2UXBO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxbO00
4YY3O 4X65O 4DR2O 4YHHO 4B3MO 4A5UB 2ZM6O 5IT9N 5H5NA 4AQYO 3J81N 4GKKO 1N34O 2LW7A 3RT3C 4LF8O 4DV7O 1N36O 4DR6O 1J5EO 2Z0AA 2FKXA 2UUCO 5FLXN 3SDLA 1HR0O 1X59A 1IBLO 5LMUO 2DJVA 3T1YO 4JV5O 4JYAO 4B3SO 2E5LO 1XMQO 4K0KO 4DV6O 3F5TA 3M8AA 4JI3O 5A2QN 3OTOO 4B3TO 1R6TA 1XEQA 1IBMO 2UUAO 5BR8O 3R66A 4JI7O 4LFCO 4DV4O 1D2DA 4LF9O 2UU9O 2N74A 2VQEO 1YZBA 2UUBO 4LF4O 4JI0O 2HHHO 3J7AU 1F7YA 1AILA 4JI5O 2ZKOA 1I94O 4LFAO 4KHPO 4DV3O 1A32A 1FYJA 4LF5O 5BY1A 4X62O 4LF6O 5LL6Y 1DK1A 1G1XB 4JI1O 4DR4O 4DR1O 4NXNO 4GKJO 1HNZO 4DV2O 1R1BA 4X64O 1FJGO 2VQFO 4DR3O 1FKAO 4JI8O 2UXCO 4DV0O 2UXDO 3J80N 2JRIA 4LF7O 4JI2O 4DUZO 5BXZA 3O65A 4LFBO 4B3RO 4DV1O 1XMOO 1XNQO 4OPAA 1KUQA 1XNRO 1HNXO 2DOSA 5LMNO 4DR5O 2F4VO 4NXMO 3JAMN 4X66O 3T1HO 1IBKO 1HNWO 1NS1A 1AB3A 1N32O 4OPHA 4JI6O 2UXBO 2AGAA 5IWAO 4DR7O 4DV5O 4JI4O 4OX9O 1N33O 4DUYO
chains in the Genus database with same CATH superfamily
4CC5A 5DECA 1BQ0A 3ZRWA 4TQFA 3HKDB 4CH5A 4U3JA 2UXBB 4X1YA 3ZMSA 4AQYO 4MSWC 4FIPC 4LF8O 1VARA 3DC5A 1K3EA 3E89A 3Q4HA 1FXVA 1AJQA 3T1YO 5CMUA 3IAYA 4IYIA 1VQ5V 3B09A 2XAHA 1IBMO 4CS3A 3RVZA 1NVPD 1Z5WA 4JI3B 1D2DA 1RM1C 3ZMUA 3AG2B 3MAQA 1AR1B 1HWYA 2JEXA 3VQVA 2GUZB 1OCRB 3MHSC 3CRMA 3SYQA 1SA0B 1PP9H 2ZE5A 4YXWG 4DUYB 2HEPA 2Q69A 4TV8B 3ZHVA 1FYJA 3B77A 3K9AA 5CA1B 3K3WA 3AG1C 4LF6B 1BL8A 3CPWU 4MVUA 3CCRV 2A3QA 3H1JH 3AG4C 2VQFO 1I94B 3G6BA 3ZHRA 3QO8A 1OCCC 2JRIA 3B4SA 2FMLA 5TISZ 4DUZO 3O65A 1ROPA 5IYDO 2Y69C 3TK1A 4O2AB 2LFRA 1KUQA 3JD2A 2B5UA 3H1IH 4WCEV 1MOFA 4XBFA 1TVKB 2P4VA 1MZFA 5BR8B 2Q5ZA 4JI6O 2QWPB 3LDDA 4UUJC 4JI4O 2W0FC 4AI8A 4J7ZA 3ABKB 4GX0A 3RYHB 5KLVH 5KAIZ 2CH7A 2HJDA 4EB6B 5J9PC 1G4YB 1XMQB 2CTWA 4JI1B 4WF9V 4B7EA 2Z0AA 2FKXA 2CTQA 3FFQA 2EX3A 1M4UA 1NKDA 4Q6GA 2OIGA 2HVJC 4HAMA 3SYOA 3ZJZA 3OUSA 1PD3A 4MW3A 4GX5A 3CC7V 2K9PA 4DV5B 4J7JA 2H94A 1ZSPA 3FB8C 2XAGA 3CCQV 2GDSA 4LFAB 2OCCC 4EEQA 3DC6A 2QR4A 4LFAO 3U11A 1K4DC 1WA8B 3WG7C 4DR1B 2GV9A 1G1XB 1HP8A 5BZBA 4DV2O 4UCTA 4YJ3B 3WU2Z 1QVFU 2Q6AA 2UXDO 2P06A 1K5SA 4PV1B 4LF7O 1WB8A 4TWKA 1P49A 2VQEB 2WPDG 5GONA 4GCZA 2Q67A 2UUCB 1SQFA 3OUFA 1HNXO 1GM9A 2PI4A 3AG1B 3CCEV 4LC1A 3K5LA 4LCUC 1R73A 5FPRA 3BFRA 3VOUA 3T1HO 1WPBA 2JGDA 1RSOB 1F23A 4DR7O 3W7TA 4XDKA 5J2UA 4YY3O 3RWRD 4B7KA 2Z3YA 3P30A 2Y69B 2ILMA 4DXWA 1N0JA 2NN4A 4X8AA 4P2ZA 4WFEA 2BTOA 4HYOA 2ZE6A 3FAVA 3ASOB 4PD4F 1JFFB 2ZQMA 3TJTA 5IYCO 3ASNC 2QWOB 2DJVA 4O4JA 3UO2A 1NVPB 4NB5A 4FLYA 2XAFA 2ZR3A 3ABLC 4WFGA 3K59A 1TA8A 2DMXA 5CA0A 2EINC 3BAAA 4JI3O 5LYJB 2EZOA 3K06A 2FL4A 4JYBA 1MABG 3THOA 1Z5VA 3BABA 4TV9B 1HNXB 3Q4HB 3E8BA 3W7XA 1XMOB 3TXQA 4X1YB 4UV9A 1YXBA 2DQ3A 3RGBA 1O9GA 1NR7A 4H0LB 2P5OA 1IX9A 1AI6A 4ZOLB 2XASA 1M57C 1DF5A 2JGDB 2YXLA 1AR5A 3L70H 1UPGA 3F5WC 3K0GA 2JDIG 3JATA 1PL0A 2OWOA 5FL7G 2RQ6A 2F93B 3CMEV 2JJ1G 3JD1A 1M56C 4EKWA 4DV1B 2PGGA 4DK1A 2LGWA 4QJFB 3CCVV 1H8EG 2P7TC 2OCHA 2E5LB 1VP7A 3E83A 5BMVB 4J41A 2X6BA 1SQVH 4TV8A 4FLTA 2EIMC 2OIEA 3WG7B 1BQZA 2EILC 1K73W 4WFFA 1SC5B 3ZN1A 3KCYA 3E22B 2XAQA 1B04A 4NXMO 4WBNA 3QO7A 5JVDB 2FTKA 2Y4TA 4L8JA 4C7UA 1WP7A 2IH3C 4O2AA 4MTFA 2UU9B 3K04A 4RQEA 2ZM6O 4O2BB 4B3TB 3JASA 4DV2B 2XTAA 1IBMB 1Q6HA 3ZRXA 2DW4A 4I5SA 2PZSA 4QGPA 3HR0A 5LYJA 4MVMA 5LMUO 3D36C 4AILC 2NNUA 2IM9A 4DV7B 1BS3A 3CB2A 3JATB 4B3TO 1QLEB 2WLJA 2UUAO 3M99B 1HDJA 3ASOC 1RPOA 1F4NA 4FZ1A 3DSQA 3N2GA 1GM7A 1QU7A 1SQXH 3ASNB 5IE9A 2A7WA 3NXSA 2Q73A 4FM2A 3ABLB 4UXNA 2P90A 1I94O 2KKWA 3E2EA 5HFLA 1R6KA 4NYKA 1S3JA 2CDYA 2F43G 5JQGA 2ZD9A 1LR1A 1G8MA 1GKFA 3BVOA 1CXZB 1ZLZA 4I4TB 1RPRA 5BMVA 3OFNG 5H9CA 4NXNO 1EBOA 4FK5C 1E79G 1P84F 1AP5A 3STZC 5C8YA 3UT5B 2QWNB 4X88A 3SYPA 3RYCA 3H1HH 4R6ZA 3K5NA 2F23A 2CTRA 3H1LH 3RFRA 1XMOO 5KHHA 1L8DA 1TUBA 5EZYB 1KMIZ 1XQ8A 1AB3A 1W2BU 4PI0A 1CP9A 5JJJB 4JAAA 4X20A 1N33O 1XDCA 2EIMB 2IW5A 4DR2O 3K08A 2EILB 2MW2B 2R70A 1N34O 3M7MX 4K0KB 4DR4B 3DXRB 1OCRC 4LWSA 2CK3G 5ITZA 5L3BA 1NT2B 1L0NH 4KUMA 5JJNB 1YEWA 3FAVB 4Q20A 2MK3A 1R6NA 2Y48A 1VMGA 1THZA 3CHXA 4X66B 5JWPA 5J2UB 2AW9A 1NTZH 1SQBH 1E1RG 3KG2A 2IJIA 3ETQA 1AILA 3CCUV 3OW2U 4LF8B 4X1IB 1ORQC 3AG3C 3LSQA 3KKYA 1XILA 2K1EA 4FFBB 3L74H 5LHHA 5FNVB 