2UXBQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxbQ00
1SMXA 2DUDA 1VQHA 4WJ3M 3AFPA 4LNQA 1YHBA 1HNXL 4IJHA 4A3CG 1PVOA 5BR8L 2Z6KA 4B3MQ 4A3DG 2K4KA 4LFCQ 2GVAA 2R7ZG 2A19A 1CSQA 1S3OA 1XNQQ 2UUBL 2IY5B 4BY7H 4KHPQ 1QUQB 3K81C 3KOJA 3F2DA 3GO5A 4GN5A 1N36Q 5IYCG 2JA6G 3KDFA 1E7ZA 4DR6L 4HIOA 3RZOH 4NPSA 5FJ8H 2Q2UA 4DV4L 5K36G 1PFSA 3D0FA 5IP9G 2AHOB 3J7A5 2ALYB 4L5RC 4MZ9A 1IBLQ 1VQNA 4IJLA 1VQBA 4J15A 2Y0SG 4JI8L 4A3BH 1KL9A 1Q7YC 3HOWH 1VQCA 3GDEA 3STBC 2K50A 2GN5A 2N8NA 2ZTEA 4BA1I 4DV6Q 4JI7L 1RL2A 4DUZL 1PH4A 1JT8A 1WYDA 3MEFA 3J80i 3PUWA 5FLXc 3PF4A 3S24A 4AYBE 2NVYH 3HKZE 4IPHA 3RLOA 5GAHC 1TWHH 1Y1WH 2R92H 2K5HA 2KHJA 4P74A 4DAYB 3GD7A 1K9MC 1XNRL 1EYGA 2JEBI 3U58A 4DAMA 4DV5Q 4EX5A 4TVAB 1GD7A 3FKIG 3OTOL 4YWKA 4OWWB 3CCLA 3W1BA 1YBYA 2JA5H 3TS2A 2V1CC 3PF5A 2VUMH 5JEAJ 5FLMG 1KXLA 1CSPA 4IPGA 4JI2L 4YCVA 1CKNA 2D62A 3KF8B 3CCMA 4JBKA 4PG3A 2ES2A 1O7IA 3IRBA 4DR1Q 3CP0A 4UP8A 3F2BA 1EQRA 1IL2A 4LF5Q 2DGYA 2R6GA 1BVSA 4O2DA 4GOPB 1HZ9A 3M3YH 1FJGQ 2WB1G 4HIDA 1YIJA 2ATWA 2LXJA 4A3LH 3S15H 1YVCA 2K75A 3D31A 3F1ZA 1CKMA 4ME3A 3RZDH 3CMAA 2K52A 4JBMA 2R7DA 3L2PA 3S1MH 2Q2TA 1OXUA 1Y1VG 4DNIA 5IYBH 5C0XJ 5IWAQ 2N78A 3I4MH 2E2HH 4JC0A 4A3JG 4JI6L 2D0PA 2VZAA 2WFWA 1U0LA 1N9WA 4B3SL 1N32L 4A3GH 1EQQA 2JA7H 2NVQH 1EIFA 3Q8DA 1J5EL 4C3IH 4A76A 3I7FA 1YJWA 4P72A 1MIUA 2UU9Q 1QVFA 4HIKA 1OXTA 4UY8C 2NN6G 4LF9L 1K83H 1HZCA 5GAEC 2VW9A 3OW2A 2I5LX 3H0GH 3S16H 1KC8C 1G51A 1HZAA 4DR6Q 3S2HH 4L5QA 1D8LA 1HR0L 2N49A 1GKHA 1YJNA 2R93H 4DV4Q 1PH1A 3KFUA 4OXPA 4A3FH 3CAMA 1C7YA 4GKKL 1IBKQ 3WWVA 1L1OB 2CWPA 2F4VL 2YTVA 4APVA 4DV1Q 5C0XI 2HHHL 3I56A 1Z9FA 1N34Q 1VQ4A 3J81c 5ELOA 2UXDQ 5C3EG 1LTLA 2UXCQ 1IYJB 4OX9Q 2UUCL 4PZ7A 1N8RC 5IYDG 2VUMG 3H15A 3FHWA 3I4OA 3B6YA 4DR5L 2E5LL 1L1OC 4GN4B 1OXVA 4YWLA 3T1HL 1PH2A 1GO3E 1TWFH 2D0OA 2H5XA 4ALPA 1FGUA 2VNUD 5M3FG 2CKZB 3PO2H 3TQYA 3HOVG 4BBRH 4BBSH 5C4XH 2MO0A 1IZ6A 1RIPA 3NENA 4DV7L 1M1KC 2EXDA 1PH6A 2QEXA 1VS0A 1KAWA 1MJCA 4LF7Q 1M90C 4DR7L 2LXKA 3KF6A 5AJ3L 1Q81C 2IX1A 1E24A 4NB3A 3AEVA 2PNHA 4BXXH 1X65A 2UXBQ 1NBWA 2JA7G 2IX0A 3UE0A 1WCMG 1N33L 3BJUA 4GLAC 4IOAA 2GVBA 4KLKA 2JE6I 4X6AH 3CF5A 3HOYH 2JK8A 4IFDG 2Q2HA 2B3GA 5IP7H 4A75A 1KIXA 4P75A 3F2CA 1VQDA 1VQPA 1I94L 4B3SQ 1L2FA 5M5YH 2ZM6L 3CCSA 1X6OA 4L5TA 4JI1L 4LF6Q 3H3VI 2R93G 1Q8KA 2VQFQ 1I3QH 4R4TA 4AYBG 4YY3Q 3HKZG 4A3FG 2I0QA 1X55A 3FP9A 1KRSA 2YU9H 2BH2A 4DV2Q 3S2DH 4K0KQ 2UUAL 2RHQB 3CD6A 2ZJQA 2AKWB 3KJOA 4DV3L 4GNXA 1PH3A 1OXSC 3PUVA 1NJIC 1Q46A 1VQ6A 2R7FA 3UDIA 1H95A 1HNZQ 1IXRA 1C0AA 1ASZA 1HR0W 4A93G 4LF4L 1VQLA 4JI4Q 1JJ2A 2NZHA 2OWOA 3CPFA 3JC66 3HOXG 3PO2G 4DK3C 4X64Q 3M4OH 1KHIA 1PH5A 3CC2A 4BBSG 4BBRG 1IBML 3RLNA 4DR3Q 4AQYQ 4A3KG 2KENA 1VQFA 3K7AH 1D7QA 2VS1A 4OWXB 4JI0L 2NN6I 4POGA 3GTOH 4YHHL 2F3IA 1QUQA 5LMUQ 4A3EH 2YTYA 3OYYA 1JJGA 2HT1A 3ULJA 3GTGH 2I5HA 4OO1I 1V1QA 1KQSA 4DV0L 4JI3L 4BXXG 4DR2Q 1HNWQ 3GTKH 4B3RQ 2HIXA 4GN3B 1WI5A 4JI5L 3VDYA 4X65L 3HOYG 5IP7G 2IHEA 2PQAB 3GTQH 1GVPA 1BKBA 3TREA 1QVGA 1G6PA 5AJ3Q 3T1YL 5LMNL 1SN8A 3BZKA 3J80c 4JYAL 3RN5A 4IFDJ 4Y52H 3G6EA 4QIWE 2VY3A 3E9HA 3G48A 4P71A 2MO1A 3W1GA 3PO3H 4BY7G 4LFBQ 1A63A 3A74A 4DK6C 3CW2C 2AWNA 1XPOA 3L0OA 2JA9A 1B70B 1DGSA 3NELA 1NMFA 1HNXQ 2RCNA 5BR8Q 5FJ8G 4A3MH 1XMOL 1X9NA 4LF8L 4QQBX 1K3RA 3TRZA 2ASBA 3RN2A 4R1JA 4IPDA 1NTGA 4NXNL 1Q1EA 3KLWA 4DUYL 2UUBQ 4C3JH 4LFAL 2PI2E 4FDBA 1TXYA 1WOCA 1YI2A 1YITA 1PYSB 4A3BG 1K8GA 3PIPA 1X54A 3HOWG 3E9IA 1X3GA 3JAMi 4HJ7A 1B7YB 4DR4L 1C9OA 4KHZA 4GOPA 4JOIC 3STBD 1X3FA 3J81i 3UDXA 3M4QA 4DV3Q 2R92G 1Y1WG 1XTDA 4B3ML 1LYLA 1I6HH 3U4VA 4JI8Q 2ZJRA 3LGJA 1XNQL 2OTJA 4A4IA 3AFQA 4HJ5A 1E1OA 1VQ8A 5M3MH 4JI7Q 4PMWA 2A1AA 3A0JA 2JQOA 4R4IA 3RR5A 4DUZQ 4KHPL 1J6QA 1FL0A 2JA5G 4A3EG 1W3SA 4LUOA 4UP7A 2PMZE 3F8TA 2FXQA 1N36L 4B3TL 2WP8J 1NE3A 2E2JH 1VQ7A 4A3DH 1HZBA 1YHQA 2R7ZH 1XNRQ 2NZOA 2EQSA 2AMCB 2MNAA 1K73C 1IBLL 3KYHC 3OTOQ 4A3LG 4YHHQ 1SLJA 3CXCA 3RLFA 3K8AA 3PGZA 1XPRA 5IYCH 5C44H 2JA6H 1JJCB 2RF4A 4JI2Q 5IT9c 3EIVA 3GTMH 1AE2A 3HOUH 1VQEA 1QVCA 4YCUA 4C3HH 1AE3A 5IP9H 2MQHA 5IYBG 3I4MG 4LUVA 5M5WH 3UE1A 3MXNB 1L1OA 1V9PA 3I55A 4KI0A 4JBJA 3K0XA 4LW1A 2PI2A 2KHIA 4PZ6A 4NXML 3UDGA 2JA8H 3A5UA 3ZJYC 4YCWA 1EIYB 1A0IA 3S1QH 4MNOA 1VQGA 4JV5L 3S17H 3TEHB 1R9TH 3ICEA 5LMNW 1TWAH 1Q86C 3CC4A 1SFOH 4JI6Q 4DR1L 1PYBA 1UEBA 2OTLA 1A62A 1G291 2CFMA 2Z6KC 2C35B 4LF5L 3KDFB 3H0GG 5IE8A 1NY4A 3FKIH 3CCEA 1FJGL 4LWCA 1N32Q 2OCEA 3NBHB 1J5EQ 1X56A 1AH9A 1OTCA 2YV5A 4R4OA 1YZ6A 3E0EA 4OWTB 3H3VH 5J3BA 2L15A 1JE5A 2IT1A 3ULLA 1I50H 1Z47A 2HIVA 2KCMA 4LF9Q 5IWAL 5EAYA 4GNXC 1VQJA 2WAQE 1WJJA 2E2IH 4GKJL 1HR0Q 3PUYA 1WFQA 4BA2I 4DPGA 1PH8A 3UDFA 4H02A 1VQIA 2K5VA 5H1SE 1S72A 4GKKQ 1BBWA 3PUXA 5E7NA 2E8GA 1V43A 4QL5A 4QJFA 4HJ8A 4A3IH 2UU9L 2F4VQ 5HGQA 2HHHQ 1Y1VH 5HY6A 3M85A 2XGTA 2KCTA 1K8AC 1P8LA 2EIFA 3J7ZC 1P16A 5GROA 3HFZB 4RMFA 4A3JH 3S14H 1E3PA 5C4XG 2UUCQ 3CQZH 4B3TQ 5M5XH 5C44G 4DR5Q 1VQ5A 1CKNB 2E5LQ 1W2BA 3CCUA 3T1HQ 3HOUG 1Q1BA 1KD1C 2CQOA 2N3SA 3M7NA 1XPUA 1IBKL 3L7ZC 2AWOA 1B8AA 2KBNA 4DV1L 1U5KA 3AQQA 5GADC 2BH8A 1E1TA 2YYZA 3G4SA 2OQ0A 1N34L 3ERSX 2JA8G 4HJAA 2YTXA 1FVIA 2OQKA 3K80C 4DV7Q 4IOCA 1QZGA 4OX9L 2CCZA 2UXCL 4X66L 1SROA 2K5NA 2QA4A 3U4ZA 4QY7A 3NEMA 5JJKA 3GTLH 1XJVA 4UP9A 3ER0A 3CCQA 4DR7Q 3KJPA 1I5FA 3GTJH 4YWMA 1A8VA 1YEZA 3BU2A 1QZHA 1PHJA 2JJQA 2NVTH 3SGIA 4IPCA 2HQLA 4NXMQ 5C3EH 1N33Q 1VQMA 1EFWA 4LUZA 4R4QA 1VQOA 5IYDH 3J81j 2Y0SE 1HJPA 2Q2IA 4JV5Q 2QGQA 3AYHB 2VQEL 4Y7NH 1TWGH 3DM3A 5GQOA 4GS3A 5M3FH 1Q82C 4LF7L 1TWCH 4GLXA 3CC7A 1I94Q 4GLVB 4JCVE 1VCIA 2ZM6Q 3ULPA 2B29A 3HOVH 3PCOB 1KRTA 4JI1Q 3I4NH 5JJLA 4QGUA 1UWVA 1VQAA 1HH2P 1PH9A 4BY1H 2UXBL 3HKSA 2VL6A 4AIMA 3HOZH 1Y14B 3CMEA 4A3IG 4X62L 1XMQL 4GOPC 3PIOA 5IY0A 5C4JH 4PZ8A 4HJ9A 2UUAQ 1SR3A 1LM0A 1Q12A 3GTPH 2PQAA 4MTNA 2B63H 4GKJQ 3U50C 1SRUA 3S1NH 1S40A 4LFCL 4LF6L 4IFDI 3TS0A 2K14A 3G71A 3RNUA 1WCMH 4WJ4A 2VQFL 2MFIA 1GM5A 4UPAA 4LF4Q 1EOVA 2IHFA 2WB1E 2Z0SA 1LUZA 4YY3L 4R4CA 2RHSB 1NMGA 1EWIA 4JBWA 4XIGS 4L5SA 4A3CH 4DV2L 4RG1A 4K0KL 3W5OA 2ZTDA 1IBMQ 2BA1A 2JEAI 1MKHA 1YHAA 4AH6A 2BA0A 4OO1G 4JG2A 1T9HA 1UE1A 3M4PA 4JOIA 4POFA 3PV0A 4JI0Q 1HNZL 3BZCA 4XTCS 1VQ9A 3JAMc 3KF6B 4DV6L 4JI4L 4O0AA 5DLQE 2I5MX 5JJIA 1PH7A 4DV0Q 4X64L 4JI3Q 2CWAA 3A5ZB 1X3EA 3PUZA 1JMCA 4X66Q 4JI5Q 1YNXA 3EN2A 1L0WA 4DR3L 1ASYA 1E22A 4AQYL 3PO3G 4X65Q 1PV4A 4DV5L 1EUJA 4A93H 3CCRA 1YJ9A 4OONA 3T1YQ 5LMNQ 1VQKA 1UE5A 3HOXH 5LMUL 4A3MG 1CUKA 1JB7A 4JYAQ 1PA6A 4DKAC 2WAQG 3K7UC 3I4NG 3M9BA 4DR2L 4BY1G 5ELNA 5JEAG 4A3KH 1HNWL 4TQUS 4B3RL 1OXXK 1UE6A 2VQEQ 1BBUA 3PSIA 3CCVA 3HOZG 1CKOA 1UE7A 2ZJPA 4A3GG 4EQ5A 1XMOQ 4LF8Q 4GNXB 3I2ZA 2F52A 3S1RH 2NVXH 5FLMH 2B63G 2A8VA 1MJEA 4NXNQ 4LFAQ 2ID0A 4DUYQ 2UXDL 5GAGC 2LSSA 3DLLA 3CPWA 1SE8A 4IO9A 3EBEA 4P73A 4DR4Q 5M3MG 4C2MH 4LFBL 4X62Q 2XTIA 1K0RA 1XMQQ 4HIMA 5C0XG 3CCJA 2ZTCA
chains in the Genus database with same CATH superfamily
4WJ3M 4IJHA 5BR8L 4B3MQ 4KMUC 3D6CA 4RCNA 4LFCQ 1Z6HA 2BDOA 2L12A 1HHVA 3NQTA 2RBMA 2B8GA 1O7ZA 1QUQB 3K81C 5KYIA 3GTKB 5CC4A 2JA6G 3KDFA 5DNFA 3MEHA 4DR6L 1XTCD 4DV4L 3QOLA 1H9KA 3D0FA 3NBHA 1SNPA 1IBLQ 2EZVA 1ICFB 3BDOA 1VQCA 4QUCA 4DUZL 1LV9A 3GV3A 5EJWA 2EYJA 5FLXc 3EA6A 1O7LA 2NVYH 5GAHC 3RLOA 1SMYD 2K5HA 2KHJA 4N8X1 4P74A 4C3JB 5EPLA 3OHXC 5KNDA 3OTOL 3T56B 5ELFA 3TS2A 4FF1A 3MXUA 1CSPA 5JVH3 1CKNA 2AUKA 2D62A 1CHPD 3Q6SA 1JQYD 4JBKA 5C3XA 2EY6A 2ES2A 1EY6A 1F2YA 2G9HD 2EYOA 3A7AB 3CP0A 1IL2A 2QEJC 2R6GA 2WB1G 2LXJA 1KNEA 1YVCA 2K75A 4CKCA 1CKMA 5E4XA 4IQZA 1PYWD 2B2TA 2ZXRA 2R7DA 3BDCA 1M8AA 4F7XA 4B08A 5IWAQ 1PTOD 4XXEA 2XWBB 1ESFA 3QJYA 1HFNA 1DOLA 3AMUA 4B3SL 4A3GH 3BG3A 1J5EL 3MHBA 3I70A 5C44B 4CDEC 1QVFA 3HOUB 4U68A 2NN6G 2VW9A 1RODA 4M8AA 3OW7A 3OW2A 2I5LX 3S2HH 2N49A 5IGEA 4ZKBB 1XX8A 1STGA 3KFUA 1AP0A 2QILA 3NWTA 4OELB 2F4VL 4APVA 4DV1Q 3S17B 4DK1A 1TWAB 3TSSA 2UXDQ 5ELOA 5C3EG 1LTLA 2AQ1B 2UUCL 2VUMG 3H15A 3FHWA 5M5YB 2E5LL 2D5DA 1PH2A 2H5XA 4ALPA 3HRZC 5M3FG 3TQYA 1A3TA 5ELBA 4BBSH 2PZUA 1GUNA 2MO0A 4FNFA 5D65A 1J9OA 4CKEA 4DXFA 1MGSA 1PH6A 1ZXTA 2FHTA 1OO9B 4HMJA 1VS0A 3D3RA 2WIIB 1MSGA 2IX1A 1BF4A 3NBIA 4NB3A 1DZ1A 1O78A 2UXBQ 1NBWA 3S14B 1IHZA 3UE0A 1WCMG 3NK9A 1T5EA 3BJUA 5CYUA 2GVBA 4IOAA 2JE6I 4IFDG 4C1NK 2JK8A 2Q2HA 4A75A 3GTOB 2F1MA 1S5ED 3IAYA 3D8GA 1VQDA 1PRTF 4KJOA 2E75C 2TMPA 2VQFQ 2XRQD 3EQLC 4R4TA 4AYBG 2I0QA 2NTSA 5D14A 1BCPF 2BH2A 2CQAA 4DV2Q 3S2DH 1KABA 2ZJQA 1PH3A 1OXSC 5I4DA 3MTSA 2R7FA 2K05A 5EBDA 1H95A 4BWGB 4RAUC 4ZKCB 1EEID 2FFKB 1BQQT 1V8QA 4BBRG 3KUPA 4JW0A 4H0LC 5KNBA 2B2YC 4HSPA 3RD4A 4HSVA 1VQFA 2ZXPA 3I4NB 2F0JA 4A3EH 2YTYA 3SR1A 3ULJA 3GTGH 4OO1I 1UEAB 1BCPC 3RMHA 3G7LA 4DR2Q 2B63B 2QDLA 4OO1H 2HIXA 1EFID 1SYEA 1Q90A 1WI5A 3NTIA 4GN3B 4X65L 1X3PA 3T1YL 3RN5A 3BVZA 4ZCKA 4QIWE 4P71A 3E9HA 3G48A 2MO1A 3PO3H 1XPOA 3L0OA 2JA9A 1B70B 4ILWA 4E6IA 1NMFA 1XXGA 3E6ZX 2RCNA 5BR8Q 5IGBA 4A3MH 1X9NA 1LTAD 4QQBX 1K3RA 3TRZA 2ASBA 2QCPX 2Z4IA 4KN7C 2RKSA 1G2TA 2PI2E 1TXYA 1WOCA 1PYSB 1DCZA 3PIPA 1X54A 3I72A 4DR4L 2Y0SB 4A93B 4TSSA 3STBD 3K5NA 1STYA 3M4QA 3HOXB 2CHBD 1WTOA 1I6HH 1FNUA 2ZJRA 4KN4C 3AFQA 3D4WA 1VQ8A 4KHPL 3QO2A 4R4IA 4DUZQ 1WTRA 4G7OC 1J6QA 1FL0A 1N36L 1A2TA 3DM1A 4L6TB 2R3ZA 1EZ6A 4PV1C 4A3DH 1JE4A 5I6WA 