2UXBO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxbO00
4DUYO 1HNZO 2E5LO 4DR6O 3R66A 1XMQO 2UXBO 4LF7O 5LMUO 4OX9O 1AB3A 1DK1A 3T1HO 4NXNO 1R6TA 5IT9N 4JI0O 4DV4O 1J5EO 2LW7A 2VQEO 1IBKO 4DR4O 3J7AU 4B3RO 4X64O 4JI2O 4JI4O 4GKJO 4OPHA 4X65O 5BY1A 1XNRO 3F5TA 4DR1O 4X62O 5A2QN 4DV7O 1IBLO 2Z0AA 4LF6O 4JI1O 3O65A 4LFAO 2ZKOA 4DV5O 1IBMO 4JI6O 4KHPO 2VQFO 4DV1O 4LFCO 5IWAO 1NS1A 2DJVA 2F4VO 1I94O 4YHHO 4JI8O 3J81N 3M8AA 5LMNO 1F7YA 1X59A 4DUZO 5BXZA 5H5NA 3JAMN 4DR5O 4B3SO 5LL6Y 4LFBO 4DR2O 5BR8O 4B3MO 4GKKO 4LF5O 4JI7O 4JI5O 4B3TO 4JYAO 4OPAA 4K0KO 1N36O 1FYJA 2HHHO 1KUQA 1FKAO 3SDLA 4X66O 1XMOO 4LF9O 5FLXN 4DV6O 1XNQO 4DV3O 2UXCO 2AGAA 4YY3O 2UU9O 1N32O 3J80N 2UUBO 2FKXA 2UUAO 4AQYO 1AILA 3OTOO 4JI3O 1D2DA 1R1BA 1G1XB 4LF8O 4NXMO 4A5UB 1N34O 1HNWO 4DV2O 1YZBA 2JRIA 1A32A 1HNXO 2DOSA 4DV0O 1FJGO 2UXDO 4LF4O 1N33O 4JV5O 1XEQA 4DR3O 2UUCO 2N74A 3RT3C 1HR0O 2ZM6O 4DR7O 3T1YO
chains in the Genus database with same CATH superfamily
1I94B 2Q68A 1E1RG 4K8XA 3HKBB 2R70A 4O4LB 2EILB 4IT5A 3CCSV 2YIBA 1CP9A 4BIUA 2K1EA 3ZIAG 2LP7A 1Y4MA 5IYBO 4DRXB 3ETGA 5C93A 4R8CA 1OCRC 4DV1B 4JI1O 3ASNB 4BIZA 4YJ2A 2QTSA 3GB7C 3T1CA 3QF7A 4JI6O 3K9SA 1K3EA 3VQXA 1GM8A 4LFCO 4CH5A 1PKXA 3C90A 3HKEA 1M4UA 4WFEA 2ZR3A 3CRAA 2QA4V 4GCZA 4JI5B 4RQFA 5KHHA 1MZFA 1U97A 2IJKA 3GVMA 3ZHTA 1EZVH 4FVMA 2Q7GA 1JCHA 4OPAA 4K0KO 2IBZH 4FPPA 5KHIA 3F5WC 2ZXWB 4U3FH 3SDLA 1K4CC 4Z1VA 2XASA 5LGUA 1RPOA 1V54C 1R73A 2ZCEA 4CZZA 2FL4A 3G6BA 3Q4HA 1BGYH 1N34B 1KP3A 1Y6XA 1KKDA 2HP8A 1EN6A 1YJ9V 1R1BA 4NXMO 4UB6Z 1YZBA 4TQDA 1QQCA 1QR8A 4XDLA 3ETEA 4PJ0Z 5LYJB 4JI1B 3OAAG 4WF9V 3K58A 1FXVA 3ABKC 4DR6B 2WPDG 4D7SA 1I7FA 5LHGA 1M9NA 2QEXV 3W7WA 3OMNB 1WB8A 4YJ3B 1GN4A 4OX9O 5B1AB 4NXNO 1L1FA 3I56V 4ZBMA 1NQTA 1PM9A 4H44B 4DV4O 1GMGA 4PA6A 1VQ5V 1BL8A 3J7AU 2DWDC 4RUFA 1AR5A 1XNRO 5JH7B 1GN6A 2NR5A 1R3IC 3OE7G 4K3AA 3K04A 4R6ZA 1TVKA 2VQFB 3ZRSA 3O9OA 3MAQA 1JX9A 3QO7A 4O4HB 5FPOA 2KSDA 3JATB 4TQFA 3N2KB 2EINC 4BAYA 3ZHSA 4PELA 3HKDB 5EBWC 3T4ZA 4DUZO 1K73W 4UV9A 3RYFB 3L74H 4DR5O 1NBMG 4J41A 4LCUC 4H0LB 1KD1W 3TXSA 2RDCA 5CA0A 2XTAA 5K1XA 3OEEG 1VQKV 4KP4A 3U11A 5EC2C 3IGAC 1VQ6V 2PYLA 2BOBC 2EIMB 3J80N 3QTCA 3CCMV 3ZHQA 4IIJA 4NXNB 2ADPA 4QGPA 5KA6A 1QR9A 3FB5C 1SA0A 2ZNIA 3STLC 1XNRB 4C7UA 1EFRG 4FZ1A 3CCEV 1K5SA 3CCQV 3B8MA 1S5LZ 3EXAA 2QSAA 1H2GA 1P49A 3CHXA 5J2TA 2PY5A 4E4EA 3RBZA 1XMQO 2UXBO 1I5YA 1Z5WA 4DUZB 1F23A 3JATA 1JFFB 5JJJB 3UT5B 4DR5B 2ITDC 1YHQV 4NVPA 1ZSPA 1SQFA 3RYFA 2GV9A 5JWPA 4QJFB 4FM2A 4F6EA 2BSKB 1XL4A 3E35A 3ASOC 4XDKA 4MTOA 4QE7A 2GTAA 3JARB 1SQXH 4LFAO 3JASA 1E79G 4UCUA 4UUJC 4O2BB 4IYHA 3TGUH 2F66C 4J11A 3W7UA 2F4VO 3RYIB 1GM7A 4MTXA 3IAYA 4GKKB 1L0LH 3BRCA 1NH2D 3A0BZ 2MW2B 4OGQB 5KLVH 1NVPD 2W0XA 3LNNA 4DV3O 1H2KA 2K9PA 3CJHB 1XMQB 5JJEB 3FB7C 1SQPH 3N2GB 3E22A 4WFBV 4AQYO 2RQ6A 3CE2A 4LF8O 3QO8A 1QVFU 1DF4A 2D3OW 1QHTA 2DOSA 1QLEB 1K92A 2IJJA 5BMVB 1WP8A 1PL4A 1JVMA 1TUBA 4CC6A 2HVKC 4NTXA 1B04A 4LFAB 3ML0A 3U10A 3OUSA 1Q6HA 2DYSB 2ZM6O 1VARA 2Y69C 2LFRA 2D2CB 2PUSA 4R50A 4J9YB 2P5OA 1E1QG 1V9PA 2RN9A 5E79Z 4JI2B 3RGBA 1Q43A 4PDLA 4NTWA 3ZN1A 3RYIA 1R3LC 1PNMA 4LNUB 2Q67A 4JI4O 3SJAC 3P30A 4NR1A 4X1IB 1FD9A 1VF5B 2ZKOA 1AROP 4DV3B 4DV5O 1NZ6A 3BAAA 3NXSA 4JI8O 2OT5A 4PD4F 1S72V 3THOA 3ZX6A 2HR3A 3D8CA 3E86A 3E8FA 3IC9A 4R7CA 4J42A 3JAMN 4HZ3A 1S5JA 2RCVA 1SERA 4X20A 1UPGA 1XDCA 3OD4A 5CB4B 3E8BA 4EFEA 1RFYA 3CCVV 2CDYA 4X66O 3ABUA 2ZM6B 5FLXN 1AP5A 2V4DA 3X2QC 1OCCC 4CH3A 2O57A 2VWJA 1PNLA 1SQBH 1QNMA 1IURA 1J95A 5GTIZ 4AHCA 2QWPB 3E89A 5LA6A 4Q20A 2DYRC 2UXDO 1BMFG 1XEQA 3E83A 5LGTA 1K34A 2YIBD 4X1YA 1YTFD 4FJCC 2XAQA 3ZRWA 1K7DA 3K03A 4DK0A 4X1IA 1M56C 4JI0B 4ZHQB 5L3DA 2CTRA 1VF7A 2VQEB 4JI8B 4DW0A 4KL1A 2KB1A 4X88A 4FZ0A 1GTOA 1IBKO 3ABMC 4X64O 4UCTA 3M7MX 4XDJA 2DW4A 1V55B 1S3JA 3GWKC 1H38A 4FM1A 3FAVA 3DGEA 2PZSA 1SETA 1M1KW 1TA8A 2YEVB 3AK3A 1IVSA 3B40A 5IYZB 2JS3A 2HG5C 2EIKC 4JZ2A 5JQGB 3M8AA 1F7YA 1MZEA 1XL6A 5DN6G 4UB8Z 4DK1A 1WA8B 2YXHA 3W7XA 1K5QA 2IJHA 3HKCA 4F6RB 5CA1A 5IJ0B 5BR8O 1XI1A 4B7KA 3WB2A 3K08A 4J9ZB 2BOCC 2YIDA 4JI7O 2UXCB 1OCZC 1RPRA 2YS8A 1G8MA 4JASA 2B9ZA 1KYOF 4I0XB 3QNEA 1N36O 1KUQA 1W0KG 1K8AW 1GO3F 5JVDB 3TJTA 3FYIB 