4DV6B 1AR4A 3SPCA 2YSUB 1CEZA 4DR4O 3JCUZ 5EIBC 3R65A 1R3KC 1Y76A 1W59A 2P4KA 4ZIBA 3CCLV 3ABMC 3K79A 2IU3A 3EVKA 4DO2A 1Q81W 1US6A 2IBZH 4YJ2B 2VQFB 1UFIA 2G38A 5LXTB 3HKBA 4GX2A 4Z2WA 1MMMA 5K1XA 2DYSC 1XNQO 2FB5A 4F6EA 3VQYA 1QR8A 4DR5O 4ZOLA 1D5NA 4PA7A 4FM1A 1VIBA 2YC0A 2ZR2A 3OMIB 1KECA 1PM9A 4JTDB 5EYPB 3L75H 3G4SV 2FYUH 3W7WA 1R3IC 4LFCB 5IYBO 4B3MO 5B1AC 1NZ6A 4TOIA 1XNQB 3OTFA 3OEHG 1GN3A 2W6JG 1BCCH 2KSDA 1FS0G 1YJ9V 4JTAB 2ZNJA 5KHKA 3N2KA 2RDCA 1S5JA 2OCCB 2ZM6B 3UCSC 1XHZA 4U7NA 1L0LH 4UCOA 4PA9A 4B3SO 3QNEA 2RCVA 3ZRWB 4RO2A 3TXSA 1HR0B 4O4IB 1YIJV 4LFCO 2GHYA 4N21A 4UCRA 4LNUA 4JI4B 4O4LA 2XUMA 5IYZA 1HW7A 4J9YB 5CA3A 1BHAA 1S0VA 2JS5A 2WLIA 4UVBA 1NTMH 4YHHB 2IJJA 2NR5A 2QKAA 3H9VA 2R72A 2CTPA 2LO1A 4MVQA 4DRXA 5KUKA 4UCUA 3OE7G 4JASA 1T5EA 4KP4A 1WJZA 1ZWIC 5JH7B 3S3WA 1I08A 3ZRSA 1VQ8V 4X62O 4MTOA 3E22A 3SJAC 1SZTA 1R1BA 3EFFK 3X2QB 4DV0O 2GTAA 3OR6C 4RQFA 1K34A 5B1OA 2HG5C 3LNNA 1NR1A 1SQPH 3CRAA 4QIWF 5CBGA 4IHJB 3ETGA 1GN4A 5IWAO 2ITCC 4ZBMA 1IBKB 4JYCA 4XDJA 3N2KB 1M90W 3BHPA 4R8CA 3BPZA 4L87A 1JX9A 3HKEB 2WLHA 4JI6B 3I55V 5IT9N 1VQOV 3ZN0A 2LW7A 4JI2B 2M7WA 2OT5A 4DV3B 4J11A 4DR6O 5J2TA 1TGOA 4JAUA 3K0DA 1I7FA 4E2LA 2EJ7A 1TUBB 1M57B 4K0KO 5KAFZ 5B66Z 4I7ZB 4BAYA 5B1AB 4J42A 5EBLC 3ZBHA 3D3QA 3MHHC 1V55B 1SA0A 2B1GA 1M56B 3OR7C 4I9WA 4JGSA 3SGIA 1SETA 2VQEO 2W0XA 5B1BB 4NR1A 2KQXA 2XNDG 1TUEB 4ZI7B 2WLNA 2ZKOA 4DR3B 2OTJV 4KHPO 3A8TA 4MTXA 1TVKA 4BW5A 3ZMZA 2YI8A 4B3SB 3LSUA 3OD4A 3JAKA 2EJRA 5LMUB 3I5DA 1PNKA 1FJGO 3CCSV 1FXHA 1H2NA 3AK3A 4JI8O 1SQGA 1M9NA 3J80N 4OX9B 1U97A 1SRYA 1VQNV 2EZPA 2JJ2G 2LGQA 1S77D 5L3GA 1QR9A 4XDLA 1XNRO 3SR2C 3UO3A 1I5YA 4FFBA 1YHQV 1L1FA 4UVCA 5L3DA 2CH7B 4J9ZB 2IJHA 1OJHA 1UJWB 3JD3A 5J2TB 4W4LA 3CRRA 2ZINA 4A5UB 2IH1C 3J81N 4ZI7A 1N36O 4LR3A 4CS4A 5KHGA 4CBCA 1GK9A 2X0LA 1ZL8B 5JVDA 3PJSK 1X59A 2RN9A 3JD4A 4U3JB 4MS2A 3IJ4A 1FXKC 4PHZA 4GLXA 4TUYB 4I9QA 4JI8B 1X4TA 4DV6O 1AVMA 1QHTA 1NI8A 1K8AW 1XEQA 3CD6V 4TQDA 2RMKB 4B3RB 4ZKIA 2PTMA 1VQPV 4GKJB 2E75B 3HB3B 1JA8A 1YSCA 4WFHA 2Q9LA 5D5QA 4AQYB 5JCOC 2QTOA 1Y4MA 1QLNA 5GTHZ 1RFYA 2HHHO 2QGNA 5GONB 5H6QA 2VS0A 1KYOF 5LHIA 4F4LA 3DTUB 4G28B 3VQWA 4YJ3A 2WSSG 5KMGA 2HP8A 3CC4V 4JI1O 1K7DA 1ZTEA 5IDJA 2QKCA 3SYAA 5IJ9B 3HKCA 2ZCEA 3BRCA 1HNZB 2O57A 3JYCA 3W7UA 1J5EB 1H2KA 5CA1A 4O4LB 1ZAUA 1IXMA 4NTWA 1VF6C 5F2VO 4G27B 1VQ9V 5LP6B 2JEUA 4FLUA 1GO3F 3CJHB 4LFBB 2QDOA 1OHHG 3OAAG 4DR5B 3WFVA 2BTQA 4IIJB 4PA3A 1IBKO 1PKXA 5KUMA 1XOUA 4TT3G 4UCSA 1PL4A 2GSMB 4YY3B 4PDVA 2PY5A 1Q3EA 3HPLC 4IHJA 5DN6G 4GKKO 3AK2A 1KBHA 1VQLV 4GZRB 2LFSA 2WA3A 1SS3A 2HJFC 2V7QG 4P9PA 5FLXN 3S3XA 3AG3B 2YIDA 4LF4B 2PI5A 1KU9A 2R9AA 3K5OA 3CP1A 1FPOA 3MDSA 3CS5A 4X20B 1WB7A 5AG2A 2P6JA 2DN9A 1AJPA 4I50A 5KHIA 2W6IG 1FFTB 3JD0A 2EIJC 1U96A 4TSFG 1GAXA 3RYIB 5EK0A 3ABMB 3QVNA 2LP7A 2UUBO 3CSXA 3AG7A 1FXKB 4JPRA 4DK0A 5LGTA 5IJ0B 3FYEB 1N0NA 2DYSB 4DV0B 4FPPA 4DV3O 2QTSA 4JI0B 5LGNA 2ZE7A 2PF4E 1EN6A 5JJEB 2EBOA 4NXNB 3WB0A 1Q7YW 2LQTA 4X65B 2YIBA 4DR6B 1BMFG 3IFXA 3VQXA 2PUSA 4DR1O 1M1KW 4GT1A 3C90A 1Q82W 2LJ2A 2ZIOA 2RNBA 4K3AA 2UXCO 3G6EV 5GTIZ 3JAKB 4JV5B 3RBZA 4PDLA 5KA5A 2DOSA 1D5AA 2ZXWC 1OZ0A 1IURA 4QE9A 3SYCA 5LOVA 1N32O 4O4JB 4DW0A 1P7BA 4HNAA 4DV5O 3L72H 2H8PC 2ADQB 3GB7C 4MVRA 1N34B 5LP6C 2YXHA 4FM0A 1JR9A 3L71H 2B1IA 1EZVH 3RT3C 4ZHQB 5LBQA 4I50B 3N2GB 3KCXA 3OT7A 4JYAB 2UUCO 3SDLA 4DUZB 4LH7A 2JIZG 1KQSU 5EYPA 1XMQO 2UXCB 4PDMA 1K4CC 3M8AA 1DTOA 1R3LC 2KG7A 5A2QN 1R6TA 3BCCH 1K5QA 1XL6A 1RSOA 4JF3A 5IY5C 1Q5OA 1VEWA 1VQ7V 2ADPA 4MVSA 5E79Z 3ETDA 1COWG 2BCCH 2QM7A 3CWBH 3X2QC 4R50A 2VRZA 5L3CA 1EM1A 2UUBB 4J80A 1DGSA 5L3EA 1G6UA 3LDCA 4CH3A 4JTCB 1I5XA 2HKOA 4LF5B 3LUTB 2HVKC 4LF5O 1IBLB 2A79B 3L9DA 5JCOA 3ZEDA 4LF6O 1GMGA 5H2FZ 3JARB 5IYZB 3OM3B 5KA6A 1LUVA 3SJBC 3TGUH 3KZIZ 3SPHA 3T1YB 1VQMV 3B2EE 1NJIW 4EB6A 4DR3O 2YICA 4ZHQA 4JZGA 2C2AA 1SQQH 2DWEC 5IJ9A 2X7RB 4B3RO 2UUAB 4LBEC 4FMTA 1NH2D 1XL4A 1IVSA 2F4VO 1JPXA 4YIOA 2Y0PA 3IC7A 3CRQA 2WLLB 3T1CA 4NTYA 1Y67A 1AI5A 4KL1A 5GW7A 1EN5A 2X6CA 2F95B 4OX9O 1V55C 3NR7A 3PN1A 3G80A 3FD9A 1VQ6V 4YHHO 3GWKC 2N04A 1WLEA 2ZDIA 4FZ0A 2CE4A 2F1MA 1XI1A 5H5NA 2Y0IA 3JCZA 5B1BC 3P32A 3T4DA 1HR0O 4B08A 5LOVB 4O2BA 