2UXBM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxbM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxbM02
3U6EA 4JI4M 3T1HM 4CISA 1L2CA 2UUBM 5ITYA 3GPYA 1IBKM 2F4VM 3U6LA 5ITQA 4G4NA 2VQFM 4JI8M 3W0FA 4LF4M 4DR4M 1PJIA 1K82A 2UXDM 4B3MM 3U6OA 4KHPM 4G4OA 4PD2A 3U6PA 1XMOM 3J7AS 3SBJA 1HR0M 3GP1A 4AQYM 3GQ3A 1L1TA 4X64M 4X62M 1PM5A 3JR4A 3SAUA 5LMNM 3GQ4A 1IBMM 3U6CA 2F5NA 4DV4M 5BR8M 5ITXA 3A42A 3T1YM 4G4QA 4DV3M 4NRWA 5ITTA 2E5LM 4X66M 3GQ5A 3JAMS 1KFVA 1L2DA 2Q2EB 5IWAM 2UUAM 1XNRM 1HNWM 2ZM6M 4JI1M 4LF7M 4K0KM 2HHHM 2UUCM 2F5OA 4PCZA 3VK7A 1Q3CA 4MB7A 2F5SA 4B3SM 1K3XA 2UXBM 5FLXS 3OTOM 5ITRA 4LF8M 2F5QA 3U6QA 2HKJA 4DV7M 1I94M 1J5EM 1XMQM 3GO8A 1Q3BA 1HNXM 4DV6M 3TWMA 2ZBKB 4DR2M 3GPUA 4JI3M 1IBLM 1Z5AA 4JI6M 4DV2M 2OPFA 1N32M 1XC8A 3SAWA 4B3RM 1HNZM 2XZFA 1NNJA 4LFCM 5ITXE 4GKKM 3U6DA 4DR7M 4DUYM 1MX0A 3SAVA 4JI0M 5ITUA 1XNQM 3SARA 4JI7M 4JI5M 4PDGA 4GKJM 4JI2M 4DR5M 1L1ZA 1PJJA 4DR1M 1Z5CA 3GPXA 4NXNM 1Z59A 2UU9M 2F5PA 2OQ4A 4ITQA 4YY3M 1R2ZA 3DOAA 5A2QS 4LFAM 4NRVA 4DV0M 4B3TM 3J80S 4DV5M 3U6SA 4OX9M 3GPPA 4YHHM 4DUZM 4G4RA 1N33M 1N36M 3JR5A 2EA0A 2VQEM 5IT9S 2UXCM 3VK8A 3SASA 4DR3M 1TDHA 4LF5M 1K3WA 1Q39A 4X65M 4LF9M 4LFBM 4JYAM 3J81S 3A46A 1Z5BA 4NXMM 1FJGM 5LMUM 3TWKA 1MU5A 1L2BA 2XZUA 1TDZA 1N34M 3U6MA 4LF6M 3C58A 4JV5M 4PDIA 4DV1M 1R2YA 3TWLA 4DR6M 3A45A 3SATA 1EE8A
chains in the Genus database with same CATH superfamily
2KA6B 3GLGE 4JI4M 3T1HM 2I7NA 1L2CA 2UUBM 4IJFA 3BBZA 1V34A 2YR0A 1G71A 1XXHE 3CF6E 5ITQA 3HHZA 1QQWA 4G4NA 5EP1A 1A5TA 5KQ8A 4JI8M 4IBJA 2DENA 4GIPA 4L6V6 1DO0A 1D2NA 3DA1A 1K82A 4KHPM 3LVWA 5FTKA 4G4OA 1PRBA 1OFHA 3AJIB 3VDPA 2QQ8A 1X37A 1HR0M 3R9XB 3SYKA 1JR3A 3GRRA 1OJLA 4NC6A 1PM5A 3E4RA 2R44A 4MGYE 2WZJA 1D0LA 4KO8A 3JR4A 2KNZA 3FRIA 2G8LA 3T15A 4AG5A 3U6CA 3ZH9B 2RRUA 2R6FA 3A42A 5ITXA 4B7GA 4AG6A 1UM8A 4G4QA 3T1YM 3U61B 5ITTA 2E5LM 2DAKA 4I5SA 3KS8A 3I4VA 4L16A 1L2DA 5IWAM 2UUAM 2HAKA 1GABA 3J7BA 2FE8A 3UZUA 4NSRA 4LF7M 3QYEA 5EP2A 3W0LB 2HCBA 1ZMWA 4PCZA 4MB7A 3MHVC 5F3WA 4HL4A 2F5SA 1SXJC 1IXZA 1IY2A 1DGFA 2WSCF 5FTNA 2NQ8C 5KPRA 3F92A 2MGWA 2Y20A 2HKJA 1I94M 3KSXA 3CF0A 4PDGA 5EXPA 1VQ1A 1J5EM 1WHCA 4GC9A 2DWNA 2LBCA 1HJPA 2DZLA 3GLHA 2RKOA 4I4LA 4FVMA 1VEKA 2MH8A 3SC3A 2D7GA 2Z7JA 2ZBKB 2O25A 1JR3E 2CHQA 3W68A 4RF1A 2C9OA 1V92A 3DZDA 3FYCA 1TH3A 4UN2B 3T38A 4FCTA 3GLIA 3SAWA 3FUWA 4AKGA 5ITXE 1T6OA 3UJNA 3ZQJA 4GKKM 2CV1A 2M5ZA 4LJ6A 1MX0A 3SAVA 1OFIA 4JI0M 3VLFB 3C3DA 3NBIA 5DFLA 4JI2M 1RU3A 1PJJA 2DXIA 1Z5CA 4GHAA 2JY7A 2C99A 4MM3B 4F2LA 3RFWA 3QAUA 4NRVA 4DV0M 3J80S 2V6ZM 4DV5M 4IIWA 3GPPA 5EXSA 1HQYE 8CATA 1BVSA 3HJQA 3NWLA 3I4YA 2VQEM 3QWLA 2VF7A 1ZMVA 2K9DA 3L28A 3KXEC 3SASA 3HWSA 3FRHA 1PJSA 1I4WA 1QAQA 1Q39A 4LF9M 1EIJA 3FD9A 4Z6YA 3PVSA 1P3QQ 1FJGM 3TWKA 3J27B 3VFDA 3GLHE 1WIVA 1L2BA 1N34M 4B7FA 3U6MA 1PGYA 3C58A 3FKEA 2DKLA 2C98A 5BPVA 1G59A 4L15A 4D80A 1ZAEA 1D0KA 3GLIE 3U6EA 2CHVA 1QDRA 1WXQA 2DI0A 1YUBA 2FNAA 2KZSA 2QNJA 5ITYA 2DAEA 2L4EA 2YFQA 4ZPXA 3GPYA 4R3DA 3U5ZB 2DVWB 3U6LA 2ERCA 3FTFA 2KZUA 1C7YA 1WR1B 1DO2A 1F4IA 4RNAA 2J7OA 3KOWE 1SXJA 3FUUA 2BJWA 4DR4M 1T3TA 2CRUA 4IBBA 3W0FA 1KSFX 4B3MM 4LZJA 5FTJA 3U6PA 1XMOM 4AZFA 3C9PA 2LNHC 2H5XA 1QUSA 1NSFA 2JZ0A 5E26A 2CUZA 4X62M 5C1BA 2GQFA 3B9PA 3SAUA 1WGLA 5LMNM 2QBYA 1NJGA 1MJGM 4GHLA 2FS1A 2YNMD 3SFZA 3TQSA 3W67A 5BR8M 2KW0A 1FNNA 4DV3M 4NRWA 3MK6A 1TH2A 3GQ5A 2O01F 1VEGA 4FWGA 4P17A 4AKIA 4XGIA 4WW0A 1XNRM 4W5WA 1J7KA 5KPTA 1G8PA 3RGPA 1HNWM 1DGGA 4GMQA 1Q02A 3FTDA 2ZM6M 2KRUA 1V33A 2MJ5B 2Z8YM 5FTLA 2HHHM 1QZEA 2XLJA 3EIHA 1N78A 4AKHA 5DNYA 2F5OA 3U60B 4I8OA 1DGHB 1NVMA 2A5YB 4FCWA 3J2PB 3VKGA 4B3SM 1K3XA 3E21A 2LXEA 1E32A 3OTOM 4M0DA 4XBOA 3ZCBB 5L8RF 3U6QA 1IY1A 4DV7M 2XSZD 2Z4RA 2DWLA 1HT1E 3LW5F 5DYIA 4LJAA 3WHKA 1SXJE 1XMQM 1HQCA 2OOBA 2J5YA 2CE7A 4D81A 2LH0A 1IN4A 2L09A 3PXGA 4DR2M 1GO5A 4REZA 4TUWA 2OPFA 1N32M 