2UXBQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxbQ00
3PV0A 4OXPA 4OWWB 4XIGS 1RL2A 3S17H 2BH2A 3J80i 5JJLA 4MNOA 4JI5L 5FLMG 3J81c 4QY7A 5FJ8G 4B3RQ 1YI2A 1PH2A 1K3RA 2ZM6Q 3CXCA 2K50A 3K0XA 4DNIA 1A63A 4A3EG 3GDEA 3FKIH 1UE5A 2PI2E 5M3MG 4A3JG 2AMCB 3H0GG 4LF9Q 4YCVA 4YCWA 2JA5G 3RN5A 4L5RC 2OTJA 2N78A 3GTPH 1JT8A 4LF8Q 1X55A 1I50H 1AH9A 1WYDA 3I4NH 4A3BG 1IBLQ 4DR4Q 1K83H 2E5LQ 4A3CH 2ALYB 3AYHB 1VQFA 2B29A 2IHEA 3PIOA 4IJHA 4TVAB 4JV5L 2ZJRA 1QUQB 1HNWQ 1G6PA 1KIXA 1NE3A 4DV0L 1YITA 1QVGA 2IY5B 4JI6Q 1N9WA 1ASZA 5FJ8H 3AQQA 4UY8C 3T1YL 2MO1A 1SMXA 2PI2A 4DAYB 5HY6A 2BA0A 2UXCL 2AWOA 3EN2A 4JI0Q 3S1RH 2JK8A 2YU9H 1SN8A 5IP7G 2VL6A 4A3EH 3Q8DA 3BZCA 1HZAA 1L0WA 5M3MH 3I4MH 1IBKL 2JA5H 2VQEL 2IX0A 2NN6I 1HNXL 2YTVA 4P72A 1I3QH 3JAMc 3PO3G 3PF5A 1YVCA 3GTQH 1VQIA 2Q2IA 2KCMA 1NY4A 1VQ4A 3F8TA 3CC7A 4K0KL 1I6HH 4JYAQ 4PG3A 2PQAA 4LNQA 2HQLA 3A5UA 1PH4A 3RLFA 1X3GA 1T9HA 4R4QA 1M90C 1IXRA 5JJIA 1WCMG 1QVCA 5M3FG 4POGA 2JA9A 1AE3A 4R4CA 3RN2A 4JI5Q 1VQJA 3NENA 4DUZL 3HOVH 4X64Q 4A3IG 4IPHA 1XPOA 1HNZL 3CPWA 4APVA 4B3TQ 4BXXG 2LSSA 2CFMA 3K80C 5H1SE 1A62A 3KF6A 4GN5A 4BA2I 1MJEA 4IFDJ 1VQPA 3TRZA 3PSIA 2H5XA 3HKZE 1PFSA 5GROA 1MIUA 4GNXB 3SGIA 1TWGH 1PV4A 3B6YA 4BBRH 2NVYH 3PUYA 4HIMA 4A3KH 1Q82C 2B63G 2R7FA 2K52A 3E9IA 4DV6L 4JV5Q 3UE1A 3A0JA 1VQ7A 1IYJB 1Q1BA 3F2CA 5M3FH 4DV0Q 1JMCA 1N32L 3OW2A 3JC66 5BR8L 2RCNA 1Q8KA 1Q7YC 1MKHA 1TXYA 1PH3A 1YHAA 4GNXC 3IRBA 3OYYA 1O7IA 2UXCQ 3FHWA 2WFWA 4R4OA 4L5SA 1P8LA 1FGUA 3I4OA 1PA6A 2VUMH 4BXXH 1YHQA 1YHBA 3J80c 2QA4A 1PH8A 1IBKQ 4A3GH 1XPUA 2BA1A 3CC2A 1HNXQ 1J5EL 1XMQL 2CQOA 1L1OB 4UP7A 4DR7L 3M4PA 5E7NA 1Y1VH 1K73C 4A93H 4JI7L 5C4JH 3S16H 2I5HA 4L5QA 3CMAA 4LUOA 1IBLL 3K81C 4DR4L 2JEAI 1SRUA 3PUVA 5IYBH 4DUZQ 5GADC 2JE6I 2ZTEA 3CQZH 1EIFA 4RMFA 1PH9A 4BY7H 1HNWL 1WFQA 1GM5A 3UDIA 4JI6L 1KRSA 3BZKA 2Z0SA 4H02A 1SE8A 4YHHQ 2WAQG 3EBEA 1BKBA 1QVFA 3M4OH 1E24A 4UPAA 4JI0L 5FLXc 4JCVE 2R92G 2CWAA 3J81j 1E22A 4DR3L 1OXSC 4DUYQ 1WI5A 1X3FA 3CPFA 4DV7Q 1WJJA 1L2FA 1QUQA 1TWAH 4AIMA 4X65L 2L15A 2WP8J 2Z6KC 4JI3L 4DV6Q 1PH7A 1C7YA 3CD6A 3I4NG 3U4ZA 2B3GA 4DAMA 2UXDL 1VQOA 1A8VA 3HFZB 5BR8Q 1QZHA 4B3ML 1UWVA 1X56A 3KDFB 3HOXH 3KOJA 4OONA 5IY0A 1NJIC 3HOWH 1OXUA 2HT1A 3I7FA 4B3SL 4A3LH 3PO2H 1HZ9A 1Q46A 3NEMA 1IZ6A 2Q2HA 4R1JA 4X64L 4GKJL 2R92H 1EWIA 2D0PA 3L7ZC 1J5EQ 1XMQQ 2UUBL 4B3TL 4WJ3M 4YY3L 4DR7Q 4LUZA 5IYCH 1YBYA 4GS3A 1Y14B 2XTIA 3I4MG 3TREA 5IT9c 4DR2L 4JI7Q 4HIOA 4JOIA 1EOVA 2AHOB 4IJLA 1KQSA 2YV5A 5M5XH 1EFWA 5M5WH 1X3EA 3GTKH 4GOPC 2V1CC 3PUXA 4R4IA 2Q2UA 2RHQB 5ELOA 4YCUA 2Y0SE 2ATWA 2VS1A 4DR6Q 