2UXBQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxbQ00
1CKNA 3AFPA 3E0EA 4FDBA 3HOUG 4BA1I 1C7YA 1GO3E 1KRSA 3I2ZA 5IT9c 3PUXA 3PO2H 4KHZA 3GTLH 5LMUL 2ZTDA 2XGTA 4C3HH 5LMNW 2IHFA 1Q12A 5FJ8H 5IYBG 2R7ZH 3JAMc 1IBKQ 2UUBQ 2KCTA 3VDYA 4B3TL 1SLJA 1H95A 4A3IG 4QQBX 4BBRG 3EN2A 1VQ9A 4JI3Q 3M3YH 4LF7Q 3UDFA 1Z9FA 1Q82C 4JI6Q 2A1AA 5LMNQ 2YYZA 2IX0A 2N8NA 2RF4A 4A76A 2QEXA 2JEAI 2NVQH 4GKJL 3HOWG 4PZ8A 1C9OA 2IHEA 4YCWA 2IT1A 4LF9L 1SE8A 2K5VA 5BR8Q 5C44H 2KENA 1PH8A 2HT1A 4GKKQ 5JJIA 3AFQA 3CCSA 4JI4Q 4GN3B 2KCMA 3I4MH 4K0KQ 4DR3Q 1PH1A 3ULJA 4A3CH 5IYCG 4IJHA 4R4IA 2OQKA 1MJCA 3I4OA 1HZ9A 3CC2A 1YJ9A 2ZTCA 4JYAL 4OONA 3STBC 3T1HQ 3M4PA 5FLMG 2I0QA 2IY5B 1D8LA 2Q2TA 5JEAJ 2D0PA 2JA8H 4EX5A 3STBD 2ZJRA 4DV2L 4JI5Q 1SN8A 4B3RL 2WP8J 3KF6A 1FGUA 4KHPQ 5JJKA 2KHJA 4IPHA 4L5QA 4DK6C 2NN6I 1K3RA 4QJFA 3J81c 4AIMA 1VQ8A 2IX1A 3OW2A 3S16H 4A3DH 1VQEA 1TWCH 4IPDA 2DGYA 1NE3A 5M3FG 5M5WH 5M3MG 2MNAA 1HR0Q 1IBLQ 4GLAC 2YTYA 4DKAC 5C0XI 4DV6L 3J80i 4LF5L 1E7ZA 4LUZA 2PQAB 3CCUA 4A3JH 1YNXA 1GM5A 2LXKA 4DV0Q 3J80c 3CCQA 4DR6Q 4A3GH 3RLNA 4JI0L 1PYSB 1X54A 2VQFQ 3U50C 1Y1VH 1FJGQ 2BH8A 1VQGA 4IOAA 1PYBA 5GAHC 1B7YB 4HIKA 1S72A 2UUAQ 2C35B 2ZTEA 3D0FA 3PV0A 3RZDH 1XPUA 1G291 3OTOQ 3PO3G 3G4SA 4NB3A 3M4OH 2E2IH 1OXVA 1ASZA 1HNXQ 3W1BA 3S14H 4WJ3M 3ULLA 4A93H 4DV7Q 4A3LG 1X56A 4LFAL 4LF6L 1X6OA 2B63H 5IP7G 1J5EL 4DV1Q 1QVFA 5C3EH 3M85A 2VQEL 4DR2L 2JA6H 1VQIA 2LSSA 1E24A 3PCOB 5IYDG 5C4XH 1I94L 1E1OA 1HH2P 4AYBE 1YIJA 3E9HA 3GTPH 4DUZQ 3E9IA 1EUJA 2VNUD 1VS0A 3J7ZC 1LTLA 2R92G 4EQ5A 2Z6KC 2E2JH 1JJGA 4YY3Q 4X65Q 2RHSB 3CD6A 3OYYA 4OO1G 1Q46A 4UP9A 1C0AA 2AWOA 1V1QA 1VQDA 4GLVB 3S1NH 3S1QH 3AYHB 1RL2A 4RMFA 1KAWA 1MKHA 4LFCL 4X66Q 4DR1L 1X65A 2UXBL 3A5ZB 4DV4Q 2JE6I 1PVOA 4A3IH 3NENA 1WCMG 1A8VA 4BBRH 3S1RH 2YV5A 4BBSH 1VCIA 4GOPB 2UUCQ 2CWAA 3G71A 5DLQE 2A8VA 4A3BG 4AYBG 1KC8C 1CSQA 2AWNA 4NXMQ 2ATWA 3K0XA 4LUVA 2JJQA 4APVA 2YU9H 3CQZH 4R4CA 3UE0A 3GTMH 2AMCB 3HOWH 3PF4A 2JQOA 5IP9H 2K50A 3T1YQ 1XPRA 1OTCA 4LF4L 2EXDA 2K75A 4DR4Q 1RIPA 2ZJPA 3I55A 4DAMA 1I5FA 4PZ7A 4X62L 2HHHQ 2I5HA 2Z6KA 4DV5Q 2OTJA 1HNZQ 2BA0A 4LF8Q 4GN5A 4YHHQ 1IBML 4MZ9A 3PIOA 3RLFA 1VQ6A 3HOZG 2GVBA 1VQNA 1U0LA 2NVXH 1X3EA 3CCMA 5FLMH 1XJVA 2K4KA 1XTDA 2N78A 2VY3A 4PMWA 4P72A 1NBWA 5H1SE 2QA4A 1PH4A 4BY1H 3KJOA 1VQPA 1DGSA 2UUBL 1IBKL 3JAMi 3G6EA 3U58A 4A3EH 1D7QA 2UXCL 1JE5A 3Q8DA 2PI2E 1XPOA 5C0XJ 4JI3L 4A3FH 1S40A 4B3SQ 5GADC 3BJUA 3TEHB 4LF7L 1N34Q 4BXXG 4JI6L 1BKBA 5LMNL 2BH2A 3L0OA 4AQYQ 1EIFA 2Q2HA 4P75A 4R1JA 5M3FH 2F52A 1YBYA 4TVAB 3HOYH 3KFUA 3I56A 2VW9A 1YHBA 4Y52H 5GAGC 4IFDJ 4HJ5A 4LFBQ 2R7FA 5BR8L 5JEAG 3CMEA 1YJNA 1PH3A 4GKKL 3CAMA 2ZM6Q 4IO9A 1XNRL 4JI4L 3H0GG 1EOVA 3CCLA 1TWGH 4K0KL 4C3JH 4DR3L 1V9PA 4JI7Q 1N33Q 5K36G 4JI1Q 4IPCA 4QY7A 3MXNB 1I50H 1N32Q 2ES2A 1IXRA 3M7NA 1K9MC 1OXTA 1UE5A 1Y14B 3T1HL 4P71A 3GTKH 4XTCS 3JC66 3NEMA 3W5OA 1U5KA 5IWAQ 3M4QA 4JI5L 1EFWA 4B3MQ 3GDEA 1N36Q 4KHPL 3I4NG 3J81i 2AHOB 2BA1A 1K73C 2ALYB 3TS2A 2JA7H 1KQSA 1GVPA 4MNOA 3F2CA 2VUMH 1VQAA 3RN5A 1YITA 4O2DA 4GLXA 5C4JH 2ASBA 1B70B 1FVIA 1Q1BA 2MO1A 2WFWA 3FHWA 4A3MG 1HR0L 1IBLL 1QUQB 3FKIH 3UDIA 4L5SA 2UU9Q 2R92H 4UP8A 5AJ3Q 4DR6L 2H5XA 4BY7H 1EWIA 2PNHA 5FLXc 1VQHA 3B6YA 2PQAA 2VQFL 4JBJA 2JA5H 4L5RC 2K14A 3PO2G 2VZAA 1Q81C 3CPWA 1YHAA 1FJGL 1R9TH 3GTOH 1WYDA 3W1GA 4PZ6A 3L2PA 3KF6B 3M9BA 2R93H 4IFDI 1XMQQ 4JI2Q 2UUAL 4C2MH 1X9NA 3TRZA 1Y1WH 3OTOL 5EAYA 3FP9A 3HOVH 1JJCB 4LW1A 3ZJYC 1HNXL 3IRBA 2E5LQ 3H15A 1VQMA 1JB7A 1PFSA 2KHIA 3HKZE 4DV7L 2R6GA 1KXLA 4LWCA 1VQ7A 4QGUA 4DAYB 4DV1L 4JG2A 3PGZA 4GNXC 1L0WA 4GOPC 4GN4B 3K8AA 4P73A 5IE8A 4C3IH 3CF5A 4R4OA 1P16A 5M5YH 2E2HH 1E3PA 2V1CC 4H02A 4JC0A 4DUZL 2Z0SA 1J6QA 1P8LA 2L15A 2OWOA 4A3CG 1SR3A 4YY3L 3HOXH 3CMAA 4HJAA 2UXDQ 1WI5A 3HOUH 4DUYQ 4XIGS 2CFMA 2E8GA 3KDFA 4OX9Q 3HKZG 4X66L 1YHQA 2JEBI 3EBEA 1NMFA 4JV5Q 2ZJQA 1YZ6A 3S15H 4DV4L 4DR5Q 1LYLA 2CWPA 2JA8G 1YEZA 3K7UC 5IYBH 1HZAA 1VQKA 1OXXK 2UUCL 3CCEA 4DR7Q 1K0RA 3UDXA 1UEBA 4JOIC 1Q86C 4A3DG 4GNXA 4NXML 1TWAH 4YCVA 1TXYA 1PH5A 2NN6G 3KOJA 4OWWB 3T1YL 2OTLA 1HJPA 4NPSA 1HNWQ 3DLLA 1T9HA 4IPGA 4A3JG 4ALPA 1IZ6A 1SRUA 2GN5A 3H0GH 2B29A 3BU2A 4O0AA 4DV5L 1HZCA 1HNZL 2Q2UA 4A3GG 5C0XG 1I6HH 1A63A 4LF8L 2MO0A 4YHHL 4YWLA 1PH6A 1CUKA 3F2DA 5IYCH 3F1ZA 3CCVA 1WOCA 2NVYH 2FXQA 1IBMQ 4LF9Q 2UXBQ 4JI8Q 4L5TA 1CKMA 3I7FA 1XMOQ 1L1OB 2MQHA 3S1MH 1NTGA 1UE6A 1VQOA 4WJ4A 4HJ9A 3HFZB 5HGQA 1G51A 4X64Q 4UP7A 3RN2A 1PV4A 4DV3Q 4A93G 4B3SL 2B3GA 2K52A 1N34L 1E1TA 3CCJA 1A62A 1QVGA 3RLOA 4AQYL 4POFA 3CP0A 4A3KG 2F4VQ 4KI0A 1W2BA 3CW2C 4NXNQ 3CPFA 4LNQA 1LUZA 5C4XG 1JT8A 4LFBL 3EIVA 5GQOA 5M3MH 1CKNB 3K7AH 1BBWA 5M5XH 2ZM6L 3H3VI 3LGJA 4OXPA 1JJ2A 1AE3A 3S17H 2K5NA 1XNQQ 1EQQA 4JI7L 1N33L 3ERSX 4JI1L 1UE1A 1HZBA 1KD1C 3H3VH 4BA2I 3GD7A 1KIXA 1N32L 4YCUA 4QL5A 5LMUQ 5E7NA 2EIFA 4RG1A 4KLKA 1O7IA 4OWTB 2NZHA 2UXCQ 3S2HH 4UPAA 3UDGA 2Q2IA 4ME3A 4MTNA 5IWAL 4BBSG 3PO3H 4B3TQ 5ELNA 2DUDA 4YWMA 1X55A 1X3FA 4B3ML 5GAEC 1B8AA 3NBHB 1N36L 2I5LX 3CCRA 3U4VA 1EYGA 1YJWA 4JBMA 4A3LH 1K83H 2NVTH 1CSPA 2ID0A 4DK3C 4R4TA 2LXJA 5HY6A 5IP9G 1OXUA 5IP7H 3KYHC 4GKJQ 1N8RC 3J81j 4POGA 2GVAA 2K5HA 1IL2A 4P74A 1XNRQ 4X6AH 5IYDH 4HIMA 2UU9L 2VS1A 5AJ3L 1BBUA 4OO1I 1VQJA 1Q7YC 1QUQA 1TWFH 1L2FA 1MIUA 1UWVA 4DNIA 4DV0L 1G6PA 2Y0SE 5J3BA 3MEFA 3CC7A 3CC4A 4HJ7A 5IY0A 1VQ5A 1XMQL 1I3QH 3L7ZC 3PSIA 4JI2L 1WJJA 2HQLA 3DM3A 4BY1G 1Z47A 1X3GA 1PH2A 1HR0W 1QZHA 2D0OA 4A3EG 3RR5A 2RCNA 5FJ8G 4DV2Q 1WCMH 3A5UA 3PUVA 2R7ZG 1PH7A 4B3RQ 3PUZA 4A3FG 2E5LL 4IOCA 2WAQE 4A3BH 1AE2A 2QGQA 4DPGA 1KRTA 3WWVA 4JBWA 1EIYB 3RZOH 2A19A 1SMXA 1EQRA 1UE7A 3BZCA 2KBNA 5ELOA 3GTJH 3HOYG 3ICEA 1AH9A 2EQSA 2Y0SG 2OQ0A 1W3SA 4DV6Q 2NZOA 4LF5Q 2PMZE 5C44G 1Q8KA 3AEVA 1VQLA 1KHIA 1NJIC 2UXDL 4JI0Q 3I4MG 1OXSC 4DUYL 1VQFA 4YWKA 2I5MX 2N49A 1FL0A 3GTGH 4X65L 1CKOA 3HOZH 4OX9L 2PI2A 2WAQG 2YTXA 1WFQA 1KL9A 5JJLA 1PH9A 3S24A 4JV5L 1S3OA 4DR5L 4A4IA 3J7A5 3K81C 3PUYA 1YVCA 2HIXA 4GS3A 1VQ4A 4DR7L 2HIVA 1V43A 3NELA 3HKSA 4LUOA 2JA9A 4A3KH 1L1OC 2RHQB 3BZKA 4R4QA 2MFIA 4LFAQ 4OWXB 3UE1A 4LF6Q 2JA7G 2VUMG 4BXXH 2F3IA 1J5EQ 4HIOA 1TWHH 2VQEQ 4J15A 4DR2Q 4GOPA 4JBKA 1VQCA 2CKZB 3FKIG 3TREA 3S2DH 1Q1EA 1HNWL 1I94Q 4DR4L 1JMCA 3PF5A 3U4ZA 1E22A 2WB1E 3KDFB 3G48A 3ER0A 2N3SA 4BY7G 4Y7NH 4TQUS 1BVSA 1ASYA 2HHHL 2CCZA 4HIDA 2JA5G 2JK8A 3CXCA 1IYJB 1K8AC 1QVCA 3F8TA 4IJLA 3A74A 3TS0A 2R93G 1A0IA 1NMGA 1SROA 4JI8L 3KLWA 4HJ8A 1Y1VG 5GROA 4DR1Q 1SFOH 1PA6A 4LFCQ 2XTIA 1GD7A 3AQQA 3K80C 1Y1WG 1XMOL 4GNXB 1M90C 2AKWB 4IFDG 3HOVG 4PG3A 2CQOA 3A0JA 1L1OA 3D31A 4X64L 3KJPA 2VL6A 4JCVE 4DV3L 4JOIA 1PHJA 4AH6A 1GKHA 4UY8C 1LM0A 1NY4A 2WB1G 3ULPA 3I4NH 2R7DA 3SGIA 1VQBA 3PUWA 4A75A 2F4VL 3KF8B 3PIPA 4QIWE 4NXNL 1K8GA 2OCEA 3RNUA 2B63G 4LF4Q 4JYAQ 5C3EG 1N9WA 3F2BA 2YTVA 1M1KC 3GO5A 4A3MH 2JA6G 3TQYA 1QZGA 2D62A 4X62Q 1YI2A 1MJEA 3GTQH 3HOXG 1XNQL
chains in the Genus database with same CATH superfamily
4S3SA 3AFPA 3E0EA 1PZJD 1GO3E 1I6VC 3D6CA 2TMPA 1IW7C 3FPUB 3PO2H 4FNFA 5LMUL 4XXEA 2CQAA 1Q12A 1K83B 4ZUJA 3K58A 3DEPA 5FJ8H 2R7ZH 4FVMA 5ELBA 3IKJA 4NP5A 3JAMc 3LX0A 1UNSA 4A3IG 4BBRG 3EN2A 4JI3Q 1VF5C 4LF7Q 1Z9FA 3MXGA 4JI6Q 2A1AA 5JJZA 2RF4A 1MD2D 3O13A 1B3AA 2IWHA 4KN7C 4B9XA 5BR8Q 2B2UC 1LTID 5A2QL 1QB5D 4JI4Q 3WOFA 1E2VA 4GN3B 3I4MH 4DAVA 1R9TB 3NTKA 4A3CH 1M4VA 4DAPA 2NZ1D 3I4OA 2EJFC 2IPKD 4K2LA 2J7ZA 3HOVB 2ZTCA 1WVLA 3I3CA 1HFGA 4ZLTF 5JVH3 2IY5B 3NE5B 4N8X1 2JA8H 3STBD 1IYVA 4U68A 1SN8A 3CHBD 2WP8J 2MP1A 5JJKA 4R8NA 3QG1A 2KHJA 2VB2X 3J81c 3S16H 2IX1A 1VQEA 4B08A 1E7ZA 4LUZA 3HOZB 4X3KA 4DV0Q 3CCQA 3I73A 5CV6A 1NAPA 4C3JG 2VQFQ 1G8ZD 4ABNA 2FJ2A 1VQGA 1PYBA 1EY7A 1XPUA 3OTOQ 3M4OH 2RA4A 1GUWA 2KECA 3ULLA 4A93H 1B9MA 4LF6L 4CKEA 2OT2A 1HUMA 1J5EL 1XX8A 5C3EH 3M85A 1VQIA 1HA5A 3U9SA 1YIJA 3E9HA 1SFOB 3CRLC 2VNUD 1LTLA 1R4QB 2E2JH 3CD6A 3OYYA 1STAA 1C0AA 1ZYRD 2RDGA 1VQDA 4GLVB 1PFBA 3S1QH 1A63A 2UXBL 2A69D 2A68D 1PRTB 3A5ZB 2WACA 4IZ8A 5CGKA 4A3IH 1CT1D 4BBRH 3S1RH 2YV5A 4GOPB 1VDZA 2CWAA 4FXKC 3G71A 1KC8C 2ATWA 4NXMQ 3PMFA 2DJGC 2RDHA 5IP9H 2F0WA 4KY5A 4LF4L 2L5TA 3NPPA 3TBIB 3S17B 1AN8A 4DAMA 4ZKBB 2I5HA 4DV5Q 2X6GA 4LF8Q 1T5XD 3RLFA 1VQ6A 3S2HB 2NVXH 1X3EA 1I4GA 1QJOA 1TR5A 1CQFA 2VY3A 2N78A 5CV8A 1YNNC 5FKAC 5M9OA 3QJYA 3KJOA 1DGSA 2A6ED 2H1EA 5JPNC 1JE5A 2PI2E 4PMCA 1SNPA 3EVQA 1S40A 4CDEC 5GADC 5LMNL 3N6RA 1EY6A 1YBYA 4KHVA 4TVAB 1VMCA 1V8QA 1CA5A 2BDOA 1YJNA 3T13A 3CAMA 2ZM6Q 3TSSA 2F0TA 2EY6A 3H0GG 1TWGH 4C3JH 1Y69U 5EPKA 1K3BC 2B8GA 4QY7A 1IXRA 1D5ZC 3DXJC 1AEXA 4P71A 4FXDA 3NEMA 1TWCB 5IWAQ 4X3SA 3M4QA 4JI5L 2VB3X 3MXPA 1EFWA 3TP6A 1N36Q 1O80A 3OOCA 2AHOB 2BA1A 3K57A 2AQ3B 1V1PB 4K8JA 2JA7H 1KQSA 1B3QA 1VQAA 4KV6A 1Q1BA 1JC7A 1HR0L 4JPBW 2AQ2B 1QUQB 1QWYA 3KLSA 3UDIA 4FXGC 1KDCA 4UP8A 3ITPA 2H5XA 1EWIA 3V2TA 1VQHA 2PQAA 2K14A 3CPWA 1YHAA 2A5HA 3GTOH 1WYDA 3W1GA 3L2PA 2R93H 3M9BA 4HSPA 1Y1WH 2F3WA 4CJ2C 2N88A 4I7AA 5EAYA 4LW1A 1HNXL 4RGMA 1PFSA 4DV7L 2WKCA 3IAYA 3S2DB 4HMIA 1GXDC 3BG3A 1L0WA 1BCPC 3DUZA 2RCFA 4Y7NB 4P73A 4N9TA 5M5YH 2EJMA 2E2HH 2V1CC 2M2LA 2L15A 4KN4C 1LABA 4DUYQ 4E6IA 2E8GA 4OX9Q 4ZAIA 3GP7A 3CRKC 1YZ6A 3S15H 1TQOA 2CWPA 1SYGA 1HZAA 1HTPA 1OXXK 3QB3A 3CCEA 4DR7Q 3OIPA 3VYUA 2EDGA 4GNXA 1TWAH 1L0XB 1TS4A 3LWUA 5DAUA 