5C5LA 1EWCA 3OTOQ 1XPRA 5CMDA 2F4IA 2RF4A 1R4PB 3NP8A 1NNXA 1QVCA 4C3HH 1RDPD 1NCVA 2K03A 3I55A 4H44C 4LW1A 4A3GG 2PI2A 2OF1A 1SMYC 4YCWA 1A0IA 4ULLA 3P20A 1FGBD 4JV5L 3RZOB 1R9TH 4JPBW 5LMNW 1KDCA 3CC4A 1KAAA 1G291 3CHBD 2Z6KC 3KDFB 5IE8A 1FJGL 3FKIH 4FXGC 4LWCA 1TS4A 2OCEA 3NBHB 1J5EQ 1SNDA 1OTCA 2YV5A 4ZYSA 4OWTB 4O1NA 5J3BA 1WTPA 2L15A 1G91A 4UHVA 2IT1A 2KJXA 2HIVA 1EOTA 2V4DA 4K5WA 3GTJB 3NE5B 4GNXC 2WAQE 2E2IH 4FXDA 2K5VA 3E5SA 4CDDC 1PLFA 1ESRA 1LTTD 1V43A 3A8IE 3VA7A 2F4VQ 1Y1VH 3C1EA 5HY6A 1K8AC 1KLGD 1MSHA 2D9UA 3HFZB 3OPOA 4RMFA 4EVOA 4A3JH 3IFTA 2UUCQ 3R3OA 5M5XH 1CKNB 3KLSX 2E5LQ 3W3AA 4RHRA 2B2UA 3RZDB 2CQOA 4WRDA 2K01A 1RF2D 5COYA 2KBNA 1JCKB 5GADC 3GTPB 1N34L 2EE1A 2JA8G 2CCZA 1AFPA 3U4ZA 2RA4A 3GTLH 2L0CA 1I5FA 1A8VA 1K28A 2F3WA 1HQMC 1Y8NB 1D5ZC 4IPCA 2HQLA 1K83B 1SE4A 2F0FA 2NTTA 3S16B 5IYDH 5L37A 2X6LA 5BN5A 2G5DA 2XNAC 1KDBA 2R93B 3K5LA 4OHJA 4Y7NH 4A3FB 3JAME 5LHY1 5GQOA 1C48A 4YIJA 4LF7L 1TWCH 4H13C 3CC7A 4GLXA 2JSOA 4JCVE 1VCIA 3ULPA 3PCOB 3J81E 2MJ8A 1PH9A 3HOZH 3CMEA 4ZAIA 1LTID 4A3IG 4X62L 2Z9HA 1M4VA 1H9JA 2PQAA 5E3FA 4KY5A 1A3UA 2KCCA 4LFCL 1H9MA 2CW0D 2K14A 3TBIB 3QIAA 1C4QA 4YY3L 4P2CB 3OOCA 1WTQA 1UUPA 1MKHA 1F2ZA 4OO1G 4JG2A 1T9HA 1UE1A 1CT1D 3BZCA 2K28A 3JAMc 4JI4L 5DLQE 2HDMA 4X64L 3VYTA 3A5ZB 5FO9B 4QCLA 2LY7A 4DR3L 3PO3G 4HN7A 1ASYA 4AQYL 4X65Q 3QG1A 2N88A 1MD2D 4J8QA 1EYCA 5K5PA 3T1YQ 4A3MG 1JOKA 1RTOA 2AUJD 2A6HD 4DN4M 1LACA 5ELNA 3K57A 4PNYA 1HNWL 1SNMA 4B3RL 1OXXK 1UE6A 2VQEQ 1BBUA 2Q8IB 3HEJA 1GHJA 4CHTB 1GUTA 3S1RH 2NVXH 3S9WA 2A8VA 1IW7D 2XRSD 3N6RA 2QW7A 1Y1WB 5DM63 1B2TA 4P73A 1H9SA 4DR4Q 3E0JA 1CA5A 3K7AB 2NVTH 3AFPA 1QNKA 1HNXL 1PVOA 1QNUA 2RDFA 4A3DG 2K4KA 2K32A 4LJZC 5T1IA 2UUBL 1EEFD 4BY7H 4KHPQ 1WVLA 3KOJA 4HCSA 4GN5A 1N36Q 1ILPA 4ZUIA 3EJIA 3NUCA 2QF7A 3GTQB 1LO5D 3NQIA 2QDBA 5FJ8H 1GHKA 3J80E 2AHOB 1B3AA 1HUMA 1S5FD 2SEBD 1VQNA 4RHSA 3SK4A 4HR7B 1S5DD 4A3BH 2EPBA 3I4MB 2FMCA 1S5BD 1Q7YC 3STBC 2K50A 4DV6Q 1ZKOA 4CDCC 1PH4A 3MEFA 3J80i 3S24A 3R8BA 1TWHH 2F0TA 3GD7A 1B53A 3FKIG 3W1BA 2VUMH 2HQEA 5JEAJ 3IKJA 1VF7A 3KF8B 4YCVA 5T1GA 1O7IA 3IRBA 3KLSA 1EQRA 1FNVA 1EY7A 2DGYA 4V190 1FJGQ 3BYTB 3F1ZA 2NUCA 2VXWA 5ISRA 1DOKA 1TY2A 3Q22A 1GUSA 2EJMA 1I4GA 2Q2TA 1Y1VG 3FDTA 4A3JG 4JI6L 2L5TA 1X32A 2RSOA 3PIP3 1EQQA 5C4XB 3N52A 2HDLA 3WDNA 3E3XA 4C3IH 4A76A 1YJWA 2JA6B 1J8IA 1NAPA 1MIUA 1PRTD 2X69A 3TP5A 4IFDH 1OXTA 1VF5C 2CVRA 2JXMB 4QIWB 3H0GH 1KC8C 4DAPA 5CR3A 1D8LA 4RKBA 1BDOA 1GKHA 1BCPD 5ELDA 2EVBA 3CAMA 1C7YA 1ENFA 1X3QA 3S1QB 2YTVA 2HHHL 3TP6A 3V2TA 4RKLA 2I46A 1I6VC 2K33A 5JPMC 1N34Q 1SFOB 3I90A 1BOSA 1N8RC 5IYDG 1LT5D 1L1OC 5ELCA 4GN4B 3LWEA 1FGUA 2VNUD 2YU9B 3G6JB 2B2WA 1PDQA 4IUUA 1I50B 4BBRH 5FOBB 2Z6BA 4DV7L 4QF4A 5DAUA 2A74C 4LF7Q 1MHWC 4IZ8A 1M90C 1KTKA 4DR7L 2GA4B 4K6DA 2JA7G 2IX0A 1EQTA 4X3UA 4X6AH 4ZLTF 1B4OA 2OT2A 1DXMA 2PNRC 3TMEA 4P75A 3F2CA 2PW7A 5M5YH 2ZM6L 1FYCA 4L5TA 3H3VI 3LX0A 4K6LA 4YY3Q 3HKZG 1KRSA 4DNRB 2PYKA 2LS01 1LT3D 2F0QA 1VMPA 2RHQB 4RGNA 3CD6A 2AKWB 3KJOA 3PUVA 1TS5A 3UDIA 2J0TD 2NWGA 1C0AA 4LF4L 4JI4Q 5I9OA 2OWOA 3JC66 3PO2G 4X64Q 3NPPA 2OXPA 4ZQ3A 2CW0C 4DR3Q 2WAQB 4AQYQ 1T5XD 1DD2A 4BY1B 4IALA 4OWXB 2PCFB 3GTOH 3FEWX 5CV4A 2L11A 5C4JB 3X3NA 2L1BA 4DV0L 2KCNA 1JC7A 1HNWQ 4B3RQ 2EY5A 3HOYG 5DEHA 5IP7G 2PQAB 5M3MB 1QVGA 1G6PA 5LMNL 1SN8A 2EYMA 2E2JB 2DJFC 1GUGA 4X3SA 1CI3M 4BY7G 5C4ZA 1A63A 3A74A 4DAYA 2AWNA 2MPMA 4MHEA 1JICA 4OL7A 1HNXQ 1STEA 5FJ8G 1XMOL 2A6HC 4RWSC 1HCZA 5EPKA 3GTMB 4IPDA 3KLWA 4DUYL 2UUBQ 3KK7A 3Q23A 1YI2A 4U673 4A3BG 1K8GA 3E9IA 4G57A 1X3GA 4XDXA 4GOPA 4B9WA 1IW7C 1B44D 4DV3Q 3NXWA 1XTDA 3ONAB 1LYLA 5CV7A 2EYHA 2MUYA 2OTJA 2JYOA 3EVQA 1E1OA 2WKDA 3IFDA 4HJ5A 4PMWA 3RUZA 2F0DA 3TDQA 4LUOA 3SE0A 1VQ7A 4QUFA 1QB5D 1VMCA 3OWEB 5C5MA 1YHQA 2R7ZH 1EZ8A 2EQSA 4IUNA 2AMCB 2MNAA 1K73C 1B1ZA 3ZYYX 3WOFA 1SLJA 4YHHQ 4KY6A 1H9RA 5IYCH 1BBXC 1CZGA 5K36H 5EQ0A 4FF4A 5IP9H 2F0PA 2MQHA 1H9SB 1WD1A 4Z9CB 1NR4A 4PMBA 2C9OA 5C6AA 1I4PA 2CH4A 2JA8H 1B9NA 1U4RA 1O80A 4C3IG 5FK9C 3H94A 3ICEA 4C3JG 1Q86C 4JI6Q 1PYBA 3CRLC 4LF5L 1CFMA 3H0GG 2HD3A 2IX3A 4LMQD 2EYFA 1R4QB 2EYLA 1QG7A 3ULLA 5FLXL 3MC0B 2L9HA 2C5CA 3PUYA 4BA2I 1HUNA 5KRUA 1EY5A 3SK8A 3MXGA 2KVMA 1ET6A 2F0HA 3L9AX 4A3IH 4QJFA 2HHHQ 1TWGB 2KCTA 1P8LA 1KDAA 4DNTB 5GROA 1LTBD 1ENCA 1E3PA 3VYUA 5C44G 4DK0A 3HOVB 1PRTC 5HGTA 1W2BA 1D2BA 3HOUG 1Q1BA 1KD1C 1SBBB 2N3SA 1IBKL 3L7ZC 2WV6D 2BH8A 1E1TA 1PMRA 3ERSX 4HJAA 4DV7Q 2OQKA 1QZGA 4OX9L 3KBGA 1SROA 2A68D 4HMIA 4KK7A 4XT3B 5I2XA 4A3GB 4I65A 3P75A 3ER0A 3CCQA 4DR7Q 3KJPA 2B2YA 3GTJH 1PHJA 1VQMA 1Y8PB 1VQOA 1HJPA 2Q2IA 3AYHB 4DA2A 4N8FA 2VQEL 1I4HA 1HA6A 2F0SA 3GP7A 1LTSD 2ZM6Q 3MZ5A 3T53B 2Z4HA 3KF8A 4ME5A 2XIWA 1Q3LA 5IOCA 1RHPA 5D3IB 5EBCA 1ET9A 4TKOB 1GOZA 4KTAA 4I7ZC 1EY4A 1SR3A 3GTPH 4GKJQ 3U50C 3BS1A 2F0KA 3S1NH 1S40A 1EIHA 2FINB 4BBSB 2A69D 3SK5A 4LF6L 3RNUA 2MFIA 4UPAA 4LF4Q 4A3KB 2WB1E 1NR2A 2Z0SA 2RHSB 1NMGA 5EKLA 1EWIA 4JBWA 4L5SA 1S4ZA 3A8JE 4RG1A 3W5OA 2BA1A 1YHAA 4RCOA 4KHVA 2BA0A 2D2CC 1U9RA 1SE3A 4C2MB 4DV6L 2KOLA 4DV0Q 2CWAA 1X3EA 4J1MA 1ZEQX 3VYRA 3PUZA 1JMCA 1AZPA 4X66Q 4KD4A 1E22A 4N9TA 3HS0C 2XN9C 1EUJA 4IUQA 3I73A 3MFGA 3CCRA 4OEMB 1YJ9A 1IKMA 5LMNQ 1UE5A 5IGFA 5EKKA 1PA6A 4DKAC 3K7UC 3S2DB 3I4NG 3M9BA 5C3WA 1D1IA 1EY8A 2J7ZA 3PSIA 1I4RA 2PMZB 3CCVA 3Q24A 2BCOA 1UE7A 2ZJPA 3HOWB 4EQ5A 1XMOQ 4C56C 1PZID 3H09A 2B63G 1MJEA 4DUYQ 5GAGC 1K0SA 3CPWA 2R92B 3TP7A 4LFBL 2XTIA 1K0RA 1XMQQ 4HIMA 3MXNA 3BDLA 3CCJA 4OONA 2DUDA 1VQHA 3T13A 3TN2A 3EROA 2JA5B 2Z6KA 4A3EB 2R7ZG 1TY0A 4EGVA 1L0XB 5EKIA 2IL8A 1QOHA 3F2DA 3M3YB 4DF7A 4KKUA 5IYCG 4NW2A 1JWSD 3A55A 3DWQA 1JOQA 4NPSA 1GUWA 5K36G 1PFSA 5IP9G 3J7A5 4L5RC 4MZ9A 4IJLA 1VQBA 4J15A 3S1MB 2Y0SG 1BUVT 2E76C 3PO3B 3GDEA 2ZTEA 2GN5A 1GUOA 1JT8A 1WYDA 3PUWA 4AYBE 3FPUB 4A3MB 1Y1WH 3OSOA 4EQPA 4DAYB 3J7YW 3U58A 3HGBA 5CV5A 4DAMA 4EX5A 4TVAB 1GD7A 2EJGC 1E2WA 1ICWA 4YWKA 4OWWB 2JP1A 3VA5A 1ONLA 1YBYA 3PF5A 2XSCA 3A56A 5KEEA 3CRKC 3CCMA 2B8FA 4K5XA 2NBFA 4UP8A 4CGYB 1I6HB 4LF5Q 1BVSA 3SK6A 4GOPB 2DY7A 3LNNA 2ATWA 1D1KA 5C4HA 3S15H 2KEEA 3CMAA 2DNEA 3FVQA 5J39A 1OXUA 5C0XJ 4IURA 1TWFB 2N78A 3I4MH 2E2HH 2WFWA 1N9WA 1N32L 2JA7H 2NVQH 4XQNA 1EIFA 3Q8DA 3PIO3 1BR9A 3I7FA 5IT9E 4C3HB 1HZCA 4CBVA 1G51A 1HZAA 1VDZA 3D6WA 4L5QA 2X6GA 4K2KA 3DWAA 3URYA 1PH1A 1L0YB 3MVVA 2J4XA 4GKKL 1IBKQ 4RFBA 2CWPA 3R2IA 4KKSA 1HFGA 4RA8A 3PMFA 5C0XI 3I56A 3W2DA 2B2VC 1VQ4A 3J81c 4OX9Q 1SNOA 3BVMA 1F9QA 3B6YA 5J22A 1SSOA 1OXVA 3T1HL 1GO3E 1KLUD 1DONA 2LKVA 2CKZB 3PO2H 3T16A 5C4XH 4F87A 4J6HA 1IZ6A 1MI2A 1RIPA 2BE5D 2IW3A 1M1KC 3H3VC 2QEXA 2N55A 1KAWA 2ZXOA 2LXKA 2KQ3A 1Y1VB 1E24A 2A68C 2PNHA 1X65A 1SNQA 1N33L 2Z8LA 3C3LA 2EJFC 4XT1B 1WTVA 3HOYH 1WD0A 2B3GA 5IP7H 1TQOA 2E2DC 4LF6Q 3QB3A 1X6OA 2R93G 1Q8KA 2F0IA 1I3QH 3QR8A 4A3FG 2FJ2A 3FP9A 2YU9H 2PZTA 3C2PA 4R8IA 5ELEA 1A15A 2LFNA 3K5MA 4DV3L 1XYIA 1Q46A 1VQ6A 3Q0AA 3EFXD 1U4MA 5F2DA 5G3LF 4OIJA 1IXRA 1F9SA 4NDXA 1HR0W 3DUZA 1JJ2A 5CBEE 4X3TA 4DK3C 3M4OH 1KHIA 2A69C 1PH5A 2PPBC 1AW7A 4ID6A 1IBML 3RLNA 3AU7A 3DMUA 5A2QL 2KENA 3OMGA 1PXUA 2VS1A 2NN6I 4YHHL 2F3IA 2G9DA 3HOZB 1JJGA 2HT1A 1F9PA 4JI3L 4BXXG 4ABNA 4DU9A 1DOMA 3GTKH 1PZJD 1QJOA 4UDUC 3V96A 5AJ3Q 3J80c 1CQFA 2Q8RE 1SDFA 1BXTA 3OIPA 1EY9A 1NSNS 1Q8IA 1IL8A 4IFDJ 4B9XA 2E74C 1D5XC 2VY3A 4LFBQ 1ML0D 4KJNA 4DK6C 1TS2A 2K6AA 3NHHA 3NELA 1DGSA 2SDFA 2F0WA 3JAML 1CHQD 3RN2A 1SXTA 4R1JA 1NTGA 4XQQA 1Q1EA 4C3JH 1YITA 5JEAH 4Q5VA 3J81L 1RKNA 2IJ0A 5M5WB 1K8MA 1B7YB 3A54A 5FKAC 1C9OA 4G7ZC 2FMMA 4JOIC 2K1BA 1X3FA 3UDXA 1Y1WG 3U4VA 1WTWA 1XNQL 3H6MA 4A4IA 3I8ZA 5M3MH 2A1AA 3A0JA 2JQOA 3RR5A 5KNCA 3H91A 2KEDA 4UP7A 2PMZE 2FXQA 2DJGC 2WP8J 2E2JH 2A5HA 1AZQA 1HZBA 2NZOA 4G7HC 2H1EA 1AN8A 3KYHC 3K8AA 3PGZA 2WB1B 5C44H 1JJCB 3GTMH 3EIVA 1AE2A 3HOUH 2HCCA 1VQEA 1AE3A 3MAQA 3I4MG 4LUVA 3MXNB 1L1OA 1V9PA 4KI0A 3K0XA 1CTMA 2KHIA 3UDGA 1CK1A 3CQZB 4EQOA 1VQGA 4NMZA 4LK1C 2NB0A 3S17H 3TEHB 1SJED 1TWAH 2EOTA 2MHVA 4DR1L 1UEBA 1A62A 3KBXA 1RCVD 3CCEA 1N32Q 1XWEA 4F88A 4OIKA 5AFWA 2EYPA 1AH9A 1Z7TA 3TP8A 5FLXE 4PMCA 2B39A 1YZ6A 3H3VH 1JE5A 1HTPA 1PTOB 3J7AF 2RDGA 4WJWA 1ENAA 5EAYA 1II3A 4GKJL 1WJJA 4HEDA 1DM0B 1PH8A 3HG9A 4H02A 5C3EB 1V1PA 5H1SE 1S72A 4GKKQ 1ZYRD 2VUMB 3PUXA 5E7NA 2E8GA 2L55A 4QL5A 2UU9L 4EQNA 4MIUA 1EU3A 2XGTA 2ICEC 3J7ZC 3S14H 5M3FB 1E2ZA 5C4XG 4G4KA 2JN4A 3KLRA 4CKBA 4B3TQ 3SXHA 1LABA 3T1HQ 1SAPA 3M7NA 3OWFA 2EY2A 2AWOA 2F0VA 3J80L 2MGSA 2OQ0A 5CORA 2K5WA 1FVIA 2YTXA 2UXCL 4IOCA 2VB2X 4X66L 2I07B 2F0NA 2QA4A 1WCMB 3NEMA 4C3IB 4LAAA 1YEZA 1QZHA 2B2TC 2JJQA 4NXMQ 2KUMA 1N33Q 2SNMA 2MP1A 4LUZA 2TSSA 3H0GB 3A7LA 3J81j 2M2LA 1SEBD 2IPKD 1IYVA 1TWGH 4HCEA 4AYBB 1DYQA 1Q82C 3SHLA 4MN3A 2BE5C 2O4XA 2B29A 4FF2A 3HOVH 1O7YA 3I4NH 3J7AV 5JJLA 4QGUA 1VQAA 5IGGA 2VL6A 3MWYW 1CM9A 1XMQL 4GOPC 3PIOA 5IY0A 1HPCA 4PZ8A 3A8KE 4O42A 2B63H 1MBYA 1SRUA 4GZYC 4BBRB 3TS0A 2PZWA 1BO0A 5JVG3 1EOVA 1LUZA 4R4CA 5IGCA 1EY0A 5CV9A 2WACA 3BYYB 4K0KL 1IBMQ 3T4AC 3MA2B 4AH6A 4POFA 1SE2A 3M4PA 1HNZL 2K5DA 3QOJA 1SYBA 4XTCS 4DFAA 2A73B 1PH7A 4FYDA 5JPNC 4JI3Q 1FD7D 1G6ZA 2RSNA 1F77A 1EU4A 2EY1A 3LWUA 3UI2A 2PW5A 5IIFA 3K5OA 4A93H 4KKTA 1SYGA 1VQKA 3HOXH 5LMUL 1JB7A 1CUKA 4PQXA 1LTRD 5LL6S 2WAQG 5TSSA 1JB3A 1JWMD 4BY1G 5JEAG 3VYSA 4A3KH 