1D7QA 1HR0Q 3L2PA 3H3VH 3K7UC 4P75A 4AH6A 1OXXK 1Z9FA 2ES2A 3S1QH 1VQGA 3NBHB 4BY1H 3HOVG 1N36Q 2JA7H 2E2HH 3U4VA 4GNXA 2JA6G 2LXJA 2MFIA 3CMEA 1K8AC 1U0LA 1VQ9A 4DV4L 4DR3Q 1TWCH 1VQHA 2E2IH 3RR5A 4A3MG 4XTCS 4A75A 1TWHH 4RG1A 3M3YH 2BH8A 4MTNA 3STBC 4X65Q 1XPRA 1PYBA 4JI3Q 3ICEA 3S1MH 4HJ7A 2UXDQ 3D31A 2F52A 5C44H 4BBRG 1AE2A 2QEXA 4A3KG 2ZJQA 3PGZA 4B3MQ 1CSPA 4HJAA 2NZOA 3ER0A 1KL9A 2NVQH 1D8LA 5M5YH 4JI1Q 2AWNA 3FP9A 3M4QA 1J6QA 3CCSA 1N8RC 4FDBA 3TEHB 4B3SQ 3W1GA 3L0OA 1CKMA 3DLLA 2KENA 3MEFA 1L1OA 2JA6H 4IPGA 2EXDA 1HR0W 4GKJQ 5C0XG 1JJGA 2UUBQ 4LF4Q 1YIJA 2EIFA 2CWPA 3STBD 2YYZA 4YY3Q 4YHHL 1CSQA 3CCJA 2VUMG 5K36G 1B7YB 1UE7A 4A3FG 4A3MH 2OQKA 4A3GG 3CCVA 3ZJYC 4DV5Q 4DR2Q 4JI4Q 1VQLA 2E2JH 4X66Q 2ZTDA 2EQSA 4NXNL 4KHZA 2YTYA 3MXNB 4DUYL 2R93G 1Y1VG 4A3DH 3CC4A 4DV7L 4NXMQ 3HOZH 3HKSA 1PYSB 3PCOB 4A93G 1KXLA 4OX9L 4LUVA 2I0QA 4LFCL 1SLJA 2LXKA 1EYGA 5IWAL 3J7A5 5JEAJ 1KAWA 1EIYB 4EQ5A 3K8AA 4UP8A 5IYBG 3RZDH 4MZ9A 5C4XH 3ERSX 4QIWE 1YJ9A 2C35B 3HOYH 4BY7G 2UUCL 4BBSG 2I5LX 4A3FH 4DV4Q 5IE8A 2NVXH 4PMWA 3BU2A 1LM0A 1Q12A 5LMUL 3HKZG 1SFOH 1K8GA 3U58A 2WB1E 2A19A 4LW1A 1OTCA 3PUZA 4DV1L 4PZ8A 2R93H 2MO0A 2K4KA 1GO3E 2VQFL 1EQQA 3KDFA 4DPGA 4Y7NH 1JE5A 1VCIA 2VW9A 3G4SA 2MQHA 3CCEA 1PH5A 4GKKQ 4R4TA 2I5MX 5DLQE 1YZ6A 1KRTA 2PMZE 4PZ6A 3S14H 3TS2A 1Q86C 2UU9L 4OO1G 2UXBL 3G48A 4DR6L 4P74A 3HOXG 3HOWG 1HR0L 1P16A 1C9OA 2A1AA 1CKNB 1Z47A 3DM3A 4BBSH 1HZBA 3H15A 4POFA 3KLWA 1B70B 2JQOA 4A3LG 3PO2G 1N36L 3CP0A 3AFPA 3ULJA 3CCRA 3RLNA 1NTGA 5LMNW 4NXNQ 2HIXA 2K5HA 5IYCG 1EQRA 1XJVA 3LGJA 3PIPA 4ALPA 4IPDA 2KBNA 1W3SA 3OTOQ 4GN3B 3GTJH 3BJUA 4OWXB 2F3IA 2Q2TA 4LFCQ 4KLKA 2DUDA 5IWAQ 1Y1WH 4NB3A 4IFDG 4AYBE 2VNUD 2PNHA 1Q1EA 1OXTA 3CCQA 2UUAQ 2IX1A 4AQYL 1NBWA 5ELNA 4DV3Q 2OTLA 1VQNA 4JI1L 4IO9A 1JJCB 3UE0A 2N49A 3CW2C 1CKOA 2AKWB 2UUCQ 1VQ5A 1S40A 3S2DH 3HOUH 3S15H 1E1TA 3RNUA 4GOPB 4BY1G 3CF5A 3J7ZC 1JB7A 5LMUQ 2JA7G 3KF8B 5IYDH 4LF4L 3T1HQ 4YWMA 2D62A 1LTLA 4JG2A 4Y52H 4DV1Q 1RIPA 4JI8L 1WOCA 1X54A 4O0AA 2HIVA 4C3IH 2VQFQ 4KHPL 5JJKA 2K75A 1VS0A 2RF4A 4DV5L 4JI4L 1KHIA 1BVSA 5EAYA 4X66L 4GLXA 3UDGA 3K7AH 1XNQQ 4LF6L 4LFAL 2JJQA 1YNXA 3WWVA 2HHHQ 1YJWA 5C44G 2OWOA 4NXML 4GN4B 1N33L 2VY3A 1W2BA 2UU9Q 1B8AA 2GVAA 1PVOA 2UXBQ 4NPSA 4QQBX 4L5TA 5AJ3Q 4YWKA 3VDYA 4HJ5A 3CAMA 3I55A 1VQDA 2DGYA 1CUKA 1GKHA 5GAHC 3RZOH 4UP9A 3RLOA 5GAGC 1XNRQ 3I56A 5LMNL 4QL5A 2YTXA 2ZJPA 1LUZA 1Q81C 1GD7A 4P71A 5C0XI 5HGQA 3A74A 4DR1Q 1BBUA 2CCZA 4WJ4A 4ME3A 1N34L 3S24A 2ID0A 1IBMQ 3U50C 4HJ9A 3CCLA 1VQ6A 1E7ZA 2F4VQ 1NMGA 1VQCA 3KYHC 4HIDA 4HJ8A 4DR5Q 1FVIA 3TS0A 3G6EA 4OX9Q 