3T1YL 1HJPA 1EYDA 3J81E 5C6AA 3H0GH 1RTOA 1HZCA 4A3GG 3KF8A 5C0XG 1I6HH 3VA5A 4YHHL 4JK1C 5IYCH 3F1ZA 1TU2B 2PZUA 2FXQA 4OELB 1QNKA 2NBFA 4XT1B 1XMOQ 2MQHA 1UE6A 4JVZA 2KHSA 4WJ4A 5HGQA 1PV4A 2XIWA 2JP1A 4B3SL 2B3GA 1EEID 2K52A 3I4LA 2F4VQ 1JOQA 3HZXA 2QEJC 3QOLA 2QDLA 5DNFA 1LUZA 5C4XG 1JT8A 2KQ3A 1LTSD 3EIVA 2CH4A 3H3VI 1JJ2A 1PDQA 1LT5D 2AQ1B 3KK7A 4JI7L 1N33L 1STBA 1I4XA 1UE1A 1KD1C 4PNYA 3UDGA 5KGUA 4QUFA 4BBSG 1U4RA 4B3TQ 5ELNA 2VUMB 3R3OA 4QB4A 3CCRA 1EYGA 4EGVA 1YJWA 2B2YA 2RVLA 3HRZC 3K5NA 2ID0A 4R4TA 4EQPA 2EYPA 1SEBD 3H94A 5A35A 4A3GB 1LTRD 5IIFA 1GUSA 2LMCB 1Y1VB 4ULLA 1MIUA 1PFMA 4DNIA 1G6PA 2DNCA 4K6LA 3L7ZC 3E0JA 1BNZA 1QNUA 1QZHA 3RR5A 1WCMH 3A5UA 3PUVA 4KY7A 4IOCA 2WAQE 2ICIA 2QDBA 4HAEA 4JBWA 3RZOH 5C4XB 2A19A 1SMXA 1I4RA 2D9UA 4FF1A 2BE5C 2Z8LA 3FMCA 4LF5Q 5C44G 4OL7A 1V1OA 3S1NB 1FR3A 1NJIC 2UXDL 4JI0Q 1PZID 2I5MX 4G7OC 5C5MA 2K6AA 2WAQG 1QILA 1WFQA 1C48A 4BBSB 5JJLA 4DR5L 1LTGD 1EYCA 4A4IA 3K81C 4GS3A 2KEEA 3HS0C 4WORA 2RHQB 4LFAQ 3UE1A 5IODA 5K5PA 2EYJA 2F3IA 4HIOA 1TWHH 4Z9CB 1MSGA 1KABA 4GOPA 1G6ZA 1LT4D 1VQCA 5CV7A 4KTAA 1I94Q 4DR4L 4F88A 2WB1E 2RQXA 2F0DA 3ER0A 2CCZA 2F0KA 3SK4A 2ZT9C 1QVCA 5KNDA 3NK9A 1SROA 1PA6A 3KLWA 4LFCQ 3GTPH 1EY0A 3AQQA 1M90C 1HCZA 2Q8IB 1KTKA 2CQOA 1B50A 4JOIA 2WB1G 1YNJD 4HR7B 1K0SA 3NUCA 4A75A 3PIPA 4QIWE 2B63G 1ZEQX 5I9PA 3F2BA 3K59A 2QW7A 2YTVA 1M1KC 2JA6G 4A3MH 3SR1A 3J7YW 3TQYA 1QZGA 1ET9A 2Z4IA 1LV9A 1KDAA 2KUMA 3HOUG 1RF2D 5I9OA 2WAQB 1C7YA 2MGSA 1Y8NB 4GZYC 4KHZA 3GTLH 2F0HA 4OGQC 4EQNA 5LMNW 1RD9D 1H95A 1SLJA 3D4RA 3VYRA 5C4HA 4G7ZC 1EL0A 2JEAI 2N8NA 4GKJL 2QEXA 3G7LA 3M4YA 1PTOC 1C9OA 4RHRA 1TVXA 5C44H 2K5VA 1PH8A 5IT9L 1KNAA 1V1PA 3D4DA 5CMDA 3OHXC 4IALA 4FO2A 4DR3Q 1D5MC 5BN3A 2SOBA 3A8KE 4IJHA 4IUVA 4R4IA 3IFDA 1SYDA 4O1NA 1SNOA 3CC2A 3FDTA 1YJ9A 3M4PA 5FLMG 1D8LA 3URYA 2Q2TA 3OWFA 5COYA 4G7HC 4EX5A 1SNMA 1SYBA 5D65A 4KHPQ 4POGA 1PVOA 2L55A 4AIMA 1WD1A 4QMGA 4CJ1B 5M5WH 3HEJA 4LMQD 1IBLQ 3MWYW 4DKAC 5C0XI 1CM9A 4DV6L 2PQAB 4A3JH 3HOUB 1YNXA 2LXKA 2B2VC 1ONLA 1B53A 2L4NA 1S72A 1B7YB 2UUAQ 2C35B 1G291 3PO3G 1OXVA 3S14H 4WJ3M 3MZ5A 5CC4A 2X6LA 5C4ZA 1PTOH 2B63H 4RH6A 2E74C 2J4XA 1VF7A 2G9DA 2L1BA 5C5LA 2VQEL 4DR2L 3E5SA 3DWAA 2JA6H 2F0OA 2LSSA 3PCOB 2F0UA 3QWNA 2EY5A 1EY5A 1HH2P 4RHSA 4AYBE 4V0BA 1G91A 3E9IA 2NVYB 2ICEC 4YY3Q 2RHSB 4ILWA 1Q46A 1STNA 1A3UA 5CV5A 2AWOA 1STGA 1EWCA 4H0LC 4X66Q 1KAWA 3I91A 1X65A 4HEDA 1CZWA 4JW0A 1S4ZA 3P20A 3NENA 1VCIA 2UUCQ 3D8GA 5IGCA 1TS3A 2BOSA 4AYBG 2AWNA 2PO4A 3K0XA 4LUVA 2JJQA 4APVA 2YU9H 3CQZH 4R4CA 3UE0A 3GTMH 2B2TC 3K7AB 4MTKA 1XPRA 1OTCA 4DR4Q 1PZKD 1Y8PB 3I55A 2MUYA 3IL8A 4J1MA 1I5FA 4PZ7A 4X62L 3PO2B 2Z6KA 1ZKOA 1HNZQ 1J8IA 4GN5A 4MZ9A 1BCPF 1SYFA 1R4PB 3HOZG 3PO3B 5FLMH 1GOZA 2NTTA 2QA4A 1PH4A 4BY1H 2UUBL 1IBKL 1YNND 2UXCL 5T1GA 1XPOA 5C0XJ 2XSCA 3BJUA 3TEHB 1N34Q 4BXXG 1BKBA 4UAIA 4AQYQ 3DHQA 4P75A 3VYSA 2F52A 3HG9A 4J8QA 4WRDA 3D6WA 1U4PA 3KFUA 1II3A 2KEDA 4LFBQ 1S5CD 4IFDJ 1HQRD 4GKKL 4IO9A 3HKZB 4K0KL 4OEMB 3M7NA 2XVSA 3Q23A 3T1HL 5IGFA 4IUPA 3W5OA 1LO5D 4AYBB 1AZPA 5FK9C 1STHA 2F0PA 3GDEA 3GTJB 3I4NG 1DOMA 1FGBD 1YITA 3OW7A 3NTHA 3C3LA 2HCIA 2WFWA 3FHWA 4DN4M 3FKIH 2RDFA 1S5DD 3EQLC 4X3UA 2A74C 4DR6L 4G4KA 4BY7H 3T53B 1FYCA 4JBJA 1SSOA 4Q0FA 5I2XA 1D1KA 1CA6A 1Q81C 1C8CA 2EJGC 5G3LF 1FJGL 1R9TH 2HCCA 4C3HG 3KF6B 3DM1A 4JI2Q 5A2QE 3TMEA 1X9NA 3C46A 3UI2A 4A3KB 3HOVH 1JJCB 4K5WA 1AZQA 3H15A 1PRTC 2XWBB 1EIHA 4DV1L 1DOKA 4GOPC 5CV9A 1I4QA 3K8AA 5IE8A 5FLXL 1SNDA 1P16A 2EYOA 4R4OA 4H02A 1BCPD 1CHQD 4DUZL 1J6QA 2L11A 1DONA 2OWOA 1E2ZA 2PYKA 5BN5A 1SR3A 3CMAA 2DY7A 1AFPA 1WI5A 2MPMA 2MHVA 3H3VC 2QCPX 4K2KA 2JEBI 5JAVA 1NMFA 3SE0A 4JV5Q 4P2CB 4DV4L 2EYFA 3WDNA 1LYLA 3I4NB 3ND9A 1CI3M 1TS5A 4PV1C 1I4PA 4XQJA 1VQKA 1K0RA 1LLRD 4JOIC 4XQQA 1SJHD 5E1FA 5J1ZA 4A3DG 4YCVA 3Q22A 2Z9HA 2NN6G 1SXTA 2F0LA 5D3IB 1LTBD 3GTQB 1WTRA 3OSOA 4HCEA 4FYDA 4RFBA 4ALPA 1IZ6A 1QCBD 2NVXB 2F0MA 3I72A 2JSOA 3L3OC 1GJXA 4U673 1PH6A 3R8BA 1CUKA 4C3HB 4H7BA 3IFTA 3FEWX 5EKIA 1IBMQ 4LF9Q 1EY8A 3I7FA 1ET6A 1LTTD 1H9SA 3S1MH 2NUCA 3SDZA 3M3YB 4QF4A 5CV4A 1VQOA 3HFZB 1XTCD 3TP5A 3MVVA 4UP7A 4X64Q 2NVQB 4DV3Q 5IGGA 1IHZA 4ZYSA 4K5VA 3EROA 1QVGA 3CP0A 4KI0A 3BDCA 2KVMA 3HGBA 4NDXA 1F9SA 1W2BA 3CPFA 3SXHA 4KJOA 4ZK9B 1BBWA 4Q5VA 2L12A 1MBYA 3S17H 4IUTA 2K5NA 1XNQQ 2OEOA 1EQQA 3ERSX 4JI1L 1KAAA 3H3VH 4DF7A 1N32L 2F1MA 4PQXA 5LMUQ 3A7AB 1WD0A 5CBEE 2NYZD 3E6ZX 4KLKA 1O7IA 1DZ1A 3MA2B 2FMCA 2UXCQ 3S2HH 1HTLD 1QG7A 4A3DB 1EOTA 4B3ML 5GAEC 2EZVA 1QE6A 2I5LX 3U4VA 3MEHA 4DK3C 3NWTA 2FFKB 5HY6A 1HFNA 1N8RC 3A8IE 2K5HA 3NQIA 1IL2A 4F7XA 2UU9L 5AJ3L 1VQJA 1SNQA 1Z7TA 1UWVA 3RUZA 1BOSA 2E75C 2Y0SE 2CH4W 2M9VA 3H09A 4C1NI 3RZDB 3CC4A 4HJ7A 5IY0A 2E2IB 2AUJD 1XMQL 1WJJA 1PH2A 1X3GA 4A3EG 2NTSA 2B2WC 1NR2A 4A3FG 2E5LL 3K5OA 2I07B 2QGQA 3WWVA 2NN6H 4KK7A 1EU3A 1EQRA 2OXPA 2KBNA 2V4DA 3BZCA 4KJNA 3HOYG 3JAME 1AH9A 2EQSA 2Y0SG 4RCNA 2BE5D 2AUKA 4B9WA 1GHJA 1VQLA 3W2DA 1TT2A 1PTOF 2Z6BA 2N49A 1FL0A 4X65L 1CKOA 1ENFA 2R3ZA 2K5DA 2YTXA 4RAUC 1KL9A 3MTSA 5I2YA 1KDBA 1JICA 3D4WA 1SDFA 3HOWB 2XRQD 3NELA 1NSNS 3KUPA 1GUGA 4N8FA 4LF6Q 5CR3A 1IL8A 3GV3A 2VUMG 1J5EQ 3R2IA 4JBKA 2K32A 2PW5A 3TREA 5FO8B 3S2DH 1HNWL 1JMCA 3PF5A 2PZWA 1ZYRC 3G48A 4KD4A 2N3SA 4Y7NH 2HHHL 2A68C 3NXWA 5CBAE 2JA5G 2JK8A 5J39A 1K8AC 2JYOA 3F8TA 4IJLA 1A0IA 1NMGA 4JI8L 2UXBQ 1Y1VG 5GROA 4A3EB 4LJZC 4YIJA 1DD2A 4ODGA 4A3FB 1BCPB 4IFDG 1A3VA 3VR5A 4PG3A 3I8ZA 1DJRD 1L1OA 3D31A 5M3FB 1B1ZA 4JCVE 4AH6A 2RBMA 1WTWA 3HOYB 1NY4A 3ULPA 3SGIA 1VQBA 2Y0SB 4NXNL 1C4QA 2OCEA 4LF4Q 1H9RA 4C3IG 3GO5A 3BYTB 1EZ8A 4RCOA 4HMJA 1TY0A 4M8AA 1I50B 3HOXG 1CKNA 2N55A 3OMCA 3GQBA 4FDBA 3KBXA 1X3PA 1KRSA 5IT9c 1JOOA 1B44D 4UDUC 2A6EC 4TKOB 2WV6D 4DXGA 2F0IA 2HDLA 2XGTA 2IHFA 1RKNA 5E3FA 5IYBG 3J7AV 4V190 3W3AA 4R8IA 4QQBX 1EYAA 3UDFA 4C56C 1Q82C 5C4JB 5LMNQ 2FINB 2YYZA 1X32A 4A76A 1CK1A 4PZ8A 3PIO3 2R92B 1EY9A 1U9RA 2KENA 2HT1A 1H9MA 2PQEA 2JA5B 2KCMA 5DM63 1O78A 3ULJA 1MJCA 3BS1A 5KNCA 1IKLA 3RZOB 2D0PA 1K8MA 1STEA 4DV2L 4JI5Q 4B3RL 3KF6A 4ID6A 2NN6I 4QJFA 4K5XA 4C3IB 4RKLA 1NE3A 5EGTA 3U9OA 1BR9A 2B2UA 2EYHA 5M3MG 1HR0Q 2PW7A 4GLAC 4OIKA 3HOXB 3N52A 4EVOA 4HN7A 2F0SA 4RKBA 1RJTA 5EBCA 4CKCA 3J80c 5C0XH 4A3GH 2C5CA 4MHEA 5NUCA 1X54A 1Y1VH 1JWMD 4RA8A 2BH8A 4IOAA 2F0NA 5GAHC 4HIKA 1M8AA 4IFDH 3D0FA 4NB3A 1RODA 1HNXQ 1F2YA 2M00A 1JOKA 4DV7Q 5KEEA 1X56A 4A3LG 4IN3A 5IP7G 1H9KA 1QVFA 1PXUA 1E24A 5IYDG 5C4XH 5I6YA 1AP0A 1E1OA 3J7ZC 1O7ZA 4X65Q 4OO1G 4IUQA 2IJ0A 3S1NH 1QOHA 1D1IA 1RL2A 1MKHA 4DR1L 4L63B 3VR3A 2JE6I 3SK6A 3BVZA 4BBSH 2A8VA 3LNNA 1G2SA 4A3BG 2SDFA 5M3MB 2AMCB 3T56B 4DU9A 2RKSA 3T1YQ 2WKDA 2ZJPA 3AMUA 2HHHQ 1PRTF 4DNRB 2OTJA 4FF3A 3T51B 1K8OA 4WFN3 3LWEA 2O5IC 3A7LA 4YHHQ 5IGBA 3OWEB 1H9SB 1VQNA 1XWEA 1EIGA 3CCMA 1LACA 1ILQA 1XJVA 2K4KA 1NR4A 3NP8A 2FHTA 2G5DA 5H1SE 2K05A 4DGZA 1IW7D 2H4OA 5E4XA 3JAMi 1B9NA 1JWUD 3G6EA 4K14A 3Q8DA 2NVTB 4JI3L 4B3SQ 4LF7L 4CDDC 4JI6L 3L0OA 1Q8IA 1EIFA 2Q2HA 1HXYD 3I56A 1YHBA 4K8IA 5GAGC 4Y52H 1HA6A 4HJ5A 5BR8L 4K6DA 5JEAG 1TWFB 2VXWA 3CMEA 1PH3A 1TKWB 1XNRL 4JI4L 2CVRA 3CCLA 4FP5D 5HGTA 1V9PA 1W6JA 4JI7Q 1N33Q 5K36G 1I3QB 2EY1A 3NQTA 2ES2A 1OXTA 4KKSA 1UE5A 1Y14B 3GTKH 1Y8OB 4XTCS 3JC66 4A3BB 1U5KA 1ENCA 1MSHA 5EBDA 2HDMA 3J81i 3TS2A 1K73C 2A6HC 1RCVD 1IKMA 3QIAA 4O2DA 4H44C 1FVIA 5C3WA 4DK0A 1WTVA 3GTGB 1WTXA 1JQYD 2F0QA 2PNHA 4IQZA 3BDLA 5FLXc 3B6YA 2VQFL 3PO2G 2VZAA 3SVMA 4PZ6A 1B4OA 4IFDI 1EWHA 4C2MH 5IT9E 2R61A 3OTOL 4F87A 4ZQ3A 5EKLA 1DM0B 1VQMA 1JB7A 3HKZE 4NW2A 2R6GA 1KXLA 4LWCA 1VQ7A 2SNSA 3K5LA 1DYQA 4DAYB 3I70A 4JG2A 3PGZA 2K33A 5FOBB 4GNXC 3BVGA 3VR6A 2LY7A 2F0JA 1BDOA 1E3PA 2F03A 1P8LA 1HUNA 3FVQA 1L0YB 4A3CG 2UXDQ 4HJAA 3HOUH 2PNRC 2CFMA 4XIGS 5KRUA 3HKZG 1D6EC 1YHQA 3OMGA 4XYOA 2ZJQA 2EYLA 5IGDA 4DR5Q 3GTMB 2JA8G 1YEZA 3K7UC 3NTIA 1LT6D 2HQEA 1WTOA 3UDXA 1F2LA 4ZCKA 4CDCC 2HD3A 4NXML 2B8FA 4OIJA 4XT3B 2SEBD 1FNVA 2K5WA 1SE3A 1O7LA 4JYAL 1SRUA 2Q2UA 2B29A 4DV5L 4LF8L 2MO0A 5K36H 3OPOA 3F2DA 1JWSD 1WOCA 2EPBA 1SYEA 2NVYH 5DM73 3J80E 2R7ZB 4XQNA 4L5TA 4WJWA 1CKMA 5KYLA 1A2UA 1L1OB 2E76C 4RGOS 1PFNA 1GUNA 4I65A 3RN2A 1G51A 4A93G 3A54A 1OO9B 1RTNA 1A62A 3RLOA 4DA2A 4POFA 1ESRA 4A3KG 1CFMA 1F2ZA 5ELDA 2B2YC 4LNQA 3G6JB 1AW7A 5GQOA 2L0CA 4G57A 2KA7A 4CBVA 3I4MB 1CKNB 3K7AH 5BN4A 5M5XH 2ZM6L 1RDPD 5KIXA 4L8JA 1AE3A 2Q8RE 4KMUC 4YCUA 4QL5A 2L9HA 3TP7A 2JA8B 2EIFA 2K28A 4RG1A 3MXNA 3H91A 2PMZB 2LKVA 1F9PA 5IWAL 3S16B 3PO3H 4YWMA 2DUDA 4TRDA 2IX3A 3NBHB 1N36L 3HP3A 3FKIB 5JVG3 1K83H 1CSPA 2SNMA 5D14A 3K0YA 5IP9G 4GKJQ 2LXJA 4BY7B 2Z1CA 3J81j 1SMYC 2GVAA 3ND8A 1XNRQ 2XWJB 3EFXD 4N9PA 2B39A 4OO1I 4CJ0B 5ISRA 4XYQA 1S5BD 4M1UB 3MEFA 4KKUA 1XYIA 2XNAC 1SAPA 3M4OB 2CW0C 3Q24A 1Q3LA 3DM3A 1K28A 4A93B 2D0OA 3SHLA 2RCNA 3EA6A 1ESFA 5C3EB 2RSOA 3X3NA 1EIYB 4IUNA 3GTJH 2NB0A 1LTAD 4LAAA 2OQ0A 1GUOA 4HCSA 4DV6Q 2E2JB 2NZOA 1Q8KA 3NHHA 2BDNA 3S1QB 1KHIA 2K03A 4KD3A 1OXSC 4DUYL 1VQFA 4YWKA 3HOZH 4OX9L 4A3IB 4BBRB 3S1RB 2TSSA 3H6MA 1VQ4A 1ICWA 4DR7L 1V43A 4KY6A 3HKSA 4LUOA 2O4XA 4A3KH 3BZKA 2JA7G 3P75A 1BXTA 4BXXH 1HPCA 3V96A 1U4MA 3I90A 3MFGA 4J15A 2VQEQ 4DR2Q 3V05A 2EVBA 2EY2A 1HHVA 1Q1EA 4DNTB 3KDFB 4DK1A 1NUCA 1ASYA 4HIDA 3S1MB 1ILPA 4C1NK 2E2DC 2LS01 5FO7B 3A74A 2R93G 4HJ8A 1SFOH 5FLXE 