1FAFA 4JYCA 5KAIZ 2CUGA 3AG2C 4PA3A 2JIZG 3K5MA 1YJNV 2E3CA 3OM3B 3CCLV 2R9AA 2GHYA 4UV8A 1KECA 1Y76B 2Z5UA 3MD0A 4ZHQA 3OGCC 2X6AA 4JI3O 1G1XB 3LNMB 1VP7A 5EIBD 1HNXO 1GN2A 1H8EG 3ABLB 3RW0A 1MSDA 1TUEB 3EVKA 3CYOA 2QE7G 3WB1A 3OGIB 1K97A 2Q69A 3RYCB 3K3WA 4KUMA 1GN3A 3SYCA 4UXNA 2LW7A 4HYOA 5IJ9A 2WLMA 1VQ9V 5BR8B 1N8RW 4GKJO 1M5IA 3H1JH 4N23A 1WA8A 4JI7B 1F51A 4DR1O 2WA3A 4CS4A 2OCCB 4F6RA 1N36B 4LF6O 5HFLA 3O65A 1G6UA 3TCUA 1XREA 1S77D 3W7SA 2JGDA 1EN4A 4KHPO 4O4IA 5FNVA 2NNUA 1UJWB 3RN4A 2XNDG 2E76B 4JI3B 5B1BB 3P32A 2XAFA 1H2LA 5AG2A 4ZKIA 3K5NA 1HNXB 4DR2O 1Y67A 4I4TB 4B3MO 5C8YA 2DN9A 5ITZB 4JYAO 2AHZA 3A0HZ 5KX5A 5B3SC 2EIJC 3AG4B 4I50B 4LF9O 2QR4A 5F2VO 1AP6A 1G4YB 4XBFA 2X6CA 2Q0OC 2AGAA 2DE0X 3BCCH 2AZ2A 4MVSA 2NN4A 4B7EA 4UCRA 2OTJV 1WP7A 2JJ1G 5GONA 3RVYA 3CC4V 3A0RA 3TETA 2XHBA 3RYCA 1HNWO 4CH6A 3F7VC 5LXTA 4GKJB 3DTUB 4DV0O 1VQNV 4EFBA 5EYPB 2GUZB 1N33O 4JV5O 2DWEC 4P2ZA 3H9VA 3CC7V 4DR3O 4KHPB 3FKSG 5IYDO 5J2UA 2ZIMA 1XHZA 3ZHVA 1VQ8V 1PNKA 1VQPV 1WPBA 4H33A 3HKBA 4O4LA 1CPYA 3ZMTA 4DR2B 4B3MB 4RAIA 3B77A 4CS2A 2AHYA 2VRZA 1DTOA 4HAMA 4LC1A 2FTKA 4DRXA 3ZMSA 4JI6B 5KHGA 2ZE7A 3M99B 4LFCB 3SYAA 4CBCA 3D3QA 4DW1A 1CEZA 1L8DA 2Q9LA 2ITCC 4GX1A 3DC5A 4I50A 1P7BA 4X89A 5CMUA 3WFVA 1MABG 3VQWA 1Y74B 4PA9A 3FD9A 2WA4A 1WLEA 4ZOLB 1RM1B 1HNWB 5L3EA 1Q90D 3K06A 4K0KB 2Q4PA 1JPXA 4DV0B 2YSUB 3SYOA 3I55V 3SPJA 4JV5B 3A8TA 2IJIA 3LDDA 4DR3B 3SJBC 2MK3A 3P3PA 4RQEA 1CXZB 2KG7B 1Q82W 1YVWA 4JF3A 4LR3A 2UU9O 2BTOA 1N32O 4NXMB 2FKXA 1VIBA 2EILC 3T2MA 3JD4A 5HFMA 3E8HA 3KG2A 2XAHA 1GK9A 1ZLZA 1R3KC 5BZBA 4X8AA 1BZKA 5LYJA 3ASNC 5KMGB 1YCIA 4HBNA 5EIBC 3K5LA 3BA8A 2Q8VA 3RT3C 1GAXA 4OX9B 2Y4UA 1K9MW 4DV4B 1AI4A 3E2EA 4J80A 2W6JG 4YJ3A 4X1KB 4ZIBA 2ODMA 3JD3A 4Z1MG 4YIPA 3ICXA 1ZX3A 5FPRA 1SS3A 1ZWIC 5LOVB 5JH7A 3RYHB 2R9IA 1RSOB 2ZXWC 5H6RA 4FLYA 2IM9A 4O4JB 4WFHA 1OV9A 3CRCA 4O4HA 3AG1B 1LUWA 3N2KA 3PN1A 1HDJA 3HKDA 2F43G 2DMXA 1GH6A 2CGOA 3H01A 4P30A 2Q0AA 4WFAV 2OIGA 4MW8A 2EX3A 1EM1A 2QWOB 4LF5O 1R3JC 3WU2Z 1MG1A 1QU7A 1OJHA 1P7GA 2BTQB 5H2FZ 3JSLA 3BHPA 2A79B 4OXSA 1FXKB 3RFRA 1COWG 4YXWG 4D7TA 3SPGA 3SGIA 5DM6V 1MA1A 5B1AC 4U3JB 3RWRD 1W0JG 2JJ2G 3IJ4A 1HP8A 1ZL8B 3G4SV 4MSWC 3H1KH 1KB9F 3HPLC 5L3BA 1AR4A 2ADQB 3CRRA 2EJ7A 5LP6B 3BY6A 3JCUZ 4J7KA 2ZQMA 2UUCO 2WLLB 1FFTB 1M57B 2N74A 2XAGA 2UXBB 1X4TA 3VBBA 1Q81W 1SC5B 3T1YO 1OCOB 3BEHA 2OYQA 2WSSG 2VWKA 2EJRA 3WG7B 5L3FA 4BW9A 4FFBB 1JFFA 1KKCA 3QG5A 3UT5A 4QE9A 3AK2A 2Z3YA 1S5HC 3VOUA 1KQSU 4K8ZA 1IXMA 1AR1B 2JGUA 2Q6AA 1YSCA 4X65O 1WN7A 2BSKA 1EN5A 1OHHG 4MVQA 3ZCCA 4EEQA 4QPJA 3JARA 2F4VB 1BS3A 2P4VA 4O2BA 2EIMC 1JJ2U 4FLTA 5D5PA 4J10A 3CMEV 2F23A 4G27B 4O2AB 5BXZA 4FLVA 5H5NA 1NR7A 2A7WA 1NTMH 1PPJH 5IY5B 2QKCA 4P9OA 5CN0A 4TV9B 4TSFG 1O9GA 4LFBO 2C2AA 2YI8A 2GSMB 4B3TO 1Z2GA 2P22C 1QBZA 4JAVA 3LSSA 2ATKC 2LGWA 3T1YB 4AQYB 2WLLA 3AG3B 1AJPA 3CJHA 4EB6B 1M90W 1PD3A 3MDSA 1NH2B 5KAFZ 2UUBO 4LF8B 3N2GA 2UUAO 5DEDA 1JQ0A 1ZUQA 3HR0A 2P90A 2QWRB 3N27A 1SKVA 1YI2V 4TV8B 1XUQA 4I55B 2CAZC 3B09A 4UVBA 2JVDA 4IL6Z 2AXTZ 5BMVA 4X65B 2BCCH 4GX2A 3K0GA 4CS3A 2JDIG 3EHBB 1FFXB 3BABA 2AW9A 2WLKA 3ZHRA 3TK1A 3SR2C 3FFQA 4LBEC 2ZDIA 2YICA 4UVCA 2RJZA 4LF7O 1VF6A 2W6IG 4JI4B 4MVMA 4IHJB 1J5EO 2WLNA 4LFBB 4NTYA 4DR4O 3ETQA 4LNUA 4X62O 2H94A 4DV7O 4DV5B 3ZS8C 4RUEA 2ARHA 1FPOA 3STZC 4FLWA 2RMKB 3UCSC 4U7OA 5KUMA 3KKYA 5E1AC 5KHKA 2UUBB 2F93B 2UUAB 1VQMV 5DECA 2PYJA 3APOA 2UXNA 2B5UA 5L3GA 4PA4A 1QLEC 3UKMA 3K5OA 4H37A 4X66B 1BHAA 2XT9A 2BE3A 1JA8A 2CH7B 4UCSA 5CB4A 1OCRB 4HNAB 2DYSC 4E2LA 4TWKA 4MVOA 2L35A 2ZDIC 3ZEDA 4I9QA 1KC8W 1VQ7V 4MVRA 1VF6C 4LF7B 1WPXA 2LQTA 3CRMA 3CSXA 2H8PC 1ORQC 1J5EB 2UXXA 4K35A 3KCYA 3CD6V 2UXDB 4DR4B 3DSQA 4A5UB 4BIOA 3ZMVA 1YDXA 4DV2O 3NR7A 3IC7A 1A32A 1WAZA 2B1GA 4X62B 4DV7B 4LF4O 3JAKB 5CBFA 1W2BU 3K9AA 2LO1A 1KU9A 4PHZA 3CC2V 4TUYB 2NLJC 2A9HA 1V54B 4ASUG 3C3SA 1BE3H 2QWNB 3G71V 4FLZA 3ZN0A 2QM8A 3CCJV 1N4CA 3JALB 1IBKB 4BW5A 4X64B 3T1HO 2L6LA 1YXBA 3G80A 1NT2B 5JCOA 1D5NA 5JJNB 4Z2WA 2KQXA 4J7ZA 5B5EZ 4GLXA 1XILA 1F4MA 3K79A 2ZD9A 1IBLO 2PF4E 1IXBA 2E75B 2ETNA 2H3OA 4FLXA 2P6JA 3DXRB 4YJ2B 1Q6UA 2QTOA 2CH7A 3ABKB 2YEVA 1M93A 5IYZA 4DV1O 1XBLA 3KZIZ 1URFA 2DJVA 