4A3DG 4JBMA 3HOZG 2Y0SG 3W1BA 4AQYQ 2QGQA 5FLMH 1QZGA 1IL2A 4GKKL 3AEVA 4LF7Q 4DV2Q 1H95A 5GQOA 3M9BA 1UEBA 1A0IA 1ASYA 1XMOL 4X62L 4A3JH 1UE1A 2KCTA 3GD7A 3H0GH 5C4XG 1E3PA 1I94L 2CKZB 3HOYG 4LF5Q 2KHJA 4JI8Q 4GLAC 4KHPQ 4A3BH 1HJPA 1YEZA 2JEBI 4LFBL 5IP9G 1DGSA 4LF6Q 1FJGL 3I2ZA 4LFAQ 2N8NA 4C3JH 1N33Q 1U5KA 4QJFA 3OTOL 1G51A 3J81i 1VQMA 2R7ZG 1CKNA 2ASBA 4O2DA 2Z6KA 4DK6C 1SR3A 2K14A 4GLVB 3F1ZA 3M85A 5IP7H 3NELA 2UUAL 2N3SA 2FXQA 1E1OA 3EIVA 1HH2P 4P73A 4DV3L 1VQEA 2NN6G 4JI2L 4OO1I 2IT1A 4IOCA 1UE6A 3D0FA 4JC0A 3A5ZB 3KJOA 4YWLA 5LMNQ 4JOIC 3PO3H 1X65A 4A4IA 3CCUA 1N34Q 1PH6A 1VQKA 1EUJA 1GVPA 1OXVA 5IP9H 3T1HL 3UDXA 1TWFH 3CCMA 1PH1A 2K5NA 5C3EG 4DK3C 1V43A 1K9MC 1KC8C 1WCMH 2KHIA 1JJ2A 2R7ZH 3KFUA 1K0RA 1XTDA 2E8GA 1VQ8A 1XNQL 3S1NH 1S72A 2IHFA 3T1YQ 4A3IH 1X9NA 2HHHL 3M7NA 1V1QA 4JBJA 1Y1WG 1HZCA 4GOPA 2PQAB 3AFQA 1XMOQ 4KI0A 4PZ7A 3GTGH 3TQYA 4X62Q 1KD1C 1G291 2VZAA 4JBKA 4IFDI 3GTLH 1I94Q 4B3RL 3JAMi 5AJ3L 1FL0A 2WAQE 2OCEA 4J15A 3UDFA 2ZM6L 2VQEQ 1M1KC 2A8VA 2JA8G 2OQ0A 3H3VI 3HOUG 3GTOH 4X6AH 2ZTCA 1XNRL 2WB1G 1I5FA 5IYDG 3GTMH 1V9PA 2D0OA 4LF9L 2RHSB 2B63H 3G71A 1S3OA 4LFBQ 3KF6B 2GVBA 4JBWA 4C2MH 5C3EH 3F2DA 4DR1L 5J3BA 4LF8L 3PUWA 1FJGQ 4IOAA 4K0KQ 4QGUA 3GO5A 1IBML 3S2HH 4C3HH 4EX5A 2E5LL 1BBWA 3F2BA 4A76A 4TQUS 4IPCA 2F4VL 1LYLA 1L1OC 4DKAC 1VQAA 4DR5L 3E0EA 1HNZQ 3W5OA 4JI2Q 2NVTH 2NZHA 2MNAA 1VQBA 4BA1I 1C0AA 1X6OA 4LF7L 4DV2L 1SROA 3ULPA 2K5VA 2JA8H 3ULLA 1NMFA 3E9HA 1YJNA 2GN5A 2R7DA 3KJPA 3FKIG 5JEAG 4LF5L 3PF4A 2R6GA 5GAEC 4LWCA 1PHJA 1R9TH 5C0XJ 4OWTB 1N32Q 4A3CG 1MJCA 4HIKA 4JYAL 2XGTA 4AYBG
chains in the Genus database with same CATH superfamily
2XRSD 3PV0A 4NP5A 3S17H 4M8AA 1K0SA 1CHPD 3HOWB 5FJ8G 1BO0A 1UNSA 4JK1C 2EOTA 2NTSA 3K0XA 3S15B 4K8IA 4YCWA 2JA5G 3SXHA 2EY1A 3NQIA 3KK7A 3T53B 1WYDA 1MHWC 2E5LQ 4A3CH 3AYHB 2B29A 4IUQA 2K5DA 2MHVA 4G4KA 2MP1A 1NE3A 4DV0L 1QVGA 2IY5B 3IAYA 2E76C 1Q8IA 2MO1A 2F0QA 4GZYC 1IL8A 4ZK9B 2UXCL 1GUNA 2YU9H 2IW3A 1E2WA 4BY1B 3I4MH 1SEBD 3RZOB 3T13A 2IX0A 4HSVA 1QCBD 3PO3G 2BE5C 2E2IB 1VQ4A 1HPCA 3BVZA 5A35A 2HQLA 2K01A 1PH4A 3RLFA 1M90C 2E2DC 1WCMG 1QVCA 4FXKC 5M3FG 1HRJA 1AE3A 1LTRD 3GP7A 5M5YB 4X64Q 1XPOA 1EOTA 5FKAC 1HNZL 3AB9A 3CPWA 1LTSD 5KNDA 3K80C 1O7ZA 4K5XA 3CHBD 1VQPA 3TRZA 2NB0A 1F9QA 1PV4A 2PQEA 3B6YA 3NTHA 1Q82C 4DFAA 3E9IA 4DV6L 3R3OA 3UE1A 2HD3A 2F0TA 3F2CA 1VF7A 4CDDC 2Y0SB 4DV0Q 1JMCA 4L63B 5BR8L 1D6EC 1IYUA 4G7OC 1TXYA 1PH3A 4CKCA 1YHAA 2UXCQ 1PYWD 2DJGC 5K36H 1OO9B 4BXXH 1YHQA 1YHBA 2BA1A 3CC2A 4DN4M 2DNEA 1BXTA 1Y1VH 1X3QA 3EA6A 2EY2A 4KN4C 4A93H 4XT3B 3O13A 1IBLL 4DR4L 2FHTA 