1GD7A 1XMOL 1Y1WG 1S5FD 2HUGA 4KKTA 1VMPA 5E4WC 5IOCA 3A0JA 1PHJA 2I46A 2IW3A 3A8JE 3I4NH 1G2TA 2ZXRA 2F4VL 3VR4A 1DXMA 4JYAQ 1TWGB 4C3JB 2D62A 4X62Q 1YI2A 1MJEA 5J22A 5KYIA 4TSSA 1UUPA 2X69A 3GTQH 1J9OA 4BA1I 3I2ZA 5G3LD 3PUXA 1A6XA 3MXUA 5JPMC 2ZTDA 4C3HH 1CTMA 3VR2A 2DNEA 2UUBQ 1IBKQ 4B3TL 2KCTA 3VDYA 2JA7B 4CHTB 1VQ9A 4BS9A 3M3YH 2WINB 2IX0A 2NVQH 3HOWG 4H13C 2QILA 2IHEA 4YCWA 2IT1A 1SE8A 4GKKQ 5JJIA 3AFQA 3CCSA 5ELCA 2CHBD 3ONAB 4K0KQ 1A2TA 1PH1A 3GTOB 2R93B 5HURA 5IYCG 2OQKA 3KBGA 1Y1WB 3TZDA 2PZTA 3JAML 1W6KA 1EY4A 1HZ9A 5CYUA 4OONA 3STBC 3T1HQ 2I0QA 5JEAJ 5EKKA 2ZJRA 1TY2A 4HTHA 1FGUA 4DK6C 4IPHA 4L5QA 3T4AC 1K3RA 1VQ8A 3OW2A 3X3MA 4A3DH 1EFID 1TWCH 4IPDA 5M5YB 2DGYA 5C3XA 2E2HB 1EZ6A 5M3FG 1JE4A 2MNAA 3RMHA 2YTYA 1S5ED 2DN8A 3J80i 4LF5L 3FRPB 3CCUA 1GM5A 4DAYA 4R9WA 4DR6Q 4NMZA 1DOLA 3RLNA 4JI0L 2BCOA 1PYSB 4EQOA 1Z6HA 2D5DA 3U50C 3S15B 4PMBA 1FJGQ 1A3TA 3SK8A 2QF7A 3PV0A 2ZTEA 1CZGA 2OF1A 3J81L 3RZDH 2F0GA 3G4SA 4QCLA 2PPBC 2E2IH 1TWAB 5KNBA 1ASZA 3W1BA 3MFYA 3TN2A 4LFAL 1EQTA 1X6OA 4CDFC 3K5MA 4DV1Q 3H0GB 4F8MA 2F3VA 1I6HB 4DXFA 3AB9A 1I94L 2ZXPA 2B2VA 2XN9C 4CKBA 5LL6S 4DUZQ 1BF4A 1EUJA 1VS0A 2R92G 4EQ5A 2Z6KC 1JJGA 1WTHA 2A69C 4UP9A 4RGTA 1PLFA 1V1QA 1MI2A 3Q0AA 3AYHB 4RMFA 1BQQT 4LFCL 2DJFC 4DFAA 4DV4Q 1WCMG 1A8VA 1PMRA 2K01A 1ML0D 5DLQE 1EU4A 2NWGA 3ZYYX 1CSQA 5LL6X 2F4IA 1JR0D 3HOWH 3PF4A 2JQOA 5DEHA 2K50A 2EXDA 2K75A 3TZUA 1RIPA 3NWSA 2C9OA 2A73B 3R93A 2BA0A 2LFNA 3PIOA 4X3TA 3KLSX 2GVBA 3C1FA 5FO9B 1U0LA 3A55A 1XTDA 1NCVA 4PMWA 3E3XA 4P72A 1NBWA 1UAPA 1VQPA 4A3EH 1F77A 3U58A 2F0VA 1D7QA 1LT3D 4A3FH 1BUVT 2B2TA 2BH2A 4R1JA 5M3FH 3EJIA 3MAQA 1WTPA 2VW9A 1ZXTA 3HOYH 3NBHA 2R7FA 3BVMA 4NKLA 1EOVA 1PTOD 4DR3L 4JI1Q 1D5XC 2KOLA 4IPCA 3MXNB 1I50H 1N32Q 1ENAA 1K9MC 2EYMA 1WCMB 1A15A 2EE1A 2JXMB 4ZKCB 4ZUIA 4B3MQ 1RHPA 4KHPL 3CU7A 2ALYB 2J0TD 4J6HA 1FNWA 1E0BA 1GVPA 4MNOA 3F2CA 2VUMH 3RN5A 4GLXA 2A6HD 5C4JH 1B70B 2MO1A 4XDXA 5EQ0A 1STYA 4A3MG 1IBLL 2ASBA 5ELEA 4L5SA 2K7VA 3VYTA 1WTQA 2UU9Q 2R92H 4RGNA 5AJ3Q 4ZRZA 2JA5H 4L5RC 1U4LA 2EXZA 3PQIA 1JCKB 1XMQQ 2UUAL 3TRZA 2MJ8A 3FP9A 3ZJYC 3IRBA 1SE4A 2E5LQ 5JOBA 2KHIA 1TWHB 1DCZA 2F0EA 4QGUA 4GN4B 3CKIB 4C3IH 3CF5A 2O2LD 1SJED 4JC0A 1F9RA 2Z0SA 4YY3L 3HOXH 3GTPB 3QO2A 5ELFA 3KDFA 4X66L 4IURA 3EBEA 5IYBH 1JB3A 1MGSA 3ERQA 2UUCL 1NNXA 1UEBA 1Q86C 3P1HA 1TXYA 4A3MB 3T16A 1PH5A 3TDQA 3KOJA 4OWWB 2OTLA 1BO0A 3DEOA 4NPSA 1HNWQ 3DLLA 1T9HA 4IPGA 4A3JG 2GN5A 3BU2A 4O0AA 1HNZL 3NSWA 1T5EA 3GV6A 3RD4A 3GTLB 5I6WA 4YWLA 1FNUA 2K04A 3CCVA 2G9HD 4JI8Q 3BYYB 4OHJA 1JORA 3VA7A 1HQMC 4BWGB 1NTGA 4HJ9A 1N34L 1E1TA 3CCJA 4AQYL 5C44B 3BDOA 4FF2A 3NBIA 3QOJA 3OIQA 3CW2C 4ME5A 2Z4HA 4NXNQ 1CQVA 1KLUD 4LFBL 5M3MH 4FF4A 1I4HA 3M7GA 2QKIC 3LGJA 3D3RA 4OXPA 1HRJA 5AFWA 3AU7A 3GTKB 3DWPA 2KJXA 1HZBA 4BA2I 3GD7A 1KIXA 2ENBA 1XXGA 3Q6SA 5CORA 5E7NA 3P7JA 1GUTA 1KLGD 2EOTA 2ZXOA 4OWTB 1UEAB 2NZHA 4UPAA 2Q2IA 4ME3A 4MTNA 3BZDB 3PIP3 1EEFD 1X55A 1TS2A 1X3FA 1B8AA 4HSVA 3A56A 1F9QA 2FMMA 5M5WB 3C2PA 4JBMA 4A3LH 2NVTH 4LK1C 1OXUA 5IP7H 3KYHC 4A3JB 1PYWD 4P74A 4QUCA 4X6AH 5IYDH 1Q90A 4HIMA 1SMYD 1X3QA 2VS1A 3KLRA 1BBUA 1Q7YC 1QUQA 1TWFH 1L2FA 4C2MB 4DV0L 4OO1H 5J3BA 2K1BA 3SEBA 3CC7A 2KCCA 5D3DA 5EJWA 1VQ5A 1I3QH 3R2TA 3PSIA 4JI2L 3S14B 2HQLA 4UHVA 4BY1G 1Z47A 2WB1B 1HR0W 4MIUA 3MC0B 3S9WA 2CW0D 5FJ8G 4DV2Q 2R7ZG 1PTOB 2B63B 1PH7A 4B3RQ 3PUZA 5EPJA 1CHPD 2XRSD 1AE2A 2Q8TA 2JA6B 4DPGA 4A3BH 1KRTA 1UE7A 2O5JC 3WOEA 5ELOA 3ICEA 1SE2A 2P5ZX 3SK5A 5I4DA 1FD7D 1PRTD 1W3SA 2D2CC 3F2UA 1GHKA 2PMZE 4CGYB 3AEVA 1SYCA 5L37A 5F2DA 1IYUA 3I4MG 4O42A 3GTGH 1H9JA 4QIWB 2PI2A 4I7ZC 1PH9A 3S24A 4L6TB 4JV5L 1S3OA 2B2WA 3J7A5 3PUYA 1YVCA 2HIXA 3TP8A 2YU9B 3CQZB 2HIVA 2JA9A 2GA4B 1L1OC 4R4QA 4OWXB 2MFIA 3J80L 2DY8A 3FPPA 1SNCA 2CKZB 3FKIG 4RWSC 5T1IA 3U4ZA 1E22A 5JEAH 1O7YA 1F2MA 5LHY1 2WIIB 4BY7G 5IGEA 1BBXC 1B2TA 4TQUS 1BVSA 1KNEA 1MHWC 4MN3A 1SBBB 3CXCA 1IYJB 5TSSA 3QR8A 3TS0A 4BY1B 1IBML 4LF9L 3L9AX 4DR1Q 2PCFB 2XTIA 3K80C 2JN4A 4GNXB 1ICFB 2AKWB 3J7AF 3HOVG 1EQVA 1YNJC 4X64L 3DMUA 3KJPA 4DV3L 3K6OA 2VL6A 1TIID 2IL8A 4IUUA 1GKHA 4UY8C 1LM0A 5EPLA 2R7DA 5M5XB 3PUWA 1E2WA 1D2BA 2K5QA 3KF8B 1K8GA 2F0FA 3RNUA 3DWQA 3C1EA 1N9WA 5C3EG 3MHBA 2KCNA 1XNQL 2RSNA
chains in the Genus database with same CATH topology
1CKNA 3AFPA 3E0EA 4FDBA 3HOUG 4BA1I 1C7YA 1GO3E 1KRSA 3I2ZA 5IT9c 3PUXA 3PO2H 4KHZA 3GTLH 5LMUL 2ZTDA 2XGTA 4C3HH 5LMNW 2IHFA 1Q12A 5FJ8H 5IYBG 2R7ZH 3JAMc 1IBKQ 2UUBQ 2KCTA 3VDYA 4B3TL 1SLJA 1H95A 4A3IG 4QQBX 4BBRG 3EN2A 1VQ9A 4JI3Q 3M3YH 4LF7Q 3UDFA 1Z9FA 1Q82C 4JI6Q 2A1AA 5LMNQ 2YYZA 2IX0A 2N8NA 2RF4A 4A76A 2QEXA 2JEAI 2NVQH 4GKJL 3HOWG 4PZ8A 1C9OA 2IHEA 4YCWA 2IT1A 4LF9L 1SE8A 2K5VA 5BR8Q 5C44H 2KENA 1PH8A 2HT1A 4GKKQ 5JJIA 3AFQA 3CCSA 4JI4Q 4GN3B 2KCMA 3I4MH 4K0KQ 4DR3Q 1PH1A 3ULJA 4A3CH 5IYCG 4IJHA 4R4IA 2OQKA 1MJCA 3I4OA 1HZ9A 3CC2A 1YJ9A 2ZTCA 4JYAL 4OONA 3STBC 3T1HQ 3M4PA 5FLMG 2I0QA 2IY5B 1D8LA 2Q2TA 5JEAJ 2D0PA 2JA8H 4EX5A 3STBD 2ZJRA 4DV2L 4JI5Q 1SN8A 4B3RL 2WP8J 3KF6A 1FGUA 4KHPQ 5JJKA 2KHJA 4IPHA 4L5QA 4DK6C 2NN6I 1K3RA 4QJFA 3J81c 4AIMA 1VQ8A 2IX1A 3OW2A 3S16H 4A3DH 1VQEA 1TWCH 4IPDA 2DGYA 1NE3A 5M3FG 5M5WH 5M3MG 2MNAA 1HR0Q 1IBLQ 4GLAC 2YTYA 4DKAC 5C0XI 4DV6L 3J80i 4LF5L 1E7ZA 4LUZA 2PQAB 3CCUA 4A3JH 1YNXA 1GM5A 2LXKA 4DV0Q 3J80c 3CCQA 4DR6Q 4A3GH 3RLNA 4JI0L 1PYSB 1X54A 2VQFQ 3U50C 1Y1VH 1FJGQ 2BH8A 1VQGA 4IOAA 1PYBA 5GAHC 1B7YB 4HIKA 1S72A 2UUAQ 2C35B 2ZTEA 3D0FA 3PV0A 3RZDH 1XPUA 1G291 3OTOQ 3PO3G 3G4SA 4NB3A 3M4OH 2E2IH 1OXVA 1ASZA 1HNXQ 3W1BA 3S14H 4WJ3M 3ULLA 4A93H 4DV7Q 4A3LG 1X56A 4LFAL 4LF6L 1X6OA 2B63H 5IP7G 1J5EL 4DV1Q 1QVFA 5C3EH 3M85A 2VQEL 4DR2L 2JA6H 1VQIA 2LSSA 1E24A 3PCOB 5IYDG 5C4XH 1I94L 1E1OA 1HH2P 4AYBE 1YIJA 3E9HA 3GTPH 4DUZQ 3E9IA 1EUJA 2VNUD 1VS0A 3J7ZC 1LTLA 2R92G 4EQ5A 2Z6KC 2E2JH 1JJGA 4YY3Q 4X65Q 2RHSB 3CD6A 3OYYA 4OO1G 1Q46A 4UP9A 1C0AA 2AWOA 1V1QA 1VQDA 4GLVB 3S1NH 3S1QH 3AYHB 1RL2A 4RMFA 1KAWA 1MKHA 4LFCL 4X66Q 4DR1L 1X65A 2UXBL 3A5ZB 4DV4Q 2JE6I 1PVOA 4A3IH 3NENA 1WCMG 1A8VA 4BBRH 3S1RH 2YV5A 4BBSH 1VCIA 4GOPB 2UUCQ 2CWAA 3G71A 5DLQE 2A8VA 4A3BG 4AYBG 1KC8C 1CSQA 2AWNA 4NXMQ 2ATWA 3K0XA 4LUVA 2JJQA 4APVA 2YU9H 3CQZH 4R4CA 3UE0A 3GTMH 2AMCB 3HOWH 3PF4A 2JQOA 5IP9H 2K50A 3T1YQ 1XPRA 1OTCA 4LF4L 2EXDA 2K75A 4DR4Q 1RIPA 2ZJPA 3I55A 4DAMA 1I5FA 4PZ7A 4X62L 2HHHQ 2I5HA 2Z6KA 4DV5Q 2OTJA 1HNZQ 2BA0A 4LF8Q 4GN5A 4YHHQ 1IBML 4MZ9A 3PIOA 3RLFA 1VQ6A 3HOZG 2GVBA 1VQNA 1U0LA 2NVXH 1X3EA 3CCMA 5FLMH 1XJVA 2K4KA 1XTDA 2N78A 2VY3A 4PMWA 4P72A 1NBWA 5H1SE 2QA4A 1PH4A 4BY1H 3KJOA 1VQPA 1DGSA 2UUBL 1IBKL 3JAMi 3G6EA 3U58A 4A3EH 1D7QA 2UXCL 1JE5A 3Q8DA 2PI2E 1XPOA 5C0XJ 4JI3L 4A3FH 1S40A 4B3SQ 5GADC 3BJUA 3TEHB 4LF7L 1N34Q 4BXXG 4JI6L 1BKBA 5LMNL 2BH2A 3L0OA 4AQYQ 1EIFA 2Q2HA 4P75A 4R1JA 5M3FH 2F52A 1YBYA 4TVAB 3HOYH 3KFUA 3I56A 2VW9A 1YHBA 4Y52H 5GAGC 4IFDJ 4HJ5A 4LFBQ 2R7FA 5BR8L 5JEAG 3CMEA 1YJNA 1PH3A 4GKKL 3CAMA 2ZM6Q 4IO9A 1XNRL 4JI4L 3H0GG 1EOVA 3CCLA 1TWGH 4K0KL 4C3JH 4DR3L 1V9PA 4JI7Q 1N33Q 5K36G 4JI1Q 4IPCA 4QY7A 3MXNB 1I50H 1N32Q 2ES2A 1IXRA 3M7NA 1K9MC 1OXTA 1UE5A 1Y14B 3T1HL 4P71A 3GTKH 4XTCS 3JC66 3NEMA 3W5OA 1U5KA 5IWAQ 3M4QA 4JI5L 1EFWA 4B3MQ 3GDEA 1N36Q 4KHPL 3I4NG 3J81i 2AHOB 2BA1A 1K73C 2ALYB 3TS2A 2JA7H 1KQSA 1GVPA 4MNOA 3F2CA 2VUMH 1VQAA 3RN5A 1YITA 4O2DA 4GLXA 5C4JH 2ASBA 1B70B 1FVIA 1Q1BA 2MO1A 2WFWA 3FHWA 4A3MG 1HR0L 1IBLL 1QUQB 3FKIH 3UDIA 4L5SA 2UU9Q 2R92H 4UP8A 5AJ3Q 4DR6L 2H5XA 4BY7H 1EWIA 2PNHA 5FLXc 1VQHA 3B6YA 2PQAA 2VQFL 4JBJA 2JA5H 4L5RC 2K14A 3PO2G 2VZAA 1Q81C 3CPWA 1YHAA 1FJGL 1R9TH 3GTOH 1WYDA 3W1GA 4PZ6A 3L2PA 3KF6B 3M9BA 2R93H 4IFDI 1XMQQ 4JI2Q 2UUAL 4C2MH 1X9NA 3TRZA 1Y1WH 3OTOL 5EAYA 3FP9A 3HOVH 1JJCB 4LW1A 3ZJYC 1HNXL 3IRBA 2E5LQ 3H15A 1VQMA 1JB7A 1PFSA 2KHIA 3HKZE 4DV7L 2R6GA 1KXLA 4LWCA 1VQ7A 4QGUA 4DAYB 4DV1L 4JG2A 3PGZA 4GNXC 1L0WA 4GOPC 4GN4B 3K8AA 4P73A 5IE8A 4C3IH 3CF5A 4R4OA 1P16A 5M5YH 2E2HH 1E3PA 2V1CC 4H02A 4JC0A 4DUZL 2Z0SA 1J6QA 1P8LA 2L15A 2OWOA 4A3CG 1SR3A 4YY3L 3HOXH 3CMAA 4HJAA 2UXDQ 1WI5A 3HOUH 4DUYQ 4XIGS 2CFMA 2E8GA 3KDFA 4OX9Q 3HKZG 4X66L 1YHQA 2JEBI 3EBEA 1NMFA 4JV5Q 2ZJQA 1YZ6A 3S15H 4DV4L 4DR5Q 1LYLA 2CWPA 2JA8G 1YEZA 3K7UC 5IYBH 1HZAA 1VQKA 1OXXK 2UUCL 3CCEA 4DR7Q 1K0RA 3UDXA 1UEBA 4JOIC 1Q86C 4A3DG 4GNXA 4NXML 1TWAH 4YCVA 1TXYA 1PH5A 2NN6G 3KOJA 4OWWB 3T1YL 2OTLA 1HJPA 4NPSA 1HNWQ 3DLLA 1T9HA 4IPGA 4A3JG 4ALPA 1IZ6A 1SRUA 2GN5A 3H0GH 2B29A 3BU2A 4O0AA 4DV5L 1HZCA 1HNZL 2Q2UA 4A3GG 5C0XG 1I6HH 1A63A 4LF8L 2MO0A 4YHHL 4YWLA 1PH6A 1CUKA 3F2DA 5IYCH 3F1ZA 3CCVA 1WOCA 2NVYH 2FXQA 1IBMQ 4LF9Q 2UXBQ 4JI8Q 4L5TA 1CKMA 3I7FA 1XMOQ 1L1OB 2MQHA 3S1MH 1NTGA 1UE6A 1VQOA 4WJ4A 4HJ9A 3HFZB 5HGQA 1G51A 4X64Q 4UP7A 3RN2A 1PV4A 4DV3Q 4A93G 4B3SL 2B3GA 2K52A 1N34L 1E1TA 3CCJA 1A62A 1QVGA 3RLOA 4AQYL 4POFA 3CP0A 4A3KG 2F4VQ 4KI0A 1W2BA 3CW2C 4NXNQ 3CPFA 4LNQA 1LUZA 5C4XG 1JT8A 4LFBL 3EIVA 5GQOA 5M3MH 1CKNB 3K7AH 1BBWA 5M5XH 2ZM6L 3H3VI 3LGJA 4OXPA 1JJ2A 1AE3A 3S17H 2K5NA 1XNQQ 1EQQA 4JI7L 1N33L 3ERSX 4JI1L 1UE1A 1HZBA 1KD1C 3H3VH 4BA2I 3GD7A 1KIXA 1N32L 4YCUA 4QL5A 5LMUQ 5E7NA 2EIFA 4RG1A 4KLKA 1O7IA 4OWTB 2NZHA 2UXCQ 3S2HH 4UPAA 3UDGA 2Q2IA 4ME3A 4MTNA 5IWAL 4BBSG 3PO3H 4B3TQ 5ELNA 2DUDA 4YWMA 1X55A 1X3FA 4B3ML 5GAEC 1B8AA 3NBHB 