3CP1A 5JQGA 4MTGA 3HKEB 4BR6A 5KHJA 1X59A 1T5EA 3UM7A 4MVUA 3OUFA 3E8GA 1KBHA 5LHIA 3S3XA 3DC6A 4PV1B 5IE9A 5IJ0A 2GBOA 3WB0A 1I0HA 2WWWA 4JI5O 1Q3EA 4WFGA 1Y66A 4DYLA 4I0XA 1FYJA 2YXYA 3P3NA 2IW5A 4W4LA 5JVDA 4LP8A 3F7YC 3R65A 1GM9A 1QVGU 2FB5A 3Q4HB 2EINB 5K1PA 1Y76A 5JCOC 4YIOA 3JALA 3CB2A 3OEHG 1N34O 2RNBA 3SJCC 1V55C 2R9RB 4DXWA 1IBLB 1N0NA 3K59A 1DGSA 2XAJA 2WLHA 1DLBA 2WAMA 1P84F 3QVNA 4FIPC 4DR7O 3DXRA 1PP9H 1EZJA 2E5LO 3JD0A 4GT1A 4DR6O 1NR1A 5GW7A 3SYPA 1DK1A 2EZOA 4NKGB 2HJDA 4DR1B 1TAEA 2YI9A 1IZ3A 4JPRA 4LF6B 1SQGA 1JR9A 1JJOA 5TISZ 1SZXA 1TVKB 3TXQA 4CH4A 4FK5C 4TOIA 2VQFO 5EC1C 4QPKA 5IWAO 4JZGA 4YHHO 3A2FA 2CGNA 3OFNG 4G2KA 4UFZA 3J81N 1Q7YW 5GTHZ 3LSUA 1H2MA 1SESA 4PI2A 4JTDB 3CMAV 4JYAB 3BVOA 3ABLC 5LL6Y 4I4TA 2HVJC 4LF9B 4IGGA 5CA0B 2P7TC 3HB3B 5ITZA 1QLNA 3ASOB 1VEWA 4DR7B 1XNQO 3SPIA 4JGSA 2E5LB 2V7QG 2EBOA 4IIJB 3OTFA 1IX9A 2OIEA 3B8NA 4I9WA 1BSMA 4MTFA 1AILA 3AG7A 2QJ1A 1SA0B 5H9CA 3T4DA 1NJIW 1D2DA 1EBOA 2PI4A 1N33B 1DF5A 2QKSA 2A0LA 4W4KA 5EYPA 2GUZA 3OMIB 2OCCC 4JYBA 2R72A 2PTMA 1BCCH 4RWUA 2HFEC 3L70H 5IWAB 5J2TB 4YHHB 1SF9A 1SRYA 4L8JA 5LBQA 1JOYA 5B1BC 4JTAB 4NYKA 2W0FC 1YEWA 1B06A 4B3RO 4MW3A 3K57A 1VQ4V 4OPHA 4UVAA 2GTSA 5BY1A 5H6QA 4ZI7B 2Z0AA 1BQZA 4PDMA 3AG4C 4J7JA 4EKWA 2VS0A 1XNQB 3JASB 4PDRA 3C3TA 2KKWA 1IBMO 3FB8C 2N05A 3B4SA 1K33A 4N21A 4KXRA 4IYIA 5EBLC 1KMIZ 1ENVA 2Y69B 3SYQA 4U7NA 1LUVA 1MNGA 2FYUH 2ZE8A 1Y74A 1H8HG 4H13B 4PDVA 3JD1A 4ZOLA 3ZRVA 4PA7A 4L87A 3IFXA 1Q6IA 2EULA 1AJQA 4B3SO 2JS5A 5D5QA 2N04A 4GKKO 5IYCO 5CA3A 1MSWD 2LJ2A 3UQ8A 2UU9B 2KG7A 1N32B 3U0ZA 2QGNA 3OW2U 4I5SA 2YC0A 2Q73A 1P4RA 4BWAA 4KFMA 4WBNB 3JAWB 3E22B 2LW1A 1PL0A 1FXHA 2CE4A 5EBMC 3OTOO 4DO2A 4B3RB 5B1OA 3ZMZA 1WJZA 2JRIA 3ZMUA 1TUBB 1FJGO 1Q5OA 1XOUA 2HKOA 1PV0A 1Q8IA 3G67A 3JD2A 4JAAA 5KMGA 1ZAUA 1AI7A 3H1LH 4X9QA 1IBMB 4ZI7A 4FLUA 1H2NA 1SQVH 3LSQA 3OMAB 4DUYO 1HNZO 2M7WA 2WLJA 4X1KA 1AB3A 1S76D 1RM1C 5IT9N 3X2QB 1OCCB 1GRJA 3APQA 4B3SB 1W59A 1R6KA 5A9GA 4JI2O 2IH1C 4P9PA 5LOVA 3ABTA 2P67A 3RYHA 2V1DA 3JYCA 2DYRB 1RSOA 4O4JA 4FFKA 1L0NH 1TGOA 2IU3A 4UCOA 4AI8A 3ETDA 1UFIA 1NS1A 3FYEB 1M56B 1NTKH 2CK3G 2ZR2A 3CPWU 1I08A 3GWOA 1SZTA 3OTOB 3OT7A 4LF5B 2E74B 4WBNA 3JAWA 2XUMA 2IU0A 2PI5A 1AI5A 3D3IA 5LHHA 1VQLV 3ABMB 1FJGB 4UCVA 3VQYA 4ICGA 2A3QA 3JCZA 4GUNA 4X20B 2BTQA 2HLDG 3SPHA 1XMOO 1FXKA 4DV6O 4MVZA 2ZIOA 4DUYB 1HNZB 1SQQH 1YIJV 1FS0G 4I7ZB 2Y48A 4GX0A 2EIKB 3CS5A 1KP2A 4F4LA 4U3JA 2JEXA 2OTLV 5IDJA 2WLIB 2EZPA 1ZL8A 3ZHUA 3VQVA 2UUCB 5LA6B 2Q7HA 2Q7EA 1JMKC 4JYYA 3OR7C 5LP6A 3BPZA 3QO5A 2QM7A 4X1YB 1OCZB 3AG1C 4LWSB 1HR0O 2LGQA 4D6TH 3ZRWB 3UO3A 1ROPA 1AI6A 1B3QA 4GZRB 3AG2B 4LH6A 1HW7A 4FFBA 5EK0A 2HJFC 1NVPB 1NU1H 1NTZH 4JI0O 3MHSC 3BFRA 1H2SB 2VQEO 1XHXA 1QCEA 1IDSA 3SPCA 5L3CA 3MHHC 1R6NA 3FAVB 3FB6C 1I5XA 1U96A 2YXLA 1NKDA 1XMOB 1FXKC 3G6EV 1HWYA 2XOKG 4DV6B 1BQ0A 5B1NA 3L75H 2CTPA 4G28B 2X7RB 4TT3G 5KA5A 3CCRV 2B1IA 2PGGA 5LMNO 4ABMA 4CC5A 4MS2A 4O2AA 3FX7A 3ZRXA 3H1HH 2ZINA 3CEIA 3EFFK 2Y0PA 3CXCU 1MMMA 2HEPA 1YJWV 4MT8A 4TV9A 5CBHA 4B3TB 3CRQA 3W7TA 3HKCB 5CA1B 1LNQA 3JSNA 3PJSK 2Y4TA 1WB7A 2M6YA 2WLIA 5LP6C 1US6A 3BA9A 1M57C 2ZE6A 1GKFA 2HHHO 2IH3C 1OZ0A 1HR0B 4JTCB 4FMTA 4RO2A 2DQ3A 3H1IH 1OCOC 2UXCO 1VQOV 4YY3O 3UO2A 2QM4A 3CXHF 3WG7C 1LR1A 4EB6A 4LWSA 4QNHB 3RVZA 2LFSA 1NI8A 1BT8A 4B08A 1YF2A 4TV8A 4I55A 1THZA 2ILMA 1Z5VA 1Q86W 5B66Z 2FMLA 1FFXA 4LH7A 3LDCA 1VMGA 5B3SB 4GX5A 1RP3B 2EIJB 2P4KA 5EZYB 3L73H 4GYCB 1XQ8A 3AEIA 3R66A 5LMNB 2F95B 3D36A 5LMUO 3KCXA 2X6BA 2GDSA 5IY5C 1R6TA 2Q5ZA 4IHJA 1ZTEA 2A06H 5J9PC 3K0DA 2Y0IA 5IJ9B 3LDEA 5FL7G 3F5TA 5A2QN 1F4NA 2CTWA 2HHHB 1O9HA 1K4DC 3ZBHA 2JGDB 3AG3C 3L71H 4O4IB 5FNVB 4YY3B 2X0LA 2ZE5A 4WCEV 3CX5F 4WFFA 1I94O 2QDOA 2JEUA 2OWOA 4Q6GA 4JAUA 1YTFB 3SJQC 3S3WA 5C8YB 2YIAA 4FM0A 2QWQB 1B6QA 2DQ0A 5KX5B 3AK1A 1WNSA 4HNAA 5KUKA 1FKAO 3CCUV 3ZJZA 4NB5A 3D36C 1BHBA 1D5AA 2JK5C 3OR6C 5LMUB 5EZYA 2ZNJA 3CWBH 4DV2B 4AILC 5GONB 4PI0A 3L9DA 1N0JA 5LGNA 3B2EE 4LF4B 2YDEA 5LXTB 2F1MA 2ZT9B 2OCHA 2YUAA 2CTQA 1S0VA 4QIWF 3L72H 3JAKA 1AVMA 3I5DA 2QKAA 1MOFA 5CBGA 1YITV 2P06A 5J2UB 3LUTB 3T1HB 4TUYA 2AZ0A 1AJNA 2G38A
chains in the Genus database with same CATH topology