1TS5A 2R7ZB 3EVQA 2ZTEA 1LT3D 1HNWL 5IODA 1GM5A 4JI6L 2XWJB 1G2TA 5IGGA 2Z0SA 3EBEA 4NW2A 1ILPA 1E24A 2EYMA 5A2QL 2R92G 3J81j 3GTOB 4DUYQ 2A73B 1X3FA 2V4DA 1WJJA 1F2MA 2K1BA 4X65L 5C3EB 4DV6Q 2Z6KC 3C46A 4OX9Q 3CD6A 3DM1A 1NCVA 1NR4A 4K8JA 1VQOA 3HFZB 5BR8Q 1GUWA 1UWVA 1X56A 3RUZA 3HOWH 1LABA 3I7FA 1BQQT 4RH6A 5E1FA 4QIWB 2J7ZA 1J8IA 4A3LH 5FLXE 2OXPA 1Q46A 3NEMA 4R1JA 4KK7A 4DF7A 1CK1A 3LWUA 5G3LD 3QIAA 2XSCA 3J7AV 5IYCH 3I4MG 1Y14B 1QB5D 3TREA 4JOIA 1PRTB 1IHZA 4L8JA 5M5WH 1XWEA 4GOPC 4HCSA 2R3ZA 2V1CC 4YCUA 2Y0SE 4DR6Q 2VS1A 1B2TA 2SOBA 4BY1H 4HCEA 2F0HA 2H1EA 3DMUA 1K8AC 2E2IH 1KDAA 4M1UB 3RR5A 4A3MG 5JJZA 1TY2A 2XVSA 4X65Q 1XPRA 3ICEA 4H7BA 2A68C 4HJ7A 3D31A 4OHJA 2IPKD 2ZJQA 4LK1C 1XX8A 3M4YA 1WTQA 1D8LA 5M5YH 4FDBA 3TEHB 1Y8OB 3W1GA 3DLLA 4CDFC 2ZXOA 4MTKA 1SBBB 2CWPA 3STBD 5K36G 1K8OA 5CV7A 3CCVA 3ZJYC 1PFBA 1JB3A 1I3QB 4RCOA 2EQSA 4NXNL 3G6JB 2B8FA 3MXNB 1Y1VG 1IKMA 2B2UC 1KLGD 3CC4A 1BCPD 4A93G 1G91A 3BDCA 1I6HB 4LFCL 1EYGA 3BYYB 4K5VA 4QIWE 2C35B 3DXJC 4OL7A 2UUCL 2B39A 3I3CA 1DD2A 4EQPA 1SFOH 1K8GA 2A19A 1OTCA 4DV1L 3V2TA 2R93H 2MO0A 2XRQD 1EQQA 1TWGB 4DPGA 2NVYB 1VCIA 4PZ6A 3TS2A 1Q86C 3L3OC 4IURA 2UXBL 4FF1A 4A3IB 3HOWG 4BBSH 1HZBA 3KLWA 4A3LG 3NWTA 1LT5D 1CTMA 2ENBA 1ESRA 4DXFA 1NTGA 3FPUB 5LMNW 3I91A 4NXNQ 5IYCG 3DEOA 3LGJA 2KA7A 5LHY1 1W3SA 4RKLA 3S16B 3BJUA 4OWXB 2F3IA 4LFCQ 1TR5A 2RSOA 4KLKA 2C9OA 1DONA 1CM9A 2D9UA 1DXMA 4AQYL 5ELNA 4JI1L 2B8GA 2WIIB 1CKOA 2AKWB 3BDLA 2UUCQ 1Q3LA 3S2DH 4B08A 3R2IA 3P1HA 4BY1G 5IYDH 1RHPA 3KF8B 4LF4L 1PZKD 4DV1Q 2K75A 4WRDA 3U9SA 1CQVA 4JI4L 1BVSA 4O1NA 2WACA 4X66L 5CV6A 2HHHQ 1YJWA 4NXML 1EZ8A 2VY3A 4Q0FA 1B8AA 2UXBQ 4O42A 2NWGA 3DEPA 3D4RA 3VDYA 4IZ8A 1B44D 4KN7C 1XNRQ 1LTAD 3MXNA 2ZJPA 5LMNL 1Q81C 2EYHA 1GD7A 4DR1Q 1Q90A 1AP0A 4WJ4A 5CC4A 2Z8LA 4Q5VA 1VQ6A 2ID0A 2RDFA 3GTPB 1I50B 1NMGA 3M7GA 1VQCA 4ULLA 3KYHC 4HIDA 1FVIA 4JBMA 2Y0SG 4AQYQ 5FLMH 1IL2A 4LF7Q 4DV2Q 1PZID 4QUCA 1UEBA 4X62L 1UE1A 3GD7A 2O5IC 3W2DA 2A68D 1EY6A 5D3DA 1TIID 1S5ED 4FXDA 1PTOD 1HJPA 1YEZA 4RGOS 4CJ1B 1KAAA 1A6XA 3GTQB 2RDGA 2OEOA 1STAA 1TY0A 1D5XC 2NTTA 2R7ZG 2X6LA 1DOMA 2CVRA 2KJXA 4BWGB 5BN3A 4XQNA 5IGFA 3JAML 3MXGA 3T51B 4CJ0B 5IGEA 4DV3L 1HH2P 2K7VA 4QB4A 2NN6G 2IT1A 4IOCA 2JA6B 1TKWB 3KJOA 1AW7A 5LMNQ 1EQTA 1PH6A 5IP9H 1OXVA 3UDXA 3CCMA 1RD9D 5ISRA 5C3EG 4I7ZC 1KC8C 4BBRB 1E2ZA 1RCVD 4A3KB 4KTAA 5CBAE 3KFUA 1K0RA 4N9TA 4I65A 4A3IH 4JBJA 1EYCA 4TKOB 5A2QE 1QNKA 4KI0A 4PZ7A 3VR3A 3KF8A 1C8CA 4X62Q 3BZDB 2VZAA 3JAMi 2OCEA 3I90A 3UDFA 2OQ0A 2DY8A 3H3VI 4TRDA 2NVXB 3GTMH 1I5FA 5IYDG 3MFGA 4LF9L 3NHHA 2DJFC 1LT6D 3SVMA 3PUWA 