1N36L 2I5LX 3CCRA 3U4VA 1EYGA 1YJWA 4JBMA 4A3LH 1K83H 2NVTH 1CSPA 2ID0A 4DK3C 4R4TA 2LXJA 5HY6A 5IP9G 1OXUA 5IP7H 3KYHC 4GKJQ 1N8RC 3J81j 4POGA 2GVAA 2K5HA 1IL2A 4P74A 1XNRQ 4X6AH 5IYDH 4HIMA 2UU9L 2VS1A 5AJ3L 1BBUA 4OO1I 1VQJA 1Q7YC 1QUQA 1TWFH 1L2FA 1MIUA 1UWVA 4DNIA 4DV0L 1G6PA 2Y0SE 5J3BA 3MEFA 3CC7A 3CC4A 4HJ7A 5IY0A 1VQ5A 1XMQL 1I3QH 3L7ZC 3PSIA 4JI2L 1WJJA 2HQLA 3DM3A 4BY1G 1Z47A 1X3GA 1PH2A 1HR0W 1QZHA 2D0OA 4A3EG 3RR5A 2RCNA 5FJ8G 4DV2Q 1WCMH 3A5UA 3PUVA 2R7ZG 1PH7A 4B3RQ 3PUZA 4A3FG 2E5LL 4IOCA 2WAQE 4A3BH 1AE2A 2QGQA 4DPGA 1KRTA 3WWVA 4JBWA 1EIYB 3RZOH 2A19A 1SMXA 1EQRA 1UE7A 3BZCA 2KBNA 5ELOA 3GTJH 3HOYG 3ICEA 1AH9A 2EQSA 2Y0SG 2OQ0A 1W3SA 4DV6Q 2NZOA 4LF5Q 2PMZE 5C44G 1Q8KA 3AEVA 1VQLA 1KHIA 1NJIC 2UXDL 4JI0Q 3I4MG 1OXSC 4DUYL 1VQFA 4YWKA 2I5MX 2N49A 1FL0A 3GTGH 4X65L 1CKOA 3HOZH 4OX9L 2PI2A 2WAQG 2YTXA 1WFQA 1KL9A 5JJLA 1PH9A 3S24A 4JV5L 1S3OA 4DR5L 4A4IA 3J7A5 3K81C 3PUYA 1YVCA 2HIXA 4GS3A 1VQ4A 4DR7L 2HIVA 1V43A 3NELA 3HKSA 4LUOA 2JA9A 4A3KH 1L1OC 2RHQB 3BZKA 4R4QA 2MFIA 4LFAQ 4OWXB 3UE1A 4LF6Q 2JA7G 2VUMG 4BXXH 2F3IA 1J5EQ 4HIOA 1TWHH 2VQEQ 4J15A 4DR2Q 4GOPA 4JBKA 1VQCA 2CKZB 3FKIG 3TREA 3S2DH 1Q1EA 1HNWL 1I94Q 4DR4L 1JMCA 3PF5A 3U4ZA 1E22A 2WB1E 3KDFB 3G48A 3ER0A 2N3SA 4BY7G 4Y7NH 4TQUS 1BVSA 1ASYA 2HHHL 2CCZA 4HIDA 2JA5G 2JK8A 3CXCA 1IYJB 1K8AC 1QVCA 3F8TA 4IJLA 3A74A 3TS0A 2R93G 1A0IA 1NMGA 1SROA 4JI8L 3KLWA 4HJ8A 1Y1VG 5GROA 4DR1Q 1SFOH 1PA6A 4LFCQ 2XTIA 1GD7A 3AQQA 3K80C 1Y1WG 1XMOL 4GNXB 1M90C 2AKWB 4IFDG 3HOVG 4PG3A 2CQOA 3A0JA 1L1OA 3D31A 4X64L 3KJPA 2VL6A 4JCVE 4DV3L 4JOIA 1PHJA 4AH6A 1GKHA 4UY8C 1LM0A 1NY4A 2WB1G 3ULPA 3I4NH 2R7DA 3SGIA 1VQBA 3PUWA 4A75A 2F4VL 3KF8B 3PIPA 4QIWE 4NXNL 1K8GA 2OCEA 3RNUA 2B63G 4LF4Q 4JYAQ 5C3EG 1N9WA 3F2BA 2YTVA 1M1KC 3GO5A 4A3MH 2JA6G 3TQYA 1QZGA 2D62A 4X62Q 1YI2A 1MJEA 3GTQH 3HOXG 1XNQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKN A;  3AFP A;  3E0E A;  4FDB A;  3HOU G;  4BA1 I;  1C7Y A;  1GO3 E;  1KRS A;  3I2Z A;  5IT9 c;  3PUX A;  3PO2 H;  4KHZ A;  3GTL H;  5LMU L;  2ZTD A;  2XGT A;  4C3H H;  5LMN W;  2IHF A;  1Q12 A;  5FJ8 H;  5IYB G;  2R7Z H;  3JAM c;  1IBK Q;  2UUB Q;  2KCT A;  3VDY A;  4B3T L;  1SLJ A;  1H95 A;  4A3I G;  4QQB X;  4BBR G;  3EN2 A;  1VQ9 A;  4JI3 Q;  3M3Y H;  4LF7 Q;  3UDF A;  1Z9F A;  1Q82 C;  4JI6 Q;  2A1A A;  5LMN Q;  2YYZ A;  2IX0 A;  2N8N A;  2RF4 A;  4A76 A;  2QEX A;  2JEA I;  2NVQ H;  4GKJ L;  3HOW G;  4PZ8 A;  1C9O A;  2IHE A;  4YCW A;  2IT1 A;  4LF9 L;  1SE8 A;  2K5V A;  5BR8 Q;  5C44 H;  2KEN A;  1PH8 A;  2HT1 A;  4GKK Q;  5JJI A;  3AFQ A;  3CCS A;  4JI4 Q;  4GN3 B;  2KCM A;  3I4M H;  4K0K Q;  4DR3 Q;  1PH1 A;  3ULJ A;  4A3C H;  5IYC G;  4IJH A;  4R4I A;  2OQK A;  1MJC A;  3I4O A;  1HZ9 A;  3CC2 A;  1YJ9 A;  2ZTC A;  4JYA L;  4OON A;  3STB C;  3T1H Q;  3M4P A;  5FLM G;  2I0Q A;  2IY5 B;  1D8L A;  2Q2T A;  5JEA J;  2D0P A;  2JA8 H;  4EX5 A;  3STB D;  2ZJR A;  4DV2 L;  4JI5 Q;  1SN8 A;  4B3R L;  2WP8 J;  3KF6 A;  1FGU A;  4KHP Q;  5JJK A;  2KHJ A;  4IPH A;  4L5Q A;  4DK6 C;  2NN6 I;  1K3R A;  4QJF A;  3J81 c;  4AIM A;  1VQ8 A;  2IX1 A;  3OW2 A;  3S16 H;  4A3D H;  1VQE A;  1TWC H;  4IPD A;  2DGY A;  1NE3 A;  5M3F G;  5M5W H;  5M3M G;  2MNA A;  1HR0 Q;  1IBL Q;  4GLA C;  2YTY A;  4DKA C;  5C0X I;  4DV6 L;  3J80 i;  4LF5 L;  1E7Z A;  4LUZ A;  2PQA B;  3CCU A;  4A3J H;  1YNX A;  1GM5 A;  2LXK A;  4DV0 Q;  3J80 c;  3CCQ A;  4DR6 Q;  4A3G H;  3RLN A;  4JI0 L;  1PYS B;  1X54 A;  2VQF Q;  3U50 C;  1Y1V H;  1FJG Q;  2BH8 A;  1VQG A;  4IOA A;  1PYB A;  5GAH C;  1B7Y B;  4HIK A;  1S72 A;  2UUA Q;  2C35 B;  2ZTE A;  3D0F A;  3PV0 A;  3RZD H;  1XPU A;  1G29 1;  3OTO Q;  3PO3 G;  3G4S A;  4NB3 A;  3M4O H;  2E2I H;  1OXV A;  1ASZ A;  1HNX Q;  3W1B A;  3S14 H;  4WJ3 M;  3ULL A;  4A93 H;  4DV7 Q;  4A3L G;  1X56 A;  4LFA L;  4LF6 L;  1X6O A;  2B63 H;  5IP7 G;  1J5E L;  4DV1 Q;  1QVF A;  5C3E H;  3M85 A;  2VQE L;  4DR2 L;  2JA6 H;  1VQI A;  2LSS A;  1E24 A;  3PCO B;  5IYD G;  5C4X H;  1I94 L;  1E1O A;  1HH2 P;  4AYB E;  1YIJ A;  3E9H A;  3GTP H;  4DUZ Q;  3E9I A;  1EUJ A;  2VNU D;  1VS0 A;  3J7Z C;  1LTL A;  2R92 G;  4EQ5 A;  2Z6K C;  2E2J H;  1JJG A;  4YY3 Q;  4X65 Q;  2RHS B;  3CD6 A;  3OYY A;  4OO1 G;  1Q46 A;  4UP9 A;  1C0A A;  2AWO A;  1V1Q A;  1VQD A;  4GLV B;  3S1N H;  3S1Q H;  3AYH B;  1RL2 A;  4RMF A;  1KAW A;  1MKH A;  4LFC L;  4X66 Q;  4DR1 L;  1X65 A;  2UXB L;  3A5Z B;  4DV4 Q;  2JE6 I;  1PVO A;  4A3I H;  3NEN A;  1WCM G;  1A8V A;  4BBR H;  3S1R H;  2YV5 A;  4BBS H;  1VCI A;  4GOP B;  2UUC Q;  2CWA A;  3G71 A;  5DLQ E;  2A8V A;  4A3B G;  4AYB G;  1KC8 C;  1CSQ A;  2AWN A;  4NXM Q;  2ATW A;  3K0X A;  4LUV A;  2JJQ A;  4APV A;  2YU9 H;  3CQZ H;  4R4C A;  3UE0 A;  3GTM H;  2AMC B;  3HOW H;  3PF4 A;  2JQO A;  5IP9 H;  2K50 A;  3T1Y Q;  1XPR A;  1OTC A;  4LF4 L;  2EXD A;  2K75 A;  4DR4 Q;  1RIP A;  2ZJP A;  3I55 A;  4DAM A;  1I5F A;  4PZ7 A;  4X62 L;  2HHH Q;  2I5H A;  2Z6K A;  4DV5 Q;  2OTJ A;  1HNZ Q;  2BA0 A;  4LF8 Q;  4GN5 A;  4YHH Q;  1IBM L;  4MZ9 A;  3PIO A;  3RLF A;  1VQ6 A;  3HOZ G;  2GVB A;  1VQN A;  1U0L A;  2NVX H;  1X3E A;  3CCM A;  5FLM H;  1XJV A;  2K4K A;  1XTD A;  2N78 A;  2VY3 A;  4PMW A;  4P72 A;  1NBW A;  5H1S E;  2QA4 A;  1PH4 A;  4BY1 H;  3KJO A;  1VQP A;  1DGS A;  2UUB L;  1IBK L;  3JAM i;  3G6E A;  3U58 A;  4A3E H;  1D7Q A;  2UXC L;  1JE5 A;  3Q8D A;  2PI2 E;  1XPO A;  5C0X J;  4JI3 L;  4A3F H;  1S40 A;  4B3S Q;  5GAD C;  3BJU A;  3TEH B;  4LF7 L;  1N34 Q;  4BXX G;  4JI6 L;  1BKB A;  5LMN L;  2BH2 A;  3L0O A;  4AQY Q;  1EIF A;  2Q2H A;  4P75 A;  4R1J A;  5M3F H;  2F52 A;  1YBY A;  4TVA B;  3HOY H;  3KFU A;  3I56 A;  2VW9 A;  1YHB A;  4Y52 H;  5GAG C;  4IFD J;  4HJ5 A;  4LFB Q;  2R7F A;  5BR8 L;  5JEA G;  3CME A;  1YJN A;  1PH3 A;  4GKK L;  3CAM A;  2ZM6 Q;  4IO9 A;  1XNR L;  4JI4 L;  3H0G G;  1EOV A;  3CCL A;  1TWG H;  4K0K L;  4C3J H;  4DR3 L;  1V9P A;  4JI7 Q;  1N33 Q;  5K36 G;  4JI1 Q;  4IPC A;  4QY7 A;  3MXN B;  1I50 H;  1N32 Q;  2ES2 A;  1IXR A;  3M7N A;  1K9M C;  1OXT A;  1UE5 A;  1Y14 B;  3T1H L;  4P71 A;  3GTK H;  4XTC S;  3JC6 6;  3NEM A;  3W5O A;  1U5K A;  5IWA Q;  3M4Q A;  4JI5 L;  1EFW A;  4B3M Q;  3GDE A;  1N36 Q;  4KHP L;  3I4N G;  3J81 i;  2AHO B;  2BA1 A;  1K73 C;  2ALY B;  3TS2 A;  2JA7 H;  1KQS A;  1GVP A;  4MNO A;  3F2C A;  2VUM H;  1VQA A;  3RN5 A;  1YIT A;  4O2D A;  4GLX A;  5C4J H;  2ASB A;  1B70 B;  1FVI A;  1Q1B A;  2MO1 A;  2WFW A;  3FHW A;  4A3M G;  1HR0 L;  1IBL L;  1QUQ B;  3FKI H;  3UDI A;  4L5S A;  2UU9 Q;  2R92 H;  4UP8 A;  5AJ3 Q;  4DR6 L;  2H5X A;  4BY7 H;  1EWI A;  2PNH A;  5FLX c;  1VQH A;  3B6Y A;  2PQA A;  2VQF L;  4JBJ A;  2JA5 H;  4L5R C;  2K14 A;  3PO2 G;  2VZA A;  1Q81 C;  3CPW A;  1YHA A;  1FJG L;  1R9T H;  3GTO H;  1WYD A;  3W1G A;  4PZ6 A;  3L2P A;  3KF6 B;  3M9B A;  2R93 H;  4IFD I;  1XMQ Q;  4JI2 Q;  2UUA L;  4C2M H;  1X9N A;  3TRZ A;  1Y1W H;  3OTO L;  5EAY A;  3FP9 A;  3HOV H;  1JJC B;  4LW1 A;  3ZJY C;  1HNX L;  3IRB A;  2E5L Q;  3H15 A;  1VQM A;  1JB7 A;  1PFS A;  2KHI A;  3HKZ E;  4DV7 L;  2R6G A;  1KXL A;  4LWC A;  1VQ7 A;  4QGU A;  4DAY B;  4DV1 L;  4JG2 A;  3PGZ A;  4GNX C;  1L0W A;  4GOP C;  4GN4 B;  3K8A A;  4P73 A;  5IE8 A;  4C3I H;  3CF5 A;  4R4O A;  1P16 A;  5M5Y H;  2E2H H;  1E3P A;  2V1C C;  4H02 A;  4JC0 A;  4DUZ L;  2Z0S A;  1J6Q A;  1P8L A;  2L15 A;  2OWO A;  4A3C G;  1SR3 A;  4YY3 L;  3HOX H;  3CMA A;  4HJA A;  2UXD Q;  1WI5 A;  3HOU H;  4DUY Q;  4XIG S;  2CFM A;  2E8G A;  3KDF A;  4OX9 Q;  3HKZ G;  4X66 L;  1YHQ A;  2JEB I;  3EBE A;  1NMF A;  4JV5 Q;  2ZJQ A;  1YZ6 A;  3S15 H;  4DV4 L;  4DR5 Q;  1LYL A;  2CWP A;  2JA8 G;  1YEZ A;  3K7U C;  5IYB H;  1HZA A;  1VQK A;  1OXX K;  2UUC L;  3CCE A;  4DR7 Q;  1K0R A;  3UDX A;  1UEB A;  4JOI C;  1Q86 C;  4A3D G;  4GNX A;  4NXM L;  1TWA H;  4YCV A;  1TXY A;  1PH5 A;  2NN6 G;  3KOJ A;  4OWW B;  3T1Y L;  2OTL A;  1HJP A;  4NPS A;  1HNW Q;  3DLL A;  1T9H A;  4IPG A;  4A3J G;  4ALP A;  1IZ6 A;  1SRU A;  2GN5 A;  3H0G H;  2B29 A;  3BU2 A;  4O0A A;  4DV5 L;  1HZC A;  1HNZ L;  2Q2U A;  4A3G G;  5C0X G;  1I6H H;  1A63 A;  4LF8 L;  2MO0 A;  4YHH L;  4YWL A;  1PH6 A;  1CUK A;  3F2D A;  5IYC H;  3F1Z A;  3CCV A;  1WOC A;  2NVY H;  2FXQ A;  1IBM Q;  4LF9 Q;  2UXB Q;  4JI8 Q;  4L5T A;  1CKM A;  3I7F A;  1XMO Q;  1L1O B;  2MQH A;  3S1M H;  1NTG A;  1UE6 A;  1VQO A;  4WJ4 A;  4HJ9 A;  3HFZ B;  5HGQ A;  1G51 A;  4X64 Q;  4UP7 A;  3RN2 A;  1PV4 A;  4DV3 Q;  4A93 G;  4B3S L;  2B3G A;  2K52 A;  1N34 L;  1E1T A;  3CCJ A;  1A62 A;  1QVG A;  3RLO A;  4AQY L;  4POF A;  3CP0 A;  4A3K G;  2F4V Q;  4KI0 A;  1W2B A;  3CW2 C;  4NXN Q;  3CPF A;  4LNQ A;  1LUZ A;  5C4X G;  1JT8 A;  4LFB L;  3EIV A;  5GQO A;  5M3M H;  1CKN B;  3K7A H;  1BBW A;  5M5X H;  2ZM6 L;  3H3V I;  3LGJ A;  4OXP A;  1JJ2 A;  1AE3 A;  3S17 H;  2K5N A;  1XNQ Q;  1EQQ A;  4JI7 L;  1N33 L;  3ERS X;  4JI1 L;  1UE1 A;  1HZB A;  1KD1 C;  3H3V H;  4BA2 I;  3GD7 A;  1KIX A;  1N32 L;  4YCU A;  4QL5 A;  5LMU Q;  5E7N A;  2EIF A;  4RG1 A;  4KLK A;  1O7I A;  4OWT B;  2NZH A;  2UXC Q;  3S2H H;  4UPA A;  3UDG A;  2Q2I A;  4ME3 A;  4MTN A;  5IWA L;  4BBS G;  3PO3 H;  4B3T