4DUYO 1HNZO 2E5LO 4DR6O 3R66A 1XMQO 2UXBO 4LF7O 5LMUO 4OX9O 1AB3A 1DK1A 3T1HO 4NXNO 1R6TA 5IT9N 4JI0O 4DV4O 1J5EO 2LW7A 2VQEO 1IBKO 4DR4O 3J7AU 4B3RO 4X64O 4JI2O 4JI4O 4GKJO 4OPHA 4X65O 5BY1A 1XNRO 3F5TA 4DR1O 4X62O 5A2QN 4DV7O 1IBLO 2Z0AA 4LF6O 4JI1O 3O65A 4LFAO 2ZKOA 4DV5O 1IBMO 4JI6O 4KHPO 2VQFO 4DV1O 4LFCO 5IWAO 1NS1A 2DJVA 2F4VO 1I94O 4YHHO 4JI8O 3J81N 3M8AA 5LMNO 1F7YA 1X59A 4DUZO 5BXZA 5H5NA 3JAMN 4DR5O 4B3SO 5LL6Y 4LFBO 4DR2O 5BR8O 4B3MO 4GKKO 4LF5O 4JI7O 4JI5O 4B3TO 4JYAO 4OPAA 4K0KO 1N36O 1FYJA 2HHHO 1KUQA 1FKAO 3SDLA 4X66O 1XMOO 4LF9O 5FLXN 4DV6O 1XNQO 4DV3O 2UXCO 2AGAA 4YY3O 2UU9O 1N32O 3J80N 2UUBO 2FKXA 2UUAO 4AQYO 1AILA 3OTOO 4JI3O 1D2DA 1R1BA 1G1XB 4LF8O 4NXMO 4A5UB 1N34O 1HNWO 4DV2O 1YZBA 2JRIA 1A32A 1HNXO 2DOSA 4DV0O 1FJGO 2UXDO 4LF4O 1N33O 4JV5O 1XEQA 4DR3O 2UUCO 2N74A 3RT3C 1HR0O 2ZM6O 4DR7O 3T1YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY O;  1HNZ O;  2E5L O;  4DR6 O;  3R66 A;  1XMQ O;  2UXB O;  4LF7 O;  5LMU O;  4OX9 O;  1AB3 A;  1DK1 A;  3T1H O;  4NXN O;  1R6T A;  5IT9 N;  4JI0 O;  4DV4 O;  1J5E O;  2LW7 A;  2VQE O;  1IBK O;  4DR4 O;  3J7A U;  4B3R O;  4X64 O;  4JI2 O;  4JI4 O;  4GKJ O;  4OPH A;  4X65 O;  5BY1 A;  1XNR O;  3F5T A;  4DR1 O;  4X62 O;  5A2Q N;  4DV7 O;  1IBL O;  2Z0A A;  4LF6 O;  4JI1 O;  3O65 A;  4LFA O;  2ZKO A;  4DV5 O;  1IBM O;  4JI6 O;  4KHP O;  2VQF O;  4DV1 O;  4LFC O;  5IWA O;  1NS1 A;  2DJV A;  2F4V O;  1I94 O;  4YHH O;  4JI8 O;  3J81 N;  3M8A A;  5LMN O;  1F7Y A;  1X59 A;  4DUZ O;  5BXZ A;  5H5N A;  3JAM N;  4DR5 O;  4B3S O;  5LL6 Y;  4LFB O;  4DR2 O;  5BR8 O;  4B3M O;  4GKK O;  4LF5 O;  4JI7 O;  4JI5 O;  4B3T O;  4JYA O;  4OPA A;  4K0K O;  1N36 O;  1FYJ A;  2HHH O;  1KUQ A;  1FKA O;  3SDL A;  4X66 O;  1XMO O;  4LF9 O;  5FLX N;  4DV6 O;  1XNQ O;  4DV3 O;  2UXC O;  2AGA A;  4YY3 O;  2UU9 O;  1N32 O;  3J80 N;  2UUB O;  2FKX A;  2UUA O;  4AQY O;  1AIL A;  3OTO O;  4JI3 O;  1D2D A;  1R1B A;  1G1X B;  4LF8 O;  4NXM O;  4A5U B;  1N34 O;  1HNW O;  4DV2 O;  1YZB A;  2JRI A;  1A32 A;  1HNX O;  2DOS A;  4DV0 O;  1FJG O;  2UXD O;  4LF4 O;  1N33 O;  4JV5 O;  1XEQ A;  4DR3 O;  2UUC O;  2N74 A;  3RT3 C;  1HR0 O;  2ZM6 O;  4DR7 O;  3T1Y O; 
#chains in the Genus database with same CATH topology
 1I94 B;  2Q68 A;  1E1R G;  4K8X A;  3HKB B;  2R70 A;  4O4L B;  2EIL B;  4IT5 A;  3CCS V;  2YIB A;  1CP9 A;  4BIU A;  2K1E A;  3ZIA G;  2LP7 A;  1Y4M A;  5IYB O;  4DRX B;  3ETG A;  5C93 A;  4R8C A;  1OCR C;  4DV1 B;  4JI1 O;  3ASN B;  4BIZ A;  4YJ2 A;  2QTS A;  3GB7 C;  3T1C A;  3QF7 A;  4JI6 O;  3K9S A;  1K3E A;  3VQX A;  1GM8 A;  4LFC O;  4CH5 A;  1PKX A;  3C90 A;  3HKE A;  1M4U A;  4WFE A;  2ZR3 A;  3CRA A;  2QA4 V;  4GCZ A;  4JI5 B;  4RQF A;  5KHH A;  1MZF A;  1U97 A;  2IJK A;  3GVM A;  3ZHT A;  1EZV H;  4FVM A;  2Q7G A;  1JCH A;  4OPA A;  4K0K O;  2IBZ H;  4FPP A;  5KHI A;  3F5W C;  2ZXW B;  4U3F H;  3SDL A;  1K4C C;  4Z1V A;  2XAS A;  5LGU A;  1RPO A;  1V54 C;  1R73 A;  2ZCE A;  4CZZ A;  2FL4 A;  3G6B A;  3Q4H A;  1BGY H;  1N34 B;  1KP3 A;  1Y6X A;  1KKD A;  2HP8 A;  1EN6 A;  1YJ9 V;  1R1B A;  4NXM O;  4UB6 Z;  1YZB A;  4TQD A;  1QQC A;  1QR8 A;  4XDL A;  3ETE A;  4PJ0 Z;  5LYJ B;  4JI1 B;  3OAA G;  4WF9 V;  3K58 A;  1FXV A;  3ABK C;  4DR6 B;  2WPD G;  4D7S A;  1I7F A;  5LHG A;  1M9N A;  2QEX V;  3W7W A;  3OMN B;  1WB8 A;  4YJ3 B;  1GN4 A;  4OX9 O;  5B1A B;  4NXN O;  1L1F A;  3I56 V;  4ZBM A;  1NQT A;  1PM9 A;  4H44 B;  4DV4 O;  1GMG A;  4PA6 A;  1VQ5 V;  1BL8 A;  3J7A U;  2DWD C;  4RUF A;  1AR5 A;  1XNR O;  5JH7 B;  1GN6 A;  2NR5 A;  1R3I C;  3OE7 G;  4K3A A;  3K04 A;  4R6Z A;  1TVK A;  2VQF B;  3ZRS A;  3O9O A;  3MAQ A;  1JX9 A;  3QO7 A;  4O4H B;  5FPO A;  2KSD A;  3JAT B;  4TQF A;  3N2K B;  2EIN C;  4BAY A;  3ZHS A;  4PEL A;  3HKD B;  5EBW C;  3T4Z A;  4DUZ O;  1K73 W;  4UV9 A;  3RYF B;  3L74 H;  4DR5 O;  1NBM G;  4J41 A;  4LCU C;  4H0L B;  1KD1 W;  3TXS A;  2RDC A;  5CA0 A;  2XTA A;  5K1X A;  3OEE G;  1VQK V;  4KP4 A;  3U11 A;  5EC2 C;  3IGA C;  1VQ6 V;  2PYL A;  2BOB C;  2EIM B;  3J80 N;  3QTC A;  3CCM V;  3ZHQ A;  4IIJ A;  4NXN B;  2ADP A;  4QGP A;  5KA6 A;  1QR9 A;  3FB5 C;  1SA0 A;  2ZNI A;  3STL C;  