2BJVA 3AFHA 3I01M 4KT0F 1J09A 1XC8A 2KNVA 4QNRA 1HNZM 2R0IA 1L8QA 2ZTCA 4L8RC 5GKNA 4CIZA 2JY6B 5DYGA 4G3OA 1GL6A 1OIZA 3U6DA 2BNKA 2LVQD 2XFTA 4DUYM 3AL0C 3GLFA 2JP7A 2O5RA 3K2LA 3KW6A 1QVRA 1L1ZA 4DR1M 3HJ8A 2OQ4A 4ITQA 3D8BA 3L26A 4LGYA 1OAOC 1R2ZA 1E9RA 3DOAA 2CP8A 4LFAM 2K0BX 2XGNA 4LGMA 4DUZM 3AKZA 4G4RA 3KVWA 3NBXX 1R7RA 4LRSA 3TE6A 3JR5A 2G5GX 1TR8A 2EA0A 4G6ZA 2KRKA 4CGYB 4HLQA 2AHMA 3TL4X 4DR3M 1TF0B 2DAIA 2XH9A 3GLGB 1K3WA 2V1UA 4GEWA 4X65M 3TPZA 2VF8A 2Y0TA 2R4EA 2EO2A 3IG8A 1XXHB 5LMUM 3U60A 2JUJA 2ZTDA 4XK8F 3AOGA 1GJSA 1NNUC 2RGHA 2LVAA 2ZANA 1T43A 2DWMA 3QYBA 1DV0A 1JR3D 2CWBA 2QP9X 3BXWA 4LJ9A 4JV5M 2DAMA 4PDIA 1OTRA 2QZ4A 3I51A 4M9SA 2VDBB 2JY5A 2CEAA 3FUVA 3KP0E 2FH0A 1EE8A 3K8ZA 5EJCA 2VIIA 2R45A 4CISA 2QCUA 2WSFF 3LVVA 2APLA 1KYIA 1D0MA 3SMSA 3U61A 2F4VM 1VG5A 4OU7A 3GLFE 1ZQ9A 2OOAA 1IY0A 1IN6A 3FTCA 2VQFM 1AUAA 4LF4M 1CUKA 2W82A 2UXDM 3U6OA 1R5LA 4LG2A 3SHGB 3GRUA 3J7AS 3SBJA 4AQYM 3GQ3A 3KOZE 1R4GA 1DGBA 1L1TA 2K6BA 3M7GA 2CFOA 1C1KA 2Y21A 3PNYA 2C5RA 2JZ1A 1G41A 2Z3XA 2JNHA 1XHBA 2DHRA 2KDLA 2X8AA 3HHYA 1AIPC 4MH0E 4QOSA 2R62A 4L4UA 1JQJC 4X66M 3GRYA 1IXSB 4FW9A 4CHTB 1S3SA 4LRTA 4OVZB 3HX3A 4QOZC 2Q2EB 1JB0F 5EP4A 5IREB 4MGZE 3FUXA 2DHYA 3LCVB 2ZAOA 3HGIA 2G3QA 2DAGA 3L2AA 5E6JA 4QNMA 1TH4A 4WP2A 1OQYA 2QPAA 2V1CA 2ZAMA 1OAIA 3MJ5A 3VK7A 2MR9A 1HT2E 1Y8GA 1NY5A 3SYLA 5FLXS 3LQQA 1G3IA 4LF8M 4R7GA 2R4JA 1N77A 3HKPA 2F5QA 2L4FA 1IN5A 3FE3A 4QHSA 3KSJA 3B74A 2JXNA 3GO8A 2JY8A 1WGNA 1GKIA 1Q3BA 1OKSA 1QAMA 3KP1E 4ANRA 4D82A 5JI2E 2FFJA 4DV6M 3TWMA 1HNXM 4B08A 1OIPA 3RE8A 3R8FA 1NHGC 3VDUA 2DNAA 1QYRA 4JI3M 3GPUA 1Z5AA 4JI6M 4JI7M 5C18A 4IBKA 1YE9A 2DZNB 2M60A 4S12A 1IN7A 4MGHA 5KPZA 2I7PA 2R46A 2DZOB 2XZFA 1NNJA 4B3RM 3CTWB 2P5TA 3KOXE 3THGA 4KLNA 3MMPA 4MGKE 1IFYA 5FSWA 5ITUA 1IQPA 1QAOA 4JI5M 4GKJM 5EP3A 4LCBA 4DR5M 3K9PA 1VDLA 1Z59A 4NXNM 2F5PA 2UU9M 3GRVA 2L6OA 3GLHB 4YY3M 3HU2A 4FD2A 5JI3E 5A2QS 4B3TM 1NO1A 2L7HA 3L27A 3Q8XA 3LCUA 1N33M 3KOYE 5H37D 1IXSA 4OVZA 4DBGB 5IT9S 3GLIB 4FWDA 3U5ZA 1TDHA 1GVNA 2LVPC 1SXJD 3L29A 4JYAM 1EFUB 3SHFA 4LJ8A 3L25A 1QANA 1QZMA 1NV8A 1QUTA 1W5TA 3E46A 3AV0A 2DWZB 5FTMA 2XFSA 4M0WA 2EJSA 4M9XA 4DV1M 2X4AA 3KFUG 3TWLA 3V76A 5IZ7D 3VKHA 2LHGA 3UMMA 1W5SA 3FUTA 4NSOB 3K1JA 1IBKM 4LJ5A 1H6UA 1LV7A 4IBEA 5EQTA 2WSEF 3K92A 4MGIE 1NV9A 2C96A 2KNAA 3ZC7B 2CV0A 3FYDA 3B7NA 4II7A 2CHGA 4F1IA 5KO3A 3UGJA 3B7ZA 1PJIA 1Z6TA 3AOEC 2OO9A 3DFZA 3FTEA 2L2DA 3CGWA 4PT5A 2KHHA 4EIWA 3A98B 4PD2A 2C9CA 1IN8A 4M9ZA 3GP1A 1DGHA 1VDDA 1N75A 4X64M 1XB2B 7CATA 4GITA 2Z4SA 1MN3A 4Q7JA 4GC5A 4LY6A 3WHLA 2MROB 4LZZA 3GQ4A 1IBMM 2F5NA 3HHXA 4DV4M 2KEBA 2N35A 3LQRA 1E94E 1LTMA 4Z8XA 2BWEA 2LWXA 3JAMS 1KFVA 4JN6A 1SXJB 3HZJA 4B7HA 3C3EA 3BOSA 1NHWC 1G4AE 4RF0A 4JI1M 4K0KM 2UUCM 2GNOA 3T6PA 1E9SA 1Q3CA 2LVOC 4GRIA 2EUCA 2UXBM 4L78A 4GH9A 2L7IA 3IG5A 3K9OA 2H1RA 4RKUF 2JA2A 5ITRA 2QBYB 1YSYA 3B89A 1IXRC 1TGUA 4IBGA 2CV2A 4NOOB 1GJTA 1WJ7A 3UK6A 3PFIA 2RGOA 2LVNC 2B3TA 1IM2A 2R65A 2R18A 1R6BX 2XF3A 2HWJA 4LJ4A 2D7HA 3HHWA 3IECA 2EKFA 4BBAA 4I81A 3RGSA 1TTEA 4HEOA 1PJTA 1GLNA 2YQZA 5EXTA 3D8LA 1IBLM 4FCVA 3Q8GA 4DV2M 2JWSA 4JXJA 1PJQA 3I04M 1NY6A 1UFZA 4WURA 3GLGA 2D7EA 3IHPA 3H4JA 5EXXA 2EKKA 4LFCM 3B7QA 3KDSE 4DR7M 1SG9A 4Y28F 4P16A 1XXHA 1VEJA 1ZV1A 1XNQM 2HL7A 3SARA 2XSZA 4IBFA 2BWBA 2K47A 3HY5A 2XEPA 1ORYB 3HU1A 4BB9A 1XWIA 4CJ6A 4OW0A 3GPXA 3SMPA 4IBDA 5KQDA 3ILKA 3LMMA 3U6SA 4OX9M 4YHHM 1QDTA 1N36M 3AOEA 3PNVA 4AW4A 2QHOB 3EIEA 4BLCA 2QSFX 2Y0QA 2UXCM 3VK8A 2KXEA 4IJEA 4LJ7A 4QHTA 3E9SA 4LF5M 1YLAA 2FOIC 3M6AA 3M0EA 4KODA 3HJSA 3HU3A 4IBIA 4NL4H 3J81S 4FWHA 4LFBM 3A46A 2LTUA 1Z5BA 3CF2A 4NXMM 3GLFB 1MU5A 4A3VB 4R71A 4AI6A 2XZUA 1TDZA 1ZMUA 4IBCA 3H4MA 4LF6M 2X49A 3KS4A 2J7NA 1NJFA 1R2YA 1GL7A 4DR6M 2LHCA 3A45A 3SATA 2QENA
chains in the Genus database with same CATH topology