Q;  5ELN A;  2DUD A;  4YWM A;  1X55 A;  1X3F A;  4B3M L;  5GAE C;  1B8A A;  3NBH B;  1N36 L;  2I5L X;  3CCR A;  3U4V A;  1EYG A;  1YJW A;  4JBM A;  4A3L H;  1K83 H;  2NVT H;  1CSP A;  2ID0 A;  4DK3 C;  4R4T A;  2LXJ A;  5HY6 A;  5IP9 G;  1OXU A;  5IP7 H;  3KYH C;  4GKJ Q;  1N8R C;  3J81 j;  4POG A;  2GVA A;  2K5H A;  1IL2 A;  4P74 A;  1XNR Q;  4X6A H;  5IYD H;  4HIM A;  2UU9 L;  2VS1 A;  5AJ3 L;  1BBU A;  4OO1 I;  1VQJ A;  1Q7Y C;  1QUQ A;  1TWF H;  1L2F A;  1MIU A;  1UWV A;  4DNI A;  4DV0 L;  1G6P A;  2Y0S E;  5J3B A;  3MEF A;  3CC7 A;  3CC4 A;  4HJ7 A;  5IY0 A;  1VQ5 A;  1XMQ L;  1I3Q H;  3L7Z C;  3PSI A;  4JI2 L;  1WJJ A;  2HQL A;  3DM3 A;  4BY1 G;  1Z47 A;  1X3G A;  1PH2 A;  1HR0 W;  1QZH A;  2D0O A;  4A3E G;  3RR5 A;  2RCN A;  5FJ8 G;  4DV2 Q;  1WCM H;  3A5U A;  3PUV A;  2R7Z G;  1PH7 A;  4B3R Q;  3PUZ A;  4A3F G;  2E5L L;  4IOC A;  2WAQ E;  4A3B H;  1AE2 A;  2QGQ A;  4DPG A;  1KRT A;  3WWV A;  4JBW A;  1EIY B;  3RZO H;  2A19 A;  1SMX A;  1EQR A;  1UE7 A;  3BZC A;  2KBN A;  5ELO A;  3GTJ H;  3HOY G;  3ICE A;  1AH9 A;  2EQS A;  2Y0S G;  2OQ0 A;  1W3S A;  4DV6 Q;  2NZO A;  4LF5 Q;  2PMZ E;  5C44 G;  1Q8K A;  3AEV A;  1VQL A;  1KHI A;  1NJI C;  2UXD L;  4JI0 Q;  3I4M G;  1OXS C;  4DUY L;  1VQF A;  4YWK A;  2I5M X;  2N49 A;  1FL0 A;  3GTG H;  4X65 L;  1CKO A;  3HOZ H;  4OX9 L;  2PI2 A;  2WAQ G;  2YTX A;  1WFQ A;  1KL9 A;  5JJL A;  1PH9 A;  3S24 A;  4JV5 L;  1S3O A;  4DR5 L;  4A4I A;  3J7A 5;  3K81 C;  3PUY A;  1YVC A;  2HIX A;  4GS3 A;  1VQ4 A;  4DR7 L;  2HIV A;  1V43 A;  3NEL A;  3HKS A;  4LUO A;  2JA9 A;  4A3K H;  1L1O C;  2RHQ B;  3BZK A;  4R4Q A;  2MFI A;  4LFA Q;  4OWX B;  3UE1 A;  4LF6 Q;  2JA7 G;  2VUM G;  4BXX H;  2F3I A;  1J5E Q;  4HIO A;  1TWH H;  2VQE Q;  4J15 A;  4DR2 Q;  4GOP A;  4JBK A;  1VQC A;  2CKZ B;  3FKI G;  3TRE A;  3S2D H;  1Q1E A;  1HNW L;  1I94 Q;  4DR4 L;  1JMC A;  3PF5 A;  3U4Z A;  1E22 A;  2WB1 E;  3KDF B;  3G48 A;  3ER0 A;  2N3S A;  4BY7 G;  4Y7N H;  4TQU S;  1BVS A;  1ASY A;  2HHH L;  2CCZ A;  4HID A;  2JA5 G;  2JK8 A;  3CXC A;  1IYJ B;  1K8A C;  1QVC A;  3F8T A;  4IJL A;  3A74 A;  3TS0 A;  2R93 G;  1A0I A;  1NMG A;  1SRO A;  4JI8 L;  3KLW A;  4HJ8 A;  1Y1V G;  5GRO A;  4DR1 Q;  1SFO H;  1PA6 A;  4LFC Q;  2XTI A;  1GD7 A;  3AQQ A;  3K80 C;  1Y1W G;  1XMO L;  4GNX B;  1M90 C;  2AKW B;  4IFD G;  3HOV G;  4PG3 A;  2CQO A;  3A0J A;  1L1O A;  3D31 A;  4X64 L;  3KJP A;  2VL6 A;  4JCV E;  4DV3 L;  4JOI A;  1PHJ A;  4AH6 A;  1GKH A;  4UY8 C;  1LM0 A;  1NY4 A;  2WB1 G;  3ULP A;  3I4N H;  2R7D A;  3SGI A;  1VQB A;  3PUW A;  4A75 A;  2F4V L;  3KF8 B;  3PIP A;  4QIW E;  4NXN L;  1K8G A;  2OCE A;  3RNU A;  2B63 G;  4LF4 Q;  4JYA Q;  5C3E G;  1N9W A;  3F2B A;  2YTV A;  1M1K C;  3GO5 A;  4A3M H;  2JA6 G;  3TQY A;  1QZG A;  2D62 A;  4X62 Q;  1YI2 A;  1MJE A;  3GTQ H;  3HOX G;  1XNQ L; 
#chains in the Genus database with same CATH topology
 4S3S A;  3AFP A;  3E0E A;  1PZJ D;  1GO3 E;  1I6V C;  3D6C A;  2TMP A;  1IW7 C;  3FPU B;  3PO2 H;  4FNF A;  5LMU L;  4XXE A;  2CQA A;  1Q12 A;  1K83 B;  4ZUJ A;  3K58 A;  3DEP A;  5FJ8 H;  2R7Z H;  4FVM A;  5ELB A;  3IKJ A;  4NP5 A;  3JAM c;  3LX0 A;  1UNS A;  4A3I G;  4BBR G;  3EN2 A;  4JI3 Q;  1VF5 C;  4LF7 Q;  1Z9F A;  3MXG A;  4JI6 Q;  2A1A A;  5JJZ A;  2RF4 A;  1MD2 D;  3O13 A;  1B3A A;  2IWH A;  4KN7 C;  4B9X A;  5BR8 Q;  2B2U C;  1LTI D;  5A2Q L;  1QB5 D;  4JI4 Q;  3WOF A;  1E2V A;  4GN3 B;  3I4M H;  4DAV A;  1R9T B;  3NTK A;  4A3C H;  1M4V A;  4DAP A;  2NZ1 D;  3I4O A;  2EJF C;  2IPK D;  4K2L A;  2J7Z A;  3HOV B;  2ZTC A;  1WVL A;  3I3C A;  1HFG A;  4ZLT F;  5JVH 3;  2IY5 B;  3NE5 B;  4N8X 1;  2JA8 H;  3STB D;  1IYV A;  4U68 A;  1SN8 A;  3CHB D;  2WP8 J;  2MP1 A;  5JJK A;  4R8N A;  3QG1 A;  2KHJ A;  2VB2 X;  3J81 c;  3S16 H;  2IX1 A;  1VQE A;  4B08 A;  1E7Z A;  4LUZ A;  3HOZ B;  4X3K A;  4DV0 Q;  3CCQ A;  3I73 A;  5CV6 A;  1NAP A;  4C3J G;  2VQF Q;  1G8Z D;  4ABN A;  2FJ2 A;  1VQG A;  1PYB A;  1EY7 A;  1XPU A;  3OTO Q;  3M4O H;  2RA4 A;  1GUW A;  2KEC A;  3ULL A;  4A93 H;  1B9M A;  4LF6 L;  4CKE A;  2OT2 A;  1HUM A;  1J5E L;  1XX8 A;  5C3E H;  3M85 A;  1VQI A;  1HA5 A;  3U9S A;  1YIJ A;  3E9H A;  1SFO B;  3CRL C;  2VNU D;  1LTL A;  1R4Q B;  2E2J H;  3CD6 A;  3OYY A;  1STA A;  1C0A A;  1ZYR D;  2RDG A;  1VQD A;  4GLV B;  1PFB A;  3S1Q H;  1A63 A;  2UXB L;  2A69 D;  2A68 D;  1PRT B;  3A5Z B;  2WAC A;  4IZ8 A;  5CGK A;  4A3I H;  1CT1 D;  4BBR H;  3S1R H;  2YV5 A;  4GOP B;  1VDZ A;  2CWA A;  4FXK C;  3G71 A;  1KC8 C;  2ATW A;  4NXM Q;  3PMF A;  2DJG C;  2RDH A;  5IP9 H;  2F0W A;  4KY5 A;  4LF4 L;  2L5T A;  3NPP A;  3TBI B;  3S17 B;  1AN8 A;  4DAM A;  4ZKB B;  2I5H A;  4DV5 Q;  2X6G A;  4LF8 Q;  1T5X D;  3RLF A;  1VQ6 A;  3S2H B;  2NVX H;  1X3E A;  1I4G A;  1QJO A;  1TR5 A;  1CQF A;  2VY3 A;  2N78 A;  5CV8 A;  1YNN C;  5FKA C;  5M9O A;  3QJY A;  3KJO A;  1DGS A;  2A6E D;  2H1E A;  5JPN C;  1JE5 A;  2PI2 E;  4PMC A;  1SNP A;  3EVQ A;  1S40 A;  4CDE C;  5GAD C;  5LMN L;  3N6R A;  1EY6 A;  1YBY A;  4KHV A;  4TVA B;  1VMC A;  1V8Q A;  1CA5 A;  2BDO A;  1YJN A;  3T13 A;  3CAM A;  2ZM6 Q;  3TSS A;  2F0T A;  2EY6 A;  3H0G G;  1TWG H;  4C3J H;  1Y69 U;  5EPK A;  1K3B C;  2B8G A;  4QY7 A;  1IXR A;  1D5Z C;  3DXJ C;  1AEX A;  4P71 A;  4FXD A;  3NEM A;  1TWC B;  5IWA Q;  4X3S A;  3M4Q A;  4JI5 L;  2VB3 X;  3MXP A;  1EFW A;  3TP6 A;  1N36 Q;  1O80 A;  3OOC A;  2AHO B;  2BA1 A;  3K57 A;  2AQ3 B;  1V1P B;  4K8J A;  2JA7 H;  1KQS A;  1B3Q A;  1VQA A;  4KV6 A;  1Q1B A;  1JC7 A;  1HR0 L;  4JPB W;  2AQ2 B;  1QUQ B;  1QWY A;  3KLS A;  3UDI A;  4FXG C;  1KDC A;  4UP8 A;  3ITP A;  2H5X A;  1EWI A;  3V2T A;  1VQH A;  2PQA A;  2K14 A;  3CPW A;  1YHA A;  2A5H A;  3GTO H;  1WYD A;  3W1G A;  3L2P A;  2R93 H;  3M9B A;  4HSP A;  1Y1W H;  2F3W A;  4CJ2 C;  2N88 A;  4I7A A;  5EAY A;  4LW1 A;  1HNX L;  4RGM A;  1PFS A;  4DV7 L;  2WKC A;  3IAY A;  3S2D B;  4HMI A;  1GXD C;  3BG3 A;  1L0W A;  1BCP C;  3DUZ A;  2RCF A;  4Y7N B;  4P73 A;  4N9T A;  5M5Y H;  2EJM A;  2E2H H;  2V1C C;  2M2L A;  2L15 A;  4KN4 C;  1LAB A;  4DUY Q;  4E6I A;  2E8G A;  4OX9 Q;  4ZAI A;  3GP7 A;  3CRK C;  1YZ6 A;  3S15 H;  1TQO A;  2CWP A;  1SYG A;  1HZA A;  1HTP A;  1OXX K;  3QB3 A;  3CCE A;  4DR7 Q;  3OIP A;  3VYU A;  2EDG A;  4GNX A;  1TWA H;  1L0X B;  1TS4 A;  3LWU A;  5DAU A;  3T1Y L;  1HJP A;  1EYD A;  3J81 E;  5C6A A;  3H0G H;  1RTO A;  1HZC A;  4A3G G;  3KF8 A;  5C0X G;  1I6H H;  3VA5 A;  4YHH L;  4JK1 C;  5IYC H;  3F1Z A;  1TU2 B;  2PZU A;  2FXQ A;  4OEL B;  1QNK A;  2NBF A;  4XT1 B;  1XMO Q;  2MQH A;  1UE6 A;  4JVZ A;  2KHS A;  4WJ4 A;  5HGQ A;  1PV4 A;  2XIW A;  2JP1 A;  4B3S L;  2B3G A;  1EEI D;  2K52 A;  3I4L A;  2F4V Q;  1JOQ A;  3HZX A;  2QEJ C;  3QOL A;  2QDL A;  5DNF A;  1LUZ A;  5C4X G;  1JT8 A;  2KQ3 A;  1LTS D;  3EIV A;  2CH4 A;  3H3V I;  1JJ2 A;  1PDQ A;  1LT5 D;  2AQ1 B;  3KK7 A;  4JI7 L;  1N33 L;  1STB A;  1I4X A;  1UE1 A;  1KD1 C;  4PNY A;  3UDG A;  5KGU A;  4QUF A;  4BBS G;  1U4R A;  4B3T Q;  5ELN A;  2VUM B;  3R3O A;  4QB4 A;  3CCR A;  1EYG A;  4EGV A;  1YJW A;  2B2Y A;  2RVL A;  3HRZ C;  3K5N A;  2ID0 A;  4R4T A;  4EQP A;  2EYP A;  1SEB D;  3H94 A;  5A35 A;  4A3G B;  1LTR D;  5IIF A;  1GUS A;  2LMC B;  1Y1V B;  4ULL A;  1MIU A;  1PFM A;  4DNI A;  1G6P A;  2DNC A;  4K6L A;  3L7Z C;  3E0J A;  1BNZ A;  1QNU A;  1QZH A;  3RR5 A;  1WCM H;  3A5U A;  3PUV A;  4KY7 A;  4IOC A;  2WAQ E;  2ICI A;  2QDB A;  4HAE A;  4JBW A;  3RZO H;  5C4X B;  2A19 A;  1SMX A;  1I4R A;  2D9U A;  4FF1 A;  2BE5 C;  2Z8L A;  3FMC A;  4LF5 Q;  5C44 G;  4OL7 A;  1V1O A;  3S1N B;  1FR3 A;  1NJI C;  2UXD L;  4JI0 Q;  1PZI D;  2I5M X;  4G7O C;  5C5M A;  2K6A A;  2WAQ G;  1QIL A;  1WFQ A;  1C48 A;  4BBS B;  5JJL A;  4DR5 L;  1LTG D;  1EYC A;  4A4I A;  3K81 C;  4GS3 A;  2KEE A;  3HS0 C;  4WOR A;  2RHQ B;  4LFA Q;  3UE1 A;  5IOD A;  5K5P A;  2EYJ A;  2F3I A;  4HIO A;  1TWH H;  4Z9C B;  1MSG A;  1KAB A;  4GOP A;  1G6Z A;  1LT4 D;  1VQC A;  5CV7 A;  4KTA A;  1I94 Q;  4DR4 L;  4F88 A;  2WB1 E;  2RQX A;  2F0D A;  3ER0 A;  2CCZ A;  2F0K A;  3SK4 A;  2ZT9 C;  1QVC A;  5KND A;  3NK9 A;  1SRO A;  1PA6 A;  3KLW A;  4LFC Q;  3GTP H;  1EY0 A;  3AQQ A;  1M90 C;  1HCZ A;  2Q8I B;  1KTK A;  2CQO A;  1B50 A;  4JOI A;  2WB1 G;  1YNJ D;  4HR7 B;  1K0S A;  3NUC A;  4A75 A;  3PIP A;  4QIW E;  2B63 G;  1ZEQ X;  5I9P A;  3F2B A;  3K59 A;  2QW7 A;  2YTV A;  1M1K C;  2JA6 G;  4A3M H;  3SR1 A;  3J7Y W;  3TQY A;  1QZG A;  1ET9 A;  2Z4I A;  1LV9 A;  1KDA A;  2KUM A;  3HOU G;  1RF2 D;  5I9O A;  2WAQ B;  1C7Y A;  2MGS A;  1Y8N B;  4GZY C;  4KHZ A;  3GTL H;  2F0H A;  4OGQ C;  4EQN A;  5LMN W;  1RD9 D;  1H95 A;  1SLJ A;  3D4R A;  3VYR A;  5C4H A;  4G7Z C;  1EL0 A;  2JEA I;  2N8N A;  4GKJ L;  2QEX A;  3G7L A;  3M4Y A;  1PTO C;  1C9O A;  4RHR A;  1TVX A;  5C44 H;  2K5V A;  1PH8 A;  5IT9 L;  1KNA A;  1V1P A;  3D4D A;  5CMD A;  3OHX C;  4IAL A;  4FO2 A;  4DR3 Q;  1D5M C;  5BN3 A;  2SOB A;  3A8K E;  4IJH A;  4IUV A;  4R4I A;  3IFD A;  1SYD A;  4O1N A;  1SNO A;  3CC2 A;  3FDT A;  1YJ9 A;  3M4P A;  5FLM G;  1D8L A;  3URY A;  2Q2T A;  3OWF A;  5COY A;  4G7H C;  4EX5 A;  