4JV5O 1Q6UA 4JYAO 4NXMB 1XHXA 4AHCA 5CB4A 1EN4A 3JARA 2EIKB 3ZS8C 4X64B 3OTOO 4PDRA 1Y76B 3OTOB 3T1HB 4DYLA 2UXXA 4RUFA 1URFA 4UB8Z 1Q43A 4B3MB 1H2LA 3CX5F 3E35A 2BSKA 1MG1A 3J7AU 3F7VC 3ICXA 3EHBB 3UT5A 5C8YB 4UCVA 3E86A 4IL6Z 4BR6A 2ZNIA 4YJ2A 2HFEC 1B06A 5IY5B 1N32B 4U7OA 2YIBD 4BWAA 1YCIA 2WLLA 3ML0A 1JOYA 4P9OA 4GUNA 3CYOA 1BSMA 2BTQB 4QPJA 3FB5C 3FB7C 4I0XB 5CBHA 2UXNA 4DR7B 4X9QA 1HNZO 1B6QA 1FAFA 1WP8A 4H33A 3ABUA 3L73H 5DEDA 1MSDA 1YTFB 1FD9A 2QE7G 1KP3A 4LFBO 3ZMTA 4JI7B 1KD1W 4DV1O 2PYJA 3DGEA 2QM4A 3ABTA 4DW1A 1B3QA 3APOA 4RWUA 4LWSB 5LHGA 2H3OA 4FLXA 4R7CA 1HNWO 3LNMB 3A0RA 3RYFB 1K97A 2UXBO 3ZX6A 3IC9A 4IT5A 1QBZA 1KC8W 3CMAV 1WN7A 4LNUB 1SESA 5B3SB 1Q90D 3G71V 3CXCU 3QG5A 5B1NA 2Q7HA 3BA9A 2ZIMA 1N4CA 1BE3H 1JQ0A 1R3JC 4DV7O 2ETNA 1JCHA 3BEHA 1OCZB 1IBLO 2AZ0A 1FFXA 2ITDC 1ZX3A 3AK1A 1V54C 4JZ2A 4O4HB 2HLDG 5HFMA 1Q8IA 2DQ0A 3CE2A 3F5TA 4ASUG 2JVDA 4UV8A 3SPGA 4G2KA 2IU0A 4RAIA 2BSKB 1JJOA 3JALB 2ODMA 5K1PA 5CBFA 2JS3A 1OCOB 2UU9O 2N74A 1F4MA 3HKCB 2YI9A 1KKDA 4NTXA 3ZCCA 2ARHA 1F7YA 5EC2C 4H13B 2EIKC 1N36B 2AHYA 1GTOA 4E4EA 4BIOA 3QTCA 1H2MA 3FKSG 3CEIA 2XOKG 4BIZA 5LL6Y 5CN0A 2YEVB 4MVOA 2BE3A 1NH2B 1F51A 3UQ8A 4EFBA 2WA4A 3HKEA 4HNAB 2JK5C 3WB1A 4MTGA 4KXRA 2Q68A 4J10A 4JI2O 1P4RA 1XNRB 3JSLA 4FFKA 3RN4A 3K58A 3RYHA 3QF7A 4J7KA 1OV9A 4OGQB 3CRCA 3B40A 3ZHQA 2YUAA 1N33B 4MT8A 3A0HZ 4X1IA 5LMNO 4HBNA 1NQTA 4X66O 4PELA 5LA6B 1E1QG 1NS1A 5LGUA 1K9MW 3JASB 2A0LA 4CH4A 3JALA 4Z1MG 4H37A 3U0ZA 3LSSA 2EIJB 2HHHB 2D3OW 3E8FA 3K57A 3CJHA 3E8HA 2Q0OC 1XREA 4F6RB 1EZJA 4BW9A 1J5EO 2Z5UA 1MZEA 2OTLV 4IIJA 4IGGA 1YJNV 4GKKB 4GYCB 2WLIB 3TETA 2Y4UA 2B9ZA 4QPKA 4UVAA 1YITV 1YDXA 4PA6A 3ZHUA 3MD0A 4UB6Z 5B3SC 1QQCA 4RUEA 2JGUA 4JI5B 3SPJA 2YEVA 1MNGA 3RW0A 5H6RA 3P3PA 3K5MA 4GX1A 3RVYA 2AHZA 1QCEA 3ZMVA 4QNHB 3SPIA 4FLZA 2GTSA 1AP6A 1FJGB 1GN2A 1YZBA 2L6LA 1V54B 2LW1A 3FX7A 1Q6IA 4KHPB 4JI5O 5EZYA 1XUQA 2E74B 4JYYA 5CA0B 3ZRVA 4CC6A 3GWOA 4LP8A 4I55B 4YIPA 2ZXWB 2WLKA 3TCUA 2ATKC 3T4ZA 1OCOC 5BY1A 3I56V 1Z2GA 1Y66A 4TV9A 3RYCB 1O9HA 1DK1A 1RP3B 2QEXV 4X62B 1Y74A 1P7GA 2Q0AA 4PI2A 2GUZA 1VF6A 1K92A 1Q86W 5LA6A 4FVMA 3VBBA 5JQGB 1KKCA 4PJ0Z 3JAWA 3B8NA 4Z1VA 3H1KH 4TUYA 1SF9A 2QJ1A 1JJ2U 3FYIB 4FJCC 2D2CB 3D3IA 2X6AA 2AGAA 3ETEA 3O9OA 1BGYH 2Q8VA 4HZ3A 4LF9B 4DUYO 5CB4B 1BHBA 4D7SA 3OGIB 1I0HA 1S5HC 3ZHSA 3OEEG 4WBNB 3D36A 1NTKH 2KB1A 1W0JG 1IXBA 3F7YC 3RYFA 1QNMA 2QKSA 4WFBV 4MW8A 5C93A 1M93A 3CCJV 1MSWD 3D8CA 2ZT9B 2QWQB 3OMNB 3HKDA 4ICGA 3R66A 1FFXB 5KX5A 3ABKC 4DV4O 2UXDB 2NLJC 1QVGU 2HR3A 2GBOA 1S5LZ 2N05A 2A06H 4I0XA 3U10A 1WNSA 2VWKA 1DF4A 4JI0O 5LXTA 5FNVA 2XHBA 2VWJA 4KFMA 1SKVA 1IZ3A 1AI7A 1AJNA 1YTFD 1JVMA 3P3NA 5IWAB 2KG7B 4ABMA 1A32A 3SJQC 4D6TH 1PNMA 2CGNA 3LDEA 1GM8A 2QM8A 2AZ2A 2PYLA 1W0KG 3H01A 1YF2A 1VQKV 1GRJA 1J95A 5EC1C 1M5IA 4P30A 2R9IA 2QA4V 3CCMV 1HNWB 3JAWB 2DYRB 2ZDIC 4K8ZA 5L3FA 2QWRB 4PA4A 1H2GA 1H2SB 3OGCC 2YDEA 1WAZA 2R9RB 1JMKC 3JAMN 4OPHA 3C3TA 2F4VB 4I4TA 4WFAV 3ZIAG 1ENVA 3RYIA 1WPXA 3WB2A 2CAZC 4X65O 1H8HG 2DE0X 3SJCC 3CC2V 2CUGA 2WLMA 3BA8A 4FLVA 5JH7A 5IJ0A 4W4KA 1XBLA 1PV0A 3STLC 1ZL8A 4JAVA 4JI7O 5B5EZ 2DWDC 4LF9O 4DRXB 1VQ4V 4LF4O 2P22C 4N23A 4NKGB 4CS2A 4X89A 4K35A 2E3CA 5LP6A 4O4IA 4FLWA 2EINB 3CXHF 1LNQA 3N27A 5A9GA 2V1DA 4X1KB 2E76B 2YXYA 1H38A 4GKJO 5DM6V 4D7TA 4UFZA 2BOBC 2M6YA 2P67A 1VF5B 5D5PA 4CZZA 5BXZA 4IYHA 1WA8A 3UKMA 2ZE8A 1Y6XA 4OPAA 1N8RW 3OMAB 5LMNB 1OCZC 4F6RA 3DXRA 4OXSA 2Q4PA 3IGAC 2F66C 4I55A 5KHJA 2YS8A 2DYRC 5KMGB 4LF7B 2AXTZ 5E1AC 4NVPA 1NBMG 3G67A 3BY6A 3A2FA 3UM7A 1EFRG 1BT8A 4EFEA 1YJWV 3AEIA 4MVZA 1RM1B 1V9PA 3T2MA 3AG2C 1S76D 4BIUA 1SZXA 2E5LO 2CGOA 2XAJA 2RJZA 1IDSA 5BR8O 1VF7A 3EXAA 5EBMC 1PNLA 2WWWA 1GH6A 1Y74B 2YIAA 4DR2B 2XT9A 4O4HA 1NU1H 3E8GA 5KX5B 1GN6A 3AG4B 5EBWC 1OCCB 3QO5A 1S72V 1AI4A 1LUWA 3HKBB 3APQA 1KB9F 1PPJH 1SERA 3B8MA 2V4DA 1QLEC 3JSNA 2EULA 1YI2V 4H44B 2OYQA 3GVMA 4X64O 3C3SA 1FKAO 5EIBD 1CPYA 1MA1A 3K03A 4QE7A 2A9HA 1JFFA 4DV4B 1K33A 1TAEA 2QSAA 1FXKA 3W7SA 4K8XA 2BOCC 3ZHTA 2L35A 1YVWA 3K9SA 2IJKA 4U3FH 1BZKA 3FB6C 2WAMA 2Q7EA 4CH6A 1ZUQA 4X1KA 1KP2A 5ITZB 1AROP 5FPOA 2Q7GA 4LH6A 1DLBA 3A0BZ
chains in the Genus database with same CATH topology