2KA6B 4JI4M 3T1HM 2I7NA 1L2CA 2UUBM 4IJFA 2YR0A 3CF6E 5ITQA 3HHZA 1QQWA 4G4NA 5EP1A 5KQ8A 4JI8M 4IBJA 4GIPA 1K82A 1DO0A 1D2NA 3DA1A 4KHPM 3LVWA 5FTKA 4G4OA 1OFHA 3AJIB 3VDPA 1HR0M 1X37A 3R9XB 3SYKA 1JR3A 3GRRA 1OJLA 1PM5A 3E4RA 3JR4A 4MGYE 4KO8A 2G8LA 3T15A 4AG5A 3U6CA 3ZH9B 3A42A 5ITXA 4B7GA 4AG6A 1UM8A 4G4QA 3T1YM 3U61B 5ITTA 2E5LM 4I5SA 3KS8A 3I4VA 4L16A 1L2DA 5IWAM 2UUAM 3J7BA 2FE8A 3UZUA 4NSRA 4LF7M 5EP2A 3W0LB 2HCBA 4PCZA 4MB7A 3MHVC 5F3WA 4HL4A 2F5SA 1SXJC 1IXZA 1IY2A 1DGFA 5FTNA 5KPRA 2NQ8C 2Y20A 2HKJA 1I94M 3KSXA 3CF0A 5EXPA 1J5EM 4GC9A 2DWNA 3GLHA 2RKOA 4I4LA 4FVMA 3SC3A 2D7GA 2Z7JA 2ZBKB 2CHQA 4RF1A 2C9OA 3DZDA 3FYCA 1TH3A 3T38A 3SAWA 4FCTA 3GLIA 3FUWA 4AKGA 5ITXE 3UJNA 4GKKM 2CV1A 2M5ZA 4LJ6A 1MX0A 3SAVA 1OFIA 4JI0M 3VLFB 3NBIA 4JI2M 1PJJA 2DXIA 1Z5CA 4GHAA 2C99A 4MM3B 3RFWA 3QAUA 4NRVA 4DV0M 3J80S 2V6ZM 4DV5M 4IIWA 3GPPA 5EXSA 1HQYE 8CATA 3HJQA 3NWLA 3I4YA 2VQEM 3QWLA 3L28A 3KXEC 3SASA 3HWSA 1I4WA 1QAQA 1Q39A 4LF9M 3FD9A 4Z6YA 3PVSA 1FJGM 3TWKA 3J27B 3VFDA 1L2BA 1N34M 4B7FA 3U6MA 3C58A 3FKEA 2C98A 5BPVA 1G59A 4L15A 4D80A 1ZAEA 3U6EA 2CHVA 1WXQA 1YUBA 2FNAA 2KZSA 5ITYA 2YFQA 4ZPXA 3GPYA 4R3DA 3U5ZB 2DVWB 3U6LA 2ERCA 3FTFA 2KZUA 1DO2A 4RNAA 2J7OA 3KOWE 1SXJA 3FUUA 2BJWA 4DR4M 1T3TA 3W0FA 4IBBA 1KSFX 4B3MM 4LZJA 5FTJA 3U6PA 1XMOM 4AZFA 2LNHC 1NSFA 5E26A 2CUZA 4X62M 5C1BA 2QBYA 3B9PA 3SAUA 5LMNM 1NJGA 4GHLA 2YNMD 3SFZA 3TQSA 5BR8M 2KW0A 1FNNA 4DV3M 4NRWA 3MK6A 1TH2A 3GQ5A 4FWGA 4AKIA 4XGIA 4WW0A 1XNRM 4W5WA 1J7KA 5KPTA 1G8PA 3RGPA 1HNWM 1DGGA 4GMQA 3FTDA 2ZM6M 2KRUA 5FTLA 2HHHM 2XLJA 1N78A 3EIHA 4AKHA 5DNYA 2F5OA 3U60B 4I8OA 1DGHB 1NVMA 2A5YB 4FCWA 3J2PB 3VKGA 4B3SM 1K3XA 2LXEA 1E32A 3OTOM 4M0DA 4XBOA 3ZCBB 3U6QA 1IY1A 4DV7M 2XSZD 2Z4RA 2DWLA 1HT1E 5DYIA 4LJAA 3WHKA 1SXJE 1XMQM 1HQCA 2CE7A 4D81A 2LH0A 1IN4A 2L09A 3PXGA 4DR2M 4REZA 4TUWA 2OPFA 1N32M 2BJVA 3AFHA 1XC8A 1J09A 4QNRA 1HNZM 4L8RC 1L8QA 5GKNA 5DYGA 1GL6A 3U6DA 2BNKA 2XFTA 4DUYM 3GLFA 2O5RA 3K2LA 3KW6A 1QVRA 1L1ZA 4DR1M 3HJ8A 2OQ4A 4ITQA 3D8BA 3L26A 4LGYA 1R2ZA 1E9RA 3DOAA 4LFAM 2XGNA 4LGMA 4DUZM 3AKZA 4G4RA 3KVWA 1R7RA 4LRSA 3TE6A 3JR5A 2G5GX 2EA0A 4G6ZA 2KRKA 4CGYB 4HLQA 2AHMA 3TL4X 4DR3M 2XH9A 3GLGB 2V1UA 1K3WA 4X65M 3TPZA 2Y0TA 3IG8A 2R4EA 2EO2A 1XXHB 5LMUM 3U60A 3AOGA 1NNUC 2RGHA 2ZANA 2DWMA 1JR3D 2QP9X 4LJ9A 4JV5M 4PDIA 2QZ4A 3I51A 4M9SA 2CEAA 3FUVA 3KP0E 1EE8A 3K8ZA 5EJCA 2VIIA 2R45A 4CISA 2QCUA 3LVVA 1KYIA 3SMSA 3U61A 2F4VM 4OU7A 1ZQ9A 1IY0A 1IN6A 3FTCA 2VQFM 4LF4M 2W82A 2UXDM 3U6OA 4LG2A 3SHGB 3GRUA 3J7AS 3SBJA 4AQYM 3GQ3A 3KOZE 1DGBA 1L1TA 3M7GA 2CFOA 1C1KA 2Y21A 3PNYA 2C5RA 1G41A 2Z3XA 1XHBA 2DHRA 2X8AA 3HHYA 4MH0E 4QOSA 2R62A 4L4UA 1JQJC 4X66M 3GRYA 1IXSB 4FW9A 4CHTB 1S3SA 4LRTA 4OVZB 4QOZC 2Q2EB 5EP4A 5IREB 4MGZE 3FUXA 2ZAOA 3HGIA 5E6JA 3L2AA 4QNMA 1TH4A 2QPAA 2V1CA 2ZAMA 3MJ5A 3VK7A 1HT2E 1NY5A 3SYLA 5FLXS 3LQQA 1G3IA 4LF8M 4R7GA 2R4JA 1N77A 3HKPA 2F5QA 1IN5A 4QHSA 3KSJA 3GO8A 3AL0C 1QAMA 1Q3BA 1GKIA 5JI2E 3KP1E 4D82A 4DV6M 1HNXM 2FFJA 3TWMA 4B08A 3RE8A 3R8FA 1NHGC 3VDUA 1QYRA 4JI3M 3GPUA 1Z5AA 4JI6M 5C18A 4IBKA 1YE9A 2DZNB 2M60A 4S12A 1IN7A 4MGHA 5KPZA 2I7PA 2R46A 2DZOB 2XZFA 1NNJA 4B3RM 3CTWB 2P5TA 3KOXE 3THGA 4KLNA 4MGKE 5FSWA 5ITUA 1IQPA 1QAOA 4JI5M 4GKJM 5EP3A 4LCBA 4DR5M 4NXNM 1Z59A 2UU9M 2F5PA 3GRVA 2L6OA 3GLHB 4YY3M 3HU2A 4FD2A 5JI3E 5A2QS 4B3TM 2L7HA 3L27A 3Q8XA 1N33M 3KOYE 5H37D 4OVZA 5IT9S 3GLIB 4FWDA 3U5ZA 1TDHA 1GVNA 1SXJD 3L29A 4JYAM 3SHFA 4LJ8A 3L25A 1QANA 1QZMA 1W5TA 3AV0A 2DWZB 5FTMA 2XFSA 4M0WA 4M9XA 4DV1M 2X4AA 3KFUG 3TWLA 5IZ7D 3VKHA 3UMMA 1W5SA 3FUTA 4NSOB 3K1JA 1IBKM 4LJ5A 1H6UA 1LV7A 4IBEA 5EQTA 3K92A 4MGIE 2C96A 2CV0A 3ZC7B 3FYDA 4II7A 5KO3A 2CHGA 3UGJA 1PJIA 1Z6TA 3AOEC 3DFZA 3FTEA 4PT5A 4EIWA 3A98B 4PD2A 2C9CA 1IN8A 4M9ZA 3GP1A 1DGHA 1VDDA 1N75A 4X64M 7CATA 4GITA 2Z4SA 4GC5A 4LY6A 3WHLA 4LZZA 3GQ4A 1IBMM 2F5NA 3HHXA 4DV4M 2KEBA 3LQRA 1E94E 4Z8XA 2LWXA 3JAMS 1KFVA 