1SNM A;  1SYB A;  5D65 A;  4KHP Q;  4POG A;  1PVO A;  2L55 A;  4AIM A;  1WD1 A;  4QMG A;  4CJ1 B;  5M5W H;  3HEJ A;  4LMQ D;  1IBL Q;  3MWY W;  4DKA C;  5C0X I;  1CM9 A;  4DV6 L;  2PQA B;  4A3J H;  3HOU B;  1YNX A;  2LXK A;  2B2V C;  1ONL A;  1B53 A;  2L4N A;  1S72 A;  1B7Y B;  2UUA Q;  2C35 B;  1G29 1;  3PO3 G;  1OXV A;  3S14 H;  4WJ3 M;  3MZ5 A;  5CC4 A;  2X6L A;  5C4Z A;  1PTO H;  2B63 H;  4RH6 A;  2E74 C;  2J4X A;  1VF7 A;  2G9D A;  2L1B A;  5C5L A;  2VQE L;  4DR2 L;  3E5S A;  3DWA A;  2JA6 H;  2F0O A;  2LSS A;  3PCO B;  2F0U A;  3QWN A;  2EY5 A;  1EY5 A;  1HH2 P;  4RHS A;  4AYB E;  4V0B A;  1G91 A;  3E9I A;  2NVY B;  2ICE C;  4YY3 Q;  2RHS B;  4ILW A;  1Q46 A;  1STN A;  1A3U A;  5CV5 A;  2AWO A;  1STG A;  1EWC A;  4H0L C;  4X66 Q;  1KAW A;  3I91 A;  1X65 A;  4HED A;  1CZW A;  4JW0 A;  1S4Z A;  3P20 A;  3NEN A;  1VCI A;  2UUC Q;  3D8G A;  5IGC A;  1TS3 A;  2BOS A;  4AYB G;  2AWN A;  2PO4 A;  3K0X A;  4LUV A;  2JJQ A;  4APV A;  2YU9 H;  3CQZ H;  4R4C A;  3UE0 A;  3GTM H;  2B2T C;  3K7A B;  4MTK A;  1XPR A;  1OTC A;  4DR4 Q;  1PZK D;  1Y8P B;  3I55 A;  2MUY A;  3IL8 A;  4J1M A;  1I5F A;  4PZ7 A;  4X62 L;  3PO2 B;  2Z6K A;  1ZKO A;  1HNZ Q;  1J8I A;  4GN5 A;  4MZ9 A;  1BCP F;  1SYF A;  1R4P B;  3HOZ G;  3PO3 B;  5FLM H;  1GOZ A;  2NTT A;  2QA4 A;  1PH4 A;  4BY1 H;  2UUB L;  1IBK L;  1YNN D;  2UXC L;  5T1G A;  1XPO A;  5C0X J;  2XSC A;  3BJU A;  3TEH B;  1N34 Q;  4BXX G;  1BKB A;  4UAI A;  4AQY Q;  3DHQ A;  4P75 A;  3VYS A;  2F52 A;  3HG9 A;  4J8Q A;  4WRD A;  3D6W A;  1U4P A;  3KFU A;  1II3 A;  2KED A;  4LFB Q;  1S5C D;  4IFD J;  1HQR D;  4GKK L;  4IO9 A;  3HKZ B;  4K0K L;  4OEM B;  3M7N A;  2XVS A;  3Q23 A;  3T1H L;  5IGF A;  4IUP A;  3W5O A;  1LO5 D;  4AYB B;  1AZP A;  5FK9 C;  1STH A;  2F0P A;  3GDE A;  3GTJ B;  3I4N G;  1DOM A;  1FGB D;  1YIT A;  3OW7 A;  3NTH A;  3C3L A;  2HCI A;  2WFW A;  3FHW A;  4DN4 M;  3FKI H;  2RDF A;  1S5D D;  3EQL C;  4X3U A;  2A74 C;  4DR6 L;  4G4K A;  4BY7 H;  3T53 B;  1FYC A;  4JBJ A;  1SSO A;  4Q0F A;  5I2X A;  1D1K A;  1CA6 A;  1Q81 C;  1C8C A;  2EJG C;  5G3L F;  1FJG L;  1R9T H;  2HCC A;  4C3H G;  3KF6 B;  3DM1 A;  4JI2 Q;  5A2Q E;  3TME A;  1X9N A;  3C46 A;  3UI2 A;  4A3K B;  3HOV H;  1JJC B;  4K5W A;  1AZQ A;  3H15 A;  1PRT C;  2XWB B;  1EIH A;  4DV1 L;  1DOK A;  4GOP C;  5CV9 A;  1I4Q A;  3K8A A;  5IE8 A;  5FLX L;  1SND A;  1P16 A;  2EYO A;  4R4O A;  4H02 A;  1BCP D;  1CHQ D;  4DUZ L;  1J6Q A;  2L11 A;  1DON A;  2OWO A;  1E2Z A;  2PYK A;  5BN5 A;  1SR3 A;  3CMA A;  2DY7 A;  1AFP A;  1WI5 A;  2MPM A;  2MHV A;  3H3V C;  2QCP X;  4K2K A;  2JEB I;  5JAV A;  1NMF A;  3SE0 A;  4JV5 Q;  4P2C B;  4DV4 L;  2EYF A;  3WDN A;  1LYL A;  3I4N B;  3ND9 A;  1CI3 M;  1TS5 A;  4PV1 C;  1I4P A;  4XQJ A;  1VQK A;  1K0R A;  1LLR D;  4JOI C;  4XQQ A;  1SJH D;  5E1F A;  5J1Z A;  4A3D G;  4YCV A;  3Q22 A;  2Z9H A;  2NN6 G;  1SXT A;  2F0L A;  5D3I B;  1LTB D;  3GTQ B;  1WTR A;  3OSO A;  4HCE A;  4FYD A;  4RFB A;  4ALP A;  1IZ6 A;  1QCB D;  2NVX B;  2F0M A;  3I72 A;  2JSO A;  3L3O C;  1GJX A;  4U67 3;  1PH6 A;  3R8B A;  1CUK A;  4C3H B;  4H7B A;  3IFT A;  3FEW X;  5EKI A;  1IBM Q;  4LF9 Q;  1EY8 A;  3I7F A;  1ET6 A;  1LTT D;  1H9S A;  3S1M H;  2NUC A;  3SDZ A;  3M3Y B;  4QF4 A;  5CV4 A;  1VQO A;  3HFZ B;  1XTC D;  3TP5 A;  3MVV A;  4UP7 A;  4X64 Q;  2NVQ B;  4DV3 Q;  5IGG A;  1IHZ A;  4ZYS A;  4K5V A;  3ERO A;  1QVG A;  3CP0 A;  4KI0 A;  3BDC A;  2KVM A;  3HGB A;  4NDX A;  1F9S A;  1W2B A;  3CPF A;  3SXH A;  4KJO A;  4ZK9 B;  1BBW A;  4Q5V A;  2L12 A;  1MBY A;  3S17 H;  4IUT A;  2K5N A;  1XNQ Q;  2OEO A;  1EQQ A;  3ERS X;  4JI1 L;  1KAA A;  3H3V H;  4DF7 A;  1N32 L;  2F1M A;  4PQX A;  5LMU Q;  3A7A B;  1WD0 A;  5CBE E;  2NYZ D;  3E6Z X;  4KLK A;  1O7I A;  1DZ1 A;  3MA2 B;  2FMC A;  2UXC Q;  3S2H H;  1HTL D;  1QG7 A;  4A3D B;  1EOT A;  4B3M L;  5GAE C;  2EZV A;  1QE6 A;  2I5L X;  3U4V A;  3MEH A;  4DK3 C;  3NWT A;  2FFK B;  5HY6 A;  1HFN A;  1N8R C;  3A8I E;  2K5H A;  3NQI A;  1IL2 A;  4F7X A;  2UU9 L;  5AJ3 L;  1VQJ A;  1SNQ A;  1Z7T A;  1UWV A;  3RUZ A;  1BOS A;  2E75 C;  2Y0S E;  2CH4 W;  2M9V A;  3H09 A;  4C1N I;  3RZD B;  3CC4 A;  4HJ7 A;  5IY0 A;  2E2I B;  2AUJ D;  1XMQ L;  1WJJ A;  1PH2 A;  1X3G A;  4A3E G;  2NTS A;  2B2W C;  1NR2 A;  4A3F G;  2E5L L;  3K5O A;  2I07 B;  2QGQ A;  3WWV A;  2NN6 H;  4KK7 A;  1EU3 A;  1EQR A;  2OXP A;  2KBN A;  2V4D A;  3BZC A;  4KJN A;  3HOY G;  3JAM E;  1AH9 A;  2EQS A;  2Y0S G;  4RCN A;  2BE5 D;  2AUK A;  4B9W A;  1GHJ A;  1VQL A;  3W2D A;  1TT2 A;  1PTO F;  2Z6B A;  2N49 A;  1FL0 A;  4X65 L;  1CKO A;  1ENF A;  2R3Z A;  2K5D A;  2YTX A;  4RAU C;  1KL9 A;  3MTS A;  5I2Y A;  1KDB A;  1JIC A;  3D4W A;  1SDF A;  3HOW B;  2XRQ D;  3NEL A;  1NSN S;  3KUP A;  1GUG A;  4N8F A;  4LF6 Q;  5CR3 A;  1IL8 A;  3GV3 A;  2VUM G;  1J5E Q;  3R2I A;  4JBK A;  2K32 A;  2PW5 A;  3TRE A;  5FO8 B;  3S2D H;  1HNW L;  1JMC A;  3PF5 A;  2PZW A;  1ZYR C;  3G48 A;  4KD4 A;  2N3S A;  4Y7N H;  2HHH L;  2A68 C;  3NXW A;  5CBA E;  2JA5 G;  2JK8 A;  5J39 A;  1K8A C;  2JYO A;  3F8T A;  4IJL A;  1A0I A;  1NMG A;  4JI8 L;  2UXB Q;  1Y1V G;  5GRO A;  4A3E B;  4LJZ C;  4YIJ A;  1DD2 A;  4ODG A;  4A3F B;  1BCP B;  4IFD G;  1A3V A;  3VR5 A;  4PG3 A;  3I8Z A;  1DJR D;  1L1O A;  3D31 A;  5M3F B;  1B1Z A;  4JCV E;  4AH6 A;  2RBM A;  1WTW A;  3HOY B;  1NY4 A;  3ULP A;  3SGI A;  1VQB A;  2Y0S B;  4NXN L;  1C4Q A;  2OCE A;  4LF4 Q;  1H9R A;  4C3I G;  3GO5 A;  3BYT B;  1EZ8 A;  4RCO A;  4HMJ A;  1TY0 A;  4M8A A;  1I50 B;  3HOX G;  1CKN A;  2N55 A;  3OMC A;  3GQB A;  4FDB A;  3KBX A;  1X3P A;  1KRS A;  5IT9 c;  1JOO A;  1B44 D;  4UDU C;  2A6E C;  4TKO B;  2WV6 D;  4DXG A;  2F0I A;  2HDL A;  2XGT A;  2IHF A;  1RKN A;  5E3F A;  5IYB G;  3J7A V;  4V19 0;  3W3A A;  4R8I A;  4QQB X;  1EYA A;  3UDF A;  4C56 C;  1Q82 C;  5C4J B;  5LMN Q;  2FIN B;  2YYZ A;  1X32 A;  4A76 A;  1CK1 A;  4PZ8 A;  3PIO 3;  2R92 B;  1EY9 A;  1U9R A;  2KEN A;  2HT1 A;  1H9M A;  2PQE A;  2JA5 B;  2KCM A;  5DM6 3;  1O78 A;  3ULJ A;  1MJC A;  3BS1 A;  5KNC A;  1IKL A;  3RZO B;  2D0P A;  1K8M A;  1STE A;  4DV2 L;  4JI5 Q;  4B3R L;  3KF6 A;  4ID6 A;  2NN6 I;  4QJF A;  4K5X A;  4C3I B;  4RKL A;  1NE3 A;  5EGT A;  3U9O A;  1BR9 A;  2B2U A;  2EYH A;  5M3M G;  1HR0 Q;  2PW7 A;  4GLA C;  4OIK A;  3HOX B;  3N52 A;  4EVO A;  4HN7 A;  2F0S A;  4RKB A;  1RJT A;  5EBC A;  4CKC A;  3J80 c;  5C0X H;  4A3G H;  2C5C A;  4MHE A;  5NUC A;  1X54 A;  1Y1V H;  1JWM D;  4RA8 A;  2BH8 A;  4IOA A;  2F0N A;  5GAH C;  4HIK A;  1M8A A;  4IFD H;  3D0F A;  4NB3 A;  1ROD A;  1HNX Q;  1F2Y A;  2M00 A;  1JOK A;  4DV7 Q;  5KEE A;  1X56 A;  4A3L G;  4IN3 A;  5IP7 G;  1H9K A;  1QVF A;  1PXU A;  1E24 A;  5IYD G;  5C4X H;  5I6Y A;  1AP0 A;  1E1O A;  3J7Z C;  1O7Z A;  4X65 Q;  4OO1 G;  4IUQ A;  2IJ0 A;  3S1N H;  1QOH A;  1D1I A;  1RL2 A;  1MKH A;  4DR1 L;  4L63 B;  3VR3 A;  2JE6 I;  3SK6 A;  3BVZ A;  4BBS H;  2A8V A;  3LNN A;  1G2S A;  4A3B G;  2SDF A;  5M3M B;  2AMC B;  3T56 B;  4DU9 A;  2RKS A;  3T1Y Q;  2WKD A;  2ZJP A;  3AMU A;  2HHH Q;  1PRT F;  4DNR B;  2OTJ A;  4FF3 A;  3T51 B;  1K8O A;  4WFN 3;  3LWE A;  2O5I C;  3A7L A;  4YHH Q;  5IGB A;  3OWE B;  1H9S B;  1VQN A;  1XWE A;  1EIG A;  3CCM A;  1LAC A;  1ILQ A;  1XJV A;  2K4K A;  1NR4 A;  3NP8 A;  2FHT A;  2G5D A;  5H1S E;  2K05 A;  4DGZ A;  1IW7 D;  2H4O A;  5E4X A;  3JAM i;  1B9N A;  1JWU D;  3G6E A;  4K14 A;  3Q8D A;  2NVT B;  4JI3 L;  4B3S Q;  4LF7 L;  4CDD C;  4JI6 L;  3L0O A;  1Q8I A;  1EIF A;  2Q2H A;  1HXY D;  3I56 A;  1YHB A;  4K8I A;  5GAG C;  4Y52 H;  1HA6 A;  4HJ5 A;  5BR8 L;  4K6D A;  5JEA G;  1TWF B;  2VXW A;  3CME A;  1PH3 A;  1TKW B;  1XNR L;  4JI4 L;  2CVR A;  3CCL A;  4FP5 D;  5HGT A;  1V9P A;  1W6J A;  4JI7 Q;  1N33 Q;  5K36 G;  1I3Q B;  2EY1 A;  3NQT A;  2ES2 A;  1OXT A;  4KKS A;  1UE5 A;  1Y14 B;  3GTK H;  1Y8O B;  4XTC S;  3JC6 6;  4A3B B;  1U5K A;  1ENC A;  1MSH A;  5EBD A;  2HDM A;  3J81 i;  3TS2 A;  1K73 C;  2A6H C;  1RCV D;  1IKM A;  3QIA A;  4O2D A;  4H44 C;  1FVI A;  5C3W A;  4DK0 A;  1WTV A;  3GTG B;  1WTX A;  1JQY D;  2F0Q A;  2PNH A;  4IQZ A;  3BDL A;  5FLX c;  3B6Y A;  2VQF L;  3PO2 G;  2VZA A;  3SVM A;  4PZ6 A;  1B4O A;  4IFD I;  1EWH A;  4C2M H;  5IT9 E;  2R61 A;  3OTO L;  4F87 A;  4ZQ3 A;  5EKL A;  1DM0 B;  1VQM A;  1JB7 A;  3HKZ E;  4NW2 A;  2R6G A;  1KXL A;  4LWC A;  1VQ7 A;  2SNS A;  3K5L A;  1DYQ A;  4DAY B;  3I70 A;  4JG2 A;  3PGZ A;  2K33 A;  5FOB B;  4GNX C;  3BVG A;  3VR6 A;  2LY7 A;  2F0J A;  1BDO A;  1E3P A;  2F03 A;  1P8L A;  1HUN A;  3FVQ A;  1L0Y B;  4A3C G;  2UXD Q;  4HJA A;  3HOU H;  2PNR C;  2CFM A;  4XIG S;  5KRU A;  3HKZ G;  1D6E C;  1YHQ A;  3OMG A;  4XYO A;  2ZJQ A;  2EYL A;  5IGD A;  4DR5 Q;  3GTM B;  2JA8 G;  1YEZ A;  3K7U C;  3NTI A;  1LT6 D;  2HQE A;  1WTO A;  3UDX A;  1F2L A;  4ZCK A;  4CDC C;  2HD3 A;  4NXM L;  2B8F A;  4OIJ A;  4XT3 B;  2SEB D;  1FNV A;  2K5W A;  1SE3 A;  1O7L A;  4JYA L;  1SRU A;  2Q2U A;  2B29 A;  4DV5 L;  4LF8 L;  2MO0 A;  5K36 H;  3OPO A;  3F2D A;  1JWS D;  1WOC A;  2EPB A;  1SYE A;  2NVY H;  5DM7 3;  3J80 E;  2R7Z B;  4XQN A;  4L5T A;  4WJW