4TQUS 2EDGA 2M00A 1CKOA 4L8JA 1CA6A 3F2UA 2M9VA 2F52A 2O2LD 2ID0A 3DLLA 3I4LA 4R9WA 2NVYB 3T51B 3EBEA 1Y8OB 5M3MG 2NZ1D 4C2MH 3SVMA 2XWJB 5J1ZA 2ZTCA 1STNA 1SMXA 1WTXA 4N9PA 4LNQA 4A3CG 1YHBA 4X3KA 1ILQA 1V1OA 2WKCA 3M4YA 2GVAA 2A19A 1CSQA 1S3OA 1XNQQ 5KYLA 1TVXA 1SYCA 2DY8A 3V05A 2IY5B 1A6XA 4CJ2C 3GO5A 1AEXA 3VR2A 1IKLA 1E7ZA 4HIOA 3ND8A 3DWPA 3RZOH 4I7AA 2Q2UA 2ALYB 4JI8L 1K8OA 5BN3A 1KL9A 3HOWH 4JI7L 2L4NA 1EIGA 2N8NA 2R61A 4BA1I 1RL2A 2F0MA 3PF4A 1YNJD 3HKZE 4IPHA 2R92H 1K9MC 1XNRL 1EYGA 2JEBI 4DV5Q 4FP5D 1Y69U 3CCLA 2JA5H 4FO2A 2V1CC 1E2VA 1KXLA 5FLMG 4KY7A 3S2HB 4IPGA 4JI2L 4PG3A 2Q8TA 4DR1Q 3F2BA 1W6JA 4KV6A 3M3YH 4O2DA 1HZ9A 2LMCB 3FRPB 4HIDA 1YIJA 4A3LH 2NYZD 4JVZA 5E4WC 3D31A 3HP3A 4ME3A 3RZDH 3AB9A 2RDHA 2K52A 4R8NA 4JBMA 4RH6A 3L2PA 3S1MH 4DNIA 5IYBH 5E1FA 2R7ZB 4JC0A 5KIXA 2D0PA 2VZAA 1U0LA 5I9PA 1QE6A 4P72A 2UU9Q 4HIKA 4UAIA 4UY8C 1B3QA 4LF9L 4IUTA 1K83H 5GAEC 3NWSA 3U9SA 3S16H 3CKIB 4DR6Q 1HR0L 2BDNA 3K0YA 1YJNA 5FO7B 2R93H 5FO8B 4DV4Q 2JA8B 2K7VA 4ZK9B 4OXPA 4A3FH 1PZKD 3WWVA 1L1OB 5JOBA 3QWNA 5G3LD 1Z9FA 3VR4A 2UXCQ 1IYJB 3WOEA 1ZYRC 4PZ7A 4DR5L 3I4OA 1STBA 2K04A 4YWLA 2RVLA 1TWFH 2D0OA 3VR3A 2F0GA 3HOVG 1YNND 3NSWA 2A6ED 3NENA 3O13A 3GV6A 2EXDA 4JK1C 1LT4D 1A2UA 4WORA 2PQEA 2PO4A 1QCBD 1MJCA 4IN3A 2XVSA 4A3IB 3M7GA 5AJ3L 3KF6A 1Q81C 4XQJA 1EQVA 4HAEA 4F8MA 3AEVA 4BXXH 5IODA 1V1PB 1PTOF 3C1FA 5JJZA 3VR6A 2IWHA 4GLAC 4KLKA 3CF5A 5BN4A 2P5ZX 1KIXA 4WFN3 1F2LA 4IUPA 1VQPA 1I94L 4B3SQ 3GTGB 1L2FA 3CCSA 1FNWA 4JI1L 2K5QA 1B9MA 1X55A 1KNAA 4MTKA 4K0KQ 2UUAL 3BZDB 2B2UC 4GNXA 3VR5A 1I4XA 1WTHA 1NJIC 4M1UB 1HNZQ 1B50A 2F0EA 1TR5A 1ASZA 1STAA 1PTOC 4A93G 1VQLA 2NZHA 1SJHD 3CPFA 5A35A 2HUGA 4DGZA 1PFMA 3HOXG 1A3VA 1K3BC 5A2QE 3CC2A 4BBSG 1LLRD 2O5IC 4A3KG 3K7AH 4DAVA 1D7QA 1D6EC 2VB3X 3X3MA 4JI0L 1GJXA 3TZUA 4POGA 5I6YA 4K14A 1QUQA 5LMUQ 5IGDA 3OYYA 2I5HA 1V1QA 1HTLD 1KQSA 3MXPA 4L63B 5D3DA 3S1NB 2KECA 2ZT9C 4HTHA 4JI5L 1EYDA 3VDYA 5EGTA 1SYFA 3ERQA 3GTQH 2IHEA 1GVPA 1BKBA 3TREA 1G8ZD 3FMCA 3BZKA 4JYAL 1TT2A 2EXZA 2OEOA 4A3DB 2RQXA 1TIID 4Y52H 3G6EA 3I91A 3W1GA 5M9OA 3K58A 1LTGD 3CW2C 4CDFC 5JAVA 2H4OA 3CU7A 4LF8L 3P7JA 4NXNL 4LFAL 2F0UA 4FDBA 4Q0FA 3HOWG 4KD3A 4HJ7A 3JAMi 2F0LA 3R2TA 4KHZA 3U9OA 1EYAA 2O5JC 4RGOS 3J81i 2R92G 3D4RA 4B3ML 4QB4A 4JI8Q 1R9TB 2ICIA 3L3OC 3LGJA 2KA7A 4NKLA 4JI7Q 5C0XH 2JA5G 4A3EG 1W3SA 3FKIB 1RJTA 4RGTA 3F8TA 1RD9D 4B3TL 1NE3A 5CBAE 3FPPA 5CV8A 3DEOA 1XNRQ 4CJ1B 1IBLL 1BNZA 2AQ2B 2Z1CA 1HRJA 4A3LG 1FR3A 3CXCA 3RLFA 1JR0D 1NUCA 2JA6H 2E2IB 5CV6A 4JI2Q 5IT9c 3D4DA 2B2VA 1CZWA 2DNCA 4YCUA 5IYBG 5M5WH 3UE1A 1QWYA 3MFYA 4TRDA 4JBJA 1YNJC 4PZ6A 1E0BA 4A3JB 4NXML 2SNSA 3A5UA 3ZJYC 1EIYB 1S5CD 5M5XB 4FF3A 3S1QH 3HZXA 4MNOA 4ODGA 2DN8A 4OGQC 1U4LA 4IUVA 1SFOH 1EL0A 3SDZA 2OTLA 2CFMA 2C35B 1NY4A 4NP5A 1X56A 1U4PA 4R4OA 3E0EA 3DHQA 1HQRD 1I50H 1Z47A 2KCMA 4LF9Q 3GTLB 3DXJC 5IWAL 1VQJA 1F9RA 1HR0Q 1WFQA 2CH4W 4DPGA 3UDFA 1SNCA 1VQIA 3K6OA 3TZDA 1BBWA 1PRTB 4HJ8A 1TU2B 5HGQA 1C8CA 4Y7NB 3M85A 2EIFA 1P16A 2ENBA 1TWCB 4H7BA 3CQZH 3DEPA 4DR5Q 1VQ5A 1BCPB 1PFNA 2SOBA 3S15B 3CCUA 3NTKA 4C3HG 1XPUA 2F03A 1JWUD 1UAPA 1B8AA 4DV1L 1U5KA 2NN6H 3AQQA 2YYZA 3G4SA 2E2HB 3GQBA 2UXDL 1F2MA 1DJRD 3K80C 2F3VA 1GXDC 2K5NA 3OIQA 5CGKA 2JA7B 2NVQB 4QY7A 4K5VA 5JJKA 1XJVA 1PTOH 4UP9A 3IL8A 4YWMA 3BU2A 5I2YA 4FXKC 3SGIA 1TS3A 1D5MC 5C3EH 1HA5A 1EFWA 3C46A 4R4QA 2Y0SE 4JV5Q 2QGQA 2F0OA 4DXGA 3DM3A 1YNNC 3HKZB 2A6EC 4GS3A 3I3CA 5M3FH 3R93A 4GLVB 1I94Q 4JI1Q 1KRTA 3PQIA 1UWVA 4K8JA 1HH2P 4BY1H 3K59A 2UXBL 3HKSA 5NUCA 4AIMA 1Y14B 4ZUJA 5C4JH 3ND9A 4HJ9A 2UUAQ 1LM0A 1Q12A 4MTNA 2KHSA 4K2LA 3PO2B 4IFDI 4BS9A 3G71A 1WCMH 4WJ4A 2VQFL 1GM5A 5DM73 2IHFA 2RCFA 5IT9L 4XIGS 4A3CH 4K8IA 4DV2L 2ZTDA 4FVMA 3S1RB 2JEAI 2NVXB 2AQ3B 5HURA 4JOIA 3BVGA 2B2WC 3PV0A 4JI0Q 4XYOA 2QKIC 2BOSA 1VQ9A 3KF6B 1TKWB 3ITPA 3HOYB 4O0AA 5JJIA 2I5MX 2NVTB 1SYDA 4C1NI 1PFBA 1QILA 4V0BA 1HXYD 1STHA 4JI5Q 1YNXA 3EN2A 1L0WA 2HCIA 5KGUA 1G2SA 1PV4A 4DV5L 5LL6X 3P1HA 1I3QB 4BY7B 3OMCA 4JYAQ 4S3SA 4QMGA 4XYQA 4DR2L 1JORA 4CJ0B 3HOZG 1UNSA 1EWHA 5EPJA 4A3BB 1I4QA 4LF8Q 3SEBA 4GNXB 3I2ZA 1CQVA 5FLMH 4NXNQ 3M4OB 4LFAQ 1W6KA 2LSSA 1LT6D 1SE8A 1TWHB 4IO9A 4ZRZA 1IYUA 1JOOA 1RTNA 4X62Q 2WINB 4RGMA 5C0XG 3NTHA
chains in the Genus database with same CATH topology
1SMXA 2DUDA 1VQHA 4WJ3M 3AFPA 4LNQA 1YHBA 1HNXL 4IJHA 4A3CG 1PVOA 5BR8L 2Z6KA 4B3MQ 4A3DG 2K4KA 4LFCQ 2GVAA 2R7ZG 2A19A 1CSQA 1S3OA 1XNQQ 2UUBL 2IY5B 4BY7H 4KHPQ 1QUQB 3K81C 3KOJA 3F2DA 3GO5A 4GN5A 1N36Q 5IYCG 2JA6G 3KDFA 1E7ZA 4DR6L 4HIOA 3RZOH 4NPSA 5FJ8H 2Q2UA 4DV4L 5K36G 1PFSA 3D0FA 5IP9G 2AHOB 3J7A5 2ALYB 4L5RC 4MZ9A 1IBLQ 1VQNA 4IJLA 1VQBA 4J15A 2Y0SG 4JI8L 4A3BH 1KL9A 1Q7YC 3HOWH 1VQCA 3GDEA 3STBC 2K50A 2GN5A 2N8NA 2ZTEA 4BA1I 4DV6Q 4JI7L 1RL2A 4DUZL 1PH4A 1JT8A 1WYDA 3MEFA 3J80i 3PUWA 5FLXc 3PF4A 3S24A 4AYBE 2NVYH 3HKZE 4IPHA 3RLOA 5GAHC 1TWHH 1Y1WH 2R92H 2K5HA 2KHJA 4P74A 4DAYB 3GD7A 1K9MC 1XNRL 1EYGA 2JEBI 3U58A 4DAMA 4DV5Q 4EX5A 4TVAB 1GD7A 3FKIG 3OTOL 4YWKA 4OWWB 3CCLA 3W1BA 1YBYA 2JA5H 3TS2A 2V1CC 3PF5A 2VUMH 5JEAJ 5FLMG 1KXLA 1CSPA 4IPGA 4JI2L 4YCVA 1CKNA 2D62A 3KF8B 3CCMA 4JBKA 4PG3A 2ES2A 1O7IA 3IRBA 4DR1Q 3CP0A 4UP8A 3F2BA 1EQRA 1IL2A 4LF5Q 2DGYA 2R6GA 1BVSA 4O2DA 4GOPB 1HZ9A 3M3YH 1FJGQ 2WB1G 4HIDA 1YIJA 2ATWA 2LXJA 4A3LH 3S15H 1YVCA 2K75A 3D31A 3F1ZA 1CKMA 4ME3A 3RZDH 3CMAA 2K52A 4JBMA 2R7DA 3L2PA 3S1MH 2Q2TA 1OXUA 1Y1VG 4DNIA 5IYBH 5C0XJ 5IWAQ 2N78A 3I4MH 2E2HH 4JC0A 4A3JG 4JI6L 2D0PA 2VZAA 2WFWA 1U0LA 1N9WA 4B3SL 1N32L 4A3GH 1EQQA 2JA7H 2NVQH 1EIFA 3Q8DA 1J5EL 4C3IH 4A76A 3I7FA 1YJWA 4P72A 1MIUA 2UU9Q 1QVFA 4HIKA 1OXTA 4UY8C 2NN6G 4LF9L 1K83H 1HZCA 5GAEC 2VW9A 3OW2A 2I5LX 3H0GH 3S16H 1KC8C 1G51A 1HZAA 4DR6Q 3S2HH 4L5QA 1D8LA 1HR0L 2N49A 1GKHA 1YJNA 2R93H 4DV4Q 1PH1A 3KFUA 4OXPA 4A3FH 3CAMA 1C7YA 4GKKL 1IBKQ 3WWVA 1L1OB 2CWPA 2F4VL 2YTVA 4APVA 4DV1Q 5C0XI 2HHHL 3I56A 1Z9FA 1N34Q 1VQ4A 3J81c 5ELOA 2UXDQ 5C3EG 1LTLA 2UXCQ 1IYJB 4OX9Q 2UUCL 4PZ7A 1N8RC 5IYDG 2VUMG 3H15A 3FHWA 3I4OA 3B6YA 4DR5L 2E5LL 1L1OC 4GN4B 1OXVA 4YWLA 3T1HL 1PH2A 1GO3E 1TWFH 2D0OA 2H5XA 4ALPA 1FGUA 2VNUD 5M3FG 2CKZB 3PO2H 3TQYA 3HOVG 4BBRH 4BBSH 5C4XH 2MO0A 1IZ6A 1RIPA 3NENA 4DV7L 1M1KC 2EXDA 1PH6A 2QEXA 1VS0A 1KAWA 1MJCA 4LF7Q 1M90C 4DR7L 2LXKA 3KF6A 5AJ3L 1Q81C 2IX1A 1E24A 4NB3A 3AEVA 2PNHA 4BXXH 1X65A 2UXBQ 1NBWA 2JA7G 2IX0A 3UE0A 1WCMG 1N33L 3BJUA 4GLAC 4IOAA 2GVBA 4KLKA 2JE6I 4X6AH 3CF5A 3HOYH 2JK8A 4IFDG 2Q2HA 2B3GA 5IP7H 4A75A 1KIXA 4P75A 3F2CA 1VQDA 1VQPA 1I94L 4B3SQ 1L2FA 5M5YH 2ZM6L 3CCSA 1X6OA 4L5TA 4JI1L 4LF6Q 3H3VI 2R93G 1Q8KA 2VQFQ 1I3QH 4R4TA 4AYBG 4YY3Q 3HKZG 4A3FG 2I0QA 1X55A 3FP9A 1KRSA 2YU9H 2BH2A 4DV2Q 3S2DH 4K0KQ 2UUAL 2RHQB 3CD6A 2ZJQA 2AKWB 3KJOA 4DV3L 4GNXA 1PH3A 1OXSC 3PUVA 1NJIC 1Q46A 1VQ6A 2R7FA 3UDIA 1H95A 1HNZQ 1IXRA 1C0AA 1ASZA 1HR0W 4A93G 4LF4L 1VQLA 4JI4Q 1JJ2A 2NZHA 2OWOA 3CPFA 3JC66 3HOXG 3PO2G 4DK3C 4X64Q 3M4OH 1KHIA 1PH5A 3CC2A 4BBSG 4BBRG 1IBML 3RLNA 4DR3Q 4AQYQ 4A3KG 2KENA 1VQFA 3K7AH 1D7QA 2VS1A 4OWXB 4JI0L 2NN6I 4POGA 3GTOH 4YHHL 2F3IA 1QUQA 5LMUQ 4A3EH 2YTYA 3OYYA 1JJGA 2HT1A 3ULJA 3GTGH 2I5HA 4OO1I 1V1QA 1KQSA 4DV0L 4JI3L 4BXXG 4DR2Q 1HNWQ 3GTKH 4B3RQ 2HIXA 4GN3B 1WI5A 4JI5L 3VDYA 4X65L 3HOYG 5IP7G 2IHEA 2PQAB 3GTQH 1GVPA 1BKBA 3TREA 1QVGA 1G6PA 5AJ3Q 3T1YL 5LMNL 1SN8A 3BZKA 3J80c 4JYAL 3RN5A 4IFDJ 4Y52H 3G6EA 4QIWE 2VY3A 3E9HA 3G48A 4P71A 2MO1A 3W1GA 3PO3H 4BY7G 4LFBQ 1A63A 3A74A 4DK6C 3CW2C 2AWNA 1XPOA 3L0OA 2JA9A 1B70B 1DGSA 3NELA 1NMFA 1HNXQ 2RCNA 5BR8Q 5FJ8G 4A3MH 1XMOL 1X9NA 4LF8L 4QQBX 1K3RA 3TRZA 2ASBA 3RN2A 4R1JA 4IPDA 1NTGA 4NXNL 1Q1EA 3KLWA 4DUYL 2UUBQ 4C3JH 4LFAL 2PI2E 4FDBA 1TXYA 1WOCA 1YI2A 1YITA 1PYSB 4A3BG 1K8GA 3PIPA 1X54A 3HOWG 3E9IA 1X3GA 3JAMi 4HJ7A 1B7YB 4DR4L 1C9OA 4KHZA 4GOPA 4JOIC 3STBD 1X3FA 3J81i 3UDXA 3M4QA 4DV3Q 2R92G 1Y1WG 1XTDA 4B3ML 1LYLA 1I6HH 3U4VA 4JI8Q 2ZJRA 3LGJA 1XNQL 2OTJA 4A4IA 3AFQA 4HJ5A 1E1OA 1VQ8A 5M3MH 4JI7Q 4PMWA 2A1AA 3A0JA 2JQOA 4R4IA 3RR5A 4DUZQ 4KHPL 1J6QA 1FL0A 2JA5G 4A3EG 1W3SA 4LUOA 4UP7A 2PMZE 3F8TA 2FXQA 1N36L 4B3TL 2WP8J 1NE3A 2E2JH 1VQ7A 4A3DH 1HZBA 1YHQA 2R7ZH 1XNRQ 2NZOA 2EQSA 2AMCB 2MNAA 1K73C 1IBLL 3KYHC 3OTOQ 4A3LG 4YHHQ 1SLJA 3CXCA 3RLFA 3K8AA 3PGZA 1XPRA 5IYCH 5C44H 2JA6H 1JJCB 2RF4A 4JI2Q 5IT9c 3EIVA 3GTMH 1AE2A 3HOUH 1VQEA 1QVCA 4YCUA 4C3HH 1AE3A 5IP9H 2MQHA 5IYBG 3I4MG 4LUVA 5M5WH 3UE1A 3MXNB 1L1OA 1V9PA 3I55A 4KI0A 4JBJA 3K0XA 4LW1A 2PI2A 2KHIA 4PZ6A 4NXML 3UDGA 2JA8H 3A5UA 3ZJYC 4YCWA 1EIYB 1A0IA 3S1QH 4MNOA 1VQGA 4JV5L 3S17H 3TEHB 1R9TH 3ICEA 5LMNW 1TWAH 1Q86C 3CC4A 1SFOH 4JI6Q 4DR1L 1PYBA 1UEBA 2OTLA 1A62A 1G291 2CFMA 2Z6KC 2C35B 4LF5L 3KDFB 3H0GG 5IE8A 1NY4A 3FKIH 3CCEA 1FJGL 4LWCA 1N32Q 2OCEA 3NBHB 1J5EQ 1X56A 1AH9A 1OTCA 2YV5A 4R4OA 1YZ6A 3E0EA 4OWTB 3H3VH 5J3BA 2L15A 1JE5A 2IT1A 3ULLA 1I50H 1Z47A 2HIVA 2KCMA 4LF9Q 5IWAL 5EAYA 4GNXC 1VQJA 2WAQE 1WJJA 2E2IH 4GKJL 1HR0Q 3PUYA 1WFQA 4BA2I 4DPGA 1PH8A 3UDFA 4H02A 1VQIA 2K5VA 5H1SE 1S72A 4GKKQ 1BBWA 3PUXA 5E7NA 2E8GA 1V43A 4QL5A 4QJFA 4HJ8A 4A3IH 2UU9L 2F4VQ 5HGQA 2HHHQ 1Y1VH 5HY6A 3M85A 2XGTA 2KCTA 1K8AC 1P8LA 2EIFA 3J7ZC 1P16A 5GROA 3HFZB 4RMFA 4A3JH 3S14H 1E3PA 5C4XG 2UUCQ 3CQZH 4B3TQ 5M5XH 5C44G 4DR5Q 1VQ5A 1CKNB 2E5LQ 1W2BA 3CCUA 3T1HQ 3HOUG 1Q1BA 