1PFNA 1T5XD 2Z1CA 1XYIA 5CV9A 1BBWA 4A76A 1LYLA 4DKAC 1GUGA 2NZHA 2MNAA 1VQBA 4N9PA 1SROA 3ULLA 2E75C 2KVMA 2F3WA 3HKZB 2BOSA 3GV6A 2VXWA 3SK6A 2PO4A 5C0XJ 1N32Q 1TWAB 5FLXc 4OXPA 1KLUD 4K5WA 2JSOA 5FLMG 3HOXB 4QY7A 1PH2A 5BN5A 5CYUA 1A63A 3GDEA 3FKIH 1UE5A 2PI2E 4IUVA 2AMCB 1WTWA 4YCVA 1JQYD 4LF9Q 2OTJA 3GTPH 2F0IA 1X55A 1I50H 5M9OA 3QB3A 3URYA 1NUCA 1SNQA 4KD4A 3QR8A 1K83H 5ELCA 2A6ED 2ALYB 4OIJA 1PFMA 4IJHA 1YNND 1TQOA 4JV5L 1ASZA 3VYRA 2RDHA 5FJ8H 4UY8C 1QE6A 2PI2A 2BA0A 3OPOA 4JI0Q 3S1RH 2JK8A 1H9SB 2N88A 2VL6A 3BZCA 2JA5H 2JA7B 3FDTA 3K0YA 1HNXL 2YTVA 1T5EA 4P72A 1S5FD 3GTQH 2KCMA 1NY4A 3EQLC 3M3YB 3CC7A 2KHSA 3A5UA 1T9HA 4DGZA 4KMUC 3VA5A 2A5HA 1SYBA 2I07B 3RN2A 1S5BD 3HG9A 4R8NA 2I46A 2NYZD 4IPHA 4A3IG 2P5ZX 4APVA 1S5CD 2CFMA 5J1ZA 1PDQA 4GN5A 4IFDJ 3PMFA 1CA6A 2LFNA 2H5XA 2N55A 1STHA 3HKZE 1PFSA 4ZAIA 2RKSA 3SK8A 3SGIA 2JYOA 4BBRH 3VA7A 4A3KH 4HIMA 4F87A 1JOQA 4JV5Q 3A0JA 5M3FH 1ONLA 4FNFA 3MXPA 2BDOA 3ND9A 3H94A 1EL0A 4HEDA 1MKHA 2F0WA 4GNXC 3IRBA 5C0XH 1O7IA 5ELFA 3VR4A 2WFWA 1DJRD 4L5SA 2J0TD 1FGUA 3I4OA 3A56A 4C1NI 1XPUA 5KYIA 1HNXQ 2SDFA 1L1OB 4DR7L 5E7NA 2F3VA 1K73C 1WD0A 2I5HA 3CMAA 3WOEA 4Y7NB 1U4RA 4P2CB 1SRUA 3PUVA 5IYBH 3EJIA 1HTLD 4RMFA 5KNCA 2HUGA 5KEEA 1KRSA 3I70A 4UPAA 2K03A 4IUUA 1CQFA 2KCNA 5EPJA 2RQXA 1ZKOA 3CPFA 2KEDA 4DV7Q 1B3AA 1TWAH 1BNZA 1C7YA 4C2MB 4JI3L 4ZUIA 2UXDL 1C4QA 3GTJB 3KDFB 3HOXH 5IY0A 1OXUA 3KLSA 4CJ2C 4F88A 1Y1WB 2HT1A 2WKDA 4RGMA 1IZ6A 2Q2HA 4X64L 3NXWA 3A54A 2R92H 2D0PA 4CHTB 3HOUB 4WJ3M 4YY3L 4DR7Q 2XTIA 3A8JE 1U4LA 4YIJA 3OMGA 5E4WC 1EOVA 1D1KA 2F0SA 3IKJA 3I4LA 1X3EA 3IFDA 4IFDH 2Q2UA 3K7AB 2ATWA 1D7QA 1A3TA 4J1MA 2EJMA 2SNMA 2B2WC 4AH6A 1Z9FA 2ES2A 1BUVT 2QDBA 1N36Q 2JA7H 3U4VA 4H13C 2EZVA 2JA6G 1HXYD 2K6AA 2LXJA 1AZPA 1C48A 3CMEA 3KLRA 4DV4L 1GUSA 5EGTA 1VQHA 4IUPA 4A75A 1SYDA 4RG1A 3M3YH 3STBC 4JI3Q 2UXDQ 4TSSA 4BBRG 3JAME 4A3KG 3PGZA 3OIQA 4HJAA 4AYBB 1JOKA 2AWNA 3CCSA 3TZUA 1LV9A 2F0PA 1BCPC 1L1OA 3MFYA 1SE2A 5C0XG 1YIJA 4YY3Q 4A3EB 1B7YB 2Z4IA 5M3MB 4A3MH 3H0GB 4DV5Q 3BVGA 3MWYW 3OWFA 5J22A 1S4ZA 4A3BB 1D2BA 4DUYL 2Z9HA 5FO9B 4MN3A 3TP7A 1PYSB 4OX9L 4LUVA 2I0QA 1SLJA 2L55A 3P20A 2LXKA 4C3JB 2AUKA 2F0KA 3J7A5 4EQNA 3K8AA 5IYBG 3NUCA 4MZ9A 4RHRA 2EJFC 2I5LX 2O2LD 4DV4Q 3D8GA 4DU9A 3QOJA 4PMWA 4K2KA 2LS01 3HKZG 2E74C 3ERQA 3PUZA 5IGCA 5J39A 1FNWA 2VQFL 3AU7A 3KDFA 4Y7NH 4X3KA 3G4SA 3F2UA 4GKKQ 5DLQE 5CR3A 2UU9L 3G48A 3TP8A 4DR6L 4P74A 3HOXG 4PQXA 1CKNB 1Z47A 1SNMA 2CQAA 3OSOA 3H15A 3GTLB 3CP0A 2B2VA 3CCRA 5LL6S 3K5LA 5EJWA 5JVG3 1EQRA 2EYJA 1PXUA 3CKIB 4ALPA 4IPDA 3Q6SA 3OTOQ 3GTJH 2TSSA 5JOBA 1U9RA 