1XNR B;  4C7U A;  1EFR G;  4FZ1 A;  3CCE V;  1K5S A;  3CCQ V;  3B8M A;  1S5L Z;  3EXA A;  2QSA A;  1H2G A;  1P49 A;  3CHX A;  5J2T A;  2PY5 A;  4E4E A;  3RBZ A;  1XMQ O;  2UXB O;  1I5Y A;  1Z5W A;  4DUZ B;  1F23 A;  3JAT A;  1JFF B;  5JJJ B;  3UT5 B;  4DR5 B;  2ITD C;  1YHQ V;  4NVP A;  1ZSP A;  1SQF A;  3RYF A;  2GV9 A;  5JWP A;  4QJF B;  4FM2 A;  4F6E A;  2BSK B;  1XL4 A;  3E35 A;  3ASO C;  4XDK A;  4MTO A;  4QE7 A;  2GTA A;  3JAR B;  1SQX H;  4LFA O;  3JAS A;  1E79 G;  4UCU A;  4UUJ C;  4O2B B;  4IYH A;  3TGU H;  2F66 C;  4J11 A;  3W7U A;  2F4V O;  3RYI B;  1GM7 A;  4MTX A;  3IAY A;  4GKK B;  1L0L H;  3BRC A;  1NH2 D;  3A0B Z;  2MW2 B;  4OGQ B;  5KLV H;  1NVP D;  2W0X A;  3LNN A;  4DV3 O;  1H2K A;  2K9P A;  3CJH B;  1XMQ B;  5JJE B;  3FB7 C;  1SQP H;  3N2G B;  3E22 A;  4WFB V;  4AQY O;  2RQ6 A;  3CE2 A;  4LF8 O;  3QO8 A;  1QVF U;  1DF4 A;  2D3O W;  1QHT A;  2DOS A;  1QLE B;  1K92 A;  2IJJ A;  5BMV B;  1WP8 A;  1PL4 A;  1JVM A;  1TUB A;  4CC6 A;  2HVK C;  4NTX A;  1B04 A;  4LFA B;  3ML0 A;  3U10 A;  3OUS A;  1Q6H A;  2DYS B;  2ZM6 O;  1VAR A;  2Y69 C;  2LFR A;  2D2C B;  2PUS A;  4R50 A;  4J9Y B;  2P5O A;  1E1Q G;  1V9P A;  2RN9 A;  5E79 Z;  4JI2 B;  3RGB A;  1Q43 A;  4PDL A;  4NTW A;  3ZN1 A;  3RYI A;  1R3L C;  1PNM A;  4LNU B;  2Q67 A;  4JI4 O;  3SJA C;  3P30 A;  4NR1 A;  4X1I B;  1FD9 A;  1VF5 B;  2ZKO A;  1ARO P;  4DV3 B;  4DV5 O;  1NZ6 A;  3BAA A;  3NXS A;  4JI8 O;  2OT5 A;  4PD4 F;  1S72 V;  3THO A;  3ZX6 A;  2HR3 A;  3D8C A;  3E86 A;  3E8F A;  3IC9 A;  4R7C A;  4J42 A;  3JAM N;  4HZ3 A;  1S5J A;  2RCV A;  1SER A;  4X20 A;  1UPG A;  1XDC A;  3OD4 A;  5CB4 B;  3E8B A;  4EFE A;  1RFY A;  3CCV V;  2CDY A;  4X66 O;  3ABU A;  2ZM6 B;  5FLX N;  1AP5 A;  2V4D A;  3X2Q C;  1OCC C;  4CH3 A;  2O57 A;  2VWJ A;  1PNL A;  1SQB H;  1QNM A;  1IUR A;  1J95 A;  5GTI Z;  4AHC A;  2QWP B;  3E89 A;  5LA6 A;  4Q20 A;  2DYR C;  2UXD O;  1BMF G;  1XEQ A;  3E83 A;  5LGT A;  1K34 A;  2YIB D;  4X1Y A;  1YTF D;  4FJC C;  2XAQ A;  3ZRW A;  1K7D A;  3K03 A;  4DK0 A;  4X1I A;  1M56 C;  4JI0 B;  4ZHQ B;  5L3D A;  2CTR A;  1VF7 A;  2VQE B;  4JI8 B;  4DW0 A;  4KL1 A;  2KB1 A;  4X88 A;  4FZ0 A;  1GTO A;  1IBK O;  3ABM C;  4X64 O;  4UCT A;  3M7M X;  4XDJ A;  2DW4 A;  1V55 B;  1S3J A;  3GWK C;  1H38 A;  4FM1 A;  3FAV A;  3DGE A;  2PZS A;  1SET A;  1M1K W;  1TA8 A;  2YEV B;  3AK3 A;  1IVS A;  3B40 A;  5IYZ B;  2JS3 A;  2HG5 C;  2EIK C;  4JZ2 A;  5JQG B;  3M8A A;  1F7Y A;  1MZE A;  1XL6 A;  5DN6 G;  4UB8 Z;  4DK1 A;  1WA8 B;  2YXH A;  3W7X A;  1K5Q A;  2IJH A;  3HKC A;  4F6R B;  5CA1 A;  5IJ0 B;  5BR8 O;  1XI1 A;  4B7K A;  3WB2 A;  3K08 A;  4J9Z B;  2BOC C;  2YID A;  4JI7 O;  2UXC B;  1OCZ C;  1RPR A;  2YS8 A;  1G8M A;  4JAS A;  2B9Z A;  1KYO F;  4I0X B;  3QNE A;  1N36 O;  1KUQ A;  1W0K G;  1K8A W;  1GO3 F;  5JVD B;  3TJT A;  3FYI B;  1FAF A;  4JYC A;  5KAI Z;  2CUG A;  3AG2 C;  4PA3 A;  2JIZ G;  3K5M A;  1YJN V;  2E3C A;  3OM3 B;  3CCL V;  2R9A A;  2GHY A;  4UV8 A;  1KEC A;  1Y76 B;  2Z5U A;  3MD0 A;  4ZHQ A;  3OGC C;  2X6A A;  4JI3 O;  1G1X B;  3LNM B;  1VP7 A;  5EIB D;  1HNX O;  1GN2 A;  1H8E G;  3ABL B;  3RW0 A;  1MSD A;  1TUE B;  3EVK A;  3CYO A;  2QE7 G;  3WB1 A;  3OGI B;  1K97 A;  2Q69 A;  3RYC B;  3K3W A;  4KUM A;  1GN3 A;  3SYC A;  4UXN A;  2LW7 A;  4HYO A;  5IJ9 A;  2WLM A;  1VQ9 V;  5BR8 B;  1N8R W;  4GKJ O;  1M5I A;  3H1J H;  4N23 A;  1WA8 A;  4JI7 B;  1F51 A;  4DR1 O;  2WA3 A;  4CS4 A;  2OCC B;  4F6R A;  1N36 B;  4LF6 O;  5HFL A;  3O65 A;  1G6U A;  3TCU A;  1XRE A;  1S77 D;  3W7S A;  2JGD A;  1EN4 A;  4KHP O;  4O4I A;  5FNV A;  2NNU A;  1UJW B;  3RN4 A;  2XND G;  2E76 B;  4JI3 B;  5B1B B;  3P32 A;  2XAF A;  1H2L A;  5AG2 A;  4ZKI A;  3K5N A;  1HNX B;  4DR2 O;  1Y67 A;  4I4T B;  4B3M O;  5C8Y A;  2DN9 A;  5ITZ B;  4JYA O;  2AHZ A;  3A0H Z;  5KX5 A;  5B3S C;  2EIJ C;  3AG4 B;  4I50 B;  4LF9 O;  2QR4 A;  5F2V O;  1AP6 A;  1G4Y B;  4XBF A;  2X6C A;  2Q0O C;  2AGA A;  2DE0 X;  3BCC H;  2AZ2 A;  4MVS A;  2NN4 A;  4B7E A;  4UCR A;  2OTJ V;  1WP7 A;  2JJ1 G;  5GON A;  3RVY A;  3CC4 V;  3A0R A;  3TET A;  2XHB A;  3RYC A;  1HNW O;  4CH6 A;  3F7V C;  5LXT A;  4GKJ B;  3DTU B;  4DV0 O;  1VQN V;  4EFB A;  5EYP B;  2GUZ B;  1N33 O;  4JV5 O;  2DWE C;  4P2Z A;  3H9V A;  3CC7 V;  4DR3 O;  4KHP B;  3FKS G;  5IYD O;  5J2U A;  2ZIM A;  1XHZ A;  3ZHV A;  1VQ8 V;  1PNK A;  1VQP V;  1WPB A;  4H33 A;  3HKB A;  4O4L A;  1CPY A;  3ZMT A;  4DR2 B;  4B3M B;  4RAI A;  3B77 A;  4CS2 A;  2AHY A;  2VRZ A;  1DTO A;  4HAM A;  4LC1 A;  2FTK A;  4DRX A;  3ZMS A;  4JI6 B;  5KHG A;  2ZE7 A;  3M99 B;  4LFC B;  3SYA A;  4CBC A;  3D3Q A;  4DW1 A;  1CEZ A;  1L8D A;  2Q9L A;  2ITC C;  4GX1 A;  3DC5 A;  4I50 A;  1P7B A;  4X89 A;  5CMU A;  3WFV A;  1MAB G;  3VQW A;  1Y74 B;  4PA9 A;  3FD9 A;  2WA4 A;  1WLE A;  4ZOL B;  1RM1 B;  1HNW B;  5L3E A;  1Q90 D;  3K06 A;  4K0K B;  2Q4P A;  1JPX A;  4DV0 B;  2YSU B;  3SYO A;  3I55 V;  3SPJ A;  4JV5 B;  3A8T A;  2IJI A;  3LDD A;  4DR3 B;  3SJB C;  2MK3 A;  3P3P A;  4RQE A;  1CXZ B;  2KG7 B;  1Q82 W;  1YVW A;  4JF3 A;  4LR3 A;  2UU9 O;  2BTO A;  1N32 O;  4NXM B;  2FKX A;  1VIB A;  2EIL C;  3T2M A;  3JD4 A;  5HFM A;  3E8H A;  3KG2 A;  2XAH A;  1GK9 A;  1ZLZ A;  1R3K C;  5BZB A;  4X8A A;  1BZK A;  5LYJ A;  3ASN C;  5KMG B;  1YCI A;  4HBN A;  5EIB C;  3K5L A;  3BA8 A;  2Q8V A;  3RT3 C;  1GAX A;  4OX9 B;  2Y4U A;  1K9M W;  4DV4 B;  1AI4 A;  3E2E A;  4J80 A;  2W6J G;  4YJ3 A;  4X1K B;  4ZIB A;  2ODM A;  3JD3 A;  4Z1M G;  4YIP A;  3ICX A;  1ZX3 A;  5FPR A;  1SS3 A;  1ZWI C;  5LOV B;  5JH7 A;  3RYH B;  2R9I A;  1RSO B;  2ZXW C;  5H6R A;  4FLY A;  2IM9 A;  4O4J B;  4WFH A;  1OV9 A;  3CRC A;  4O4H A;  3AG1 B;  1LUW A;  3N2K A;  3PN1 A;  1HDJ A;  3HKD A;  2F43 G;  2DMX A;  1GH6 A;  2CGO A;  3H01 A;  4P30 A;  2Q0A A;  4WFA V;  2OIG A;  4MW8 A;  2EX3 A;  1EM1 A;  2QWO B;  4LF5 O;  1R3J C;  3WU2 Z;  1MG1 A;  1QU7 A;  1OJH A;  1P7G A;  2BTQ B;  5H2F Z;  3JSL A;  3BHP A;  2A79 B;  4OXS A;  1FXK B;  3RFR A;  1COW G;  4YXW G;  4D7T A;  3SPG A;  3SGI A;  5DM6 V;  1MA1 A;  5B1A C;  4U3J B;  3RWR D;  1W0J G;  2JJ2 G;  3IJ4 A;  1HP8 A;  1ZL8 B;  3G4S V;  4MSW C;  3H1K H;  1KB9 F;  3HPL C;  5L3B A;  1AR4 A;  2ADQ B;  3CRR A;  2EJ7 A;  5LP6 B;  3BY6 A;  3JCU Z;  4J7K A;  2ZQM A;  2UUC O;  2WLL B;  1FFT B;  1M57 B;  2N74 A;  2XAG A;  2UXB B;  1X4T A;  3VBB A;  1Q81 W;  1SC5 B;  3T1Y O;  1OCO B;  3BEH A;  2OYQ A;  2WSS G;  2VWK A;  2EJR A;  3WG7 B;  5L3F A;  4BW9 A;  4FFB B;  1JFF A;  1KKC A;  3QG5 A;  3UT5 A;  4QE9 A;  3AK2 A;  2Z3Y A;  1S5H C;  3VOU A;  1KQS U;  4K8Z A;  1IXM A;  1AR1 B;  2JGU A;  2Q6A A;  1YSC A;  4X65 O;  1WN7 A;  2BSK A;  1EN5 A;  1OHH G;  4MVQ A;  3ZCC A;  4EEQ A;  4QPJ A;  3JAR A;  2F4V B;  1BS3 A;  2P4V A;  4O2B A;  2EIM C;  1JJ2 U;  4FLT A;  5D5P A;  4J10 A;  3CME V;  2F23 A;  4G27 B;  4O2A B;  5BXZ A;  4FLV A;  5H5N A;  1NR7 A;  2A7W A;  1NTM H;  1PPJ H;  5IY5 B;  2QKC A;  4P9O A;  5CN0 A;  4TV9 B;  4TSF G;  1O9G A;  4LFB O;  2C2A A;  2YI8 A;  2GSM B;  4B3T O;  1Z2G A;  2P22 C;  1QBZ A;  4JAV A;  3LSS A;  2ATK C;  2LGW A;  3T1Y B;  4AQY B;  2WLL A;  3AG3 B;  1AJP A;  3CJH A;  4EB6 B;  1M90 W;  1PD3 A;  3MDS A;  1NH2 B;  5KAF Z;  2UUB O;  4LF8 B;  3N2G A;  2UUA O;  5DED A;  1JQ0 A;  1ZUQ A;  3HR0 A;  2P90 A;  2QWR B;  3N27 A;  1SKV A;  1YI2 V;  4TV8 B;  1XUQ A;  4I55 B;  2CAZ C;  3B09 A;  4UVB A;  2JVD A;  4IL6 Z;  2AXT Z;  5BMV A;  4X65 B;  2BCC H;  4GX2 A;  3K0G A;  4CS3 A;  2JDI G;  3EHB B;  1FFX B;  3BAB A;  2AW9 A;  2WLK A;  3ZHR A;  3TK1 A;  3SR2 C;  3FFQ A;  4LBE C;  2ZDI A;  2YIC A;  4UVC A;  2RJZ A;  4LF7 O;  1VF6 A;  2W6I G;  4JI4 B;  4MVM A;  4IHJ B;  1J5E O;  2WLN A;  4LFB B;  4NTY A;  4DR4 O;  3ETQ A;  4LNU A;  4X62 O;  2H94 A;  4DV7 O;  4DV5 B;  3ZS8 C;  4RUE A;  2ARH A;  1FPO A;  3STZ C;  4FLW A;  2RMK B;  3UCS C;  4U7O A;  5KUM A;  3KKY A;  5E1A C;  5KHK A;  2UUB B;  2F93 B;  2UUA B;  1VQM V;  5DEC A;  2PYJ A;  3APO A;  2UXN A;  2B5U A;  5L3G A;  4PA4 A;  1QLE C;  3UKM A;  3K5O A;  4H37 A;  4X66 B;  1BHA A;  2XT9 A;  2BE3 A;  1JA8 A;  2CH7 B;  4UCS A;  5CB4 A;  1OCR B;  4HNA B;  2DYS C;  4E2L A;  4TWK A;  4MVO A;  2L35 A;  2ZDI C;  3ZED A;  4I9Q A;  1KC8 W;  1VQ7 V;  4MVR A;  1VF6 C;  4LF7 B;  1WPX A;  2LQT A;  3CRM A;  3CSX A;  2H8P C;  1ORQ C;  1J5E B;  2UXX A;  4K35 A;  