4JN6A 1SXJB 4B7HA 3BOSA 1NHWC 1G4AE 4RF0A 4JI1M 4K0KM 2UUCM 1E9SA 1Q3CA 4GRIA 2EUCA 2UXBM 4L78A 4GH9A 2L7IA 3IG5A 2H1RA 2JA2A 5ITRA 2QBYB 1YSYA 1IXRC 1TGUA 4IBGA 2CV2A 4NOOB 3UK6A 3PFIA 2RGOA 1IM2A 2R65A 2R18A 1R6BX 2XF3A 4LJ4A 2D7HA 3HHWA 4BBAA 4I81A 3RGSA 1GLNA 2YQZA 5EXTA 3D8LA 1IBLM 4FCVA 4DV2M 4JXJA 1NY6A 4WURA 3GLGA 2D7EA 4LFCM 5EXXA 3KDSE 4DR7M 4P16A 1XXHA 1XNQM 2HL7A 3SARA 2XSZA 4IBFA 4PDGA 2K47A 4BB9A 2XEPA 1ORYB 3HU1A 4JI7M 1XWIA 4OW0A 3GPXA 3SMPA 4IBDA 5KQDA 3ILKA 3LMMA 3U6SA 4OX9M 4YHHM 1N36M 3AOEA 3PNVA 4AW4A 3EIEA 4BLCA 2Y0QA 2UXCM 3VK8A 2KXEA 4IJEA 4LJ7A 4QHTA 3E9SA 4LF5M 2FOIC 3M6AA 3M0EA 4KODA 3HJSA 3HU3A 4IBIA 4NL4H 3J81S 4FWHA 4LFBM 3A46A 1Z5BA 3CF2A 4NXMM 3GLFB 1MU5A 4A3VB 4AI6A 2XZUA 1TDZA 4IBCA 3H4MA 4LF6M 2X49A 3KS4A 2J7NA 1NJFA 1R2YA 1GL7A 4DR6M 3A45A 3SATA 2QENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6E A;  4JI4 M;  3T1H M;  4CIS A;  1L2C A;  2UUB M;  5ITY A;  3GPY A;  1IBK M;  2F4V M;  3U6L A;  5ITQ A;  4G4N A;  2VQF M;  4JI8 M;  3W0F A;  4LF4 M;  4DR4 M;  1PJI A;  1K82 A;  2UXD M;  4B3M M;  3U6O A;  4KHP M;  4G4O A;  4PD2 A;  3U6P A;  1XMO M;  3J7A S;  3SBJ A;  1HR0 M;  3GP1 A;  4AQY M;  3GQ3 A;  1L1T A;  4X64 M;  4X62 M;  1PM5 A;  3JR4 A;  3SAU A;  5LMN M;  3GQ4 A;  1IBM M;  3U6C A;  2F5N A;  4DV4 M;  5BR8 M;  5ITX A;  3A42 A;  3T1Y M;  4G4Q A;  4DV3 M;  4NRW A;  5ITT A;  2E5L M;  4X66 M;  3GQ5 A;  3JAM S;  1KFV A;  1L2D A;  2Q2E B;  5IWA M;  2UUA M;  1XNR M;  1HNW M;  2ZM6 M;  4JI1 M;  4LF7 M;  4K0K M;  2HHH M;  2UUC M;  2F5O A;  4PCZ A;  3VK7 A;  1Q3C A;  4MB7 A;  2F5S A;  4B3S M;  1K3X A;  2UXB M;  5FLX S;  3OTO M;  5ITR A;  4LF8 M;  2F5Q A;  3U6Q A;  2HKJ A;  4DV7 M;  1I94 M;  1J5E M;  1XMQ M;  3GO8 A;  1Q3B A;  1HNX M;  4DV6 M;  3TWM A;  2ZBK B;  4DR2 M;  3GPU A;  4JI3 M;  1IBL M;  1Z5A A;  4JI6 M;  4DV2 M;  2OPF A;  1N32 M;  1XC8 A;  3SAW A;  4B3R M;  1HNZ M;  2XZF A;  1NNJ A;  4LFC M;  5ITX E;  4GKK M;  3U6D A;  4DR7 M;  4DUY M;  1MX0 A;  3SAV A;  4JI0 M;  5ITU A;  1XNQ M;  3SAR A;  4JI7 M;  4JI5 M;  4PDG A;  4GKJ M;  4JI2 M;  4DR5 M;  1L1Z A;  1PJJ A;  4DR1 M;  1Z5C A;  3GPX A;  4NXN M;  1Z59 A;  2UU9 M;  2F5P A;  2OQ4 A;  4ITQ A;  4YY3 M;  1R2Z A;  3DOA A;  5A2Q S;  4LFA M;  4NRV A;  4DV0 M;  4B3T M;  3J80 S;  4DV5 M;  3U6S A;  4OX9 M;  3GPP A;  4YHH M;  4DUZ M;  4G4R A;  1N33 M;  1N36 M;  3JR5 A;  2EA0 A;  2VQE M;  5IT9 S;  2UXC M;  3VK8 A;  3SAS A;  4DR3 M;  1TDH A;  4LF5 M;  1K3W A;  1Q39 A;  4X65 M;  4LF9 M;  4LFB M;  4JYA M;  3J81 S;  3A46 A;  1Z5B A;  4NXM M;  1FJG M;  5LMU M;  3TWK A;  1MU5 A;  1L2B A;  2XZU A;  1TDZ A;  1N34 M;  3U6M A;  4LF6 M;  3C58 A;  4JV5 M;  4PDI A;  4DV1 M;  1R2Y A;  3TWL A;  4DR6 M;  3A45 A;  3SAT A;  1EE8 A; 
#chains in the Genus database with same CATH topology
 2KA6 B;  3GLG E;  4JI4 M;  3T1H M;  2I7N A;  1L2C A;  2UUB M;  4IJF A;  3BBZ A;  1V34 A;  2YR0 A;  1G71 A;  1XXH E;  3CF6 E;  5ITQ A;  3HHZ A;  1QQW A;  4G4N A;  5EP1 A;  1A5T A;  5KQ8 A;  4JI8 M;  4IBJ A;  2DEN A;  4GIP A;  4L6V 6;  1DO0 A;  1D2N A;  3DA1 A;  1K82 A;  4KHP M;  3LVW A;  5FTK A;  4G4O A;  1PRB A;  1OFH A;  3AJI B;  3VDP A;  2QQ8 A;  1X37 A;  1HR0 M;  3R9X B;  3SYK A;  1JR3 A;  3GRR A;  1OJL A;  4NC6 A;  1PM5 A;  3E4R A;  2R44 A;  4MGY E;  2WZJ A;  1D0L A;  4KO8 A;  3JR4 A;  2KNZ A;  3FRI A;  2G8L A;  3T15 A;  4AG5 A;  3U6C A;  3ZH9 B;  2RRU A;  2R6F A;  3A42 A;  5ITX A;  4B7G A;  4AG6 A;  1UM8 A;  4G4Q A;  3T1Y M;  3U61 B;  5ITT A;  2E5L M;  2DAK A;  4I5S A;  3KS8 A;  3I4V A;  4L16 A;  1L2D A;  5IWA M;  2UUA M;  2HAK A;  1GAB A;  3J7B A;  2FE8 A;  3UZU A;  4NSR A;  4LF7 M;  3QYE A;  5EP2 A;  3W0L B;  2HCB A;  1ZMW A;  4PCZ A;  4MB7 A;  3MHV C;  5F3W A;  4HL4 A;  2F5S A;  1SXJ C;  1IXZ A;  1IY2 A;  1DGF A;  2WSC F;  5FTN A;  2NQ8 C;  5KPR A;  3F92 A;  2MGW A;  2Y20 A;  2HKJ A;  1I94 M;  3KSX A;  3CF0 A;  4PDG A;  5EXP A;  1VQ1 A;  1J5E M;  1WHC A;  4GC9 A;  2DWN A;  2LBC A;  1HJP A;  2DZL A;  3GLH A;  2RKO A;  4I4L A;  4FVM A;  1VEK A;  2MH8 A;  3SC3 A;  2D7G A;  2Z7J A;  2ZBK B;  2O25 A;  1JR3 E;  2CHQ A;  3W68 A;  4RF1 A;  2C9O A;  1V92 A;  3DZD A;  3FYC A;  1TH3 A;  4UN2 B;  3T38 A;  4FCT A;  3GLI A;  3SAW A;  3FUW A;  4AKG A;  5ITX E;  1T6O A;  3UJN A;  3ZQJ A;  4GKK M;  2CV1 A;  2M5Z A;  4LJ6 A;  1MX0 A;  3SAV A;  1OFI A;  4JI0 M;  3VLF B;  3C3D A;  3NBI A;  5DFL A;  4JI2 M;  1RU3 A;  1PJJ A;  2DXI A;  1Z5C A;  4GHA A;  2JY7 A;  2C99 A;  4MM3 B;  4F2L A;  3RFW A;  3QAU A;  4NRV A;  4DV0 M;  3J80 S;  2V6Z M;  4DV5 M;  4IIW A;  3GPP A;  5EXS A;  1HQY E;  8CAT A;  1BVS A;  3HJQ A;  3NWL A;  3I4Y A;  2VQE M;  3QWL A;  2VF7 A;  1ZMV A;  2K9D A;  3L28 A;  3KXE C;  3SAS A;  3HWS A;  3FRH A;  1PJS A;  1I4W A;  1QAQ A;  1Q39 A;  4LF9 M;  1EIJ A;  3FD9 A;  4Z6Y A;  3PVS A;  1P3Q Q;  1FJG M;  3TWK A;  3J27 B;  3VFD A;  3GLH E;  1WIV A;  1L2B A;  1N34 M;  4B7F A;  3U6M A;  1PGY A;  3C58 A;  3FKE A;  2DKL A;  2C98 A;  5BPV A;  1G59 A;  4L15 A;  4D80 A;  1ZAE A;  1D0K A;  3GLI E;  3U6E A;  2CHV A;  1QDR A;  1WXQ A;  2DI0 A;  1YUB A;  2FNA A;  2KZS A;  2QNJ A;  5ITY A;  2DAE A;  2L4E A;  2YFQ A;  4ZPX A;  3GPY A;  4R3D A;  3U5Z B;  2DVW B;  3U6L A;  2ERC A;  3FTF A;  2KZU A;  1C7Y A;  1WR1 B;  1DO2 A;  1F4I A;  4RNA A;  2J7O A;  3KOW E;  1SXJ A;  3FUU A;  2BJW A;  4DR4 M;  1T3T A;  2CRU A;  4IBB A;  3W0F A;  1KSF X;  4B3M M;  4LZJ A;  5FTJ A;  3U6P A;  1XMO M;  4AZF A;  3C9P A;  2LNH C;  2H5X A;  1QUS A;  1NSF A;  2JZ0 A;  5E26 A;  2CUZ A;  4X62 M;  5C1B A;  2GQF A;  3B9P A;  3SAU A;  1WGL A;  5LMN M;  2QBY A;  1NJG A;  1MJG M;  4GHL A;  2FS1 A;  2YNM D;  3SFZ A;  3TQS A;  3W67 A;  5BR8 M;  2KW0 A;  1FNN A;  4DV3 M;  4NRW A;  3MK6 A;  1TH2 A;  3GQ5 A;  2O01 F;  1VEG A;  4FWG A;  4P17 A;  4AKI A;  4XGI A;  4WW0 A;  1XNR M;  4W5W A;  1J7K A;  5KPT A;  1G8P A;  3RGP A;  1HNW M;  1DGG A;  4GMQ A;  1Q02 A;  3FTD A;  2ZM6 M;  2KRU A;  1V33 A;  2MJ5 B;  2Z8Y M;  5FTL A;  2HHH M;  1QZE A;  2XLJ A;  3EIH A;  1N78 A;  4AKH A;  5DNY A;  2F5O A;  3U60 B;  4I8O A;  1DGH B;  1NVM A;  2A5Y B;  4FCW A;  3J2P B;  3VKG A;  4B3S M;  1K3X A;  3E21 A;  2LXE A;  1E32 A;  3OTO M;  4M0D A;  4XBO A;  3ZCB B;  5L8R F;  3U6Q A;  1IY1 A;  4DV7 M;  2XSZ D;  2Z4R A;  2DWL A;  1HT1 E;  3LW5 F;  5DYI A;  4LJA A;  3WHK A;  1SXJ E;  1XMQ M;  1HQC A;  2OOB A;  2J5Y A;  2CE7 A;  4D81 A;  2LH0 A;  1IN4 A;  2L09 A;  3PXG A;  4DR2 M;  1GO5 A;  4REZ A;  4TUW A;  2OPF A;  1N32 M;  2BJV A;  3AFH A;  3I01 M;  4KT0 F;  1J09 A;  1XC8 A;  2KNV A;  4QNR A;  1HNZ M;  2R0I A;  1L8Q A;  2ZTC A;  4L8R C;  5GKN A;  4CIZ A;  2JY6 B;  5DYG A;  4G3O A;  1GL6 A;  1OIZ A;  3U6D A;  2BNK A;  2LVQ D;  2XFT A;  4DUY M;  3AL0 C;  3GLF A;  2JP7 A;  2O5R A;  3K2L A;  3KW6 A;  1QVR A;  1L1Z A;  4DR1 M;  3HJ8 A;  2OQ4 A;  4ITQ A;  3D8B A;  3L26 A;  4LGY A;  1OAO C;  1R2Z A;  1E9R A;  3DOA A;  2CP8 A;  4LFA M;  2K0B X;  2XGN A;  4LGM A;  4DUZ M;  3AKZ A;  4G4R A;  3KVW A;  3NBX X;  1R7R A;  4LRS A;  3TE6 A;  3JR5 A;  2G5G X;  1TR8 A;  2EA0 A;  4G6Z A;  2KRK A;  4CGY B;  4HLQ A;  2AHM A;  3TL4 X;  4DR3 M;  1TF0 B;  2DAI A;  2XH9 A;  3GLG B;  1K3W A;  2V1U A;  4GEW A;  4X65 M;  3TPZ A;  2VF8 A;  2Y0T A;  2R4E A;  2EO2 A;  3IG8 A;  1XXH B;  5LMU M;  3U60 A;  2JUJ A;  2ZTD A;  4XK8 F;  3AOG A;  1GJS A;  1NNU C;  2RGH A;  2LVA A;  2ZAN A;  1T43 A;  2DWM A;  3QYB A;  1DV0 A;  1JR3 D;  2CWB A;  2QP9 X;  3BXW A;  4LJ9 A;  4JV5 M;  2DAM A;  4PDI A;  1OTR A;  2QZ4 A;  3I51 A;  4M9S A;  2VDB B;  2JY5 A;  2CEA A;  3FUV A;  3KP0 E;  2FH0 A;  1EE8 A;  3K8Z A;  5EJC A;  2VII A;  2R45 A;  4CIS A;  2QCU A;  2WSF F;  3LVV A;  2APL A;  1KYI A;  1D0M A;  3SMS A;  3U61 A;  2F4V M;  1VG5 A;  4OU7 A;  3GLF E;  1ZQ9 A;  