4YY3O 4X65O 4DR2O 4YHHO 4B3MO 4A5UB 2ZM6O 5IT9N 5H5NA 4AQYO 3J81N 4GKKO 1N34O 2LW7A 3RT3C 4LF8O 4DV7O 1N36O 4DR6O 1J5EO 2Z0AA 2FKXA 2UUCO 5FLXN 3SDLA 1HR0O 1X59A 1IBLO 5LMUO 2DJVA 3T1YO 4JV5O 4JYAO 4B3SO 2E5LO 1XMQO 4K0KO 4DV6O 3F5TA 3M8AA 4JI3O 5A2QN 3OTOO 4B3TO 1R6TA 1XEQA 1IBMO 2UUAO 5BR8O 3R66A 4JI7O 4LFCO 4DV4O 1D2DA 4LF9O 2UU9O 2N74A 2VQEO 1YZBA 2UUBO 4LF4O 4JI0O 2HHHO 3J7AU 1F7YA 1AILA 4JI5O 2ZKOA 1I94O 4LFAO 4KHPO 4DV3O 1A32A 1FYJA 4LF5O 5BY1A 4X62O 4LF6O 5LL6Y 1DK1A 1G1XB 4JI1O 4DR4O 4DR1O 4NXNO 4GKJO 1HNZO 4DV2O 1R1BA 4X64O 1FJGO 2VQFO 4DR3O 1FKAO 4JI8O 2UXCO 4DV0O 2UXDO 3J80N 2JRIA 4LF7O 4JI2O 4DUZO 5BXZA 3O65A 4LFBO 4B3RO 4DV1O 1XMOO 1XNQO 4OPAA 1KUQA 1XNRO 1HNXO 2DOSA 5LMNO 4DR5O 2F4VO 4NXMO 3JAMN 4X66O 3T1HO 1IBKO 1HNWO 1NS1A 1AB3A 1N32O 4OPHA 4JI6O 2UXBO 2AGAA 5IWAO 4DR7O 4DV5O 4JI4O 4OX9O 1N33O 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 O;  4X65 O;  4DR2 O;  4YHH O;  4B3M O;  4A5U B;  2ZM6 O;  5IT9 N;  5H5N A;  4AQY O;  3J81 N;  4GKK O;  1N34 O;  2LW7 A;  3RT3 C;  4LF8 O;  4DV7 O;  1N36 O;  4DR6 O;  1J5E O;  2Z0A A;  2FKX A;  2UUC O;  5FLX N;  3SDL A;  1HR0 O;  1X59 A;  1IBL O;  5LMU O;  2DJV A;  3T1Y O;  4JV5 O;  4JYA O;  4B3S O;  2E5L O;  1XMQ O;  4K0K O;  4DV6 O;  3F5T A;  3M8A A;  4JI3 O;  5A2Q N;  3OTO O;  4B3T O;  1R6T A;  1XEQ A;  1IBM O;  2UUA O;  5BR8 O;  3R66 A;  4JI7 O;  4LFC O;  4DV4 O;  1D2D A;  4LF9 O;  2UU9 O;  2N74 A;  2VQE O;  1YZB A;  2UUB O;  4LF4 O;  4JI0 O;  2HHH O;  3J7A U;  1F7Y A;  1AIL A;  4JI5 O;  2ZKO A;  1I94 O;  4LFA O;  4KHP O;  4DV3 O;  1A32 A;  1FYJ A;  4LF5 O;  5BY1 A;  4X62 O;  4LF6 O;  5LL6 Y;  1DK1 A;  1G1X B;  4JI1 O;  4DR4 O;  4DR1 O;  4NXN O;  4GKJ O;  1HNZ O;  4DV2 O;  1R1B A;  4X64 O;  1FJG O;  2VQF O;  4DR3 O;  1FKA O;  4JI8 O;  2UXC O;  4DV0 O;  2UXD O;  3J80 N;  2JRI A;  4LF7 O;  4JI2 O;  4DUZ O;  5BXZ A;  3O65 A;  4LFB O;  4B3R O;  4DV1 O;  1XMO O;  1XNQ O;  4OPA A;  1KUQ A;  1XNR O;  1HNX O;  2DOS A;  5LMN O;  4DR5 O;  2F4V O;  4NXM O;  3JAM N;  4X66 O;  3T1H O;  1IBK O;  1HNW O;  1NS1 A;  1AB3 A;  1N32 O;  4OPH A;  4JI6 O;  2UXB O;  2AGA A;  5IWA O;  4DR7 O;  4DV5 O;  4JI4 O;  4OX9 O;  1N33 O;  4DUY O; 
#chains in the Genus database with same CATH topology
 4CC5 A;  5DEC A;  1BQ0 A;  3ZRW A;  4TQF A;  3HKD B;  4CH5 A;  4U3J A;  2UXB B;  4X1Y A;  3ZMS A;  4AQY O;  4MSW C;  4FIP C;  4LF8 O;  1VAR A;  3DC5 A;  1K3E A;  3E89 A;  3Q4H A;  1FXV A;  1AJQ A;  3T1Y O;  5CMU A;  3IAY A;  4IYI A;  1VQ5 V;  3B09 A;  2XAH A;  1IBM O;  4CS3 A;  3RVZ A;  1NVP D;  1Z5W A;  4JI3 B;  1D2D A;  1RM1 C;  3ZMU A;  3AG2 B;  3MAQ A;  1AR1 B;  1HWY A;  2JEX A;  3VQV A;  2GUZ B;  1OCR B;  3MHS C;  3CRM A;  3SYQ A;  1SA0 B;  1PP9 H;  2ZE5 A;  4YXW G;  4DUY B;  2HEP A;  2Q69 A;  4TV8 B;  3ZHV A;  1FYJ A;  3B77 A;  3K9A A;  5CA1 B;  3K3W A;  3AG1 C;  4LF6 B;  1BL8 A;  3CPW U;  4MVU A;  3CCR V;  2A3Q A;  3H1J H;  3AG4 C;  2VQF O;  1I94 B;  3G6B A;  3ZHR A;  3QO8 A;  1OCC C;  2JRI A;  3B4S A;  2FML A;  5TIS Z;  4DUZ O;  3O65 A;  1ROP A;  5IYD O;  2Y69 C;  3TK1 A;  4O2A B;  2LFR A;  1KUQ A;  3JD2 A;  2B5U A;  3H1I H;  4WCE V;  1MOF A;  4XBF A;  1TVK B;  2P4V A;  1MZF A;  5BR8 B;  2Q5Z A;  4JI6 O;  2QWP B;  3LDD A;  4UUJ C;  4JI4 O;  2W0F C;  4AI8 A;  4J7Z A;  3ABK B;  4GX0 A;  3RYH B;  5KLV H;  5KAI Z;  2CH7 A;  2HJD A;  4EB6 B;  5J9P C;  1G4Y B;  1XMQ B;  2CTW A;  4JI1 B;  4WF9 V;  4B7E A;  2Z0A A;  2FKX A;  2CTQ A;  3FFQ A;  2EX3 A;  1M4U A;  1NKD A;  4Q6G A;  2OIG A;  2HVJ C;  4HAM A;  3SYO A;  3ZJZ A;  3OUS A;  1PD3 A;  4MW3 A;  4GX5 A;  3CC7 V;  2K9P A;  4DV5 B;  4J7J A;  2H94 A;  1ZSP A;  3FB8 C;  2XAG A;  3CCQ V;  2GDS A;  4LFA B;  2OCC C;  4EEQ A;  3DC6 A;  2QR4 A;  4LFA O;  3U11 A;  1K4D C;  1WA8 B;  3WG7 C;  4DR1 B;  2GV9 A;  1G1X B;  1HP8 A;  5BZB A;  4DV2 O;  4UCT A;  4YJ3 B;  3WU2 Z;  1QVF U;  2Q6A A;  2UXD O;  2P06 A;  1K5S A;  4PV1 B;  4LF7 O;  1WB8 A;  4TWK A;  1P49 A;  2VQE B;  2WPD G;  5GON A;  4GCZ A;  2Q67 A;  2UUC B;  1SQF A;  3OUF A;  1HNX O;  1GM9 A;  2PI4 A;  3AG1 B;  3CCE V;  4LC1 A;  3K5L A;  4LCU C;  1R73 A;  5FPR A;  3BFR A;  3VOU A;  3T1H O;  1WPB A;  2JGD A;  1RSO B;  