3KCY A;  3CD6 V;  2UXD B;  4DR4 B;  3DSQ A;  4A5U B;  4BIO A;  3ZMV A;  1YDX A;  4DV2 O;  3NR7 A;  3IC7 A;  1A32 A;  1WAZ A;  2B1G A;  4X62 B;  4DV7 B;  4LF4 O;  3JAK B;  5CBF A;  1W2B U;  3K9A A;  2LO1 A;  1KU9 A;  4PHZ A;  3CC2 V;  4TUY B;  2NLJ C;  2A9H A;  1V54 B;  4ASU G;  3C3S A;  1BE3 H;  2QWN B;  3G71 V;  4FLZ A;  3ZN0 A;  2QM8 A;  3CCJ V;  1N4C A;  3JAL B;  1IBK B;  4BW5 A;  4X64 B;  3T1H O;  2L6L A;  1YXB A;  3G80 A;  1NT2 B;  5JCO A;  1D5N A;  5JJN B;  4Z2W A;  2KQX A;  4J7Z A;  5B5E Z;  4GLX A;  1XIL A;  1F4M A;  3K79 A;  2ZD9 A;  1IBL O;  2PF4 E;  1IXB A;  2E75 B;  2ETN A;  2H3O A;  4FLX A;  2P6J A;  3DXR B;  4YJ2 B;  1Q6U A;  2QTO A;  2CH7 A;  3ABK B;  2YEV A;  1M93 A;  5IYZ A;  4DV1 O;  1XBL A;  3KZI Z;  1URF A;  2DJV A;  3CP1 A;  5JQG A;  4MTG A;  3HKE B;  4BR6 A;  5KHJ A;  1X59 A;  1T5E A;  3UM7 A;  4MVU A;  3OUF A;  3E8G A;  1KBH A;  5LHI A;  3S3X A;  3DC6 A;  4PV1 B;  5IE9 A;  5IJ0 A;  2GBO A;  3WB0 A;  1I0H A;  2WWW A;  4JI5 O;  1Q3E A;  4WFG A;  1Y66 A;  4DYL A;  4I0X A;  1FYJ A;  2YXY A;  3P3N A;  2IW5 A;  4W4L A;  5JVD A;  4LP8 A;  3F7Y C;  3R65 A;  1GM9 A;  1QVG U;  2FB5 A;  3Q4H B;  2EIN B;  5K1P A;  1Y76 A;  5JCO C;  4YIO A;  3JAL A;  3CB2 A;  3OEH G;  1N34 O;  2RNB A;  3SJC C;  1V55 C;  2R9R B;  4DXW A;  1IBL B;  1N0N A;  3K59 A;  1DGS A;  2XAJ A;  2WLH A;  1DLB A;  2WAM A;  1P84 F;  3QVN A;  4FIP C;  4DR7 O;  3DXR A;  1PP9 H;  1EZJ A;  2E5L O;  3JD0 A;  4GT1 A;  4DR6 O;  1NR1 A;  5GW7 A;  3SYP A;  1DK1 A;  2EZO A;  4NKG B;  2HJD A;  4DR1 B;  1TAE A;  2YI9 A;  1IZ3 A;  4JPR A;  4LF6 B;  1SQG A;  1JR9 A;  1JJO A;  5TIS Z;  1SZX A;  1TVK B;  3TXQ A;  4CH4 A;  4FK5 C;  4TOI A;  2VQF O;  5EC1 C;  4QPK A;  5IWA O;  4JZG A;  4YHH O;  3A2F A;  2CGN A;  3OFN G;  4G2K A;  4UFZ A;  3J81 N;  1Q7Y W;  5GTH Z;  3LSU A;  1H2M A;  1SES A;  4PI2 A;  4JTD B;  3CMA V;  4JYA B;  3BVO A;  3ABL C;  5LL6 Y;  4I4T A;  2HVJ C;  4LF9 B;  4IGG A;  5CA0 B;  2P7T C;  3HB3 B;  5ITZ A;  1QLN A;  3ASO B;  1VEW A;  4DR7 B;  1XNQ O;  3SPI A;  4JGS A;  2E5L B;  2V7Q G;  2EBO A;  4IIJ B;  3OTF A;  1IX9 A;  2OIE A;  3B8N A;  4I9W A;  1BSM A;  4MTF A;  1AIL A;  3AG7 A;  2QJ1 A;  1SA0 B;  5H9C A;  3T4D A;  1NJI W;  1D2D A;  1EBO A;  2PI4 A;  1N33 B;  1DF5 A;  2QKS A;  2A0L A;  4W4K A;  5EYP A;  2GUZ A;  3OMI B;  2OCC C;  4JYB A;  2R72 A;  2PTM A;  1BCC H;  4RWU A;  2HFE C;  3L70 H;  5IWA B;  5J2T B;  4YHH B;  1SF9 A;  1SRY A;  4L8J A;  5LBQ A;  1JOY A;  5B1B C;  4JTA B;  4NYK A;  2W0F C;  1YEW A;  1B06 A;  4B3R O;  4MW3 A;  3K57 A;  1VQ4 V;  4OPH A;  4UVA A;  2GTS A;  5BY1 A;  5H6Q A;  4ZI7 B;  2Z0A A;  1BQZ A;  4PDM A;  3AG4 C;  4J7J A;  4EKW A;  2VS0 A;  1XNQ B;  3JAS B;  4PDR A;  3C3T A;  2KKW A;  1IBM O;  3FB8 C;  2N05 A;  3B4S A;  1K33 A;  4N21 A;  4KXR A;  4IYI A;  5EBL C;  1KMI Z;  1ENV A;  2Y69 B;  3SYQ A;  4U7N A;  1LUV A;  1MNG A;  2FYU H;  2ZE8 A;  1Y74 A;  1H8H G;  4H13 B;  4PDV A;  3JD1 A;  4ZOL A;  3ZRV A;  4PA7 A;  4L87 A;  3IFX A;  1Q6I A;  2EUL A;  1AJQ A;  4B3S O;  2JS5 A;  5D5Q A;  2N04 A;  4GKK O;  5IYC O;  5CA3 A;  1MSW D;  2LJ2 A;  3UQ8 A;  2UU9 B;  2KG7 A;  1N32 B;  3U0Z A;  2QGN A;  3OW2 U;  4I5S A;  2YC0 A;  2Q73 A;  1P4R A;  4BWA A;  4KFM A;  4WBN B;  3JAW B;  3E22 B;  2LW1 A;  1PL0 A;  1FXH A;  2CE4 A;  5EBM C;  3OTO O;  4DO2 A;  4B3R B;  5B1O A;  3ZMZ A;  1WJZ A;  2JRI A;  3ZMU A;  1TUB B;  1FJG O;  1Q5O A;  1XOU A;  2HKO A;  1PV0 A;  1Q8I A;  3G67 A;  3JD2 A;  4JAA A;  5KMG A;  1ZAU A;  1AI7 A;  3H1L H;  4X9Q A;  1IBM B;  4ZI7 A;  4FLU A;  1H2N A;  1SQV H;  3LSQ A;  3OMA B;  4DUY O;  1HNZ O;  2M7W A;  2WLJ A;  4X1K A;  1AB3 A;  1S76 D;  1RM1 C;  5IT9 N;  3X2Q B;  1OCC B;  1GRJ A;  3APQ A;  4B3S B;  1W59 A;  1R6K A;  5A9G A;  4JI2 O;  2IH1 C;  4P9P A;  5LOV A;  3ABT A;  2P67 A;  3RYH A;  2V1D A;  3JYC A;  2DYR B;  1RSO A;  4O4J A;  4FFK A;  1L0N H;  1TGO A;  2IU3 A;  4UCO A;  4AI8 A;  3ETD A;  1UFI A;  1NS1 A;  3FYE B;  1M56 B;  1NTK H;  2CK3 G;  2ZR2 A;  3CPW U;  1I08 A;  3GWO A;  1SZT A;  3OTO B;  3OT7 A;  4LF5 B;  2E74 B;  4WBN A;  3JAW A;  2XUM A;  2IU0 A;  2PI5 A;  1AI5 A;  3D3I A;  5LHH A;  1VQL V;  3ABM B;  1FJG B;  