2OOA A;  1IY0 A;  1IN6 A;  3FTC A;  2VQF M;  1AUA A;  4LF4 M;  1CUK A;  2W82 A;  2UXD M;  3U6O A;  1R5L A;  4LG2 A;  3SHG B;  3GRU A;  3J7A S;  3SBJ A;  4AQY M;  3GQ3 A;  3KOZ E;  1R4G A;  1DGB A;  1L1T A;  2K6B A;  3M7G A;  2CFO A;  1C1K A;  2Y21 A;  3PNY A;  2C5R A;  2JZ1 A;  1G41 A;  2Z3X A;  2JNH A;  1XHB A;  2DHR A;  2KDL A;  2X8A A;  3HHY A;  1AIP C;  4MH0 E;  4QOS A;  2R62 A;  4L4U A;  1JQJ C;  4X66 M;  3GRY A;  1IXS B;  4FW9 A;  4CHT B;  1S3S A;  4LRT A;  4OVZ B;  3HX3 A;  4QOZ C;  2Q2E B;  1JB0 F;  5EP4 A;  5IRE B;  4MGZ E;  3FUX A;  2DHY A;  3LCV B;  2ZAO A;  3HGI A;  2G3Q A;  2DAG A;  3L2A A;  5E6J A;  4QNM A;  1TH4 A;  4WP2 A;  1OQY A;  2QPA A;  2V1C A;  2ZAM A;  1OAI A;  3MJ5 A;  3VK7 A;  2MR9 A;  1HT2 E;  1Y8G A;  1NY5 A;  3SYL A;  5FLX S;  3LQQ A;  1G3I A;  4LF8 M;  4R7G A;  2R4J A;  1N77 A;  3HKP A;  2F5Q A;  2L4F A;  1IN5 A;  3FE3 A;  4QHS A;  3KSJ A;  3B74 A;  2JXN A;  3GO8 A;  2JY8 A;  1WGN A;  1GKI A;  1Q3B A;  1OKS A;  1QAM A;  3KP1 E;  4ANR A;  4D82 A;  5JI2 E;  2FFJ A;  4DV6 M;  3TWM A;  1HNX M;  4B08 A;  1OIP A;  3RE8 A;  3R8F A;  1NHG C;  3VDU A;  2DNA A;  1QYR A;  4JI3 M;  3GPU A;  1Z5A A;  4JI6 M;  4JI7 M;  5C18 A;  4IBK A;  1YE9 A;  2DZN B;  2M60 A;  4S12 A;  1IN7 A;  4MGH A;  5KPZ A;  2I7P A;  2R46 A;  2DZO B;  2XZF A;  1NNJ A;  4B3R M;  3CTW B;  2P5T A;  3KOX E;  3THG A;  4KLN A;  3MMP A;  4MGK E;  1IFY A;  5FSW A;  5ITU A;  1IQP A;  1QAO A;  4JI5 M;  4GKJ M;  5EP3 A;  4LCB A;  4DR5 M;  3K9P A;  1VDL A;  1Z59 A;  4NXN M;  2F5P A;  2UU9 M;  3GRV A;  2L6O A;  3GLH B;  4YY3 M;  3HU2 A;  4FD2 A;  5JI3 E;  5A2Q S;  4B3T M;  1NO1 A;  2L7H A;  3L27 A;  3Q8X A;  3LCU A;  1N33 M;  3KOY E;  5H37 D;  1IXS A;  4OVZ A;  4DBG B;  5IT9 S;  3GLI B;  4FWD A;  3U5Z A;  1TDH A;  1GVN A;  2LVP C;  1SXJ D;  3L29 A;  4JYA M;  1EFU B;  3SHF A;  4LJ8 A;  3L25 A;  1QAN A;  1QZM A;  1NV8 A;  1QUT A;  1W5T A;  3E46 A;  3AV0 A;  2DWZ B;  5FTM A;  2XFS A;  4M0W A;  2EJS A;  4M9X A;  4DV1 M;  2X4A A;  3KFU G;  3TWL A;  3V76 A;  5IZ7 D;  3VKH A;  2LHG A;  3UMM A;  1W5S A;  3FUT A;  4NSO B;  3K1J A;  1IBK M;  4LJ5 A;  1H6U A;  1LV7 A;  4IBE A;  5EQT A;  2WSE F;  3K92 A;  4MGI E;  1NV9 A;  2C96 A;  2KNA A;  3ZC7 B;  2CV0 A;  3FYD A;  3B7N A;  4II7 A;  2CHG A;  4F1I A;  5KO3 A;  3UGJ A;  3B7Z A;  1PJI A;  1Z6T A;  3AOE C;  2OO9 A;  3DFZ A;  3FTE A;  2L2D A;  3CGW A;  4PT5 A;  2KHH A;  4EIW A;  3A98 B;  4PD2 A;  2C9C A;  1IN8 A;  4M9Z A;  3GP1 A;  1DGH A;  1VDD A;  1N75 A;  4X64 M;  1XB2 B;  7CAT A;  4GIT A;  2Z4S A;  1MN3 A;  4Q7J A;  4GC5 A;  4LY6 A;  3WHL A;  2MRO B;  4LZZ A;  3GQ4 A;  1IBM M;  2F5N A;  3HHX A;  4DV4 M;  2KEB A;  2N35 A;  3LQR A;  1E94 E;  1LTM A;  4Z8X A;  2BWE A;  2LWX A;  3JAM S;  1KFV A;  4JN6 A;  1SXJ B;  3HZJ A;  4B7H A;  3C3E A;  3BOS A;  1NHW C;  1G4A E;  4RF0 A;  4JI1 M;  4K0K M;  2UUC M;  2GNO A;  3T6P A;  1E9S A;  1Q3C A;  2LVO C;  4GRI A;  2EUC A;  2UXB M;  4L78 A;  4GH9 A;  2L7I A;  3IG5 A;  3K9O A;  2H1R A;  4RKU F;  2JA2 A;  5ITR A;  2QBY B;  1YSY A;  3B89 A;  1IXR C;  1TGU A;  4IBG A;  2CV2 A;  4NOO B;  1GJT A;  1WJ7 A;  3UK6 A;  3PFI A;  2RGO A;  2LVN C;  2B3T A;  1IM2 A;  2R65 A;  2R18 A;  1R6B X;  2XF3 A;  2HWJ A;  4LJ4 A;  2D7H A;  3HHW A;  3IEC A;  2EKF A;  4BBA A;  4I81 A;  3RGS A;  1TTE A;  4HEO A;  1PJT A;  1GLN A;  2YQZ A;  5EXT A;  3D8L A;  1IBL M;  4FCV A;  3Q8G A;  4DV2 M;  2JWS A;  4JXJ A;  1PJQ A;  3I04 M;  1NY6 A;  1UFZ A;  4WUR A;  3GLG A;  2D7E A;  3IHP A;  3H4J A;  5EXX A;  2EKK A;  4LFC M;  3B7Q A;  3KDS E;  4DR7 M;  1SG9 A;  4Y28 F;  4P16 A;  1XXH A;  1VEJ A;  1ZV1 A;  1XNQ M;  2HL7 A;  3SAR A;  2XSZ A;  4IBF A;  2BWB A;  2K47 A;  3HY5 A;  2XEP A;  1ORY B;  3HU1 A;  4BB9 A;  1XWI A;  4CJ6 A;  4OW0 A;  3GPX A;  3SMP A;  4IBD A;  5KQD A;  3ILK A;  3LMM A;  3U6S A;  4OX9 M;  4YHH M;  1QDT A;  1N36 M;  3AOE A;  3PNV A;  4AW4 A;  2QHO B;  3EIE A;  4BLC A;  2QSF X;  2Y0Q A;  2UXC M;  3VK8 A;  2KXE A;  4IJE A;  4LJ7 A;  4QHT A;  3E9S A;  4LF5 M;  1YLA A;  2FOI C;  3M6A A;  3M0E A;  4KOD A;  3HJS A;  3HU3 A;  4IBI A;  4NL4 H;  3J81 S;  4FWH A;  4LFB M;  3A46 A;  2LTU A;  1Z5B A;  3CF2 A;  4NXM M;  3GLF B;  1MU5 A;  4A3V B;  4R71 A;  4AI6 A;  2XZU A;  1TDZ A;  1ZMU A;  4IBC A;  3H4M A;  4LF6 M;  2X49 A;  3KS4 A;  2J7N A;  1NJF A;  1R2Y A;  1GL7 A;  4DR6 M;  2LHC A;  3A45 A;  3SAT A;  2QEN A; 