1F23 A;  4DR7 O;  3W7T A;  4XDK A;  5J2U A;  4YY3 O;  3RWR D;  4B7K A;  2Z3Y A;  3P30 A;  2Y69 B;  2ILM A;  4DXW A;  1N0J A;  2NN4 A;  4X8A A;  4P2Z A;  4WFE A;  2BTO A;  4HYO A;  2ZE6 A;  3FAV A;  3ASO B;  4PD4 F;  1JFF B;  2ZQM A;  3TJT A;  5IYC O;  3ASN C;  2QWO B;  2DJV A;  4O4J A;  3UO2 A;  1NVP B;  4NB5 A;  4FLY A;  2XAF A;  2ZR3 A;  3ABL C;  4WFG A;  3K59 A;  1TA8 A;  2DMX A;  5CA0 A;  2EIN C;  3BAA A;  4JI3 O;  5LYJ B;  2EZO A;  3K06 A;  2FL4 A;  4JYB A;  1MAB G;  3THO A;  1Z5V A;  3BAB A;  4TV9 B;  1HNX B;  3Q4H B;  3E8B A;  3W7X A;  1XMO B;  3TXQ A;  4X1Y B;  4UV9 A;  1YXB A;  2DQ3 A;  3RGB A;  1O9G A;  1NR7 A;  4H0L B;  2P5O A;  1IX9 A;  1AI6 A;  4ZOL B;  2XAS A;  1M57 C;  1DF5 A;  2JGD B;  2YXL A;  1AR5 A;  3L70 H;  1UPG A;  3F5W C;  3K0G A;  2JDI G;  3JAT A;  1PL0 A;  2OWO A;  5FL7 G;  2RQ6 A;  2F93 B;  3CME V;  2JJ1 G;  3JD1 A;  1M56 C;  4EKW A;  4DV1 B;  2PGG A;  4DK1 A;  2LGW A;  4QJF B;  3CCV V;  1H8E G;  2P7T C;  2OCH A;  2E5L B;  1VP7 A;  3E83 A;  5BMV B;  4J41 A;  2X6B A;  1SQV H;  4TV8 A;  4FLT A;  2EIM C;  2OIE A;  3WG7 B;  1BQZ A;  2EIL C;  1K73 W;  4WFF A;  1SC5 B;  3ZN1 A;  3KCY A;  3E22 B;  2XAQ A;  1B04 A;  4NXM O;  4WBN A;  3QO7 A;  5JVD B;  2FTK A;  2Y4T A;  4L8J A;  4C7U A;  1WP7 A;  2IH3 C;  4O2A A;  4MTF A;  2UU9 B;  3K04 A;  4RQE A;  2ZM6 O;  4O2B B;  4B3T B;  3JAS A;  4DV2 B;  2XTA A;  1IBM B;  1Q6H A;  3ZRX A;  2DW4 A;  4I5S A;  2PZS A;  4QGP A;  3HR0 A;  5LYJ A;  4MVM A;  5LMU O;  3D36 C;  4AIL C;  2NNU A;  2IM9 A;  4DV7 B;  1BS3 A;  3CB2 A;  3JAT B;  4B3T O;  1QLE B;  2WLJ A;  2UUA O;  3M99 B;  1HDJ A;  3ASO C;  1RPO A;  1F4N A;  4FZ1 A;  3DSQ A;  3N2G A;  1GM7 A;  1QU7 A;  1SQX H;  3ASN B;  5IE9 A;  2A7W A;  3NXS A;  2Q73 A;  4FM2 A;  3ABL B;  4UXN A;  2P90 A;  1I94 O;  2KKW A;  3E2E A;  5HFL A;  1R6K A;  4NYK A;  1S3J A;  2CDY A;  2F43 G;  5JQG A;  2ZD9 A;  1LR1 A;  1G8M A;  1GKF A;  3BVO A;  1CXZ B;  1ZLZ A;  4I4T B;  1RPR A;  5BMV A;  3OFN G;  5H9C A;  4NXN O;  1EBO A;  4FK5 C;  1E79 G;  1P84 F;  1AP5 A;  3STZ C;  5C8Y A;  3UT5 B;  2QWN B;  4X88 A;  3SYP A;  3RYC A;  3H1H H;  4R6Z A;  3K5N A;  2F23 A;  2CTR A;  3H1L H;  3RFR A;  1XMO O;  5KHH A;  1L8D A;  1TUB A;  5EZY B;  1KMI Z;  1XQ8 A;  1AB3 A;  1W2B U;  4PI0 A;  1CP9 A;  5JJJ B;  4JAA A;  4X20 A;  1N33 O;  1XDC A;  2EIM B;  2IW5 A;  4DR2 O;  3K08 A;  2EIL B;  2MW2 B;  2R70 A;  1N34 O;  3M7M X;  4K0K B;  4DR4 B;  3DXR B;  1OCR C;  4LWS A;  2CK3 G;  5ITZ A;  5L3B A;  1NT2 B;  1L0N H;  4KUM A;  5JJN B;  1YEW A;  3FAV B;  4Q20 A;  2MK3 A;  1R6N A;  2Y48 A;  1VMG A;  1THZ A;  3CHX A;  4X66 B;  5JWP A;  5J2U B;  2AW9 A;  1NTZ H;  1SQB H;  1E1R G;  3KG2 A;  2IJI A;  3ETQ A;  1AIL A;  3CCU V;  3OW2 U;  4LF8 B;  4X1I B;  1ORQ C;  3AG3 C;  3LSQ A;  3KKY A;  1XIL A;  2K1E A;  4FFB B;  3L74 H;  5LHH A;  5FNV B;  4DV6 B;  1AR4 A;  3SPC A;  2YSU B;  1CEZ A;  4DR4 O;  3JCU Z;  5EIB C;  3R65 A;  1R3K C;  1Y76 A;  1W59 A;  2P4K A;  4ZIB A;  3CCL V;  3ABM C;  3K79 A;  2IU3 A;  3EVK A;  4DO2 A;  1Q81 W;  1US6 A;  2IBZ H;  4YJ2 B;  2VQF B;  1UFI A;  2G38 A;  5LXT B;  3HKB A;  4GX2 A;  4Z2W A;  1MMM A;  5K1X A;  2DYS C;  1XNQ O;  2FB5 A;  4F6E A;  3VQY A;  1QR8 A;  4DR5 O;  4ZOL A;  1D5N A;  4PA7 A;  4FM1 A;  1VIB A;  2YC0 A;  2ZR2 A;  3OMI B;  1KEC A;  1PM9 A;  4JTD B;  5EYP B;  3L75 H;  3G4S V;  2FYU H;  3W7W A;  1R3I C;  4LFC B;  5IYB O;  4B3M O;  5B1A C;  1NZ6 A;  4TOI A;  1XNQ B;  3OTF A;  3OEH G;  1GN3 A;  2W6J G;  1BCC H;  2KSD A;  1FS0 G;  1YJ9 V;  4JTA B;  2ZNJ A;  5KHK A;  3N2K A;  2RDC A;  1S5J A;  2OCC B;  2ZM6 B;  3UCS C;  1XHZ A;  4U7N A;  1L0L H;  4UCO A;  4PA9 A;  4B3S O;  3QNE A;  2RCV A;  3ZRW B;  4RO2 A;  3TXS A;  1HR0 B;  4O4I B;  1YIJ V;  4LFC O;  2GHY A;  4N21 A;  4UCR A;  4LNU A;  4JI4 B;  4O4L A;  2XUM A;  5IYZ A;  1HW7 A;  4J9Y B;  5CA3 A;  1BHA A;  1S0V A;  2JS5 A;  2WLI A;  4UVB A;  1NTM H;  4YHH B;  2IJJ A;  2NR5 A;  2QKA A;  3H9V A;  2R72 A;  2CTP A;  2LO1 A;  4MVQ A;  4DRX A;  5KUK A;  4UCU A;  3OE7 G;  4JAS A;  1T5E A;  4KP4 A;  1WJZ A;  1ZWI C;  5JH7 B;  3S3W A;  1I08 A;  3ZRS A;  1VQ8 V;  4X62 O;  4MTO A;  3E22 A;  3SJA C;  1SZT