1KD1C 2CQOA 2N3SA 3M7NA 1XPUA 1IBKL 3L7ZC 2AWOA 1B8AA 2KBNA 4DV1L 1U5KA 3AQQA 5GADC 2BH8A 1E1TA 2YYZA 3G4SA 2OQ0A 1N34L 3ERSX 2JA8G 4HJAA 2YTXA 1FVIA 2OQKA 3K80C 4DV7Q 4IOCA 1QZGA 4OX9L 2CCZA 2UXCL 4X66L 1SROA 2K5NA 2QA4A 3U4ZA 4QY7A 3NEMA 5JJKA 3GTLH 1XJVA 4UP9A 3ER0A 3CCQA 4DR7Q 3KJPA 1I5FA 3GTJH 4YWMA 1A8VA 1YEZA 3BU2A 1QZHA 1PHJA 2JJQA 2NVTH 3SGIA 4IPCA 2HQLA 4NXMQ 5C3EH 1N33Q 1VQMA 1EFWA 4LUZA 4R4QA 1VQOA 5IYDH 3J81j 2Y0SE 1HJPA 2Q2IA 4JV5Q 2QGQA 3AYHB 2VQEL 4Y7NH 1TWGH 3DM3A 5GQOA 4GS3A 5M3FH 1Q82C 4LF7L 1TWCH 4GLXA 3CC7A 1I94Q 4GLVB 4JCVE 1VCIA 2ZM6Q 3ULPA 2B29A 3HOVH 3PCOB 1KRTA 4JI1Q 3I4NH 5JJLA 4QGUA 1UWVA 1VQAA 1HH2P 1PH9A 4BY1H 2UXBL 3HKSA 2VL6A 4AIMA 3HOZH 1Y14B 3CMEA 4A3IG 4X62L 1XMQL 4GOPC 3PIOA 5IY0A 5C4JH 4PZ8A 4HJ9A 2UUAQ 1SR3A 1LM0A 1Q12A 3GTPH 2PQAA 4MTNA 2B63H 4GKJQ 3U50C 1SRUA 3S1NH 1S40A 4LFCL 4LF6L 4IFDI 3TS0A 2K14A 3G71A 3RNUA 1WCMH 4WJ4A 2VQFL 2MFIA 1GM5A 4UPAA 4LF4Q 1EOVA 2IHFA 2WB1E 2Z0SA 1LUZA 4YY3L 4R4CA 2RHSB 1NMGA 1EWIA 4JBWA 4XIGS 4L5SA 4A3CH 4DV2L 4RG1A 4K0KL 3W5OA 2ZTDA 1IBMQ 2BA1A 2JEAI 1MKHA 1YHAA 4AH6A 2BA0A 4OO1G 4JG2A 1T9HA 1UE1A 3M4PA 4JOIA 4POFA 3PV0A 4JI0Q 1HNZL 3BZCA 4XTCS 1VQ9A 3JAMc 3KF6B 4DV6L 4JI4L 4O0AA 5DLQE 2I5MX 5JJIA 1PH7A 4DV0Q 4X64L 4JI3Q 2CWAA 3A5ZB 1X3EA 3PUZA 1JMCA 4X66Q 4JI5Q 1YNXA 3EN2A 1L0WA 4DR3L 1ASYA 1E22A 4AQYL 3PO3G 4X65Q 1PV4A 4DV5L 1EUJA 4A93H 3CCRA 1YJ9A 4OONA 3T1YQ 5LMNQ 1VQKA 1UE5A 3HOXH 5LMUL 4A3MG 1CUKA 1JB7A 4JYAQ 1PA6A 4DKAC 2WAQG 3K7UC 3I4NG 3M9BA 4DR2L 4BY1G 5ELNA 5JEAG 4A3KH 1HNWL 4TQUS 4B3RL 1OXXK 1UE6A 2VQEQ 1BBUA 3PSIA 3CCVA 3HOZG 1CKOA 1UE7A 2ZJPA 4A3GG 4EQ5A 1XMOQ 4LF8Q 4GNXB 3I2ZA 2F52A 3S1RH 2NVXH 5FLMH 2B63G 2A8VA 1MJEA 4NXNQ 4LFAQ 2ID0A 4DUYQ 2UXDL 5GAGC 2LSSA 3DLLA 3CPWA 1SE8A 4IO9A 3EBEA 4P73A 4DR4Q 5M3MG 4C2MH 4LFBL 4X62Q 2XTIA 1K0RA 1XMQQ 4HIMA 5C0XG 3CCJA 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMX A;  2DUD A;  1VQH A;  4WJ3 M;  3AFP A;  4LNQ A;  1YHB A;  1HNX L;  4IJH A;  4A3C G;  1PVO A;  5BR8 L;  2Z6K A;  4B3M Q;  4A3D G;  2K4K A;  4LFC Q;  2GVA A;  2R7Z G;  2A19 A;  1CSQ A;  1S3O A;  1XNQ Q;  2UUB L;  2IY5 B;  4BY7 H;  4KHP Q;  1QUQ B;  3K81 C;  3KOJ A;  3F2D A;  3GO5 A;  4GN5 A;  1N36 Q;  5IYC G;  2JA6 G;  3KDF A;  1E7Z A;  4DR6 L;  4HIO A;  3RZO H;  4NPS A;  5FJ8 H;  2Q2U A;  4DV4 L;  5K36 G;  1PFS A;  3D0F A;  5IP9 G;  2AHO B;  3J7A 5;  2ALY B;  4L5R C;  4MZ9 A;  1IBL Q;  1VQN A;  4IJL A;  1VQB A;  4J15 A;  2Y0S G;  4JI8 L;  4A3B H;  1KL9 A;  1Q7Y C;  3HOW H;  1VQC A;  3GDE A;  3STB C;  2K50 A;  2GN5 A;  2N8N A;  2ZTE A;  4BA1 I;  4DV6 Q;  4JI7 L;  1RL2 A;  4DUZ L;  1PH4 A;  1JT8 A;  1WYD A;  3MEF A;  3J80 i;  3PUW A;  5FLX c;  3PF4 A;  3S24 A;  4AYB E;  2NVY H;  3HKZ E;  4IPH A;  3RLO A;  5GAH C;  1TWH H;  1Y1W H;  2R92 H;  2K5H A;  2KHJ A;  4P74 A;  4DAY B;  3GD7 A;  1K9M C;  1XNR L;  1EYG A;  2JEB I;  3U58 A;  4DAM A;  4DV5 Q;  4EX5 A;  4TVA B;  1GD7 A;  3FKI G;  3OTO L;  4YWK A;  4OWW B;  3CCL A;  3W1B A;  1YBY A;  2JA5 H;  3TS2 A;  2V1C C;  3PF5 A;  2VUM H;  5JEA J;  5FLM G;  1KXL A;  1CSP A;  4IPG A;  4JI2 L;  4YCV A;  1CKN A;  2D62 A;  3KF8 B;  3CCM A;  4JBK A;  4PG3 A;  2ES2 A;  1O7I A;  3IRB A;  4DR1 Q;  3CP0 A;  4UP8 A;  3F2B A;  1EQR A;  1IL2 A;  4LF5 Q;  2DGY A;  2R6G A;  1BVS A;  4O2D A;  4GOP B;  1HZ9 A;  3M3Y H;  1FJG Q;  2WB1 G;  4HID A;  1YIJ A;  2ATW A;  2LXJ A;  4A3L H;  3S15 H;  1YVC A;  2K75 A;  3D31 A;  3F1Z A;  1CKM A;  4ME3 A;  3RZD H;  3CMA A;  2K52 A;  4JBM A;  2R7D A;  3L2P A;  3S1M H;  2Q2T A;  1OXU A;  1Y1V G;  4DNI A;  5IYB H;  5C0X J;  5IWA Q;  2N78 A;  3I4M H;  2E2H H;  4JC0 A;  4A3J G;  4JI6 L;  2D0P A;  2VZA A;  2WFW A;  1U0L A;  1N9W A;  4B3S L;  1N32 L;  4A3G H;  1EQQ A;  2JA7 H;  2NVQ H;  1EIF A;  3Q8D A;  1J5E L;  4C3I H;  4A76 A;  3I7F A;  1YJW A;  4P72 A;  1MIU A;  2UU9 Q;  1QVF A;  4HIK A;  1OXT A;  4UY8 C;  2NN6 G;  4LF9 L;  1K83 H;  1HZC A;  5GAE C;  2VW9 A;  3OW2 A;  2I5L X;  3H0G H;  3S16 H;  1KC8 C;  1G51 A;  1HZA A;  4DR6 Q;  3S2H H;  4L5Q A;  1D8L A;  1HR0 L;  2N49 A;  1GKH A;  1YJN A;  2R93 H;  4DV4 Q;  1PH1 A;  3KFU A;  4OXP A;  4A3F H;  3CAM A;  1C7Y A;  4GKK L;  1IBK Q;  3WWV A;  1L1O B;  2CWP A;  2F4V L;  2YTV A;  4APV A;  4DV1 Q;  5C0X I;  2HHH L;  3I56 A;  1Z9F A;  1N34 Q;  1VQ4 A;  3J81 c;  5ELO A;  2UXD Q;  5C3E G;  1LTL A;  2UXC Q;  1IYJ B;  4OX9 Q;  2UUC L;  4PZ7 A;  1N8R C;  5IYD G;  2VUM G;  3H15 A;  3FHW A;  3I4O A;  3B6Y A;  4DR5 L;  2E5L L;  1L1O C;  4GN4 B;  1OXV A;  4YWL A;  3T1H L;  1PH2 A;  1GO3 E;  1TWF H;  2D0O A;  2H5X A;  4ALP A;  1FGU A;  2VNU D;  5M3F G;  2CKZ B;  3PO2 H;  3TQY A;  3HOV G;  4BBR H;  4BBS H;  5C4X H;  2MO0 A;  1IZ6 A;  1RIP A;  3NEN A;  4DV7 L;  1M1K C;  2EXD A;  1PH6 A;  2QEX A;  1VS0 A;  1KAW A;  1MJC A;  4LF7 Q;  1M90 C;  4DR7 L;  2LXK A;  3KF6 A;  5AJ3 L;  1Q81 C;  2IX1 A;  1E24 A;  4NB3 A;  3AEV A;  2PNH A;  4BXX H;  1X65 A;  2UXB Q;  1NBW A;  2JA7 G;  2IX0 A;  3UE0 A;  1WCM G;  1N33 L;  3BJU A;  4GLA C;  4IOA A;  2GVB A;  4KLK A;  2JE6 I;  4X6A H;  3CF5 A;  3HOY H;  2JK8 A;  4IFD G;  2Q2H A;  2B3G A;  5IP7 H;  4A75 A;  1KIX A;  4P75 A;  3F2C A;  1VQD A;  1VQP A;  1I94 L;  4B3S Q;  1L2F A;  5M5Y H;  2ZM6 L;  3CCS A;  1X6O A;  4L5T A;  4JI1 L;  4LF6 Q;  3H3V I;  2R93 G;  1Q8K A;  2VQF Q;  1I3Q H;  4R4T A;  4AYB G;  4YY3 Q;  3HKZ G;  4A3F G;  2I0Q A;  1X55 A;  3FP9 A;  1KRS A;  2YU9 H;  2BH2 A;  4DV2 Q;  3S2D H;  4K0K Q;  2UUA L;  2RHQ B;  3CD6 A;  2ZJQ A;  2AKW B;  3KJO A;  4DV3 L;  4GNX A;  1PH3 A;  1OXS C;  3PUV A;  1NJI C;  1Q46 A;  1VQ6 A;  2R7F A;  3UDI A;  1H95 A;  1HNZ Q;  1IXR A;  1C0A A;  1ASZ A;  1HR0 W;  4A93 G;  4LF4 L;  1VQL A;  4JI4 Q;  1JJ2 A;  2NZH A;  2OWO A;  3CPF A;  3JC6 6;  3HOX G;  3PO2 G;  4DK3 C;  4X64 Q;  3M4O H;  1KHI A;  1PH5 A;  3CC2 A;  4BBS G;  4BBR G;  1IBM L;  3RLN A;  4DR3 Q;  4AQY Q;  4A3K G;  2KEN A;  1VQF A;  3K7A H;  1D7Q A;  2VS1 A;  4OWX B;  4JI0 L;  2NN6 I;  4POG A;  3GTO H;  4YHH L;  2F3I A;  1QUQ A;  5LMU Q;  4A3E H;  2YTY A;  3OYY A;  1JJG A;  2HT1 A;  3ULJ A;  3GTG H;  2I5H A;  4OO1 I;  1V1Q A;  1KQS A;  4DV0 L;  4JI3 L;  4BXX G;  4DR2 Q;  1HNW Q;  3GTK H;  4B3R Q;  2HIX A;  4GN3 B;  1WI5 A;  4JI5 L;  3VDY A;  4X65 L;  3HOY G;  5IP7 G;  2IHE A;  2PQA B;  3GTQ H;  1GVP A;  1BKB A;  3TRE A;  1QVG A;  1G6P A;  5AJ3 Q;  3T1Y L;  5LMN L;  1SN8 A;  3BZK A;  3J80 c;  4JYA L;  3RN5 A;  4IFD J;  4Y52 H;  3G6E A;  4QIW E;  2VY3 A;  3E9H A;  3G48 A;  4P71 A;  2MO1 A;  3W1G A;  3PO3 H;  4BY7 G;  4LFB Q;  1A63 A;  3A74 A;  4DK6 C;  3CW2 C;  2AWN A;  1XPO A;  3L0O A;  2JA9 A;  1B70 B;  1DGS A;  3NEL A;  1NMF A;  1HNX Q;  2RCN A;  5BR8 Q;  5FJ8 G;  4A3M H;  1XMO L;  1X9N A;  4LF8 L;  4QQB X;  1K3R A;  3TRZ A;  2ASB A;  3RN2 A;  4R1J A;  4IPD A;  1NTG A;  4NXN L;  1Q1E A;  3KLW A;  4DUY L;  2UUB Q;  4C3J H;  4LFA L;  2PI2 E;  4FDB A;  1TXY A;  1WOC A;  1YI2 A;  1YIT A;  1PYS B;  4A3B G;  1K8G A;  3PIP A;  1X54 A;  3HOW G;  3E9I A;  1X3G A;  3JAM i;  4HJ7 A;  1B7Y B;  4DR4 L;  1C9O A;  4KHZ A;  4GOP A;  4JOI C;  3STB D;  1X3F A;  3J81 i;  3UDX A;  3M4Q A;  4DV3 Q;  2R92 G;  1Y1W G;  1XTD A;  4B3M L;  1LYL A;  1I6H H;  3U4V A;  4JI8 Q;  2ZJR A;  3LGJ A;  1XNQ L;  2OTJ A;  4A4I A;  3AFQ A;  4HJ5 A;  1E1O A;  1VQ8 A;  5M3M H;  4JI7 Q;  4PMW A;  2A1A A;  3A0J A;  2JQO A;  4R4I A;  3RR5 A;  4DUZ Q;  4KHP L;  1J6Q A;  1FL0 A;  2JA5 G;  4A3E G;  1W3S A;  4LUO A;  4UP7 A;  2PMZ E;  3F8T A;  2FXQ A;  1N36 L;  4B3T L;  2WP8 J;  1NE3 A;  2E2J H;  1VQ7 A;  4A3D H;  1HZB A;  1YHQ A;  2R7Z H;  1XNR Q;  2NZO A;  2EQS A;  2AMC B;  2MNA A;  1K73 C;  1IBL L;  3KYH C;  3OTO Q;  4A3L G;  4YHH Q;  1SLJ A;  3CXC A;  3RLF A;  3K8A A;  3PGZ A;  1XPR A;  5IYC H;  5C44 H;  2JA6 H;  1JJC B;  2RF4 A;  4JI2 Q;  5IT9 c;  3EIV A;  3GTM H;  1AE2 A;  3HOU H;  1VQE A;  1QVC A;  4YCU A;  4C3H H;  1AE3 A;  5IP9 H;  2MQH A;  5IYB G;  3I4M G;  4LUV A;  5M5W H;  3UE1 A;  3MXN B;  1L1O A;  1V9P A;  3I55 A;  4KI0 A;  4JBJ A;  3K0X A;  4LW1 A;  2PI2 A;  2KHI A;  4PZ6 A;  4NXM L;  3UDG A;  2JA8 H;  3A5U A;  3ZJY C;  4YCW A;  1EIY B;  1A0I A;  3S1Q H;  4MNO A;  1VQG A;  4JV5 L;  3S17 H;  3TEH B;  1R9T H;  3ICE A;  5LMN W;  1TWA H;  1Q86 C;  3CC4 A;  1SFO H;  4JI6 Q;  4DR1 L;  1PYB A;  1UEB A;  2OTL A;  1A62 A;  1G29 1;  2CFM A;  2Z6K C;  2C35 B;  4LF5 L;  3KDF B;  3H0G G;  5IE8 A;  1NY4 A;  3FKI H;  3CCE A;  1FJG L;  4LWC A;  1N32 Q;  2OCE A;  3NBH B;  1J5E Q;  1X56 A;  1AH9 A;  1OTC A;  2YV5 A;  4R4O A;  1YZ6 A;  3E0E A;  4OWT B;  3H3V H;  5J3B A;  2L15 A;  1JE5 A;  2IT1 A;  3ULL A;  1I50 H;  1Z47 A;  2HIV A;  2KCM A;  4LF9 Q;  5IWA L;  5EAY A;  4GNX C;  1VQJ A;  2WAQ E;  1WJJ A;  2E2I H;  4GKJ L;  1HR0 Q;  3PUY A;  1WFQ A;  4BA2 I;  4DPG A;  1PH8 A;  3UDF A;  4H02 A;  1VQI A;  2K5V A;  5H1S E;  1S72 A;  4GKK Q;  1BBW A;  3PUX A;  5E7N A;  2E8G A;  1V43 A;  4QL5 A;  4QJF A;  4HJ8 A;  4A3I H;  2UU9 L;  2F4V Q;  5HGQ A;  2HHH Q;  1Y1V H;  5HY6 A;  3M85 A;  2XGT A;  2KCT A;  1K8A C;  1P8L A;  2EIF A;  3J7Z C;  1P16 A;  5GRO A;  3HFZ B;  4RMF A;  4A3J H;  3S14 H;  1E3P A;  5C4X G;  2UUC Q;  3CQZ H;  4B3T Q;  5M5X H;  5C44 G;  