1Y1WH 4IFDG 4AYBE 1RKNA 2UUAQ 4IO9A 1JJCB 2N49A 3CW2C 1VQ5A 3E5SA 1S40A 3SE0A 3HOUH 3S15H 2OF1A 3RNUA 2NZ1D 4ZYSA 1JB7A 2JA7G 3M4OB 2D62A 4HMIA 2L5TA 1X54A 5KRUA 2VQFQ 4KHPL 1VS0A 2KUMA 2KCCA 1KHIA 2F0GA 3ND8A 1BOSA 3MZ5A 4GLXA 1XNQQ 3K7AH 4LF6L 5JPMC 4LFAL 2JJQA 1YNXA 3WWVA 1QWYA 2B2UA 2UU9Q 5EPLA 4JVZA 5AJ3Q 4YWKA 4HJ5A 3CAMA 5I2XA 3I55A 4RA8A 1I6VC 3RZOH 5GAGC 4X3UA 2K28A 3I56A 1V8QA 1LUZA 4P71A 2Q8IB 4ME3A 2PW7A 1IBMQ 2L9HA 3FVQA 1E7ZA 1HQMC 5G3LF 5CGKA 3J81L 2F4VQ 3I4NB 4OELB 1SYGA 5FO8B 3TS0A 1PTOC 4UAIA 3G6EA 2SNSA 2EDGA 3GQBA 3GTKB 4DXGA 4QCLA 3AEVA 2XWBB 5DM63 1ENCA 5GQOA 1A0IA 5EKKA 1XMOL 3D4WA 1ET9A 1ZYRD 3H0GH 1I94L 2CKZB 1U4PA 1LT4D 4R9WA 4LF5Q 1V1OA 4KHPQ 4A3BH 1KTKA 1STEA 2JEBI 1SDFA 4LFBL 1RDPD 1BF4A 4LF6Q 1FJGL 4LFAQ 4C3JH 1CA5A 1G51A 2CW0D 3J81i 3K5NA 1VQMA 1CKNA 2ASBA 4O2DA 2AQ2B 1K28A 1A15A 1AN8A 3OMCA 3NELA 4JI2L 2FXQA 3Q24A 1A3VA 3D0FA 4JOIC 1X65A 1GVPA 1YNJD 3KBXA 5D65A 1PH1A 2PZTA 2E2JB 1J9OA 1K9MC 1E0BA 2WV6D 4EGVA 3NK9A 2R7ZH 3RD4A 2E8GA 1I4QA 3LNNA 1S72A 2IHFA 1VMPA 1U4MA 1CT1D 5D14A 3T1YQ 1X9NA 2HHHL 1Y1WG 2PQAB 1EY4A 1XMOQ 1BCPF 2NN6H 3SEBA 3TQYA 1G291 5IGDA 4JBKA 2FMMA 3GTLH 1I94Q 4S3SA 2VQEQ 1F9PA 2ZM6L 4B9XA 2VUMB 3HOUG 3WDNA 4A3FB 3GTOH 1XNRL 1V9PA 2D0OA 4PMBA 4LFBQ 3G71A 1S3OA 1SNDA 2GVBA 4JBWA 5C3EH 4DR1L 1JWUD 4LF8L 1FJGQ 4K0KQ 3E3XA 2EJGC 1MGSA 3GO5A 3TP5A 2BDNA 4EX5A 5C4JB 3OOCA 2QEJC 4TQUS 3J80L 5CORA 2PZWA 4J6HA 1VQAA 3E0EA 5EKIA 2QILA 4JI2Q 2B2TA 1EY8A 1X6OA 4LF7L 4DV2L 2K5VA 3CQZB 4BY7B 4HTHA 5EPKA 1GHJA 4CDCC 2R7DA 1DM0B 1M4VA 1A2UA 1W6JA 2F0NA 3DUZA 4OWTB 4KJNA 3X3NA 4JYAL 4AYBG 4U673 1IYVA 4OWWB 4XIGS 1RL2A 3J80i 2A6EC 4KKUA 4JI5L 1YNNC 2HDLA 3IL8A 1K3RA 2F1MA 3FRPB 3UI2A 2ZM6Q 1WTHA 4KHVA 3PO2B 1X3PA 1GHKA 4A3EG 2F0FA 5M3MG 3H0GG 3RN5A 2N78A 2X69A 4LF8Q 1TS2A 4KY5A 1B50A 1AH9A 3I4NH 4A3BG 1STYA 2Q8TA 1HUMA 1VQFA 2IHEA 1TS4A 2F0UA 3HP3A 4PV1C 5M5XB 5KNBA 1SE3A 1QUQB 4C3JG 1HHVA 1G6PA 1KIXA 5E3FA 1YITA 1SMXA 4DAYB 2B2YA 5HY6A 4DNRB 3EN2A 5IT9L 3N6RA 3LWEA 1SN8A 1VDZA 3Q8DA 4JW0A 1L0WA 2E2HB 1I4RA 2NN6I 5DNFA 1I3QH 5KGUA 3JAMc 1YVCA 1TWCB 1WTOA 4CKEA 1HA6A 1ENAA 3H3VC 2L1BA 1M8AA 1I6HH 4G7ZC 4KD3A 4PG3A 2PQAA 4JYAQ 1II3A 3TP6A 1X3GA 5JJIA 1RODA 5NUCA 3BYTB 4POGA 2JA9A 4ABNA 4MIUA 4R4CA 4JI5Q 1VQJA 2M9VA 2WKCA 3NWSA 4B3TQ 5H1SE 1A62A 3T56B 1KNAA 1MIUA 4GNXB 4G7HC 3K5OA 1TWGH 1JC7A 2NVYH 1EY5A 2HDMA 2K52A 2LMCB 2BCOA 4A3DB 4B9WA 1PTOF 1IYJB 1JOOA 3HOZB 1N32L 3JC66 2RCNA 1Q8KA 5IOCA 3OYYA 4PNYA 1P8LA 1PA6A 2VUMH 2K04A 2FJ2A 3RZDB 5C4XB 5IIFA 2Z6BA 5D3IB 5F2DA 1XMQL 2CQOA 1EYDA 4UP7A 3M4PA 3P75A 4JI7L 5C4JH 3S16H 