A;  1R1B A;  3EFF K;  3X2Q B;  4DV0 O;  2GTA A;  3OR6 C;  4RQF A;  1K34 A;  5B1O A;  2HG5 C;  3LNN A;  1NR1 A;  1SQP H;  3CRA A;  4QIW F;  5CBG A;  4IHJ B;  3ETG A;  1GN4 A;  5IWA O;  2ITC C;  4ZBM A;  1IBK B;  4JYC A;  4XDJ A;  3N2K B;  1M90 W;  3BHP A;  4R8C A;  3BPZ A;  4L87 A;  1JX9 A;  3HKE B;  2WLH A;  4JI6 B;  3I55 V;  5IT9 N;  1VQO V;  3ZN0 A;  2LW7 A;  4JI2 B;  2M7W A;  2OT5 A;  4DV3 B;  4J11 A;  4DR6 O;  5J2T A;  1TGO A;  4JAU A;  3K0D A;  1I7F A;  4E2L A;  2EJ7 A;  1TUB B;  1M57 B;  4K0K O;  5KAF Z;  5B66 Z;  4I7Z B;  4BAY A;  5B1A B;  4J42 A;  5EBL C;  3ZBH A;  3D3Q A;  3MHH C;  1V55 B;  1SA0 A;  2B1G A;  1M56 B;  3OR7 C;  4I9W A;  4JGS A;  3SGI A;  1SET A;  2VQE O;  2W0X A;  5B1B B;  4NR1 A;  2KQX A;  2XND G;  1TUE B;  4ZI7 B;  2WLN A;  2ZKO A;  4DR3 B;  2OTJ V;  4KHP O;  3A8T A;  4MTX A;  1TVK A;  4BW5 A;  3ZMZ A;  2YI8 A;  4B3S B;  3LSU A;  3OD4 A;  3JAK A;  2EJR A;  5LMU B;  3I5D A;  1PNK A;  1FJG O;  3CCS V;  1FXH A;  1H2N A;  3AK3 A;  4JI8 O;  1SQG A;  1M9N A;  3J80 N;  4OX9 B;  1U97 A;  1SRY A;  1VQN V;  2EZP A;  2JJ2 G;  2LGQ A;  1S77 D;  5L3G A;  1QR9 A;  4XDL A;  1XNR O;  3SR2 C;  3UO3 A;  1I5Y A;  4FFB A;  1YHQ V;  1L1F A;  4UVC A;  5L3D A;  2CH7 B;  4J9Z B;  2IJH A;  1OJH A;  1UJW B;  3JD3 A;  5J2T B;  4W4L A;  3CRR A;  2ZIN A;  4A5U B;  2IH1 C;  3J81 N;  4ZI7 A;  1N36 O;  4LR3 A;  4CS4 A;  5KHG A;  4CBC A;  1GK9 A;  2X0L A;  1ZL8 B;  5JVD A;  3PJS K;  1X59 A;  2RN9 A;  3JD4 A;  4U3J B;  4MS2 A;  3IJ4 A;  1FXK C;  4PHZ A;  4GLX A;  4TUY B;  4I9Q A;  4JI8 B;  1X4T A;  4DV6 O;  1AVM A;  1QHT A;  1NI8 A;  1K8A W;  1XEQ A;  3CD6 V;  4TQD A;  2RMK B;  4B3R B;  4ZKI A;  2PTM A;  1VQP V;  4GKJ B;  2E75 B;  3HB3 B;  1JA8 A;  1YSC A;  4WFH A;  2Q9L A;  5D5Q A;  4AQY B;  5JCO C;  2QTO A;  1Y4M A;  1QLN A;  5GTH Z;  1RFY A;  2HHH O;  2QGN A;  5GON B;  5H6Q A;  2VS0 A;  1KYO F;  5LHI A;  4F4L A;  3DTU B;  4G28 B;  3VQW A;  4YJ3 A;  2WSS G;  5KMG A;  2HP8 A;  3CC4 V;  4JI1 O;  1K7D A;  1ZTE A;  5IDJ A;  2QKC A;  3SYA A;  5IJ9 B;  3HKC A;  2ZCE A;  3BRC A;  1HNZ B;  2O57 A;  3JYC A;  3W7U A;  1J5E B;  1H2K A;  5CA1 A;  4O4L B;  1ZAU A;  1IXM A;  4NTW A;  1VF6 C;  5F2V O;  4G27 B;  1VQ9 V;  5LP6 B;  2JEU A;  4FLU A;  1GO3 F;  3CJH B;  4LFB B;  2QDO A;  1OHH G;  3OAA G;  4DR5 B;  3WFV A;  2BTQ A;  4IIJ B;  4PA3 A;  1IBK O;  1PKX A;  5KUM A;  1XOU A;  4TT3 G;  4UCS A;  1PL4 A;  2GSM B;  4YY3 B;  4PDV A;  2PY5 A;  1Q3E A;  3HPL C;  4IHJ A;  5DN6 G;  4GKK O;  3AK2 A;  1KBH A;  1VQL V;  4GZR B;  2LFS A;  2WA3 A;  1SS3 A;  2HJF C;  2V7Q G;  4P9P A;  5FLX N;  3S3X A;  3AG3 B;  2YID A;  4LF4 B;  2PI5 A;  1KU9 A;  2R9A A;  3K5O A;  3CP1 A;  1FPO A;  3MDS A;  3CS5 A;  4X20 B;  1WB7 A;  5AG2 A;  2P6J A;  2DN9 A;  1AJP A;  4I50 A;  5KHI A;  2W6I G;  1FFT B;  3JD0 A;  2EIJ C;  1U96 A;  4TSF G;  1GAX A;  3RYI B;  5EK0 A;  3ABM B;  3QVN A;  2LP7 A;  2UUB O;  3CSX A;  3AG7 A;  1FXK B;  4JPR A;  4DK0 A;  5LGT A;  5IJ0 B;  3FYE B;  1N0N A;  2DYS B;  4DV0 B;  4FPP A;  4DV3 O;  2QTS A;  4JI0 B;  5LGN A;  2ZE7 A;  2PF4 E;  1EN6 A;  5JJE B;  2EBO A;  4NXN B;  3WB0 A;  1Q7Y W;  2LQT A;  4X65 B;  2YIB A;  4DR6 B;  1BMF G;  3IFX A;  3VQX A;  2PUS A;  4DR1 O;  1M1K W;  4GT1 A;  3C90 A;  1Q82 W;  2LJ2 A;  2ZIO A;  2RNB A;  4K3A A;  2UXC O;  3G6E V;  5GTI Z;  3JAK B;  4JV5 B;  3RBZ A;  4PDL A;  5KA5 A;  2DOS A;  1D5A A;  2ZXW C;  1OZ0 A;  1IUR A;  4QE9 A;  3SYC A;  5LOV A;  1N32 O;  4O4J B;  4DW0 A;  1P7B A;  4HNA A;  4DV5 O;  3L72 H;  2H8P C;  2ADQ B;  3GB7 C;  4MVR A;  1N34 B;  5LP6 C;  2YXH A;  4FM0 A;  1JR9 A;  3L71 H;  2B1I A;  1EZV H;  3RT3 C;  4ZHQ B;  5LBQ A;  4I50 B;  3N2G B;  3KCX A;  3OT7 A;  4JYA B;  2UUC O;  3SDL A;  4DUZ B;  4LH7 A;  2JIZ G;  1KQS U;  5EYP A;  1XMQ O;  2UXC B;  4PDM A;  1K4C C;  3M8A A;  1DTO A;  1R3L C;  2KG7 A;  5A2Q N;  1R6T A;  3BCC H;  1K5Q A;  1XL6 A;  1RSO A;  4JF3 A;  5IY5 C;  1Q5O A;  1VEW A;  1VQ7 V;  2ADP A;  4MVS A;  5E79 Z;  3ETD A;  1COW G;  2BCC H;  2QM7 A;  3CWB H;  3X2Q C;  4R50 A;  2VRZ A;  5L3C A;  1EM1 A;  2UUB B;  4J80 A;  1DGS A;  5L3E A;  1G6U A;  3LDC A;  4CH3 A;  4JTC B;  1I5X A;  2HKO A;  4LF5 B;  