4DR5 Q;  1VQ5 A;  1CKN B;  2E5L Q;  1W2B A;  3CCU A;  3T1H Q;  3HOU G;  1Q1B A;  1KD1 C;  2CQO A;  2N3S A;  3M7N A;  1XPU A;  1IBK L;  3L7Z C;  2AWO A;  1B8A A;  2KBN A;  4DV1 L;  1U5K A;  3AQQ A;  5GAD C;  2BH8 A;  1E1T A;  2YYZ A;  3G4S A;  2OQ0 A;  1N34 L;  3ERS X;  2JA8 G;  4HJA A;  2YTX A;  1FVI A;  2OQK A;  3K80 C;  4DV7 Q;  4IOC A;  1QZG A;  4OX9 L;  2CCZ A;  2UXC L;  4X66 L;  1SRO A;  2K5N A;  2QA4 A;  3U4Z A;  4QY7 A;  3NEM A;  5JJK A;  3GTL H;  1XJV A;  4UP9 A;  3ER0 A;  3CCQ A;  4DR7 Q;  3KJP A;  1I5F A;  3GTJ H;  4YWM A;  1A8V A;  1YEZ A;  3BU2 A;  1QZH A;  1PHJ A;  2JJQ A;  2NVT H;  3SGI A;  4IPC A;  2HQL A;  4NXM Q;  5C3E H;  1N33 Q;  1VQM A;  1EFW A;  4LUZ A;  4R4Q A;  1VQO A;  5IYD H;  3J81 j;  2Y0S E;  1HJP A;  2Q2I A;  4JV5 Q;  2QGQ A;  3AYH B;  2VQE L;  4Y7N H;  1TWG H;  3DM3 A;  5GQO A;  4GS3 A;  5M3F H;  1Q82 C;  4LF7 L;  1TWC H;  4GLX A;  3CC7 A;  1I94 Q;  4GLV B;  4JCV E;  1VCI A;  2ZM6 Q;  3ULP A;  2B29 A;  3HOV H;  3PCO B;  1KRT A;  4JI1 Q;  3I4N H;  5JJL A;  4QGU A;  1UWV A;  1VQA A;  1HH2 P;  1PH9 A;  4BY1 H;  2UXB L;  3HKS A;  2VL6 A;  4AIM A;  3HOZ H;  1Y14 B;  3CME A;  4A3I G;  4X62 L;  1XMQ L;  4GOP C;  3PIO A;  5IY0 A;  5C4J H;  4PZ8 A;  4HJ9 A;  2UUA Q;  1SR3 A;  1LM0 A;  1Q12 A;  3GTP H;  2PQA A;  4MTN A;  2B63 H;  4GKJ Q;  3U50 C;  1SRU A;  3S1N H;  1S40 A;  4LFC L;  4LF6 L;  4IFD I;  3TS0 A;  2K14 A;  3G71 A;  3RNU A;  1WCM H;  4WJ4 A;  2VQF L;  2MFI A;  1GM5 A;  4UPA A;  4LF4 Q;  1EOV A;  2IHF A;  2WB1 E;  2Z0S A;  1LUZ A;  4YY3 L;  4R4C A;  2RHS B;  1NMG A;  1EWI A;  4JBW A;  4XIG S;  4L5S A;  4A3C H;  4DV2 L;  4RG1 A;  4K0K L;  3W5O A;  2ZTD A;  1IBM Q;  2BA1 A;  2JEA I;  1MKH A;  1YHA A;  4AH6 A;  2BA0 A;  4OO1 G;  4JG2 A;  1T9H A;  1UE1 A;  3M4P A;  4JOI A;  4POF A;  3PV0 A;  4JI0 Q;  1HNZ L;  3BZC A;  4XTC S;  1VQ9 A;  3JAM c;  3KF6 B;  4DV6 L;  4JI4 L;  4O0A A;  5DLQ E;  2I5M X;  5JJI A;  1PH7 A;  4DV0 Q;  4X64 L;  4JI3 Q;  2CWA A;  3A5Z B;  1X3E A;  3PUZ A;  1JMC A;  4X66 Q;  4JI5 Q;  1YNX A;  3EN2 A;  1L0W A;  4DR3 L;  1ASY A;  1E22 A;  4AQY L;  3PO3 G;  4X65 Q;  1PV4 A;  4DV5 L;  1EUJ A;  4A93 H;  3CCR A;  1YJ9 A;  4OON A;  3T1Y Q;  5LMN Q;  1VQK A;  1UE5 A;  3HOX H;  5LMU L;  4A3M G;  1CUK A;  1JB7 A;  4JYA Q;  1PA6 A;  4DKA C;  2WAQ G;  3K7U C;  3I4N G;  3M9B A;  4DR2 L;  4BY1 G;  5ELN A;  5JEA G;  4A3K H;  1HNW L;  4TQU S;  4B3R L;  1OXX K;  1UE6 A;  2VQE Q;  1BBU A;  3PSI A;  3CCV A;  3HOZ G;  1CKO A;  1UE7 A;  2ZJP A;  4A3G G;  4EQ5 A;  1XMO Q;  4LF8 Q;  4GNX B;  3I2Z A;  2F52 A;  3S1R H;  2NVX H;  5FLM H;  2B63 G;  2A8V A;  1MJE A;  4NXN Q;  4LFA Q;  2ID0 A;  4DUY Q;  2UXD L;  5GAG C;  2LSS A;  3DLL A;  3CPW A;  1SE8 A;  4IO9 A;  3EBE A;  4P73 A;  4DR4 Q;  5M3M G;  4C2M H;  4LFB L;  4X62 Q;  2XTI A;  1K0R A;  1XMQ Q;  4HIM A;  5C0X G;  3CCJ A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 4WJ3 M;  4IJH A;  5BR8 L;  4B3M Q;  4KMU C;  3D6C A;  4RCN A;  4LFC Q;  1Z6H A;  2BDO A;  2L12 A;  1HHV A;  3NQT A;  2RBM A;  2B8G A;  1O7Z A;  1QUQ B;  3K81 C;  5KYI A;  3GTK B;  5CC4 A;  2JA6 G;  3KDF A;  5DNF A;  3MEH A;  4DR6 L;  1XTC D;  4DV4 L;  3QOL A;  1H9K A;  3D0F A;  3NBH A;  1SNP A;  1IBL Q;  2EZV A;  1ICF B;  3BDO A;  1VQC A;  4QUC A;  4DUZ L;  1LV9 A;  3GV3 A;  5EJW A;  2EYJ A;  5FLX c;  3EA6 A;  1O7L A;  2NVY H;  5GAH C;  3RLO A;  1SMY D;  2K5H A;  2KHJ A;  4N8X 1;  4P74 A;  4C3J B;  5EPL A;  3OHX C;  5KND A;  3OTO L;  3T56 B;  5ELF A;  3TS2 A;  4FF1 A;  3MXU A;  1CSP A;  5JVH 3;  1CKN A;  2AUK A;  2D62 A;  1CHP D;  3Q6S A;  1JQY D;  4JBK A;  5C3X A;  2EY6 A;  2ES2 A;  1EY6 A;  1F2Y A;  2G9H D;  2EYO A;  3A7A B;  3CP0 A;  1IL2 A;  2QEJ C;  2R6G A;  2WB1 G;  2LXJ A;  1KNE A;  1YVC A;  2K75 A;  4CKC A;  1CKM A;  5E4X A;  4IQZ A;  1PYW D;  2B2T A;  2ZXR A;  2R7D A;  3BDC A;  1M8A A;  4F7X A;  4B08 A;  5IWA Q;  1PTO D;  4XXE A;  2XWB B;  1ESF A;  3QJY A;  1HFN A;  1DOL A;  3AMU A;  4B3S L;  4A3G H;  3BG3 A;  1J5E L;  3MHB A;  3I70 A;  5C44 B;  4CDE C;  1QVF A;  3HOU B;  4U68 A;  2NN6 G;  2VW9 A;  1ROD A;  4M8A A;  3OW7 A;  3OW2 A;  2I5L X;  3S2H H;  2N49 A;  5IGE A;  4ZKB B;  1XX8 A;  1STG A;  3KFU A;  1AP0 A;  2QIL A;  3NWT A;  4OEL B;  2F4V L;  4APV A;  4DV1 Q;  3S17 B;  4DK1 A;  1TWA B;  3TSS A;  2UXD Q;  5ELO A;  5C3E G;  1LTL A;  2AQ1 B;  2UUC L;  2VUM G;  3H15 A;  3FHW A;  5M5Y B;  2E5L L;  2D5D A;  1PH2 A;  2H5X A;  4ALP A;  3HRZ C;  5M3F G;  3TQY A;  1A3T A;  5ELB A;  4BBS H;  2PZU A;  1GUN A;  2MO0 A;  4FNF A;  5D65 A;  1J9O A;  4CKE A;  4DXF A;  1MGS A;  1PH6 A;  1ZXT A;  2FHT A;  1OO9 B;  4HMJ A;  1VS0 A;  3D3R A;  2WII B;  1MSG A;  2IX1 A;  1BF4 A;  3NBI A;  4NB3 A;  1DZ1 A;  1O78 A;  2UXB Q;  1NBW A;  3S14 B;  1IHZ A;  3UE0 A;  1WCM G;  3NK9 A;  1T5E A;  3BJU A;  5CYU A;  2GVB A;  4IOA A;  2JE6 I;  4IFD G;  4C1N K;  2JK8 A;  2Q2H A;  4A75 A;  3GTO B;  2F1M A;  1S5E D;  3IAY A;  3D8G A;  1VQD A;  1PRT F;  4KJO A;  2E75 C;  2TMP A;  2VQF Q;  2XRQ D;  3EQL C;  4R4T A;  4AYB G;  2I0Q A;  2NTS A;  5D14 A;  1BCP F;  2BH2 A;  2CQA A;  4DV2 Q;  3S2D H;  1KAB A;  2ZJQ A;  1PH3 A;  1OXS C;  5I4D A;  3MTS A;  2R7F A;  2K05 A;  5EBD A;  1H95 A;  4BWG B;  4RAU C;  4ZKC B;  1EEI D;  2FFK B;  1BQQ T;  1V8Q A;  4BBR G;  3KUP A;  4JW0 A;  4H0L C;  5KNB A;  2B2Y C;  4HSP A;  3RD4 A;  4HSV A;  1VQF A;  2ZXP A;  3I4N B;  2F0J A;  4A3E H;  2YTY A;  3SR1 A;  3ULJ A;  3GTG H;  4OO1 I;  1UEA B;  1BCP C;  3RMH A;  3G7L A;  4DR2 Q;  2B63 B;  2QDL A;  4OO1 H;  2HIX A;  1EFI D;  1SYE A;  1Q90 A;  1WI5 A;  3NTI A;  4GN3 B;  4X65 L;  1X3P A;  3T1Y L;  3RN5 A;  3BVZ A;  4ZCK A;  4QIW E;  4P71 A;  3E9H A;  3G48 A;  2MO1 A;  3PO3 H;  1XPO A;  3L0O A;  2JA9 A;  1B70 B;  4ILW A;  4E6I A;  1NMF A;  1XXG A;  3E6Z X;  2RCN A;  5BR8 Q;  5IGB A;  4A3M H;  1X9N A;  1LTA D;  4QQB X;  1K3R A;  3TRZ A;  2ASB A;  2QCP X;  2Z4I A;  4KN7 C;  2RKS A;  1G2T A;  2PI2 E;  1TXY A;  1WOC A;  1PYS B;  1DCZ A;  3PIP A;  1X54 A;  3I72 A;  4DR4 L;  2Y0S B;  4A93 B;  4TSS A;  3STB D;  3K5N A;  1STY A;  3M4Q A;  3HOX B;  2CHB D;  1WTO A;  1I6H H;  1FNU A;  2ZJR A;  4KN4 C;  3AFQ A;  3D4W A;  1VQ8 A;  4KHP L;  3QO2 A;  4R4I A;  4DUZ Q;  1WTR A;  4G7O C;  1J6Q A;  1FL0 A;  1N36 L;  1A2T A;  3DM1 A;  4L6T B;  2R3Z A;  1EZ6 A;  4PV1 C;  4A3D H;  1JE4 A;  5I6W A;  5C5L A;  1EWC A;  3OTO Q;  1XPR A;  5CMD A;  2F4I A;  2RF4 A;  1R4P B;  3NP8 A;  1NNX A;  1QVC A;  4C3H H;  1RDP D;  1NCV A;  2K03 A;  3I55 A;  4H44 C;  4LW1 A;  4A3G G;  2PI2 A;  2OF1 A;  1SMY C;  4YCW A;  1A0I A;  4ULL A;  3P20 A;  1FGB D;  4JV5 L;  3RZO B;  1R9T H;  4JPB W;  5LMN W;  1KDC A;  3CC4 A;  1KAA A;  1G29 1;  3CHB D;  2Z6K C;  3KDF B;  5IE8 A;  1FJG L;  3FKI H;  4FXG C;  4LWC A;  1TS4 A;  2OCE A;  3NBH B;  1J5E Q;  1SND A;  1OTC A;  2YV5 A;  4ZYS A;  4OWT B;  4O1N A;  5J3B A;  1WTP A;  2L15 A;  1G91 A;  4UHV A;  2IT1 A;  2KJX A;  2HIV A;  1EOT A;  2V4D A;  4K5W A;  3GTJ B;  3NE5 B;  4GNX C;  2WAQ E;  2E2I H;  4FXD A;  2K5V A;  3E5S A;  4CDD C;  1PLF A;  1ESR A;  1LTT D;  1V43 A;  3A8I E;  3VA7 A;  2F4V Q;  1Y1V H;  3C1E A;  5HY6 A;  1K8A C;  1KLG D;  1MSH A;  2D9U A;  3HFZ B;  3OPO A;  4RMF A;  4EVO A;  4A3J H;  3IFT A;  2UUC Q;  3R3O A;  5M5X H;  1CKN B;  3KLS X;  2E5L Q;  3W3A A;  4RHR A;  2B2U A;  3RZD B;  2CQO A;  4WRD A;  2K01 A;  1RF2 D;  5COY A;  2KBN A;  1JCK B;  5GAD C;  3GTP B;  1N34 L;  2EE1 A;  2JA8 G;  2CCZ A;  1AFP A;  3U4Z A;  2RA4 A;  3GTL H;  2L0C A;  1I5F A;  1A8V A;  1K28 A;  2F3W A;  1HQM C;  1Y8N B;  1D5Z C;  4IPC A;  2HQL A;  1K83 B;  1SE4 A;  2F0F A;  2NTT A;  3S16 B;  5IYD H;  5L37 A;  2X6L A;  5BN5 A;  2G5D A;  2XNA C;  1KDB A;  2R93 B;  3K5L A;  4OHJ A;  4Y7N H;  4A3F B;  3JAM E;  5LHY 1;  5GQO A;  1C48 A;  4YIJ A;  4LF7 L;  1TWC H;  4H13 C;  3CC7 A;  4GLX A;  2JSO A;  4JCV E;  1VCI A;  3ULP A;  3PCO B;  3J81 E;  2MJ8 A;  1PH9 A;  3HOZ H;  3CME A;  4ZAI A;  1LTI D;  4A3I G;  4X62 L;  2Z9H A;  1M4V A;  1H9J A;  2PQA A;  5E3F A;  4KY5 A;  1A3U A;  2KCC A;  4LFC L;  1H9M A;  2CW0 D;  2K14 A;  3TBI B;  3QIA A;  1C4Q A;  4YY3 L;  4P2C B;  3OOC A;  1WTQ A;  1UUP A;  1MKH A;  1F2Z A;  4OO1 G;  4JG2 A;  1T9H A;  1UE1 A;  1CT1 D;  3BZC A;  2K28 A;  3JAM c;  4JI4 L;  5DLQ E;  2HDM A;  4X64 L;  3VYT A;  3A5Z B;  5FO9 B;  4QCL A;  2LY7 A;  4DR3 L;  3PO3 G;  4HN7 A;  1ASY A;  4AQY L;  4X65 Q;  3QG1 A;  2N88 A;  1MD2 D;  4J8Q A;  1EYC A;  5K5P A;  3T1Y Q;  4A3M G;  1JOK A;  1RTO A;  2AUJ D;  2A6H D;  4DN4 M;  1LAC A;  5ELN A;  3K57 A;  4PNY A;  1HNW L;  1SNM A;  4B3R L;  1OXX K;  1UE6 A;  2VQE Q;  1BBU A;  2Q8I B;  3HEJ A;  1GHJ A;  4CHT B;  1GUT A;  3S1R H;  2NVX H;  3S9W A;  2A8V A;  1IW7 D;  2XRS D;  3N6R A;  2QW7 A;  1Y1W B;  5DM6 3;  1B2T A;  4P73 A;  1H9S A;  4DR4 Q;  3E0J A;  1CA5 A;  3K7A B;  2NVT H;  3AFP A;  1QNK A;  1HNX L;  1PVO A;  1QNU A;  2RDF A;  4A3D G;  2K4K A;  2K32 A;  4LJZ C;  5T1I A;  2UUB L;  1EEF D;  4BY7 H;  4KHP Q;  1WVL A;  3KOJ A;  4HCS A;  4GN5 A;  1N36 Q;  1ILP A;  4ZUI A;  3EJI A;  3NUC A;  2QF7 A;  3GTQ B;  1LO5 D;  3NQI A;  2QDB A;  5FJ8 H;  1GHK A;  3J80 E;  2AHO B;  1B3A A;  1HUM A;  1S5F