A;  1CKM A;  5KYL A;  1A2U A;  1L1O B;  2E76 C;  4RGO S;  1PFN A;  1GUN A;  4I65 A;  3RN2 A;  1G51 A;  4A93 G;  3A54 A;  1OO9 B;  1RTN A;  1A62 A;  3RLO A;  4DA2 A;  4POF A;  1ESR A;  4A3K G;  1CFM A;  1F2Z A;  5ELD A;  2B2Y C;  4LNQ A;  3G6J B;  1AW7 A;  5GQO A;  2L0C A;  4G57 A;  2KA7 A;  4CBV A;  3I4M B;  1CKN B;  3K7A H;  5BN4 A;  5M5X H;  2ZM6 L;  1RDP D;  5KIX A;  4L8J A;  1AE3 A;  2Q8R E;  4KMU C;  4YCU A;  4QL5 A;  2L9H A;  3TP7 A;  2JA8 B;  2EIF A;  2K28 A;  4RG1 A;  3MXN A;  3H91 A;  2PMZ B;  2LKV A;  1F9P A;  5IWA L;  3S16 B;  3PO3 H;  4YWM A;  2DUD A;  4TRD A;  2IX3 A;  3NBH B;  1N36 L;  3HP3 A;  3FKI B;  5JVG 3;  1K83 H;  1CSP A;  2SNM A;  5D14 A;  3K0Y A;  5IP9 G;  4GKJ Q;  2LXJ A;  4BY7 B;  2Z1C A;  3J81 j;  1SMY C;  2GVA A;  3ND8 A;  1XNR Q;  2XWJ B;  3EFX D;  4N9P A;  2B39 A;  4OO1 I;  4CJ0 B;  5ISR A;  4XYQ A;  1S5B D;  4M1U B;  3MEF A;  4KKU A;  1XYI A;  2XNA C;  1SAP A;  3M4O B;  2CW0 C;  3Q24 A;  1Q3L A;  3DM3 A;  1K28 A;  4A93 B;  2D0O A;  3SHL A;  2RCN A;  3EA6 A;  1ESF A;  5C3E B;  2RSO A;  3X3N A;  1EIY B;  4IUN A;  3GTJ H;  2NB0 A;  1LTA D;  4LAA A;  2OQ0 A;  1GUO A;  4HCS A;  4DV6 Q;  2E2J B;  2NZO A;  1Q8K A;  3NHH A;  2BDN A;  3S1Q B;  1KHI A;  2K03 A;  4KD3 A;  1OXS C;  4DUY L;  1VQF A;  4YWK A;  3HOZ H;  4OX9 L;  4A3I B;  4BBR B;  3S1R B;  2TSS A;  3H6M A;  1VQ4 A;  1ICW A;  4DR7 L;  1V43 A;  4KY6 A;  3HKS A;  4LUO A;  2O4X A;  4A3K H;  3BZK A;  2JA7 G;  3P75 A;  1BXT A;  4BXX H;  1HPC A;  3V96 A;  1U4M A;  3I90 A;  3MFG A;  4J15 A;  2VQE Q;  4DR2 Q;  3V05 A;  2EVB A;  2EY2 A;  1HHV A;  1Q1E A;  4DNT B;  3KDF B;  4DK1 A;  1NUC A;  1ASY A;  4HID A;  3S1M B;  1ILP A;  4C1N K;  2E2D C;  2LS0 1;  5FO7 B;  3A74 A;  2R93 G;  4HJ8 A;  1SFO H;  5FLX E;  1GD7 A;  1XMO L;  1Y1W G;  1S5F D;  2HUG A;  4KKT A;  1VMP A;  5E4W C;  5IOC A;  3A0J A;  1PHJ A;  2I46 A;  2IW3 A;  3A8J E;  3I4N H;  1G2T A;  2ZXR A;  2F4V L;  3VR4 A;  1DXM A;  4JYA Q;  1TWG B;  4C3J B;  2D62 A;  4X62 Q;  1YI2 A;  1MJE A;  5J22 A;  5KYI A;  4TSS A;  1UUP A;  2X69 A;  3GTQ H;  1J9O A;  4BA1 I;  3I2Z A;  5G3L D;  3PUX A;  1A6X A;  3MXU A;  5JPM C;  2ZTD A;  4C3H H;  1CTM A;  3VR2 A;  2DNE A;  2UUB Q;  1IBK Q;  4B3T L;  2KCT A;  3VDY A;  2JA7 B;  4CHT B;  1VQ9 A;  4BS9 A;  3M3Y H;  2WIN B;  2IX0 A;  2NVQ H;  3HOW G;  4H13 C;  2QIL A;  2IHE A;  4YCW A;  2IT1 A;  1SE8 A;  4GKK Q;  5JJI A;  3AFQ A;  3CCS A;  5ELC A;  2CHB D;  3ONA B;  4K0K Q;  1A2T A;  1PH1 A;  3GTO B;  2R93 B;  5HUR A;  5IYC G;  2OQK A;  3KBG A;  1Y1W B;  3TZD A;  2PZT A;  3JAM L;  1W6K A;  1EY4 A;  1HZ9 A;  5CYU A;  4OON A;  3STB C;  3T1H Q;  2I0Q A;  5JEA J;  5EKK A;  2ZJR A;  1TY2 A;  4HTH A;  1FGU A;  4DK6 C;  4IPH A;  4L5Q A;  3T4A C;  1K3R A;  1VQ8 A;  3OW2 A;  3X3M A;  4A3D H;  1EFI D;  1TWC H;  4IPD A;  5M5Y B;  2DGY A;  5C3X A;  2E2H B;  1EZ6 A;  5M3F G;  1JE4 A;  2MNA A;  3RMH A;  2YTY A;  1S5E D;  2DN8 A;  3J80 i;  4LF5 L;  3FRP B;  3CCU A;  1GM5 A;  4DAY A;  4R9W A;  4DR6 Q;  4NMZ A;  1DOL A;  3RLN A;  4JI0 L;  2BCO A;  1PYS B;  4EQO A;  1Z6H A;  2D5D A;  3U50 C;  3S15 B;  4PMB A;  1FJG Q;  1A3T A;  3SK8 A;  2QF7 A;  3PV0 A;  2ZTE A;  1CZG A;  2OF1 A;  3J81 L;  3RZD H;  2F0G A;  3G4S A;  4QCL A;  2PPB C;  2E2I H;  1TWA B;  5KNB A;  1ASZ A;  3W1B A;  3MFY A;  3TN2 A;  4LFA L;  1EQT A;  1X6O A;  4CDF C;  3K5M A;  4DV1 Q;  3H0G B;  4F8M A;  2F3V A;  1I6H B;  4DXF A;  3AB9 A;  1I94 L;  2ZXP A;  2B2V A;  2XN9 C;  4CKB A;  5LL6 S;  4DUZ Q;  1BF4 A;  1EUJ A;  1VS0 A;  2R92 G;  4EQ5 A;  2Z6K C;  1JJG A;  1WTH A;  2A69 C;  4UP9 A;  4RGT A;  1PLF A;  1V1Q A;  1MI2 A;  3Q0A A;  3AYH B;  4RMF A;  1BQQ T;  4LFC L;  2DJF C;  4DFA A;  4DV4 Q;  1WCM G;  1A8V A;  1PMR A;  2K01 A;  1ML0 D;  5DLQ E;  1EU4 A;  2NWG A;  3ZYY X;  1CSQ A;  5LL6 X;  2F4I A;  1JR0 D;  3HOW H;  3PF4 A;  2JQO A;  5DEH A;  2K50 A;  2EXD A;  2K75 A;  3TZU A;  1RIP A;  3NWS A;  2C9O A;  2A73 B;  3R93 A;  2BA0 A;  2LFN A;  3PIO A;  4X3T A;  3KLS X;  2GVB A;  3C1F A;  5FO9 B;  1U0L A;  3A55 A;  1XTD A;  1NCV A;  4PMW A;  3E3X A;  4P72 A;  1NBW A;  1UAP A;  1VQP A;  4A3E H;  1F77 A;  3U58 A;  2F0V A;  1D7Q A;  1LT3 D;  4A3F H;  1BUV T;  2B2T A;  2BH2 A;  4R1J A;  5M3F H;  3EJI A;  3MAQ A;  1WTP A;  2VW9 A;  1ZXT A;  3HOY H;  3NBH A;  2R7F A;  3BVM A;  4NKL A;  1EOV A;  1PTO D;  4DR3 L;  4JI1 Q;  1D5X C;  2KOL A;  4IPC A;  3MXN B;  1I50 H;  1N32 Q;  1ENA A;  1K9M C;  2EYM A;  1WCM B;  1A15 A;  2EE1 A;  2JXM B;  4ZKC B;  4ZUI A;  4B3M Q;  1RHP A;  4KHP L;  3CU7 A;  2ALY B;  2J0T D;  4J6H A;  1FNW A;  1E0B A;  1GVP A;  4MNO A;  3F2C A;  2VUM H;  3RN5 A;  4GLX A;  2A6H D;  5C4J H;  1B70 B;  2MO1 A;  4XDX A;  5EQ0 A;  1STY A;  4A3M G;  1IBL L;  2ASB A;  5ELE A;  4L5S A;  2K7V A;  3VYT A;  1WTQ A;  2UU9 Q;  2R92 H;  4RGN A;  5AJ3 Q;  4ZRZ A;  2JA5 H;  4L5R C;  1U4L A;  2EXZ A;  3PQI A;  1JCK B;  1XMQ Q;  2UUA L;  3TRZ A;  2MJ8 A;  3FP9 A;  3ZJY C;  3IRB A;  1SE4 A;  2E5L Q;  5JOB A;  2KHI A;  1TWH B;  1DCZ A;  2F0E A;  4QGU A;  4GN4 B;  3CKI B;  4C3I H;  3CF5 A;  2O2L D;  1SJE D;  4JC0 A;  1F9R A;  2Z0S A;  4YY3 L;  3HOX H;  3GTP B;  3QO2 A;  5ELF A;  3KDF A;  4X66 L;  4IUR A;  3EBE A;  5IYB H;  1JB3 A;  1MGS A;  3ERQ A;  2UUC L;  1NNX A;  1UEB A;  1Q86 C;  3P1H A;  1TXY A;  4A3M B;  3T16 A;  1PH5 A;  3TDQ A;  3KOJ A;  4OWW B;  2OTL A;  1BO0 A;  3DEO A;  4NPS A;  1HNW Q;  3DLL A;  1T9H A;  4IPG A;  4A3J G;  2GN5 A;  3BU2 A;  4O0A A;  1HNZ L;  3NSW A;  1T5E A;  3GV6 A;  3RD4 A;  3GTL B;  5I6W A;  4YWL A;  1FNU A;  2K04 A;  3CCV A;  2G9H D;  4JI8 Q;  3BYY B;  4OHJ A;  1JOR A;  3VA7 A;  1HQM C;  4BWG B;  1NTG A;  4HJ9 A;  1N34 L;  1E1T A;  3CCJ A;  4AQY L;  5C44 B;  3BDO A;  4FF2 A;  3NBI A;  3QOJ A;  3OIQ A;  3CW2 C;  4ME5 A;  2Z4H A;  4NXN Q;  1CQV A;  1KLU D;  4LFB L;  5M3M H;  4FF4 A;  1I4H A;  3M7G A;  2QKI C;  3LGJ A;  3D3R A;  4OXP A;  1HRJ A;  5AFW A;  3AU7 A;  3GTK B;  3DWP A;  2KJX A;  1HZB A;  4BA2 I;  3GD7 A;  1KIX A;  2ENB A;  1XXG A;  3Q6S A;  5COR A;  5E7N A;  3P7J A;  1GUT A;  1KLG D;  2EOT A;  2ZXO A;  4OWT B;  1UEA B;  2NZH A;  4UPA A;  2Q2I A;  4ME3 A;  4MTN A;  3BZD B;  3PIP 3;  1EEF D;  1X55 A;  1TS2 A;  1X3F A;  1B8A A;  4HSV A;  3A56 A;  1F9Q A;  2FMM A;  5M5W B;  3C2P A;  4JBM A;  4A3L H;  2NVT H;  4LK1 C;  1OXU A;  5IP7 H;  3KYH C;  4A3J B;  1PYW D;  4P74 A;  4QUC A;  4X6A H;  5IYD H;  1Q90 A;  4HIM A;  1SMY D;  1X3Q A;  2VS1 A;  3KLR A;  1BBU A;  1Q7Y C;  1QUQ A;  1TWF H;  1L2F A;  4C2M B;  4DV0 L;  4OO1 H;  5J3B A;  2K1B A;  3SEB A;  3CC7 A;  2KCC A;  5D3D A;  5EJW A;  1VQ5 A;  1I3Q H;  3R2T A;  3PSI A;  4JI2 L;  3S14 B;  2HQL A;  4UHV A;  4BY1 G;  1Z47 A;  2WB1 B;  1HR0 W;  4MIU A;  3MC0 B;  3S9W A;  2CW0 D;  5FJ8 G;  4DV2 Q;  2R7Z G;  1PTO B;  2B63 B;  1PH7 A;  4B3R Q;  3PUZ A;  5EPJ A;  1CHP D;  2XRS D;  1AE2 A;  2Q8T A;  2JA6 B;  4DPG A;  4A3B H;  1KRT A;  1UE7 A;  2O5J C;  3WOE A;  5ELO A;  3ICE A;  1SE2 A;  2P5Z X;  3SK5 A;  5I4D A;  1FD7 D;  1PRT D;  1W3S A;  2D2C C;  3F2U A;  1GHK A;  2PMZ E;  4CGY B;  3AEV A;  1SYC A;  5L37 A;  5F2D A;  1IYU A;  3I4M G;  4O42 A;  3GTG H;  1H9J A;  4QIW B;  2PI2 A;  4I7Z C;  1PH9 A;  3S24 A;  4L6T B;  4JV5 L;  1S3O A;  2B2W A;  3J7A 5;  3PUY A;  1YVC A;  2HIX A;  3TP8 A;  2YU9 B;  3CQZ B;  2HIV A;  2JA9 A;  2GA4 B;  1L1O C;  4R4Q A;  4OWX B;  2MFI A;  3J80 L;  2DY8 A;  3FPP A;  1SNC A;  2CKZ B;  3FKI G;  4RWS C;  5T1I A;  3U4Z A;  1E22 A;  5JEA H;  1O7Y A;  1F2M A;  5LHY 1;  2WII B;  4BY7 G;  5IGE A;  1BBX C;  1B2T A;  4TQU S;  1BVS A;  1KNE A;  1MHW C;  4MN3 A;  1SBB B;  3CXC A;  1IYJ B;  5TSS A;  3QR8 A;  3TS0 A;  4BY1 B;  1IBM L;  4LF9 L;  3L9A X;  4DR1 Q;  2PCF B;  2XTI A;  3K80 C;  2JN4 A;  4GNX B;  1ICF B;  2AKW B;  3J7A F;  3HOV G;  1EQV A;  1YNJ C;  4X64 L;  3DMU A;  3KJP A;  4DV3 L;  3K6O A;  2VL6 A;  1TII D;  2IL8 A;  4IUU A;  1GKH A;  4UY8 C;  1LM0 A;  5EPL A;  2R7D A;  5M5X B;  3PUW A;  1E2W A;  1D2B A;  2K5Q A;  3KF8 B;  1K8G A;  2F0F A;  3RNU A;  3DWQ A;  3C1E A;  1N9W A;  5C3E G;  3MHB A;  2KCN A;  1XNQ L;  2RSN A; 
#chains in the Genus database with same CATH homology