3LUT B;  2HVK C;  4LF5 O;  1IBL B;  2A79 B;  3L9D A;  5JCO A;  3ZED A;  4LF6 O;  1GMG A;  5H2F Z;  3JAR B;  5IYZ B;  3OM3 B;  5KA6 A;  1LUV A;  3SJB C;  3TGU H;  3KZI Z;  3SPH A;  3T1Y B;  1VQM V;  3B2E E;  1NJI W;  4EB6 A;  4DR3 O;  2YIC A;  4ZHQ A;  4JZG A;  2C2A A;  1SQQ H;  2DWE C;  5IJ9 A;  2X7R B;  4B3R O;  2UUA B;  4LBE C;  4FMT A;  1NH2 D;  1XL4 A;  1IVS A;  2F4V O;  1JPX A;  4YIO A;  2Y0P A;  3IC7 A;  3CRQ A;  2WLL B;  3T1C A;  4NTY A;  1Y67 A;  1AI5 A;  4KL1 A;  5GW7 A;  1EN5 A;  2X6C A;  2F95 B;  4OX9 O;  1V55 C;  3NR7 A;  3PN1 A;  3G80 A;  3FD9 A;  1VQ6 V;  4YHH O;  3GWK C;  2N04 A;  1WLE A;  2ZDI A;  4FZ0 A;  2CE4 A;  2F1M A;  1XI1 A;  5H5N A;  2Y0I A;  3JCZ A;  5B1B C;  3P32 A;  3T4D A;  1HR0 O;  4B08 A;  5LOV B;  4O2B A;  4JV5 O;  1Q6U A;  4JYA O;  4NXM B;  1XHX A;  4AHC A;  5CB4 A;  1EN4 A;  3JAR A;  2EIK B;  3ZS8 C;  4X64 B;  3OTO O;  4PDR A;  1Y76 B;  3OTO B;  3T1H B;  4DYL A;  2UXX A;  4RUF A;  1URF A;  4UB8 Z;  1Q43 A;  4B3M B;  1H2L A;  3CX5 F;  3E35 A;  2BSK A;  1MG1 A;  3J7A U;  3F7V C;  3ICX A;  3EHB B;  3UT5 A;  5C8Y B;  4UCV A;  3E86 A;  4IL6 Z;  4BR6 A;  2ZNI A;  4YJ2 A;  2HFE C;  1B06 A;  5IY5 B;  1N32 B;  4U7O A;  2YIB D;  4BWA A;  1YCI A;  2WLL A;  3ML0 A;  1JOY A;  4P9O A;  4GUN A;  3CYO A;  1BSM A;  2BTQ B;  4QPJ A;  3FB5 C;  3FB7 C;  4I0X B;  5CBH A;  2UXN A;  4DR7 B;  4X9Q A;  1HNZ O;  1B6Q A;  1FAF A;  1WP8 A;  4H33 A;  3ABU A;  3L73 H;  5DED A;  1MSD A;  1YTF B;  1FD9 A;  2QE7 G;  1KP3 A;  4LFB O;  3ZMT A;  4JI7 B;  1KD1 W;  4DV1 O;  2PYJ A;  3DGE A;  2QM4 A;  3ABT A;  4DW1 A;  1B3Q A;  3APO A;  4RWU A;  4LWS B;  5LHG A;  2H3O A;  4FLX A;  4R7C A;  1HNW O;  3LNM B;  3A0R A;  3RYF B;  1K97 A;  2UXB O;  3ZX6 A;  3IC9 A;  4IT5 A;  1QBZ A;  1KC8 W;  3CMA V;  1WN7 A;  4LNU B;  1SES A;  5B3S B;  1Q90 D;  3G71 V;  3CXC U;  3QG5 A;  5B1N A;  2Q7H A;  3BA9 A;  2ZIM A;  1N4C A;  1BE3 H;  1JQ0 A;  1R3J C;  4DV7 O;  2ETN A;  1JCH A;  3BEH A;  1OCZ B;  1IBL O;  2AZ0 A;  1FFX A;  2ITD C;  1ZX3 A;  3AK1 A;  1V54 C;  4JZ2 A;  4O4H B;  2HLD G;  5HFM A;  1Q8I A;  2DQ0 A;  3CE2 A;  3F5T A;  4ASU G;  2JVD A;  4UV8 A;  3SPG A;  4G2K A;  2IU0 A;  4RAI A;  2BSK B;  1JJO A;  3JAL B;  2ODM A;  5K1P A;  5CBF A;  2JS3 A;  1OCO B;  2UU9 O;  2N74 A;  1F4M A;  3HKC B;  2YI9 A;  1KKD A;  4NTX A;  3ZCC A;  2ARH A;  1F7Y A;  5EC2 C;  4H13 B;  2EIK C;  1N36 B;  2AHY A;  1GTO A;  4E4E A;  4BIO A;  3QTC A;  1H2M A;  3FKS G;  3CEI A;  2XOK G;  4BIZ A;  5LL6 Y;  5CN0 A;  2YEV B;  4MVO A;  2BE3 A;  1NH2 B;  1F51 A;  3UQ8 A;  4EFB A;  2WA4 A;  3HKE A;  4HNA B;  2JK5 C;  3WB1 A;  4MTG A;  4KXR A;  2Q68 A;  4J10 A;  4JI2 O;  1P4R A;  1XNR B;  3JSL A;  4FFK A;  3RN4 A;  3K58 A;  3RYH A;  3QF7 A;  4J7K A;  1OV9 A;  4OGQ B;  3CRC A;  3B40 A;  3ZHQ A;  2YUA A;  1N33 B;  4MT8 A;  3A0H Z;  4X1I A;  5LMN O;  4HBN A;  1NQT A;  4X66 O;  4PEL A;  5LA6 B;  1E1Q G;  1NS1 A;  5LGU A;  1K9M W;  3JAS B;  2A0L A;  4CH4 A;  3JAL A;  4Z1M G;  4H37 A;  3U0Z A;  3LSS A;  2EIJ B;  2HHH B;  2D3O W;  3E8F A;  3K57 A;  3CJH A;  3E8H A;  2Q0O C;  1XRE A;  4F6R B;  1EZJ A;  4BW9 A;  1J5E O;  2Z5U A;  1MZE A;  2OTL V;  4IIJ A;  4IGG A;  1YJN V;  4GKK B;  4GYC B;  2WLI B;  3TET A;  2Y4U A;  2B9Z A;  4QPK A;  4UVA A;  1YIT V;  1YDX A;  4PA6 A;  3ZHU A;  3MD0 A;  4UB6 Z;  5B3S C;  1QQC A;  4RUE A;  2JGU A;  4JI5 B;  3SPJ A;  2YEV A;  1MNG A;  3RW0 A;  5H6R A;  3P3P A;  3K5M A;  4GX1 A;  3RVY A;  2AHZ A;  1QCE A;  3ZMV A;  4QNH B;  3SPI A;  4FLZ A;  2GTS A;  1AP6 A;  1FJG B;  1GN2 A;  1YZB A;  2L6L A;  1V54 B;  2LW1 A;  3FX7 A;  1Q6I A;  4KHP B;  4JI5 O;  5EZY A;  1XUQ A;  2E74 B;  4JYY A;  5CA0 B;  3ZRV A;  4CC6 A;  3GWO A;  4LP8 A;  4I55 B;  4YIP A;  2ZXW B;  2WLK A;  3TCU A;  2ATK C;  3T4Z A;  1OCO C;  5BY1 A;  3I56 V;  1Z2G A;  1Y66 A;  4TV9 A;  3RYC B;  1O9H A;  1DK1 A;  1RP3 B;  2QEX V;  4X62 B;  1Y74 A;  1P7G A;  2Q0A A;  4PI2 A;  2GUZ A;  1VF6 A;  1K92 A;  1Q86 W;  5LA6 A;  4FVM A;  3VBB A;  5JQG B;  1KKC A;  4PJ0 Z;  3JAW A;  3B8N A;  4Z1V A;  3H1K H;  4TUY A;  1SF9 A;  2QJ1 A;  1JJ2 U;  3FYI B;  4FJC C;  2D2C B;  3D3I A;  2X6A A;  2AGA A;  3ETE A;  3O9O A;  1BGY