D;  2SEB D;  1VQN A;  4RHS A;  3SK4 A;  4HR7 B;  1S5D D;  4A3B H;  2EPB A;  3I4M B;  2FMC A;  1S5B D;  1Q7Y C;  3STB C;  2K50 A;  4DV6 Q;  1ZKO A;  4CDC C;  1PH4 A;  3MEF A;  3J80 i;  3S24 A;  3R8B A;  1TWH H;  2F0T A;  3GD7 A;  1B53 A;  3FKI G;  3W1B A;  2VUM H;  2HQE A;  5JEA J;  3IKJ A;  1VF7 A;  3KF8 B;  4YCV A;  5T1G A;  1O7I A;  3IRB A;  3KLS A;  1EQR A;  1FNV A;  1EY7 A;  2DGY A;  4V19 0;  1FJG Q;  3BYT B;  3F1Z A;  2NUC A;  2VXW A;  5ISR A;  1DOK A;  1TY2 A;  3Q22 A;  1GUS A;  2EJM A;  1I4G A;  2Q2T A;  1Y1V G;  3FDT A;  4A3J G;  4JI6 L;  2L5T A;  1X32 A;  2RSO A;  3PIP 3;  1EQQ A;  5C4X B;  3N52 A;  2HDL A;  3WDN A;  3E3X A;  4C3I H;  4A76 A;  1YJW A;  2JA6 B;  1J8I A;  1NAP A;  1MIU A;  1PRT D;  2X69 A;  3TP5 A;  4IFD H;  1OXT A;  1VF5 C;  2CVR A;  2JXM B;  4QIW B;  3H0G H;  1KC8 C;  4DAP A;  5CR3 A;  1D8L A;  4RKB A;  1BDO A;  1GKH A;  1BCP D;  5ELD A;  2EVB A;  3CAM A;  1C7Y A;  1ENF A;  1X3Q A;  3S1Q B;  2YTV A;  2HHH L;  3TP6 A;  3V2T A;  4RKL A;  2I46 A;  1I6V C;  2K33 A;  5JPM C;  1N34 Q;  1SFO B;  3I90 A;  1BOS A;  1N8R C;  5IYD G;  1LT5 D;  1L1O C;  5ELC A;  4GN4 B;  3LWE A;  1FGU A;  2VNU D;  2YU9 B;  3G6J B;  2B2W A;  1PDQ A;  4IUU A;  1I50 B;  4BBR H;  5FOB B;  2Z6B A;  4DV7 L;  4QF4 A;  5DAU A;  2A74 C;  4LF7 Q;  1MHW C;  4IZ8 A;  1M90 C;  1KTK A;  4DR7 L;  2GA4 B;  4K6D A;  2JA7 G;  2IX0 A;  1EQT A;  4X3U A;  4X6A H;  4ZLT F;  1B4O A;  2OT2 A;  1DXM A;  2PNR C;  3TME A;  4P75 A;  3F2C A;  2PW7 A;  5M5Y H;  2ZM6 L;  1FYC A;  4L5T A;  3H3V I;  3LX0 A;  4K6L A;  4YY3 Q;  3HKZ G;  1KRS A;  4DNR B;  2PYK A;  2LS0 1;  1LT3 D;  2F0Q A;  1VMP A;  2RHQ B;  4RGN A;  3CD6 A;  2AKW B;  3KJO A;  3PUV A;  1TS5 A;  3UDI A;  2J0T D;  2NWG A;  1C0A A;  4LF4 L;  4JI4 Q;  5I9O A;  2OWO A;  3JC6 6;  3PO2 G;  4X64 Q;  3NPP A;  2OXP A;  4ZQ3 A;  2CW0 C;  4DR3 Q;  2WAQ B;  4AQY Q;  1T5X D;  1DD2 A;  4BY1 B;  4IAL A;  4OWX B;  2PCF B;  3GTO H;  3FEW X;  5CV4 A;  2L11 A;  5C4J B;  3X3N A;  2L1B A;  4DV0 L;  2KCN A;  1JC7 A;  1HNW Q;  4B3R Q;  2EY5 A;  3HOY G;  5DEH A;  5IP7 G;  2PQA B;  5M3M B;  1QVG A;  1G6P A;  5LMN L;  1SN8 A;  2EYM A;  2E2J B;  2DJF C;  1GUG A;  4X3S A;  1CI3 M;  4BY7 G;  5C4Z A;  1A63 A;  3A74 A;  4DAY A;  2AWN A;  2MPM A;  4MHE A;  1JIC A;  4OL7 A;  1HNX Q;  1STE A;  5FJ8 G;  1XMO L;  2A6H C;  4RWS C;  1HCZ A;  5EPK A;  3GTM B;  4IPD A;  3KLW A;  4DUY L;  2UUB Q;  3KK7 A;  3Q23 A;  1YI2 A;  4U67 3;  4A3B G;  1K8G A;  3E9I A;  4G57 A;  1X3G A;  4XDX A;  4GOP A;  4B9W A;  1IW7 C;  1B44 D;  4DV3 Q;  3NXW A;  1XTD A;  3ONA B;  1LYL A;  5CV7 A;  2EYH A;  2MUY A;  2OTJ A;  2JYO A;  3EVQ A;  1E1O A;  2WKD A;  3IFD A;  4HJ5 A;  4PMW A;  3RUZ A;  2F0D A;  3TDQ A;  4LUO A;  3SE0 A;  1VQ7 A;  4QUF A;  1QB5 D;  1VMC A;  3OWE B;  5C5M A;  1YHQ A;  2R7Z H;  1EZ8 A;  2EQS A;  4IUN A;  2AMC B;  2MNA A;  1K73 C;  1B1Z A;  3ZYY X;  3WOF A;  1SLJ A;  4YHH Q;  4KY6 A;  1H9R A;  5IYC H;  1BBX C;  1CZG A;  5K36 H;  5EQ0 A;  4FF4 A;  5IP9 H;  2F0P A;  2MQH A;  1H9S B;  1WD1 A;  4Z9C B;  1NR4 A;  4PMB A;  2C9O A;  5C6A A;  1I4P A;  2CH4 A;  2JA8 H;  1B9N A;  1U4R A;  1O80 A;  4C3I G;  5FK9 C;  3H94 A;  3ICE A;  4C3J G;  1Q86 C;  4JI6 Q;  1PYB A;  3CRL C;  4LF5 L;  1CFM A;  3H0G G;  2HD3 A;  2IX3 A;  4LMQ D;  2EYF A;  1R4Q B;  2EYL A;  1QG7 A;  3ULL A;  5FLX L;  3MC0 B;  2L9H A;  2C5C A;  3PUY A;  4BA2 I;  1HUN A;  5KRU A;  1EY5 A;  3SK8 A;  3MXG A;  2KVM A;  1ET6 A;  2F0H A;  3L9A X;  4A3I H;  4QJF A;  2HHH Q;  1TWG B;  2KCT A;  1P8L A;  1KDA A;  4DNT B;  5GRO A;  1LTB D;  1ENC A;  1E3P A;  3VYU A;  5C44 G;  4DK0 A;  3HOV B;  1PRT C;  5HGT A;  1W2B A;  1D2B A;  3HOU G;  1Q1B A;  1KD1 C;  1SBB B;  2N3S A;  1IBK L;  3L7Z C;  2WV6 D;  2BH8 A;  1E1T A;  1PMR A;  3ERS X;  4HJA A;  4DV7 Q;  2OQK A;  1QZG A;  4OX9 L;  3KBG A;  1SRO A;  2A68 D;  4HMI A;  4KK7 A;  4XT3 B;  5I2X A;  4A3G B;  4I65 A;  3P75 A;  3ER0 A;  3CCQ A;  4DR7 Q;  3KJP A;  2B2Y A;  3GTJ H;  1PHJ A;  1VQM A;  1Y8P B;  1VQO A;  1HJP A;  2Q2I A;  3AYH B;  4DA2 A;  4N8F A;  2VQE L;  1I4H A;  1HA6 A;  2F0S A;  3GP7 A;  1LTS D;  2ZM6 Q;  3MZ5 A;  3T53 B;  2Z4H A;  3KF8 A;  4ME5 A;  2XIW A;  1Q3L A;  5IOC A;  1RHP A;  5D3I B;  5EBC A;  1ET9 A;  4TKO B;  1GOZ A;  4KTA A;  4I7Z C;  1EY4 A;  1SR3 A;  3GTP H;  4GKJ Q;  3U50 C;  3BS1 A;  2F0K A;  3S1N H;  1S40 A;  1EIH A;  2FIN B;  4BBS B;  2A69 D;  3SK5 A;  4LF6 L;  3RNU A;  2MFI A;  4UPA A;  4LF4 Q;  4A3K B;  2WB1 E;  1NR2 A;  2Z0S A;  2RHS B;  1NMG A;  5EKL A;  1EWI A;  4JBW A;  4L5S A;  1S4Z A;  3A8J E;  4RG1 A;  3W5O A;  2BA1 A;  1YHA A;  4RCO A;  4KHV A;  2BA0 A;  2D2C C;  1U9R A;  1SE3 A;  4C2M B;  4DV6 L;  2KOL A;  4DV0 Q;  2CWA A;  1X3E A;  4J1M A;  1ZEQ X;  3VYR A;  3PUZ A;  1JMC A;  1AZP A;  4X66 Q;  4KD4 A;  1E22 A;  4N9T A;  3HS0 C;  2XN9 C;  1EUJ A;  4IUQ A;  3I73 A;  3MFG A;  3CCR A;  4OEM B;  1YJ9 A;  1IKM A;  5LMN Q;  1UE5 A;  5IGF A;  5EKK A;  1PA6 A;  4DKA C;  3K7U C;  3S2D B;  3I4N G;  3M9B A;  5C3W A;  1D1I A;  1EY8 A;  2J7Z A;  3PSI A;  1I4R A;  2PMZ B;  3CCV A;  3Q24 A;  2BCO A;  1UE7 A;  2ZJP A;  3HOW B;  4EQ5 A;  1XMO Q;  4C56 C;  1PZI D;  3H09 A;  2B63 G;  1MJE A;  4DUY Q;  5GAG C;  1K0S A;  3CPW A;  2R92 B;  3TP7 A;  4LFB L;  2XTI A;  1K0R A;  1XMQ Q;  4HIM A;  3MXN A;  3BDL A;  3CCJ A;  4OON A;  2DUD A;  1VQH A;  3T13 A;  3TN2 A;  3ERO A;  2JA5 B;  2Z6K A;  4A3E B;  2R7Z G;  1TY0 A;  4EGV A;  1L0X B;  5EKI A;  2IL8 A;  1QOH A;  3F2D A;  3M3Y B;  4DF7 A;  4KKU A;  5IYC G;  4NW2 A;  1JWS D;  3A55 A;  3DWQ A;  1JOQ A;  4NPS A;  1GUW A;  5K36 G;  1PFS A;  5IP9 G;  3J7A 5;  4L5R C;  4MZ9 A;  4IJL A;  1VQB A;  4J15 A;  3S1M B;  2Y0S G;  1BUV T;  2E76 C;  3PO3 B;  3GDE A;  2ZTE A;  2GN5 A;  1GUO A;  1JT8 A;  1WYD A;  3PUW A;  4AYB E;  3FPU B;  4A3M B;  1Y1W H;  3OSO A;  4EQP A;  4DAY B;  3J7Y W;  3U58 A;  3HGB A;  5CV5 A;  4DAM A;  4EX5 A;  4TVA B;  1GD7 A;  2EJG C;  1E2W A;  1ICW A;  4YWK A;  4OWW B;  2JP1 A;  3VA5 A;  1ONL A;  1YBY A;  3PF5 A;  2XSC A;  3A56 A;  5KEE A;  3CRK C;  3CCM A;  2B8F A;  4K5X A;  2NBF A;  4UP8 A;  4CGY B;  1I6H B;  4LF5 Q;  1BVS A;  3SK6 A;  4GOP B;  2DY7 A;  3LNN A;  2ATW A;  1D1K A;  5C4H A;  3S15 H;  2KEE A;  3CMA A;  2DNE A;  3FVQ A;  5J39 A;  1OXU A;  5C0X J;  4IUR A;  1TWF B;  2N78 A;  3I4M H;  2E2H H;  2WFW A;  1N9W A;  1N32 L;  2JA7 H;  2NVQ H;  4XQN A;  1EIF A;  3Q8D A;  3PIO 3;  1BR9 A;  3I7F A;  5IT9 E;  4C3H B;  1HZC A;  4CBV A;  1G51 A;  1HZA A;  1VDZ A;  3D6W A;  4L5Q A;  2X6G A;  4K2K A;  3DWA A;  3URY A;  1PH1 A;  1L0Y B;  3MVV A;  2J4X A;  4GKK L;  1IBK Q;  4RFB A;  2CWP A;  3R2I A;  4KKS A;  1HFG A;  4RA8 A;  3PMF A;  5C0X I;  3I56 A;  3W2D A;  2B2V C;  1VQ4 A;  3J81 c;  4OX9 Q;  1SNO A;  3BVM A;  1F9Q A;  3B6Y A;  5J22 A;  1SSO A;  1OXV A;  3T1H L;  1GO3 E;  1KLU D;  1DON A;  2LKV A;  2CKZ B;  3PO2 H;  3T16 A;  5C4X H;  4F87 A;  4J6H A;  1IZ6 A;  1MI2 A;  1RIP A;  2BE5 D;  2IW3 A;  1M1K C;  3H3V C;  2QEX A;  2N55 A;  1KAW A;  2ZXO A;  2LXK A;  2KQ3 A;  1Y1V B;  1E24 A;  2A68 C;  2PNH A;  1X65 A;  1SNQ A;  1N33 L;  2Z8L A;  3C3L A;  2EJF C;  4XT1 B;  1WTV A;  3HOY H;  1WD0 A;  2B3G A;  5IP7 H;  1TQO A;  2E2D C;  4LF6 Q;  3QB3 A;  1X6O A;  2R93 G;  1Q8K A;  2F0I A;  1I3Q H;  3QR8 A;  4A3F G;  2FJ2 A;  3FP9 A;  2YU9 H;  2PZT A;  3C2P A;  4R8I A;  5ELE A;  1A15 A;  2LFN A;  3K5M A;  4DV3 L;  1XYI A;  1Q46 A;  1VQ6 A;  3Q0A A;  3EFX D;  1U4M A;  5F2D A;  5G3L F;  4OIJ A;  1IXR A;  1F9S A;  4NDX A;  1HR0 W;  3DUZ A;  1JJ2 A;  5CBE E;  4X3T A;  4DK3 C;  3M4O H;  1KHI A;  2A69 C;  1PH5 A;  2PPB C;  1AW7 A;  4ID6 A;  1IBM L;  3RLN A;  3AU7 A;  3DMU A;  5A2Q L;  2KEN A;  3OMG A;  1PXU A;  2VS1 A;  2NN6 I;  4YHH L;  2F3I A;  2G9D A;  3HOZ B;  1JJG A;  2HT1 A;  1F9P A;  4JI3 L;  4BXX G;  4ABN A;  4DU9 A;  1DOM A;  3GTK H;  1PZJ D;  1QJO A;  4UDU C;  3V96 A;  5AJ3 Q;  3J80 c;  1CQF A;  2Q8R E;  1SDF A;  1BXT A;  3OIP A;  1EY9 A;  1NSN S;  1Q8I A;  1IL8 A;  4IFD J;  4B9X A;  2E74 C;  1D5X C;  2VY3 A;  4LFB Q;  1ML0 D;  4KJN A;  4DK6 C;  1TS2 A;  2K6A A;  3NHH A;  3NEL A;  1DGS A;  2SDF A;  2F0W A;  3JAM L;  1CHQ D;  3RN2 A;  1SXT A;  4R1J A;  1NTG A;  4XQQ A;  1Q1E A;  4C3J H;  1YIT A;  5JEA H;  4Q5V A;  3J81 L;  1RKN A;  2IJ0 A;  5M5W B;  1K8M A;  1B7Y B;  3A54 A;  5FKA C;  1C9O A;  4G7Z C;  2FMM A;  4JOI C;  2K1B A;  1X3F A;  3UDX A;  1Y1W G;  3U4V A;  1WTW A;  1XNQ L;  3H6M A;  4A4I A;  3I8Z A;  5M3M H;  2A1A A;  3A0J A;  2JQO A;  3RR5 A;  5KNC A;  3H91 A;  2KED A;  4UP7 A;  2PMZ E;  2FXQ A;  2DJG C;  2WP8 J;  2E2J H;  2A5H A;  1AZQ A;  1HZB A;  2NZO A;  4G7H C;  2H1E A;  1AN8 A;  3KYH C;  3K8A A;  3PGZ A;  2WB1 B;  5C44 H;  1JJC B;  3GTM H;  3EIV A;  1AE2 A;  3HOU H;  2HCC A;  1VQE A;  1AE3 A;  3MAQ A;  3I4M G;  4LUV A;  3MXN B;  1L1O A;  1V9P A;  4KI0 A;  3K0X A;  1CTM A;  2KHI A;  3UDG A;  1CK1 A;  3CQZ B;  4EQO A;  1VQG A;  4NMZ A;  4LK1 C;  2NB0 A;  3S17 H;  3TEH B;  1SJE D;  1TWA H;  2EOT A;  2MHV A;  4DR1 L;  1UEB A;  1A62 A;  3KBX A;  1RCV D;  3CCE A;  1N32 Q;  1XWE A;  4F88 A;  4OIK A;  5AFW A;  2EYP A;  1AH9 A;  1Z7T A;  3TP8 A;  5FLX E;  4PMC