 1CKN A;  3AFP A;  3E0E A;  4FDB A;  3HOU G;  4BA1 I;  1C7Y A;  1GO3 E;  1KRS A;  3I2Z A;  5IT9 c;  3PUX A;  3PO2 H;  4KHZ A;  3GTL H;  5LMU L;  2ZTD A;  2XGT A;  4C3H H;  5LMN W;  2IHF A;  1Q12 A;  5FJ8 H;  5IYB G;  2R7Z H;  3JAM c;  1IBK Q;  2UUB Q;  2KCT A;  3VDY A;  4B3T L;  1SLJ A;  1H95 A;  4A3I G;  4QQB X;  4BBR G;  3EN2 A;  1VQ9 A;  4JI3 Q;  3M3Y H;  4LF7 Q;  3UDF A;  1Z9F A;  1Q82 C;  4JI6 Q;  2A1A A;  5LMN Q;  2YYZ A;  2IX0 A;  2N8N A;  2RF4 A;  4A76 A;  2QEX A;  2JEA I;  2NVQ H;  4GKJ L;  3HOW G;  4PZ8 A;  1C9O A;  2IHE A;  4YCW A;  2IT1 A;  4LF9 L;  1SE8 A;  2K5V A;  5BR8 Q;  5C44 H;  2KEN A;  1PH8 A;  2HT1 A;  4GKK Q;  5JJI A;  3AFQ A;  3CCS A;  4JI4 Q;  4GN3 B;  2KCM A;  3I4M H;  4K0K Q;  4DR3 Q;  1PH1 A;  3ULJ A;  4A3C H;  5IYC G;  4IJH A;  4R4I A;  2OQK A;  1MJC A;  3I4O A;  1HZ9 A;  3CC2 A;  1YJ9 A;  2ZTC A;  4JYA L;  4OON A;  3STB C;  3T1H Q;  3M4P A;  5FLM G;  2I0Q A;  2IY5 B;  1D8L A;  2Q2T A;  5JEA J;  2D0P A;  2JA8 H;  4EX5 A;  3STB D;  2ZJR A;  4DV2 L;  4JI5 Q;  1SN8 A;  4B3R L;  2WP8 J;  3KF6 A;  1FGU A;  4KHP Q;  5JJK A;  2KHJ A;  4IPH A;  4L5Q A;  4DK6 C;  2NN6 I;  1K3R A;  4QJF A;  3J81 c;  4AIM A;  1VQ8 A;  2IX1 A;  3OW2 A;  3S16 H;  4A3D H;  1VQE A;  1TWC H;  4IPD A;  2DGY A;  1NE3 A;  5M3F G;  5M5W H;  5M3M G;  2MNA A;  1HR0 Q;  1IBL Q;  4GLA C;  2YTY A;  4DKA C;  5C0X I;  4DV6 L;  3J80 i;  4LF5 L;  1E7Z A;  4LUZ A;  2PQA B;  3CCU A;  4A3J H;  1YNX A;  1GM5 A;  2LXK A;  4DV0 Q;  3J80 c;  3CCQ A;  4DR6 Q;  4A3G H;  3RLN A;  4JI0 L;  1PYS B;  1X54 A;  2VQF Q;  3U50 C;  1Y1V H;  1FJG Q;  2BH8 A;  1VQG A;  4IOA A;  1PYB A;  5GAH C;  1B7Y B;  4HIK A;  1S72 A;  2UUA Q;  2C35 B;  2ZTE A;  3D0F A;  3PV0 A;  3RZD H;  1XPU A;  1G29 1;  3OTO Q;  3PO3 G;  3G4S A;  4NB3 A;  3M4O H;  2E2I H;  1OXV A;  1ASZ A;  1HNX Q;  3W1B A;  3S14 H;  4WJ3 M;  3ULL A;  4A93 H;  4DV7 Q;  4A3L G;  1X56 A;  4LFA L;  4LF6 L;  1X6O A;  2B63 H;  5IP7 G;  1J5E L;  4DV1 Q;  1QVF A;  5C3E H;  3M85 A;  2VQE L;  4DR2 L;  2JA6 H;  1VQI A;  2LSS A;  1E24 A;  3PCO B;  5IYD G;  5C4X H;  1I94 L;  1E1O A;  1HH2 P;  4AYB E;  1YIJ A;  3E9H A;  3GTP H;  4DUZ Q;  3E9I A;  1EUJ A;  2VNU D;  1VS0 A;  3J7Z C;  1LTL A;  2R92 G;  4EQ5 A;  2Z6K C;  2E2J H;  1JJG A;  4YY3 Q;  4X65 Q;  2RHS B;  3CD6 A;  3OYY A;  4OO1 G;  1Q46 A;  4UP9 A;  1C0A A;  2AWO A;  1V1Q A;  1VQD A;  4GLV B;  3S1N H;  3S1Q H;  3AYH B;  1RL2 A;  4RMF A;  1KAW A;  1MKH A;  4LFC L;  4X66 Q;  4DR1 L;  1X65 A;  2UXB L;  3A5Z B;  4DV4 Q;  2JE6 I;  1PVO A;  4A3I H;  3NEN A;  1WCM G;  1A8V A;  4BBR H;  3S1R H;  2YV5 A;  4BBS H;  1VCI A;  4GOP B;  2UUC Q;  2CWA A;  3G71 A;  5DLQ E;  2A8V A;  4A3B G;  4AYB G;  1KC8 C;  1CSQ A;  2AWN A;  4NXM Q;  2ATW A;  3K0X A;  4LUV A;  2JJQ A;  4APV A;  2YU9 H;  3CQZ H;  4R4C A;  3UE0 A;  3GTM H;  2AMC B;  3HOW H;  3PF4 A;  2JQO A;  5IP9 H;  2K50 A;  3T1Y Q;  1XPR A;  1OTC A;  4LF4 L;  2EXD A;  2K75 A;  4DR4 Q;  1RIP A;  2ZJP A;  3I55 A;  4DAM A;  1I5F A;  4PZ7 A;  4X62 L;  2HHH Q;  2I5H A;  2Z6K A;  4DV5 Q;  2OTJ A;  1HNZ Q;  2BA0 A;  4LF8 Q;  4GN5 A;  4YHH Q;  1IBM L;  4MZ9 A;  3PIO A;  3RLF A;  1VQ6 A;  3HOZ G;  2GVB A;  1VQN A;  1U0L A;  2NVX H;  1X3E A;  3CCM A;  5FLM H;  1XJV A;  2K4K A;  1XTD A;  2N78 A;  2VY3 A;  4PMW A;  4P72 A;  1NBW A;  5H1S E;  2QA4 A;  1PH4 A;  4BY1 H;  3KJO A;  1VQP A;  1DGS A;  2UUB L;  1IBK L;  3JAM i;  3G6E A;  3U58 A;  4A3E H;  1D7Q A;  2UXC L;  1JE5 A;  3Q8D A;  2PI2 E;  1XPO A;  5C0X J;  4JI3 L;  4A3F H;  1S40 A;  4B3S Q;  5GAD C;  3BJU A;  3TEH B;  4LF7 L;  1N34 Q;  4BXX G;  4JI6 L;  1BKB A;  5LMN L;  2BH2 A;  3L0O A;  4AQY Q;  1EIF A;  2Q2H A;  4P75 A;  4R1J A;  5M3F H;  2F52 A;  1YBY A;  4TVA B;  3HOY H;  3KFU A;  3I56 A;  2VW9 A;  1YHB A;  4Y52 H;  5GAG C;  4IFD J;  4HJ5 A;  4LFB Q;  2R7F A;  5BR8 L;  5JEA G;  3CME A;  1YJN A;  1PH3 A;  4GKK L;  3CAM A;  2ZM6 Q;  4IO9 A;  1XNR L;  4JI4 L;  3H0G G;  1EOV A;  3CCL A;  1TWG H;  4K0K L;  4C3J H;  4DR3 L;  1V9P A;  4JI7 Q;  1N33 Q;  5K36 G;  4JI1 Q;  4IPC A;  4QY7 A;  3MXN B;  1I50 H;  1N32 Q;  2ES2 A;  1IXR A;  3M7N A;  1K9M C;  1OXT A;  1UE5 A;  1Y14 B;  3T1H L;  4P71 A;  3GTK H;  4XTC S;  3JC6 6;  3NEM A;  3W5O A;  1U5K A;  5IWA Q;  3M4Q A;  4JI5 L;  1EFW A;  4B3M Q;  3GDE A;  1N36 Q;  4KHP L;  3I4N G;  3J81 i;  2AHO B;  2BA1 A;  1K73 C;  2ALY B;  3TS2 A;  2JA7 H;  1KQS A;  1GVP A;  4MNO A;  3F2C A;  2VUM H;  1VQA A;  3RN5 A;  1YIT A;  4O2D A;  4GLX A;  5C4J H;  2ASB A;  1B70 B;  1FVI A;  1Q1B A;  2MO1 A;  2WFW A;  3FHW A;  4A3M G;  1HR0 L;  1IBL L;  1QUQ B;  3FKI H;  3UDI A;  4L5S A;  2UU9 Q;  2R92 H;  4UP8 A;  5AJ3 Q;  4DR6 L;  2H5X A;  4BY7 H;  1EWI A;  2PNH A;  5FLX c;  1VQH A;  3B6Y A;  2PQA A;  2VQF L;  4JBJ A;  2JA5 H;  4L5R C;  2K14 A;  3PO2 G;  2VZA A;  1Q81 C;  3CPW A;  1YHA A;  1FJG L;  1R9T H;  3GTO H;  1WYD A;  3W1G A;  4PZ6 A;  3L2P A;  3KF6 B;  3M9B A;  2R93 H;  4IFD I;  1XMQ Q;  4JI2 Q;  2UUA L;  4C2M H;  1X9N A;  3TRZ A;  1Y1W H;  3OTO L;  5EAY A;  3FP9 A;  3HOV H;  1JJC B;  4LW1 A;  3ZJY C;  1HNX L;  3IRB A;  2E5L Q;  3H15 A;  1VQM A;  1JB7 A;  1PFS A;  2KHI A;  3HKZ E;  4DV7 L;  2R6G A;  1KXL A;  4LWC A;  1VQ7 A;  4QGU A;  4DAY B;  4DV1 L;  4JG2 A;  3PGZ A;  4GNX C;  1L0W A;  4GOP C;  4GN4 B;  3K8A A;  4P73 A;  5IE8 A;  4C3I H;  3CF5 A;  4R4O A;  1P16 A;  5M5Y H;  2E2H H;  1E3P A;  2V1C C;  4H02 A;  4JC0 A;  4DUZ L;  2Z0S A;  1J6Q A;  1P8L A;  2L15 A;  2OWO A;  4A3C G;  1SR3 A;  4YY3 L;  3HOX H;  3CMA A;  4HJA A;  2UXD Q;  1WI5 A;  3HOU H;  4DUY Q;  4XIG S;  2CFM A;  2E8G A;  3KDF A;  4OX9 Q;  3HKZ G;  4X66 L;  1YHQ A;  2JEB I;  3EBE A;  1NMF A;  4JV5 Q;  2ZJQ A;  1YZ6 A;  3S15 H;  4DV4 L;  4DR5 Q;  1LYL A;  2CWP A;  2JA8 G;  1YEZ A;  3K7U C;  5IYB H;  1HZA A;  1VQK A;  1OXX K;  2UUC L;  3CCE A;  4DR7 Q;  1K0R A;  3UDX A;  1UEB A;  4JOI C;  1Q86 C;  4A3D G;  4GNX A;  4NXM L;  1TWA H;  4YCV A;  1TXY A;  1PH5 A;  2NN6 G;  3KOJ A;  4OWW B;  3T1Y L;  2OTL A;  1HJP A;  4NPS A;  1HNW Q;  3DLL A;  1T9H A;  4IPG A;  4A3J G;  4ALP A;  1IZ6 A;  1SRU A;  2GN5 A;  3H0G H;  2B29 A;  3BU2 A;  4O0A A;  4DV5 L;  1HZC A;  1HNZ L;  2Q2U A;  4A3G G;  5C0X G;  1I6H H;  1A63 A;  4LF8 L;  2MO0 A;  4YHH L;  4YWL A;  1PH6 A;  1CUK A;  3F2D A;  5IYC H;  3F1Z A;  3CCV A;  1WOC A;  2NVY H;  2FXQ A;  1IBM Q;  4LF9 Q;  2UXB Q;  4JI8 Q;  4L5T A;  1CKM A;  3I7F A;  1XMO Q;  1L1O B;  2MQH A;  3S1M H;  1NTG A;  1UE6 A;  1VQO A;  4WJ4 A;  4HJ9 A;  3HFZ B;  5HGQ A;  1G51 A;  4X64 Q;  4UP7 A;  3RN2 A;  1PV4 A;  4DV3 Q;  4A93 G;  4B3S L;  2B3G A;  2K52 A;  1N34 L;  1E1T A;  3CCJ A;  1A62 A;  1QVG A;  3RLO A;  4AQY L;  4POF A;  3CP0 A;  4A3K G;  2F4V Q;  4KI0 A;  1W2B A;  3CW2 C;  4NXN Q;  3CPF A;  4LNQ A;  1LUZ A;  5C4X G;  1JT8 A;  4LFB L;  3EIV A;  5GQO A;  5M3M H;  1CKN B;  3K7A H;  1BBW A;  5M5X H;  2ZM6 L;  3H3V I;  3LGJ A;  4OXP A;  1JJ2 A;  1AE3 A;  3S17 H;  2K5N A;  1XNQ Q;  1EQQ A;  4JI7 L;  1N33 L;  3ERS X;  4JI1 L;  1UE1 A;  1HZB A;  1KD1 C;  3H3V H;  4BA2 I;  3GD7 A;  1KIX A;  1N32 L;  4YCU A;  4QL5 A;  5LMU Q;  5E7N A;  2EIF A;  4RG1 A;  4KLK A;  1O7I A;  4OWT B;  2NZH A;  2UXC Q;  3S2H H;  4UPA A;  3UDG A;  2Q2I A;  4ME3 A;  4MTN A;  5IWA L;  4BBS G;  3PO3 H;  4B3T Q;  5ELN A;  2DUD A;  4YWM A;  1X55 A;  1X3F A;  4B3M L;  5GAE C;  1B8A A;  3NBH B;  1N36 L;  2I5L X;  3CCR A;  3U4V A;  1EYG A;  1YJW A;  4JBM A;  4A3L H;  1K83 H;  2NVT H;  1CSP A;  2ID0 A;  4DK3 C;  4R4T A;  2LXJ A;  5HY6 A;  5IP9 G;  1OXU A;  5IP7 H;  3KYH C;  4GKJ Q;  1N8R C;  3J81 j;  4POG A;  2GVA A;  2K5H A;  1IL2 A;  4P74 A;  1XNR Q;  4X6A H;  5IYD H;  4HIM A;  2UU9 L;  2VS1 A;  5AJ3 L;  1BBU A;  4OO1 I;  1VQJ A;  1Q7Y C;  1QUQ A;  1TWF H;  1L2F A;  1MIU A;  1UWV A;  4DNI A;  4DV0 L;  1G6P A;  2Y0S E;  5J3B A;  3MEF A;  3CC7 A;  3CC4 A;  4HJ7 A;  5IY0 A;  1VQ5 A;  1XMQ L;  1I3Q H;  3L7Z C;  3PSI A;  4JI2 L;  1WJJ A;  2HQL A;  3DM3 A;  4BY1 G;  1Z47 A;  1X3G A;  1PH2 A;  1HR0 W;  1QZH A;  2D0O A;  4A3E G;  3RR5 A;  2RCN A;  5FJ8 G;  4DV2 Q;  1WCM H;  3A5U A;  3PUV A;  2R7Z G;  1PH7 A;  4B3R Q;  3PUZ A;  4A3F G;  2E5L L;  4IOC A;  2WAQ E;  4A3B H;  1AE2 A;  2QGQ A;  4DPG A;  1KRT A;  3WWV A;  4JBW A;  1EIY B;  3RZO H;  2A19 A;  1SMX A;  1EQR A;  1UE7 A;  3BZC A;  2KBN A;  5ELO A;  3GTJ H;  3HOY G;  3ICE A;  1AH9 A;  2EQS A;  2Y0S G;  2OQ0 A;  1W3S A;  4DV6 Q;  2NZO A;  4LF5 Q;  2PMZ E;  5C44 G;  1Q8K A;  3AEV A;  1VQL A;  1KHI A;  1NJI C;  2UXD L;  4JI0 Q;  3I4M G;  1OXS C;  4DUY L;  1VQF A;  4YWK A;  2I5M X;  2N49 A;  1FL0 A;  3GTG H;  4X65 L;  1CKO A;  3HOZ H;  4OX9 L;  2PI2 A;  2WAQ G;  2YTX A;  1WFQ A;  1KL9 A;  5JJL A;  1PH9 A;  3S24 A;  4JV5 L;  1S3O A;  4DR5 L;  4A4I A;  3J7A 5;  3K81 C;  3PUY A;  1YVC A;  2HIX A;  4GS3 A;  1VQ4 A;  4DR7 L;  2HIV A;  1V43 A;  3NEL A;  3HKS A;  4LUO A;  2JA9 A;  4A3K H;  1L1O C;  2RHQ B;  3BZK A;  4R4Q A;  2MFI A;  4LFA Q;  4OWX B;  3UE1 A;  4LF6 Q;  2JA7 G;  2VUM G;  4BXX H;  2F3I A;  1J5E Q;  4HIO A;  1TWH H;  2VQE Q;  4J15 A;  4DR2 Q;  4GOP A;  4JBK A;  1VQC A;  2CKZ B;  3FKI G;  3TRE A;  3S2D H;  1Q1E A;  1HNW L;  1I94 Q;  4DR4 L;  1JMC A;  3PF5 A;  3U4Z A;  1E22 A;  2WB1 E;  3KDF B;  3G48 A;  3ER0 A;  2N3S A;  4BY7 G;  4Y7N H;  4TQU S;  1BVS A;  1ASY A;  2HHH L;  2CCZ A;  4HID A;  2JA5 G;  2JK8 A;  3CXC A;  1IYJ B;  1K8A C;  1QVC A;  3F8T A;  4IJL A;  3A74 A;  3TS0 A;  2R93 G;  1A0I A;  1NMG A;  1SRO A;  4JI8 L;  3KLW A;  4HJ8 A;  1Y1V G;  5GRO A;  4DR1 Q;  1SFO H;  1PA6 A;  4LFC Q;  2XTI A;  1GD7 A;  3AQQ A;  3K80 C;  1Y1W G;  1XMO L;  4GNX B;  1M90 C;  2AKW B;  4IFD G;  3HOV G;  4PG3 A;  2CQO A;  3A0J A;  1L1O A;  3D31 A;  4X64 L;  3KJP A;  2VL6 A;  4JCV E;  4DV3 L;  4JOI A;  1PHJ A;  4AH6 A;  1GKH A;  4UY8 C;  1LM0 A;  1NY4 A;  2WB1 G;  3ULP A;  3I4N H;  2R7D A;  3SGI A;  1VQB A;  3PUW A;  4A75 A;  2F4V L;  3KF8 B;  3PIP A;  4QIW E;  4NXN L;  1K8G A;  2OCE A;  3RNU A;  2B63 G;  4LF4 Q;  4JYA Q;  5C3E G;  1N9W A;  3F2B A;  2YTV A;  1M1K C;  3GO5 A;  4A3M H;  2JA6 G;  3TQY A;  1QZG A;  2D62 A;  4X62 Q;  1YI2 A;  1MJE A;  3GTQ H;  3HOX G;  1XNQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...