H;  2Q8V A;  4HZ3 A;  4LF9 B;  4DUY O;  5CB4 B;  1BHB A;  4D7S A;  3OGI B;  1I0H A;  1S5H C;  3ZHS A;  3OEE G;  4WBN B;  3D36 A;  1NTK H;  2KB1 A;  1W0J G;  1IXB A;  3F7Y C;  3RYF A;  1QNM A;  2QKS A;  4WFB V;  4MW8 A;  5C93 A;  1M93 A;  3CCJ V;  1MSW D;  3D8C A;  2ZT9 B;  2QWQ B;  3OMN B;  3HKD A;  4ICG A;  3R66 A;  1FFX B;  5KX5 A;  3ABK C;  4DV4 O;  2UXD B;  2NLJ C;  1QVG U;  2HR3 A;  2GBO A;  1S5L Z;  2N05 A;  2A06 H;  4I0X A;  3U10 A;  1WNS A;  2VWK A;  1DF4 A;  4JI0 O;  5LXT A;  5FNV A;  2XHB A;  2VWJ A;  4KFM A;  1SKV A;  1IZ3 A;  1AI7 A;  1AJN A;  1YTF D;  1JVM A;  3P3N A;  5IWA B;  2KG7 B;  4ABM A;  1A32 A;  3SJQ C;  4D6T H;  1PNM A;  2CGN A;  3LDE A;  1GM8 A;  2QM8 A;  2AZ2 A;  2PYL A;  1W0K G;  3H01 A;  1YF2 A;  1VQK V;  1GRJ A;  1J95 A;  5EC1 C;  1M5I A;  4P30 A;  2R9I A;  2QA4 V;  3CCM V;  1HNW B;  3JAW B;  2DYR B;  2ZDI C;  4K8Z A;  5L3F A;  2QWR B;  4PA4 A;  1H2G A;  1H2S B;  3OGC C;  2YDE A;  1WAZ A;  2R9R B;  1JMK C;  3JAM N;  4OPH A;  3C3T A;  2F4V B;  4I4T A;  4WFA V;  3ZIA G;  1ENV A;  3RYI A;  1WPX A;  3WB2 A;  2CAZ C;  4X65 O;  1H8H G;  2DE0 X;  3SJC C;  3CC2 V;  2CUG A;  2WLM A;  3BA8 A;  4FLV A;  5JH7 A;  5IJ0 A;  4W4K A;  1XBL A;  1PV0 A;  3STL C;  1ZL8 A;  4JAV A;  4JI7 O;  5B5E Z;  2DWD C;  4LF9 O;  4DRX B;  1VQ4 V;  4LF4 O;  2P22 C;  4N23 A;  4NKG B;  4CS2 A;  4X89 A;  4K35 A;  2E3C A;  5LP6 A;  4O4I A;  4FLW A;  2EIN B;  3CXH F;  1LNQ A;  3N27 A;  5A9G A;  2V1D A;  4X1K B;  2E76 B;  2YXY A;  1H38 A;  4GKJ O;  5DM6 V;  4D7T A;  4UFZ A;  2BOB C;  2M6Y A;  2P67 A;  1VF5 B;  5D5P A;  4CZZ A;  5BXZ A;  4IYH A;  1WA8 A;  3UKM A;  2ZE8 A;  1Y6X A;  4OPA A;  1N8R W;  3OMA B;  5LMN B;  1OCZ C;  4F6R A;  3DXR A;  4OXS A;  2Q4P A;  3IGA C;  2F66 C;  4I55 A;  5KHJ A;  2YS8 A;  2DYR C;  5KMG B;  4LF7 B;  2AXT Z;  5E1A C;  4NVP A;  1NBM G;  3G67 A;  3BY6 A;  3A2F A;  3UM7 A;  1EFR G;  1BT8 A;  4EFE A;  1YJW V;  3AEI A;  4MVZ A;  1RM1 B;  1V9P A;  3T2M A;  3AG2 C;  1S76 D;  4BIU A;  1SZX A;  2E5L O;  2CGO A;  2XAJ A;  2RJZ A;  1IDS A;  5BR8 O;  1VF7 A;  3EXA A;  5EBM C;  1PNL A;  2WWW A;  1GH6 A;  1Y74 B;  2YIA A;  4DR2 B;  2XT9 A;  4O4H A;  1NU1 H;  3E8G A;  5KX5 B;  1GN6 A;  3AG4 B;  5EBW C;  1OCC B;  3QO5 A;  1S72 V;  1AI4 A;  1LUW A;  3HKB B;  3APQ A;  1KB9 F;  1PPJ H;  1SER A;  3B8M A;  2V4D A;  1QLE C;  3JSN A;  2EUL A;  1YI2 V;  4H44 B;  2OYQ A;  3GVM A;  4X64 O;  3C3S A;  1FKA O;  5EIB D;  1CPY A;  1MA1 A;  3K03 A;  4QE7 A;  2A9H A;  1JFF A;  4DV4 B;  1K33 A;  1TAE A;  2QSA A;  1FXK A;  3W7S A;  4K8X A;  2BOC C;  3ZHT A;  2L35 A;  1YVW A;  3K9S A;  2IJK A;  4U3F H;  1BZK A;  3FB6 C;  2WAM A;  2Q7E A;  4CH6 A;  1ZUQ A;  4X1K A;  1KP2 A;  5ITZ B;  1ARO P;  5FPO A;  2Q7G A;  4LH6 A;  1DLB A;  3A0B Z; 
#chains in the Genus database with same CATH homology
 4YY3 O;  4X65 O;  4DR2 O;  4YHH O;  4B3M O;  4A5U B;  2ZM6 O;  5IT9 N;  5H5N A;  4AQY O;  3J81 N;  4GKK O;  1N34 O;  2LW7 A;  3RT3 C;  4LF8 O;  4DV7 O;  1N36 O;  4DR6 O;  1J5E O;  2Z0A A;  2FKX A;  2UUC O;  5FLX N;  3SDL A;  1HR0 O;  1X59 A;  1IBL O;  5LMU O;  2DJV A;  3T1Y O;  4JV5 O;  4JYA O;  4B3S O;  2E5L O;  1XMQ O;  4K0K O;  4DV6 O;  3F5T A;  3M8A A;  4JI3 O;  5A2Q N;  3OTO O;  4B3T O;  1R6T A;  1XEQ A;  1IBM O;  2UUA O;  5BR8 O;  3R66 A;  4JI7 O;  4LFC O;  4DV4 O;  1D2D A;  4LF9 O;  2UU9 O;  2N74 A;  2VQE O;  1YZB A;  2UUB O;  4LF4 O;  4JI0 O;  2HHH O;  3J7A U;  1F7Y A;  1AIL A;  4JI5 O;  2ZKO A;  1I94 O;  4LFA O;  4KHP O;  4DV3 O;  1A32 A;  1FYJ A;  4LF5 O;  5BY1 A;  4X62 O;  4LF6 O;  5LL6 Y;  1DK1 A;  1G1X B;  4JI1 O;  4DR4 O;  4DR1 O;  4NXN O;  4GKJ O;  1HNZ O;  4DV2 O;  1R1B A;  4X64 O;  1FJG O;  2VQF O;  4DR3 O;  1FKA O;  4JI8 O;  2UXC O;  4DV0 O;  2UXD O;  3J80 N;  2JRI A;  4LF7 O;  4JI2 O;  4DUZ O;  5BXZ A;  3O65 A;  4LFB O;  4B3R O;  4DV1 O;  1XMO O;  1XNQ O;  4OPA A;  1KUQ A;  1XNR O;  1HNX O;  2DOS A;  5LMN O;  4DR5 O;  2F4V O;  4NXM O;  3JAM N;  4X66 O;  3T1H O;  1IBK O;  1HNW O;  1NS1 A;  1AB3 A;  1N32 O;  4OPH A;  4JI6 O;  2UXB O;  2AGA A;  5IWA O;  4DR7 O;  4DV5 O;  4JI4 O;  4OX9 O;  1N33 O;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...