A;  2B39 A;  1YZ6 A;  3H3V H;  1JE5 A;  1HTP A;  1PTO B;  3J7A F;  2RDG A;  4WJW A;  1ENA A;  5EAY A;  1II3 A;  4GKJ L;  1WJJ A;  4HED A;  1DM0 B;  1PH8 A;  3HG9 A;  4H02 A;  5C3E B;  1V1P A;  5H1S E;  1S72 A;  4GKK Q;  1ZYR D;  2VUM B;  3PUX A;  5E7N A;  2E8G A;  2L55 A;  4QL5 A;  2UU9 L;  4EQN A;  4MIU A;  1EU3 A;  2XGT A;  2ICE C;  3J7Z C;  3S14 H;  5M3F B;  1E2Z A;  5C4X G;  4G4K A;  2JN4 A;  3KLR A;  4CKB A;  4B3T Q;  3SXH A;  1LAB A;  3T1H Q;  1SAP A;  3M7N A;  3OWF A;  2EY2 A;  2AWO A;  2F0V A;  3J80 L;  2MGS A;  2OQ0 A;  5COR A;  2K5W A;  1FVI A;  2YTX A;  2UXC L;  4IOC A;  2VB2 X;  4X66 L;  2I07 B;  2F0N A;  2QA4 A;  1WCM B;  3NEM A;  4C3I B;  4LAA A;  1YEZ A;  1QZH A;  2B2T C;  2JJQ A;  4NXM Q;  2KUM A;  1N33 Q;  2SNM A;  2MP1 A;  4LUZ A;  2TSS A;  3H0G B;  3A7L A;  3J81 j;  2M2L A;  1SEB D;  2IPK D;  1IYV A;  1TWG H;  4HCE A;  4AYB B;  1DYQ A;  1Q82 C;  3SHL A;  4MN3 A;  2BE5 C;  2O4X A;  2B29 A;  4FF2 A;  3HOV H;  1O7Y A;  3I4N H;  3J7A V;  5JJL A;  4QGU A;  1VQA A;  5IGG A;  2VL6 A;  3MWY W;  1CM9 A;  1XMQ L;  4GOP C;  3PIO A;  5IY0 A;  1HPC A;  4PZ8 A;  3A8K E;  4O42 A;  2B63 H;  1MBY A;  1SRU A;  4GZY C;  4BBR B;  3TS0 A;  2PZW A;  1BO0 A;  5JVG 3;  1EOV A;  1LUZ A;  4R4C A;  5IGC A;  1EY0 A;  5CV9 A;  2WAC A;  3BYY B;  4K0K L;  1IBM Q;  3T4A C;  3MA2 B;  4AH6 A;  4POF A;  1SE2 A;  3M4P A;  1HNZ L;  2K5D A;  3QOJ A;  1SYB A;  4XTC S;  4DFA A;  2A73 B;  1PH7 A;  4FYD A;  5JPN C;  4JI3 Q;  1FD7 D;  1G6Z A;  2RSN A;  1F77 A;  1EU4 A;  2EY1 A;  3LWU A;  3UI2 A;  2PW5 A;  5IIF A;  3K5O A;  4A93 H;  4KKT A;  1SYG A;  1VQK A;  3HOX H;  5LMU L;  1JB7 A;  1CUK A;  4PQX A;  1LTR D;  5LL6 S;  2WAQ G;  5TSS A;  1JB3 A;  1JWM D;  4BY1 G;  5JEA G;  3VYS A;  4A3K H;  4TQU S;  2EDG A;  2M00 A;  1CKO A;  4L8J A;  1CA6 A;  3F2U A;  2M9V A;  2F52 A;  2O2L D;  2ID0 A;  3DLL A;  3I4L A;  4R9W A;  2NVY B;  3T51 B;  3EBE A;  1Y8O B;  5M3M G;  2NZ1 D;  4C2M H;  3SVM A;  2XWJ B;  5J1Z A;  2ZTC A;  1STN A;  1SMX A;  1WTX A;  4N9P A;  4LNQ A;  4A3C G;  1YHB A;  4X3K A;  1ILQ A;  1V1O A;  2WKC A;  3M4Y A;  2GVA A;  2A19 A;  1CSQ A;  1S3O A;  1XNQ Q;  5KYL A;  1TVX A;  1SYC A;  2DY8 A;  3V05 A;  2IY5 B;  1A6X A;  4CJ2 C;  3GO5 A;  1AEX A;  3VR2 A;  1IKL A;  1E7Z A;  4HIO A;  3ND8 A;  3DWP A;  3RZO H;  4I7A A;  2Q2U A;  2ALY B;  4JI8 L;  1K8O A;  5BN3 A;  1KL9 A;  3HOW H;  4JI7 L;  2L4N A;  1EIG A;  2N8N A;  2R61 A;  4BA1 I;  1RL2 A;  2F0M A;  3PF4 A;  1YNJ D;  3HKZ E;  4IPH A;  2R92 H;  1K9M C;  1XNR L;  1EYG A;  2JEB I;  4DV5 Q;  4FP5 D;  1Y69 U;  3CCL A;  2JA5 H;  4FO2 A;  2V1C C;  1E2V A;  1KXL A;  5FLM G;  4KY7 A;  3S2H B;  4IPG A;  4JI2 L;  4PG3 A;  2Q8T A;  4DR1 Q;  3F2B A;  1W6J A;  4KV6 A;  3M3Y H;  4O2D A;  1HZ9 A;  2LMC B;  3FRP B;  4HID A;  1YIJ A;  4A3L H;  2NYZ D;  4JVZ A;  5E4W C;  3D31 A;  3HP3 A;  4ME3 A;  3RZD H;  3AB9 A;  2RDH A;  2K52 A;  4R8N A;  4JBM A;  4RH6 A;  3L2P A;  3S1M H;  4DNI A;  5IYB H;  5E1F A;  2R7Z B;  4JC0 A;  5KIX A;  2D0P A;  2VZA A;  1U0L A;  5I9P A;  1QE6 A;  4P72 A;  2UU9 Q;  4HIK A;  4UAI A;  4UY8 C;  1B3Q A;  4LF9 L;  4IUT A;  1K83 H;  5GAE C;  3NWS A;  3U9S A;  3S16 H;  3CKI B;  4DR6 Q;  1HR0 L;  2BDN A;  3K0Y A;  1YJN A;  5FO7 B;  2R93 H;  5FO8 B;  4DV4 Q;  2JA8 B;  2K7V A;  4ZK9 B;  4OXP A;  4A3F H;  1PZK D;  3WWV A;  1L1O B;  5JOB A;  3QWN A;  5G3L D;  1Z9F A;  3VR4 A;  2UXC Q;  1IYJ B;  3WOE A;  1ZYR C;  4PZ7 A;  4DR5 L;  3I4O A;  1STB A;  2K04 A;  4YWL A;  2RVL A;  1TWF H;  2D0O A;  3VR3 A;  2F0G A;  3HOV G;  1YNN D;  3NSW A;  2A6E D;  3NEN A;  3O13 A;  3GV6 A;  2EXD A;  4JK1 C;  1LT4 D;  1A2U A;  4WOR A;  2PQE A;  2PO4 A;  1QCB D;  1MJC A;  4IN3 A;  2XVS A;  4A3I B;  3M7G A;  5AJ3 L;  3KF6 A;  1Q81 C;  4XQJ A;  1EQV A;  4HAE A;  4F8M A;  3AEV A;  4BXX H;  5IOD A;  1V1P B;  1PTO F;  3C1F A;  5JJZ A;  3VR6 A;  2IWH A;  4GLA C;  4KLK A;  3CF5 A;  5BN4 A;  2P5Z X;  1KIX A;  4WFN 3;  1F2L A;  4IUP A;  1VQP A;  1I94 L;  4B3S Q;  3GTG B;  1L2F A;  3CCS A;  1FNW A;  4JI1 L;  2K5Q A;  1B9M A;  1X55 A;  1KNA A;  4MTK A;  4K0K Q;  2UUA L;  3BZD B;  2B2U C;  4GNX A;  3VR5 A;  1I4X A;  1WTH A;  1NJI C;  4M1U B;  1HNZ Q;  1B50 A;  2F0E A;  1TR5 A;  1ASZ A;  1STA A;  1PTO C;  4A93 G;  1VQL A;  2NZH A;  1SJH D;  3CPF A;  5A35 A;  2HUG A;  4DGZ A;  1PFM A;  3HOX G;  1A3V A;  1K3B C;  5A2Q E;  3CC2 A;  4BBS G;  1LLR D;  2O5I C;  4A3K G;  3K7A H;  4DAV A;  1D7Q A;  1D6E C;  2VB3 X;  3X3M A;  4JI0 L;  1GJX A;  3TZU A;  4POG A;  5I6Y A;  4K14 A;  1QUQ A;  5LMU Q;  5IGD A;  3OYY A;  2I5H A;  1V1Q A;  1HTL D;  1KQS A;  3MXP A;  4L63 B;  5D3D A;  3S1N B;  2KEC A;  2ZT9 C;  4HTH A;  4JI5 L;  1EYD A;  3VDY A;  5EGT A;  1SYF A;  3ERQ A;  3GTQ H;  2IHE A;  1GVP A;  1BKB A;  3TRE A;  1G8Z D;  3FMC A;  3BZK A;  4JYA L;  1TT2 A;  2EXZ A;  2OEO A;  4A3D B;  2RQX A;  1TII D;  4Y52 H;  3G6E A;  3I91 A;  3W1G A;  5M9O A;  3K58 A;  1LTG D;  3CW2 C;  4CDF C;  5JAV A;  2H4O A;  3CU7 A;  4LF8 L;  3P7J A;  4NXN L;  4LFA L;  2F0U A;  4FDB A;  4Q0F A;  3HOW G;  4KD3 A;  4HJ7 A;  3JAM i;  2F0L A;  3R2T A;  4KHZ A;  3U9O A;  1EYA A;  2O5J C;  4RGO S;  3J81 i;  2R92 G;  3D4R A;  4B3M L;  4QB4 A;  4JI8 Q;  1R9T B;  2ICI A;  3L3O C;  3LGJ A;  2KA7 A;  4NKL A;  4JI7 Q;  5C0X H;  2JA5 G;  4A3E G;  1W3S A;  3FKI B;  1RJT A;  4RGT A;  3F8T A;  1RD9 D;  4B3T L;  1NE3 A;  5CBA E;  3FPP A;  5CV8 A;  3DEO A;  1XNR Q;  4CJ1 B;  1IBL L;  1BNZ A;  2AQ2 B;  2Z1C A;  1HRJ A;  4A3L G;  1FR3 A;  3CXC A;  3RLF A;  1JR0 D;  1NUC A;  2JA6 H;  2E2I B;  5CV6 A;  4JI2 Q;  5IT9 c;  3D4D A;  2B2V A;  1CZW A;  2DNC A;  4YCU A;  5IYB G;  5M5W H;  3UE1 A;  1QWY A;  3MFY A;  4TRD A;  4JBJ A;  1YNJ C;  4PZ6 A;  1E0B A;  4A3J B;  4NXM L;  2SNS A;  3A5U A;  3ZJY C;  1EIY B;  1S5C D;  5M5X B;  4FF3 A;  3S1Q H;  3HZX A;  4MNO A;  4ODG A;  2DN8 A;  4OGQ C;  1U4L A;  4IUV A;  1SFO H;  1EL0 A;  3SDZ A;  2OTL A;  2CFM A;  2C35 B;  1NY4 A;  4NP5 A;  1X56 A;  1U4P A;  4R4O A;  3E0E A;  3DHQ A;  1HQR D;  1I50 H;  1Z47 A;  2KCM A;  4LF9 Q;  3GTL B;  3DXJ C;  5IWA L;  1VQJ A;  1F9R A;  1HR0 Q;  1WFQ A;  2CH4 W;  4DPG A;  3UDF A;  1SNC A;  1VQI A;  3K6O A;  3TZD A;  1BBW A;  1PRT B;  4HJ8 A;  1TU2 B;  5HGQ A;  1C8C A;  4Y7N B;  3M85 A;  2EIF A;  1P16 A;  2ENB A;  1TWC B;  4H7B A;  3CQZ H;  3DEP A;  4DR5 Q;  1VQ5 A;  1BCP B;  1PFN A;  2SOB A;  3S15 B;  3CCU A;  3NTK A;  4C3H G;  1XPU A;  2F03 A;  1JWU D;  1UAP A;  1B8A A;  4DV1 L;  1U5K A;  2NN6 H;  3AQQ A;  2YYZ A;  3G4S A;  2E2H B;  3GQB A;  2UXD L;  1F2M A;  1DJR D;  3K80 C;  2F3V A;  1GXD C;  2K5N A;  3OIQ A;  5CGK A;  2JA7 B;  2NVQ B;  4QY7 A;  4K5V A;  5JJK A;  1XJV A;  1PTO H;  4UP9 A;  3IL8 A;  4YWM A;  3BU2 A;  5I2Y A;  4FXK C;  3SGI A;  1TS3 A;  1D5M C;  5C3E H;  1HA5 A;  1EFW A;  3C46 A;  4R4Q A;  2Y0S E;  4JV5 Q;  2QGQ A;  2F0O A;  4DXG A;  3DM3 A;  1YNN C;  3HKZ B;  2A6E C;  4GS3 A;  3I3C A;  5M3F H;  3R93 A;  4GLV B;  1I94 Q;  4JI1 Q;  1KRT A;  3PQI A;  1UWV A;  4K8J A;  1HH2 P;  4BY1 H;  3K59 A;  2UXB L;  3HKS A;  5NUC A;  4AIM A;  1Y14 B;  4ZUJ A;  5C4J H;  3ND9 A;  4HJ9 A;  2UUA Q;  1LM0 A;  1Q12 A;  4MTN A;  2KHS A;  4K2L A;  3PO2 B;  4IFD I;  4BS9 A;  3G71 A;  1WCM H;  4WJ4 A;  2VQF L;  1GM5 A;  5DM7 3;  2IHF A;  2RCF A;  5IT9 L;  4XIG S;  4A3C H;  4K8I A;  4DV2 L;  2ZTD A;  4FVM A;  3S1R B;  2JEA I;  2NVX B;  2AQ3 B;  5HUR A;  4JOI A;  3BVG A;  2B2W C;  3PV0 A;  4JI0 Q;  4XYO A;  2QKI C;  2BOS A;  1VQ9 A;  3KF6 B;  1TKW B;  3ITP A;  3HOY B;  4O0A A;  5JJI A;  2I5M X;  2NVT B;  1SYD A;  4C1N I;  1PFB A;  1QIL A;  4V0B A;  1HXY D;  1STH A;  4JI5 Q;  1YNX A;  3EN2 A;  1L0W A;  2HCI A;  5KGU A;  1G2S A;  1PV4 A;  4DV5 L;  5LL6 X;  3P1H A;  1I3Q B;  4BY7 B;  3OMC A;  4JYA Q;  4S3S A;  4QMG A;  4XYQ A;  4DR2 L;  1JOR A;  4CJ0 B;  3HOZ G;  1UNS A;  1EWH A;  5EPJ A;  4A3B B;  1I4Q A;  4LF8 Q;  3SEB A;  4GNX B;  3I2Z A;  1CQV A;  5FLM H;  4NXN Q;  3M4O B;  4LFA Q;  1W6K A;  2LSS A;  1LT6 D;  1SE8 A;  1TWH B;  4IO9 A;  4ZRZ A;  1IYU A;  1JOO A;  1RTN A;  4X62 Q;  2WIN B;  4RGM A;  5C0X G;  3NTH A; 
#chains in the Genus database with same CATH homology