4L5QA 1FR3A 4ZKCB 5C5MA 4LUOA 3Q22A 4MHEA 2JEAI 1KDBA 3TMEA 4FXGC 3TN2A 5GADC 2JE6I 3CQZH 1EIFA 4BY7H 5EQ0A 3NQTA 1H9RA 3UDIA 1SXTA 1TT2A 4YHHQ 3BDOA 2EPBA 4KKSA 1BKBA 1QVFA 4HMJA 4JI0L 2CH4W 1B4OA 2NUCA 1E22A 3DHQA 4HR7B 1OXSC 2L12A 1JORA 2EE1A 1WI5A 4HAEA 1L2FA 1QUQA 2L15A 1PH7A 1WTPA 1HA5A 3I4NG 4C3HB 2L11A 1A8VA 1EWHA 4DAYA 4B3ML 4OO1H 3KOJA 2K32A 4KY7A 3VR2A 3KBGA 2NVTB 1EY7A 3PO2H 1HZ9A 1NR2A 2L4NA 2JA8B 3L7ZC 2UUBL 1XMQQ 3J81E 4H44C 1SNPA 3MAQA 2EY5A 4DR2L 4JI7Q 3T16A 4HIOA 4RHSA 4C3IB 1KQSA 1I4GA 2YV5A 5M5XH 1EFWA 1ENFA 3PUXA 4R4IA 1AFPA 5ELOA 2RSNA 1HR0Q 1NSNS 3K7UC 4P75A 4JPBW 1OXXK 4R8IA 1TVXA 1WVLA 1O80A 2E2HH 4GNXA 1ET6A 1TWCH 1Y69U 4XTCS 1BCPB 2A6HD 4OEMB 2BH8A 5JAVA 5C4HA 1PYBA 4XXEA 2F52A 4OIKA 2QEXA 1LTGD 4B3MQ 2NZOA 3ER0A 4DNTB 5FOBB 1PRTD 1DZ1A 4RCNA 1GJXA 3FP9A 1N8RC 5IGBA 2JXMB 3L0OA 1CKMA 1GOZA 2G9HD 1EU4A 2Q8RE 3MEFA 2JA6H 1JJGA 2UUBQ 2EYOA 2AQ3B 1FYCA 3CCJA 2YYZA 4FF3A 2VUMG 4A3JB 3V05A 4A3FG 2OQKA 4DR2Q 1V1PB 3SHLA 1EEFD 5I6WA 2ZTDA 5EBCA 5LL6X 4KHZA 3A55A 3KLSX 4A3DH 4DV7L 3HOZH 1BR9A 4FF4A 3PCOB 4RGTA 4CDEC 3SK4A 5IWAL 1F77A 3R8BA 1LLRD 3BG3A 2A74C 3RZDH 5C4XH 3ERSX 1YJ9A 1CZWA 4BY7G 3OWEB 2NVXH 4ODGA 1LM0A 1Q12A 2MJ8A 5JPNC 4LW1A 1RF2D 3J80E 2EVBA 1GO3E 2K4KA 2MQHA 2EXZA 1PH5A 4R4TA 1KRTA 4C56C 3PIO3 3QWNA 4OO1G 3S1NB 3RMHA 5I4DA 1P16A 1C9OA 2A1AA 3DM3A 1ML0D 4ILWA 4F8MA 2B2WA 5I9PA 2MUYA 3GTGB 3MTSA 3QJYA 4POFA 1B70B 3PO2G 1N36L 3ULJA 2ICEC 4ZKBB 5DEHA 3Q0AA 1G8ZD 2OT2A 1XJVA 2B63B 5FK9C 2Q2TA 5C3WA 3S2HB 2DUDA 5IWAQ 2O4XA 4NB3A 2IX3A 1Q1EA 1H9SA 2OTLA 4K6DA 1SMYC 2RBMA 4QUFA 4ZLTF 3UE0A 3S9WA 1B9NA 5L37A 4GOPB 3IFTA 3J7ZC 3T1HQ 1EY0A 4Y52H 1LTLA 1SSOA 5CMDA 4JI8L 1WOCA 4C3IH 4O0AA 2HIVA 2RF4A 4N8X1 4DV5L 4XQJA 1SJHD 3FMCA 4RAUC 1K8MA 3UDGA 5IT9E 1R9TB 1N33L 4GN4B 1PVOA 3TSSA 2GVAA 2EY6A 3MEHA 4RWSC 2R61A 2AQ1B 4QQBX 4L5TA 4LMQD 1CUKA 1GKHA 1V1PA 2WAQB 3HZXA 4UP9A 1PTOB 3MA2B 3D6WA 3C3LA 4QL5A 2YTXA 3K5MA 5C0XI 5HGQA 2CCZA 1Z7TA 1IKLA 1ZYRC 1G6ZA 3U50C 5C4ZA 3K58A 1RTNA 3WOFA 4HN7A 3HS0C 4A3DG 4DR5Q 5M5WB 3HOZG 4GKKL 2KECA 1VF5C 4KY6A 1PZJD 3M9BA 4XYQA 2CW0C 3FPPA 1LTTD 4A3JH 1KDCA 2KCTA 3K59A 5C4XG 4K14A 1HTPA 4JI8Q 5CV4A 4C1NK 2IL8A 4ZCKA 1SJED 3NSWA 4RFBA 4E6IA 1B9MA 1LTID 1PLFA 2N8NA 3KUPA 1N33Q 4QJFA 3U9OA 3OTOL 1YNJC 4FYDA 5T1IA 1EY9A 2Z6KA 4DK6C 1SR3A 2K14A 2NBFA 3M85A 5IP7H 2UUAL 1E1OA 4P73A 3HOVB 1STBA 1VQEA 1HUNA 3A5ZB 1D1IA 3Q23A 1VQKA 1EUJA 3A7AB 2PPBC 4DK3C 1V43A 4PMCA 1B1ZA 1JJ2A 4C3HG 3S1NH 1XNQL 2K33A 1I4PA 1HZCA 4GOPA 3AFQA 3GTGH 5I6YA 1BDOA 1G2SA 1KD1C 4IFDI 1HFNA 3C1EA 4B3RL 5AJ3L 2WAQE 2JA8G 4J15A 1M1KC 