#chains in the Genus database with same CATH homology
 2KA6 B;  4JI4 M;  3T1H M;  2I7N A;  1L2C A;  2UUB M;  4IJF A;  2YR0 A;  3CF6 E;  5ITQ A;  3HHZ A;  1QQW A;  4G4N A;  5EP1 A;  5KQ8 A;  4JI8 M;  4IBJ A;  4GIP A;  1K82 A;  1DO0 A;  1D2N A;  3DA1 A;  4KHP M;  3LVW A;  5FTK A;  4G4O A;  1OFH A;  3AJI B;  3VDP A;  1HR0 M;  1X37 A;  3R9X B;  3SYK A;  1JR3 A;  3GRR A;  1OJL A;  1PM5 A;  3E4R A;  3JR4 A;  4MGY E;  4KO8 A;  2G8L A;  3T15 A;  4AG5 A;  3U6C A;  3ZH9 B;  3A42 A;  5ITX A;  4B7G A;  4AG6 A;  1UM8 A;  4G4Q A;  3T1Y M;  3U61 B;  5ITT A;  2E5L M;  4I5S A;  3KS8 A;  3I4V A;  4L16 A;  1L2D A;  5IWA M;  2UUA M;  3J7B A;  2FE8 A;  3UZU A;  4NSR A;  4LF7 M;  5EP2 A;  3W0L B;  2HCB A;  4PCZ A;  4MB7 A;  3MHV C;  5F3W A;  4HL4 A;  2F5S A;  1SXJ C;  1IXZ A;  1IY2 A;  1DGF A;  5FTN A;  5KPR A;  2NQ8 C;  2Y20 A;  2HKJ A;  1I94 M;  3KSX A;  3CF0 A;  5EXP A;  1J5E M;  4GC9 A;  2DWN A;  3GLH A;  2RKO A;  4I4L A;  4FVM A;  3SC3 A;  2D7G A;  2Z7J A;  2ZBK B;  2CHQ A;  4RF1 A;  2C9O A;  3DZD A;  3FYC A;  1TH3 A;  3T38 A;  3SAW A;  4FCT A;  3GLI A;  3FUW A;  4AKG A;  5ITX E;  3UJN A;  4GKK M;  2CV1 A;  2M5Z A;  4LJ6 A;  1MX0 A;  3SAV A;  1OFI A;  4JI0 M;  3VLF B;  3NBI A;  4JI2 M;  1PJJ A;  2DXI A;  1Z5C A;  4GHA A;  2C99 A;  4MM3 B;  3RFW A;  3QAU A;  4NRV A;  4DV0 M;  3J80 S;  2V6Z M;  4DV5 M;  4IIW A;  3GPP A;  5EXS A;  1HQY E;  8CAT A;  3HJQ A;  3NWL A;  3I4Y A;  2VQE M;  3QWL A;  3L28 A;  3KXE C;  3SAS A;  3HWS A;  1I4W A;  1QAQ A;  1Q39 A;  4LF9 M;  3FD9 A;  4Z6Y A;  3PVS A;  1FJG M;  3TWK A;  3J27 B;  3VFD A;  1L2B A;  1N34 M;  4B7F A;  3U6M A;  3C58 A;  3FKE A;  2C98 A;  5BPV A;  1G59 A;  4L15 A;  4D80 A;  1ZAE A;  3U6E A;  2CHV A;  1WXQ A;  1YUB A;  2FNA A;  2KZS A;  5ITY A;  2YFQ A;  4ZPX A;  3GPY A;  4R3D A;  3U5Z B;  2DVW B;  3U6L A;  2ERC A;  3FTF A;  2KZU A;  1DO2 A;  4RNA A;  2J7O A;  3KOW E;  1SXJ A;  3FUU A;  2BJW A;  4DR4 M;  1T3T A;  3W0F A;  4IBB A;  1KSF X;  4B3M M;  4LZJ A;  5FTJ A;  3U6P A;  1XMO M;  4AZF A;  2LNH C;  1NSF A;  5E26 A;  2CUZ A;  4X62 M;  5C1B A;  2QBY A;  3B9P A;  3SAU A;  5LMN M;  1NJG A;  4GHL A;  2YNM D;  3SFZ A;  3TQS A;  5BR8 M;  2KW0 A;  1FNN A;  4DV3 M;  4NRW A;  3MK6 A;  1TH2 A;  3GQ5 A;  4FWG A;  4AKI A;  4XGI A;  4WW0 A;  1XNR M;  4W5W A;  1J7K A;  5KPT A;  1G8P A;  3RGP A;  1HNW M;  1DGG A;  4GMQ A;  3FTD A;  2ZM6 M;  2KRU A;  5FTL A;  2HHH M;  2XLJ A;  1N78 A;  3EIH A;  4AKH A;  5DNY A;  2F5O A;  3U60 B;  4I8O A;  1DGH B;  1NVM A;  2A5Y B;  4FCW A;  3J2P B;  3VKG A;  4B3S M;  1K3X A;  2LXE A;  1E32 A;  3OTO M;  4M0D A;  4XBO A;  3ZCB B;  3U6Q A;  1IY1 A;  4DV7 M;  2XSZ D;  2Z4R A;  2DWL A;  1HT1 E;  5DYI A;  4LJA A;  3WHK A;  1SXJ E;  1XMQ M;  1HQC A;  2CE7 A;  4D81 A;  2LH0 A;  1IN4 A;  2L09 A;  3PXG A;  4DR2 M;  4REZ A;  4TUW A;  2OPF A;  1N32 M;  2BJV A;  3AFH A;  1XC8 A;  1J09 A;  4QNR A;  1HNZ M;  4L8R C;  1L8Q A;  5GKN A;  5DYG A;  1GL6 A;  3U6D A;  2BNK A;  2XFT A;  4DUY M;  3GLF A;  2O5R A;  3K2L A;  3KW6 A;  1QVR A;  1L1Z A;  4DR1 M;  3HJ8 A;  2OQ4 A;  4ITQ A;  3D8B A;  3L26 A;  4LGY A;  1R2Z A;  1E9R A;  3DOA A;  4LFA M;  2XGN A;  4LGM A;  4DUZ M;  3AKZ A;  4G4R A;  3KVW A;  1R7R A;  4LRS A;  3TE6 A;  3JR5 A;  2G5G X;  2EA0 A;  4G6Z A;  2KRK A;  4CGY B;  4HLQ A;  2AHM A;  3TL4 X;  4DR3 M;  2XH9 