 1SMX A;  2DUD A;  1VQH A;  4WJ3 M;  3AFP A;  4LNQ A;  1YHB A;  1HNX L;  4IJH A;  4A3C G;  1PVO A;  5BR8 L;  2Z6K A;  4B3M Q;  4A3D G;  2K4K A;  4LFC Q;  2GVA A;  2R7Z G;  2A19 A;  1CSQ A;  1S3O A;  1XNQ Q;  2UUB L;  2IY5 B;  4BY7 H;  4KHP Q;  1QUQ B;  3K81 C;  3KOJ A;  3F2D A;  3GO5 A;  4GN5 A;  1N36 Q;  5IYC G;  2JA6 G;  3KDF A;  1E7Z A;  4DR6 L;  4HIO A;  3RZO H;  4NPS A;  5FJ8 H;  2Q2U A;  4DV4 L;  5K36 G;  1PFS A;  3D0F A;  5IP9 G;  2AHO B;  3J7A 5;  2ALY B;  4L5R C;  4MZ9 A;  1IBL Q;  1VQN A;  4IJL A;  1VQB A;  4J15 A;  2Y0S G;  4JI8 L;  4A3B H;  1KL9 A;  1Q7Y C;  3HOW H;  1VQC A;  3GDE A;  3STB C;  2K50 A;  2GN5 A;  2N8N A;  2ZTE A;  4BA1 I;  4DV6 Q;  4JI7 L;  1RL2 A;  4DUZ L;  1PH4 A;  1JT8 A;  1WYD A;  3MEF A;  3J80 i;  3PUW A;  5FLX c;  3PF4 A;  3S24 A;  4AYB E;  2NVY H;  3HKZ E;  4IPH A;  3RLO A;  5GAH C;  1TWH H;  1Y1W H;  2R92 H;  2K5H A;  2KHJ A;  4P74 A;  4DAY B;  3GD7 A;  1K9M C;  1XNR L;  1EYG A;  2JEB I;  3U58 A;  4DAM A;  4DV5 Q;  4EX5 A;  4TVA B;  1GD7 A;  3FKI G;  3OTO L;  4YWK A;  4OWW B;  3CCL A;  3W1B A;  1YBY A;  2JA5 H;  3TS2 A;  2V1C C;  3PF5 A;  2VUM H;  5JEA J;  5FLM G;  1KXL A;  1CSP A;  4IPG A;  4JI2 L;  4YCV A;  1CKN A;  2D62 A;  3KF8 B;  3CCM A;  4JBK A;  4PG3 A;  2ES2 A;  1O7I A;  3IRB A;  4DR1 Q;  3CP0 A;  4UP8 A;  3F2B A;  1EQR A;  1IL2 A;  4LF5 Q;  2DGY A;  2R6G A;  1BVS A;  4O2D A;  4GOP B;  1HZ9 A;  3M3Y H;  1FJG Q;  2WB1 G;  4HID A;  1YIJ A;  2ATW A;  2LXJ A;  4A3L H;  3S15 H;  1YVC A;  2K75 A;  3D31 A;  3F1Z A;  1CKM A;  4ME3 A;  3RZD H;  3CMA A;  2K52 A;  4JBM A;  2R7D A;  3L2P A;  3S1M H;  2Q2T A;  1OXU A;  1Y1V G;  4DNI A;  5IYB H;  5C0X J;  5IWA Q;  2N78 A;  3I4M H;  2E2H H;  4JC0 A;  4A3J G;  4JI6 L;  2D0P A;  2VZA A;  2WFW A;  1U0L A;  1N9W A;  4B3S L;  1N32 L;  4A3G H;  1EQQ A;  2JA7 H;  2NVQ H;  1EIF A;  3Q8D A;  1J5E L;  4C3I H;  4A76 A;  3I7F A;  1YJW A;  4P72 A;  1MIU A;  2UU9 Q;  1QVF A;  4HIK A;  1OXT A;  4UY8 C;  2NN6 G;  4LF9 L;  1K83 H;  1HZC A;  5GAE C;  2VW9 A;  3OW2 A;  2I5L X;  3H0G H;  3S16 H;  1KC8 C;  1G51 A;  1HZA A;  4DR6 Q;  3S2H H;  4L5Q A;  1D8L A;  1HR0 L;  2N49 A;  1GKH A;  1YJN A;  2R93 H;  4DV4 Q;  1PH1 A;  3KFU A;  4OXP A;  4A3F H;  3CAM A;  1C7Y A;  4GKK L;  1IBK Q;  3WWV A;  1L1O B;  2CWP A;  2F4V L;  2YTV A;  4APV A;  4DV1 Q;  5C0X I;  2HHH L;  3I56 A;  1Z9F A;  1N34 Q;  1VQ4 A;  3J81 c;  5ELO A;  2UXD Q;  5C3E G;  1LTL A;  2UXC Q;  1IYJ B;  4OX9 Q;  2UUC L;  4PZ7 A;  1N8R C;  5IYD G;  2VUM G;  3H15 A;  3FHW A;  3I4O A;  3B6Y A;  4DR5 L;  2E5L L;  1L1O C;  4GN4 B;  1OXV A;  4YWL A;  3T1H L;  1PH2 A;  1GO3 E;  1TWF H;  2D0O A;  2H5X A;  4ALP A;  1FGU A;  2VNU D;  5M3F G;  2CKZ B;  3PO2 H;  3TQY A;  3HOV G;  4BBR H;  4BBS H;  5C4X H;  2MO0 A;  1IZ6 A;  1RIP A;  3NEN A;  4DV7 L;  1M1K C;  2EXD A;  1PH6 A;  2QEX A;  1VS0 A;  1KAW A;  1MJC A;  4LF7 Q;  1M90 C;  4DR7 L;  2LXK A;  3KF6 A;  5AJ3 L;  1Q81 C;  2IX1 A;  1E24 A;  4NB3 A;  3AEV A;  2PNH A;  4BXX H;  1X65 A;  2UXB Q;  1NBW A;  2JA7 G;  2IX0 A;  3UE0 A;  1WCM G;  1N33 L;  3BJU A;  4GLA C;  4IOA A;  2GVB A;  4KLK A;  2JE6 I;  4X6A H;  3CF5 A;  3HOY H;  2JK8 A;  4IFD G;  2Q2H A;  2B3G A;  5IP7 H;  4A75 A;  1KIX A;  4P75 A;  3F2C A;  1VQD A;  1VQP A;  1I94 L;  4B3S Q;  1L2F A;  5M5Y H;  2ZM6 L;  3CCS A;  1X6O A;  4L5T A;  4JI1 L;  4LF6 Q;  3H3V I;  2R93 G;  1Q8K A;  2VQF Q;  1I3Q H;  4R4T A;  4AYB G;  4YY3 Q;  3HKZ G;  4A3F G;  2I0Q A;  1X55 A;  3FP9 A;  1KRS A;  2YU9 H;  2BH2 A;  4DV2 Q;  3S2D H;  4K0K Q;  2UUA L;  2RHQ B;  3CD6 A;  2ZJQ A;  2AKW B;  3KJO A;  4DV3 L;  4GNX A;  1PH3 A;  1OXS C;  3PUV A;  1NJI C;  1Q46 A;  1VQ6 A;  2R7F A;  3UDI A;  1H95 A;  1HNZ Q;  1IXR A;  1C0A A;  1ASZ A;  1HR0 W;  4A93 G;  4LF4 L;  1VQL A;  4JI4 Q;  1JJ2 A;  2NZH A;  2OWO A;  3CPF A;  3JC6 6;  3HOX G;  3PO2 G;  4DK3 C;  4X64 Q;  3M4O H;  1KHI A;  1PH5 A;  3CC2 A;  4BBS G;  4BBR G;  1IBM L;  3RLN A;  4DR3 Q;  4AQY Q;  4A3K G;  2KEN A;  1VQF A;  3K7A H;  1D7Q A;  2VS1 A;  4OWX B;  4JI0 L;  2NN6 I;  4POG A;  3GTO H;  4YHH L;  2F3I A;  1QUQ A;  5LMU Q;  4A3E H;  2YTY A;  3OYY A;  1JJG A;  2HT1 A;  3ULJ A;  3GTG H;  2I5H A;  4OO1 I;  1V1Q A;  1KQS A;  4DV0 L;  4JI3 L;  4BXX G;  4DR2 Q;  1HNW Q;  3GTK H;  4B3R Q;  2HIX A;  4GN3 B;  1WI5 A;  4JI5 L;  3VDY A;  4X65 L;  3HOY G;  5IP7 G;  2IHE A;  2PQA B;  3GTQ H;  1GVP A;  1BKB A;  3TRE A;  1QVG A;  1G6P A;  5AJ3 Q;  3T1Y L;  5LMN L;  1SN8 A;  3BZK A;  3J80 c;  4JYA L;  3RN5 A;  4IFD J;  4Y52 H;  3G6E A;  4QIW E;  2VY3 A;  3E9H A;  3G48 A;  4P71 A;  2MO1 A;  3W1G A;  3PO3 H;  4BY7 G;  4LFB Q;  1A63 A;  3A74 A;  4DK6 C;  3CW2 C;  2AWN A;  1XPO A;  3L0O A;  2JA9 A;  1B70 B;  1DGS A;  3NEL A;  1NMF A;  1HNX Q;  2RCN A;  5BR8 Q;  5FJ8 G;  4A3M H;  1XMO L;  1X9N A;  4LF8 L;  4QQB X;  1K3R A;  3TRZ A;  2ASB A;  3RN2 A;  4R1J A;  4IPD A;  1NTG A;  4NXN L;  1Q1E A;  3KLW A;  4DUY L;  2UUB Q;  4C3J H;  4LFA L;  2PI2 E;  4FDB A;  1TXY A;  1WOC A;  1YI2 A;  1YIT A;  1PYS B;  4A3B G;  1K8G A;  3PIP A;  1X54 A;  3HOW G;  3E9I A;  1X3G A;  3JAM i;  4HJ7 A;  1B7Y B;  4DR4 L;  1C9O A;  4KHZ A;  4GOP A;  4JOI C;  3STB D;  1X3F A;  3J81 i;  3UDX A;  3M4Q A;  4DV3 Q;  2R92 G;  1Y1W G;  1XTD A;  4B3M L;  1LYL A;  1I6H H;  3U4V A;  4JI8 Q;  2ZJR A;  3LGJ A;  1XNQ L;  2OTJ A;  4A4I A;  3AFQ A;  4HJ5 A;  1E1O A;  1VQ8 A;  5M3M H;  4JI7 Q;  4PMW A;  2A1A A;  3A0J A;  2JQO A;  4R4I A;  3RR5 A;  4DUZ Q;  4KHP L;  1J6Q A;  1FL0 A;  2JA5 G;  4A3E G;  1W3S A;  4LUO A;  4UP7 A;  2PMZ E;  3F8T A;  2FXQ A;  1N36 L;  4B3T L;  2WP8 J;  1NE3 A;  2E2J H;  1VQ7 A;  4A3D H;  1HZB A;  1YHQ A;  2R7Z H;  1XNR Q;  2NZO A;  2EQS A;  2AMC B;  2MNA A;  1K73 C;  1IBL L;  3KYH C;  3OTO Q;  4A3L G;  4YHH Q;  1SLJ A;  3CXC A;  3RLF A;  3K8A A;  3PGZ A;  1XPR A;  5IYC H;  5C44 H;  2JA6 H;  1JJC B;  2RF4 A;  4JI2 Q;  5IT9 c;  3EIV A;  3GTM H;  1AE2 A;  3HOU H;  1VQE A;  1QVC A;  4YCU A;  4C3H H;  1AE3 A;  5IP9 H;  2MQH A;  5IYB G;  3I4M G;  4LUV A;  5M5W H;  3UE1 A;  3MXN B;  1L1O A;  1V9P A;  3I55 A;  4KI0 A;  4JBJ A;  3K0X A;  4LW1 A;  2PI2 A;  2KHI A;  4PZ6 A;  4NXM L;  3UDG A;  2JA8 H;  3A5U A;  3ZJY C;  4YCW A;  1EIY B;  1A0I A;  3S1Q H;  4MNO A;  1VQG A;  4JV5 L;  3S17 H;  3TEH B;  1R9T H;  3ICE A;  5LMN W;  1TWA H;  1Q86 C;  3CC4 A;  1SFO H;  4JI6 Q;  4DR1 L;  1PYB A;  1UEB A;  2OTL A;  1A62 A;  1G29 1;  2CFM A;  2Z6K C;  2C35 B;  4LF5 L;  3KDF B;  3H0G G;  5IE8 A;  1NY4 A;  3FKI H;  3CCE A;  1FJG L;  4LWC A;  1N32 Q;  2OCE A;  3NBH B;  1J5E Q;  1X56 A;  1AH9 A;  1OTC A;  2YV5 A;  4R4O A;  1YZ6 A;  3E0E A;  4OWT B;  3H3V H;  5J3B A;  2L15 A;  1JE5 A;  2IT1 A;  3ULL A;  1I50 H;  1Z47 A;  2HIV A;  2KCM A;  4LF9 Q;  5IWA L;  5EAY A;  4GNX C;  1VQJ A;  2WAQ E;  1WJJ A;  2E2I H;  4GKJ L;  1HR0 Q;  3PUY A;  1WFQ A;  4BA2 I;  4DPG A;  1PH8 A;  3UDF A;  4H02 A;  1VQI A;  2K5V A;  5H1S E;  1S72 A;  4GKK Q;  1BBW A;  3PUX A;  5E7N A;  2E8G A;  1V43 A;  4QL5 A;  4QJF A;  4HJ8 A;  4A3I H;  2UU9 L;  2F4V Q;  5HGQ A;  2HHH Q;  1Y1V H;  5HY6 A;  3M85 A;  2XGT A;  2KCT A;  1K8A C;  1P8L A;  2EIF A;  3J7Z C;  1P16 A;  5GRO A;  3HFZ B;  4RMF A;  4A3J H;  3S14 H;  1E3P A;  5C4X G;  2UUC Q;  3CQZ H;  4B3T Q;  5M5X H;  5C44 G;  4DR5 Q;  1VQ5 A;  1CKN B;  2E5L Q;  1W2B A;  3CCU A;  3T1H Q;  3HOU G;  1Q1B A;  1KD1 C;  2CQO A;  2N3S A;  3M7N A;  1XPU A;  1IBK L;  3L7Z C;  2AWO A;  1B8A A;  2KBN A;  4DV1 L;  1U5K A;  3AQQ A;  5GAD C;  2BH8 A;  1E1T A;  2YYZ A;  3G4S A;  2OQ0 A;  1N34 L;  3ERS X;  2JA8 G;  4HJA A;  2YTX A;  1FVI A;  2OQK A;  3K80 C;  4DV7 Q;  4IOC A;  1QZG A;  4OX9 L;  2CCZ A;  2UXC L;  4X66 L;  1SRO A;  2K5N A;  2QA4 A;  3U4Z A;  4QY7 A;  3NEM A;  5JJK A;  3GTL H;  1XJV A;  4UP9 A;  3ER0 A;  3CCQ A;  4DR7 Q;  3KJP A;  1I5F A;  3GTJ H;  4YWM A;  1A8V A;  1YEZ A;  3BU2 A;  1QZH A;  1PHJ A;  2JJQ A;  2NVT H;  3SGI A;  4IPC A;  2HQL A;  4NXM Q;  5C3E H;  1N33 Q;  1VQM A;  1EFW A;  4LUZ A;  4R4Q A;  1VQO A;  5IYD H;  3J81 j;  2Y0S E;  1HJP A;  2Q2I A;  4JV5 Q;  2QGQ A;  3AYH B;  2VQE L;  4Y7N H;  1TWG H;  3DM3 A;  5GQO A;  4GS3 A;  5M3F H;  1Q82 C;  4LF7 L;  1TWC H;  4GLX A;  3CC7 A;  1I94 Q;  4GLV B;  4JCV E;  1VCI A;  2ZM6 Q;  3ULP A;  2B29 A;  3HOV H;  3PCO B;  1KRT A;  4JI1 Q;  3I4N H;  5JJL A;  4QGU A;  1UWV A;  1VQA A;  1HH2 P;  1PH9 A;  4BY1 H;  2UXB L;  3HKS A;  2VL6 A;  4AIM A;  3HOZ H;  1Y14 B;  3CME A;  4A3I G;  4X62 L;  1XMQ L;  4GOP C;  3PIO A;  5IY0 A;  5C4J H;  4PZ8 A;  4HJ9 A;  2UUA Q;  1SR3 A;  1LM0 A;  1Q12 A;  3GTP H;  2PQA A;  4MTN A;  2B63 H;  4GKJ Q;  3U50 C;  1SRU A;  3S1N H;  1S40 A;  4LFC L;  4LF6 L;  4IFD I;  3TS0 A;  2K14 A;  3G71 A;  3RNU A;  1WCM H;  4WJ4 A;  2VQF L;  2MFI A;  1GM5 A;  4UPA A;  4LF4 Q;  1EOV A;  2IHF A;  2WB1 E;  2Z0S A;  1LUZ A;  4YY3 L;  4R4C A;  2RHS B;  1NMG A;  1EWI A;  4JBW A;  4XIG S;  4L5S A;  4A3C H;  4DV2 L;  4RG1 A;  4K0K L;  3W5O A;  2ZTD A;  1IBM Q;  2BA1 A;  2JEA I;  1MKH A;  1YHA A;  4AH6 A;  2BA0 A;  4OO1 G;  4JG2 A;  1T9H A;  1UE1 A;  3M4P A;  4JOI A;  4POF A;  3PV0 A;  4JI0 Q;  1HNZ L;  3BZC A;  4XTC S;  1VQ9 A;  3JAM c;  3KF6 B;  4DV6 L;  4JI4 L;  4O0A A;  5DLQ E;  2I5M X;  5JJI A;  1PH7 A;  4DV0 Q;  4X64 L;  4JI3 Q;  2CWA A;  3A5Z B;  1X3E A;  3PUZ A;  1JMC A;  4X66 Q;  4JI5 Q;  1YNX A;  3EN2 A;  1L0W A;  4DR3 L;  1ASY A;  1E22 A;  4AQY L;  3PO3 G;  4X65 Q;  1PV4 A;  4DV5 L;  1EUJ A;  4A93 H;  3CCR A;  1YJ9 A;  4OON A;  3T1Y Q;  5LMN Q;  1VQK A;  1UE5 A;  3HOX H;  5LMU L;  4A3M G;  1CUK A;  1JB7 A;  4JYA Q;  1PA6 A;  4DKA C;  2WAQ G;  3K7U C;  3I4N G;  3M9B A;  4DR2 L;  4BY1 G;  5ELN A;  5JEA G;  4A3K H;  1HNW L;  4TQU S;  4B3R L;  1OXX K;  1UE6 A;  2VQE Q;  1BBU A;  3PSI A;  3CCV A;  3HOZ G;  1CKO A;  1UE7 A;  2ZJP A;  4A3G G;  4EQ5 A;  1XMO Q;  4LF8 Q;  4GNX B;  3I2Z A;  2F52 A;  3S1R H;  2NVX H;  5FLM H;  2B63 G;  2A8V A;  1MJE A;  4NXN Q;  4LFA Q;  2ID0 A;  4DUY Q;  2UXD L;  5GAG C;  2LSS A;  3DLL A;  3CPW A;  1SE8 A;  4IO9 A;  3EBE A;  4P73 A;  4DR4 Q;  5M3M G;  4C2M H;  4LFB L;  4X62 Q;  2XTI A;  1K0R A;  1XMQ Q;  4HIM A;  5C0X G;  3CCJ A;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...