;  3M0E A;  1Z5C A;  2CHG A;  4LJ7 A;  3KXE C;  3VDP A;  5IRE B;  4JN6 A;  5LMU M;  3SAU A;  2UUB M;  4XGI A;  1QAN A;  3LQR A;  4AG5 A;  2KA6 B;  1L1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...