A;  3GLG B;  2V1U A;  1K3W A;  4X65 M;  3TPZ A;  2Y0T A;  3IG8 A;  2R4E A;  2EO2 A;  1XXH B;  5LMU M;  3U60 A;  3AOG A;  1NNU C;  2RGH A;  2ZAN A;  2DWM A;  1JR3 D;  2QP9 X;  4LJ9 A;  4JV5 M;  4PDI A;  2QZ4 A;  3I51 A;  4M9S A;  2CEA A;  3FUV A;  3KP0 E;  1EE8 A;  3K8Z A;  5EJC A;  2VII A;  2R45 A;  4CIS A;  2QCU A;  3LVV A;  1KYI A;  3SMS A;  3U61 A;  2F4V M;  4OU7 A;  1ZQ9 A;  1IY0 A;  1IN6 A;  3FTC A;  2VQF M;  4LF4 M;  2W82 A;  2UXD M;  3U6O A;  4LG2 A;  3SHG B;  3GRU A;  3J7A S;  3SBJ A;  4AQY M;  3GQ3 A;  3KOZ E;  1DGB A;  1L1T A;  3M7G A;  2CFO A;  1C1K A;  2Y21 A;  3PNY A;  2C5R A;  1G41 A;  2Z3X A;  1XHB A;  2DHR A;  2X8A A;  3HHY A;  4MH0 E;  4QOS A;  2R62 A;  4L4U A;  1JQJ C;  4X66 M;  3GRY A;  1IXS B;  4FW9 A;  4CHT B;  1S3S A;  4LRT A;  4OVZ B;  4QOZ C;  2Q2E B;  5EP4 A;  5IRE B;  4MGZ E;  3FUX A;  2ZAO A;  3HGI A;  5E6J A;  3L2A A;  4QNM A;  1TH4 A;  2QPA A;  2V1C A;  2ZAM A;  3MJ5 A;  3VK7 A;  1HT2 E;  1NY5 A;  3SYL A;  5FLX S;  3LQQ A;  1G3I A;  4LF8 M;  4R7G A;  2R4J A;  1N77 A;  3HKP A;  2F5Q A;  1IN5 A;  4QHS A;  3KSJ A;  3GO8 A;  3AL0 C;  1QAM A;  1Q3B A;  1GKI A;  5JI2 E;  3KP1 E;  4D82 A;  4DV6 M;  1HNX M;  2FFJ A;  3TWM A;  4B08 A;  3RE8 A;  3R8F A;  1NHG C;  3VDU A;  1QYR A;  4JI3 M;  3GPU A;  1Z5A A;  4JI6 M;  5C18 A;  4IBK A;  1YE9 A;  2DZN B;  2M60 A;  4S12 A;  1IN7 A;  4MGH A;  5KPZ A;  2I7P A;  2R46 A;  2DZO B;  2XZF A;  1NNJ A;  4B3R M;  3CTW B;  2P5T A;  3KOX E;  3THG A;  4KLN A;  4MGK E;  5FSW A;  5ITU A;  1IQP A;  1QAO A;  4JI5 M;  4GKJ M;  5EP3 A;  4LCB A;  4DR5 M;  4NXN M;  1Z59 A;  2UU9 M;  2F5P A;  3GRV A;  2L6O A;  3GLH B;  4YY3 M;  3HU2 A;  4FD2 A;  5JI3 E;  5A2Q S;  4B3T M;  2L7H A;  3L27 A;  3Q8X A;  1N33 M;  3KOY E;  5H37 D;  4OVZ A;  5IT9 S;  3GLI B;  4FWD A;  3U5Z A;  1TDH A;  1GVN A;  1SXJ D;  3L29 A;  4JYA M;  3SHF A;  4LJ8 A;  3L25 A;  1QAN A;  1QZM A;  1W5T A;  3AV0 A;  2DWZ B;  5FTM A;  2XFS A;  4M0W A;  4M9X A;  4DV1 M;  2X4A A;  3KFU G;  3TWL A;  5IZ7 D;  3VKH A;  3UMM A;  1W5S A;  3FUT A;  4NSO B;  3K1J A;  1IBK M;  4LJ5 A;  1H6U A;  1LV7 A;  4IBE A;  5EQT A;  3K92 A;  4MGI E;  2C96 A;  2CV0 A;  3ZC7 B;  3FYD A;  4II7 A;  5KO3 A;  2CHG A;  3UGJ A;  1PJI A;  1Z6T A;  3AOE C;  3DFZ A;  3FTE A;  4PT5 A;  4EIW A;  3A98 B;  4PD2 A;  2C9C A;  1IN8 A;  4M9Z A;  3GP1 A;  1DGH A;  1VDD A;  1N75 A;  4X64 M;  7CAT A;  4GIT A;  2Z4S A;  4GC5 A;  4LY6 A;  3WHL A;  4LZZ A;  3GQ4 A;  1IBM M;  2F5N A;  3HHX A;  4DV4 M;  2KEB A;  3LQR A;  1E94 E;  4Z8X A;  2LWX A;  3JAM S;  1KFV A;  4JN6 A;  1SXJ B;  4B7H A;  3BOS A;  1NHW C;  1G4A E;  4RF0 A;  4JI1 M;  4K0K M;  2UUC M;  1E9S A;  1Q3C A;  4GRI A;  2EUC A;  2UXB M;  4L78 A;  4GH9 A;  2L7I A;  3IG5 A;  2H1R A;  2JA2 A;  5ITR A;  2QBY B;  1YSY A;  1IXR C;  1TGU A;  4IBG A;  2CV2 A;  4NOO B;  3UK6 A;  3PFI A;  2RGO A;  1IM2 A;  2R65 A;  2R18 A;  1R6B X;  2XF3 A;  4LJ4 A;  2D7H A;  3HHW A;  4BBA A;  4I81 A;  3RGS A;  1GLN A;  2YQZ A;  5EXT A;  3D8L A;  1IBL M;  4FCV A;  4DV2 M;  4JXJ A;  1NY6 A;  4WUR A;  3GLG A;  2D7E A;  4LFC M;  5EXX A;  3KDS E;  4DR7 M;  4P16 A;  1XXH A;  1XNQ M;  2HL7 A;  3SAR A;  2XSZ A;  4IBF A;  4PDG A;  2K47 A;  4BB9 A;  2XEP A;  1ORY B;  3HU1 A;  4JI7 M;  1XWI A;  4OW0 A;  3GPX A;  3SMP A;  4IBD A;  5KQD A;  3ILK A;  3LMM A;  3U6S A;  4OX9 M;  4YHH M;  1N36 M;  3AOE A;  3PNV A;  4AW4 A;  3EIE A;  4BLC A;  2Y0Q A;  2UXC M;  3VK8 A;  2KXE A;  4IJE A;  4LJ7 A;  4QHT A;  3E9S A;  4LF5 M;  2FOI C;  3M6A A;  3M0E A;  4KOD A;  3HJS A;  3HU3 A;  4IBI A;  4NL4 H;  3J81 S;  4FWH A;  4LFB M;  3A46 A;  1Z5B A;  3CF2 A;  4NXM M;  3GLF B;  1MU5 A;  4A3V B;  4AI6 A;  2XZU A;  1TDZ A;  4IBC A;  3H4M A;  4LF6 M;  2X49 A;  3KS4 A;  2J7N A;  1NJF A;  1R2Y A;  1GL7 A;  4DR6 M;  3A45 A;  3SAT A;  2QEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...