4UCV A;  3VQY A;  4ICG A;  2A3Q A;  3JCZ A;  4GUN A;  4X20 B;  2BTQ A;  2HLD G;  3SPH A;  1XMO O;  1FXK A;  4DV6 O;  4MVZ A;  2ZIO A;  4DUY B;  1HNZ B;  1SQQ H;  1YIJ V;  1FS0 G;  4I7Z B;  2Y48 A;  4GX0 A;  2EIK B;  3CS5 A;  1KP2 A;  4F4L A;  4U3J A;  2JEX A;  2OTL V;  5IDJ A;  2WLI B;  2EZP A;  1ZL8 A;  3ZHU A;  3VQV A;  2UUC B;  5LA6 B;  2Q7H A;  2Q7E A;  1JMK C;  4JYY A;  3OR7 C;  5LP6 A;  3BPZ A;  3QO5 A;  2QM7 A;  4X1Y B;  1OCZ B;  3AG1 C;  4LWS B;  1HR0 O;  2LGQ A;  4D6T H;  3ZRW B;  3UO3 A;  1ROP A;  1AI6 A;  1B3Q A;  4GZR B;  3AG2 B;  4LH6 A;  1HW7 A;  4FFB A;  5EK0 A;  2HJF C;  1NVP B;  1NU1 H;  1NTZ H;  4JI0 O;  3MHS C;  3BFR A;  1H2S B;  2VQE O;  1XHX A;  1QCE A;  1IDS A;  3SPC A;  5L3C A;  3MHH C;  1R6N A;  3FAV B;  3FB6 C;  1I5X A;  1U96 A;  2YXL A;  1NKD A;  1XMO B;  1FXK C;  3G6E V;  1HWY A;  2XOK G;  4DV6 B;  1BQ0 A;  5B1N A;  3L75 H;  2CTP A;  4G28 B;  2X7R B;  4TT3 G;  5KA5 A;  3CCR V;  2B1I A;  2PGG A;  5LMN O;  4ABM A;  4CC5 A;  4MS2 A;  4O2A A;  3FX7 A;  3ZRX A;  3H1H H;  2ZIN A;  3CEI A;  3EFF K;  2Y0P A;  3CXC U;  1MMM A;  2HEP A;  1YJW V;  4MT8 A;  4TV9 A;  5CBH A;  4B3T B;  3CRQ A;  3W7T A;  3HKC B;  5CA1 B;  1LNQ A;  3JSN A;  3PJS K;  2Y4T A;  1WB7 A;  2M6Y A;  2WLI A;  5LP6 C;  1US6 A;  3BA9 A;  1M57 C;  2ZE6 A;  1GKF A;  2HHH O;  2IH3 C;  1OZ0 A;  1HR0 B;  4JTC B;  4FMT A;  4RO2 A;  2DQ3 A;  3H1I H;  1OCO C;  2UXC O;  1VQO V;  4YY3 O;  3UO2 A;  2QM4 A;  3CXH F;  3WG7 C;  1LR1 A;  4EB6 A;  4LWS A;  4QNH B;  3RVZ A;  2LFS A;  1NI8 A;  1BT8 A;  4B08 A;  1YF2 A;  4TV8 A;  4I55 A;  1THZ A;  2ILM A;  1Z5V A;  1Q86 W;  5B66 Z;  2FML A;  1FFX A;  4LH7 A;  3LDC A;  1VMG A;  5B3S B;  4GX5 A;  1RP3 B;  2EIJ B;  2P4K A;  5EZY B;  3L73 H;  4GYC B;  1XQ8 A;  3AEI A;  3R66 A;  5LMN B;  2F95 B;  3D36 A;  5LMU O;  3KCX A;  2X6B A;  2GDS A;  5IY5 C;  1R6T A;  2Q5Z A;  4IHJ A;  1ZTE A;  2A06 H;  5J9P C;  3K0D A;  2Y0I A;  5IJ9 B;  3LDE A;  5FL7 G;  3F5T A;  5A2Q N;  1F4N A;  2CTW A;  2HHH B;  1O9H A;  1K4D C;  3ZBH A;  2JGD B;  3AG3 C;  3L71 H;  4O4I B;  5FNV B;  4YY3 B;  2X0L A;  2ZE5 A;  4WCE V;  3CX5 F;  4WFF A;  1I94 O;  2QDO A;  2JEU A;  2OWO A;  4Q6G A;  4JAU A;  1YTF B;  3SJQ C;  3S3W A;  5C8Y B;  2YIA A;  4FM0 A;  2QWQ B;  1B6Q A;  2DQ0 A;  5KX5 B;  3AK1 A;  1WNS A;  4HNA A;  5KUK A;  1FKA O;  3CCU V;  3ZJZ A;  4NB5 A;  3D36 C;  1BHB A;  1D5A A;  2JK5 C;  3OR6 C;  5LMU B;  5EZY A;  2ZNJ A;  3CWB H;  4DV2 B;  4AIL C;  5GON B;  4PI0 A;  3L9D A;  1N0J A;  5LGN A;  3B2E E;  4LF4 B;  2YDE A;  5LXT B;  2F1M A;  2ZT9 B;  2OCH A;  2YUA A;  2CTQ A;  1S0V A;  4QIW F;  3L72 H;  3JAK A;  1AVM A;  3I5D A;  2QKA A;  1MOF A;  5CBG A;  1YIT V;  2P06 A;  5J2U B;  3LUT B;  3T1H B;  4TUY A;  2AZ0 A;  1AJN A;  2G38 A; 
#chains in the Genus database with same CATH homology
 4DUY O;  1HNZ O;  2E5L O;  4DR6 O;  3R66 A;  1XMQ O;  2UXB O;  4LF7 O;  5LMU O;  4OX9 O;  1AB3 A;  1DK1 A;  3T1H O;  4NXN O;  1R6T A;  5IT9 N;  4JI0 O;  4DV4 O;  1J5E O;  2LW7 A;  2VQE O;  1IBK O;  4DR4 O;  3J7A U;  4B3R O;  4X64 O;  4JI2 O;  4JI4 O;  4GKJ O;  4OPH A;  4X65 O;  5BY1 A;  1XNR O;  3F5T A;  4DR1 O;  4X62 O;  5A2Q N;  4DV7 O;  1IBL O;  2Z0A A;  4LF6 O;  4JI1 O;  3O65 A;  4LFA O;  2ZKO A;  4DV5 O;  1IBM O;  4JI6 O;  4KHP O;  2VQF O;  4DV1 O;  4LFC O;  5IWA O;  1NS1 A;  2DJV A;  2F4V O;  1I94 O;  4YHH O;  4JI8 O;  3J81 N;  3M8A A;  5LMN O;  1F7Y A;  1X59 A;  4DUZ O;  5BXZ A;  5H5N A;  3JAM N;  4DR5 O;  4B3S O;  5LL6 Y;  4LFB O;  4DR2 O;  5BR8 O;  4B3M O;  4GKK O;  4LF5 O;  4JI7 O;  4JI5 O;  4B3T O;  4JYA O;  4OPA A;  4K0K O;  1N36 O;  1FYJ A;  2HHH O;  1KUQ A;  1FKA O;  3SDL A;  4X66 O;  1XMO O;  4LF9 O;  5FLX N;  4DV6 O;  1XNQ O;  4DV3 O;  2UXC O;  2AGA A;  4YY3 O;  2UU9 O;  1N32 O;  3J80 N;  2UUB O;  2FKX A;  2UUA O;  4AQY O;  1AIL A;  3OTO O;  4JI3 O;  1D2D A;  1R1B A;  1G1X B;  4LF8 O;  4NXM O;  4A5U B;  1N34 O;  1HNW O;  4DV2 O;  1YZB A;  2JRI A;  1A32 A;  1HNX O;  2DOS A;  4DV0 O;  1FJG O;  2UXD O;  4LF4 O;  1N33 O;  4JV5 O;  1XEQ A;  4DR3 O;  2UUC O;  2N74 A;  3RT3 C;  1HR0 O;  2ZM6 O;  4DR7 O;  3T1Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...