4IALA 1MD2D 3QO2A 4A3GB 2ZTCA 2QW7A 1QNUA 1O7YA 2B63H 1SFOB 4G57A 3ONAB 3KF6B 4C2MH 3F2DA 1E2VA 1SYEA 5J3BA 4EVOA 4C3IG 2R93B 5KIXA 5BN4A 1IBML 3LX0A 3S2HH 3J7YW 4H0LC 3F2BA 3EFXD 4IPCA 3K6OA 2F4VL 1TU2B 1L1OC 4ZQ3A 2O5JC 1B3QA 1HNZQ 1HCZA 3W5OA 3ULPA 4BBSB 3OHXC 2ICIA 2F03A 1NMFA 1CI3M 2PZUA 3E9HA 1ILQA 2GN5A 4LF5L 1F2ZA 1R4PB 4LWCA 1PHJA 1R9TH 4J8QA 4A3CG 1SMYD 3NTIA 1MJCA 2HCCA 3E0JA 1GUOA 2BH2A 5JJLA 1KABA 4MNOA 2A69D 4WFN3 2TMPA 3J81c 1PTOH 4B3RQ 1YI2A 2F0VA 4L6TB 3CXCA 2K50A 4DNIA 3S2DB 1H9JA 1LACA 4A3JG 5EKLA 1ICFB 4L5RC 3MC0B 2CH4A 1IBLQ 2WINB 4DR4Q 3PIOA 2DN8A 4TVAB 1H9KA 2ZJRA 3D6CA 1FD7D 3I73A 1EZ6A 1HNWQ 1EWCA 3V96A 1N9WA 4JI6Q 3AQQA 3T1YL 1MI2A 4RGNA 2B2VC 1EIGA 2AWOA 1IW7C 5IP7G 4A3EH 3S1QB 1HZAA 5M3MH 1I4XA 1IBKL 4KV6A 2VQEL 3G7LA 5JVH3 2KOLA 3PF5A 1LTBD 2RA4A 1VQIA 2Q2IA 4K6LA 3VR6A 1TWHB 3F8TA 3H91A 3S1MB 4ME5A 4K0KL 4LNQA 5I2YA 4R4QA 4U68A 5C44B 1IXRA 3PIP3 4XT1B 2NVQB 3NENA 4DUZL 3HOVH 5C5LA 4N8FA 3MVVA 2BE5D 3ZYYX 5DM73 4BXXG 2LSSA 3KF6A 4BA2I 1MJEA 3PSIA 5GROA 3HRZC 3PUYA 2B63G 2R7FA 2FINB 1EFID 2PW5A 3C1FA 3CRLC 1O7LA 1VQ7A 1Q1BA 1RTOA 1STGA 3MXUA 3OW2A 1HFGA 1Q7YC 2MPMA 4CKBA 1GXDC 3FHWA 4R4OA 4DK0A 1GUTA 2F0EA 3EROA 3SDZA 3J80c 1X32A 3BS1A 3R2TA 2QA4A 5K5PA 1PH8A 1IBKQ 3HOYB 4A3GH 3T4AC 1J5EL 1QJOA 2XIWA 5CBEE 1SAPA 1D5ZC 4RKBA 3K81C 2RCFA 1L0YB 4HSPA 1DYQA 4NKLA 4DUZQ 1PH9A 3S14B 1WFQA 1WD1A 3BZKA 4H02A 4DK1A 1SE8A 3QOLA 2WAQG 3M4OH 4JCVE 2CWAA 4DR3L 3GTMB 4UDUC 3VR5A 4AIMA 5TSSA 2F0OA 2WP8J 1EQVA 1FGBD 4EQOA 4XQQA 2B3GA 3U4ZA 4DAMA 1A2TA 1QG7A 1QZHA 2EYLA 1NJIC 4OONA 2C5CA 1NNXA 2AUJD 4B3SL 3H6MA 4GKJL 1EWIA 3W3AA 1J5EQ 4CBVA 4B3TL 1KNEA 3D4DA 4LUZA 1YBYA 2WB1B 4GS3A 1NAPA 5IT9c 1JWSD 3H09A 1ESFA 3SK5A 2AHOB 4IJLA 1QILA 2IWHA 3GTKH 3A8IE 2PMZB 2A6HC 2D5DA 2RHQB 1JCKB 5CV8A 2HQEA 1Z6HA 1FNVA 2PNRC 3L2PA 3H3VH 3TBIB 5FO7B 3S1QH 1VQGA 1O78A 1PRTC 3NBHB 3HOVG 2X6GA 4WORA 1SNOA 2MFIA 1U0LA 1VQ9A 4DR3Q 1DOKA 1SE4A 3FKIB 5CV5A 3BVMA 3DWQA 1TWHH 4MTNA 2QKIC 3S1MH 3OW7A 5ELBA 1R4QB 5C44H 1AE2A 4FP5D 1K83B 1CSPA 2B2TC 3D3RA 1MBYA 1KL9A 2NVQH 1IW7D 4JI1Q 3M4QA 5DAUA 1J6QA 3R93A 1WTRA 4B3SQ 2EYPA 2KENA 4IN3A 4GKJQ 1UEAB 2SEBD 2EXDA 4IPGA 1HR0W 3HGBA 3S1RB 1Y8PB 2EIFA 4LF4Q 1JT8A 4YHHL 1CSQA 4K2LA 1UE7A 4A3GG 5ELDA 1HQRD 2JA5B 4JI4Q 2F0DA 1VQLA 4LAAA 1EEID 2E2JH 4X66Q 4IUTA 1K3BC 2ZT9C 2YTYA 2R93G 2CHBD 3C2PA 4NXMQ 3HKSA 3K57A 1KXLA 2M00A 1AZQA 3A7LA 2F0JA 2F0LA 2QF7A 5JEAJ 1KAWA 1EIYB 4V190 4EQ5A 1WTXA 4UP8A 4LJZC 4NMZA 3HOYH 4BBSG 1TS3A 4A3FH 2H4OA 5IE8A 1STNA 3BU2A 3NBIA 5LMUL 5HGTA 3PO3B 3U58A 4QF4A 2WB1E 1ICWA 1F9RA 4PZ8A 3OIPA 2LKVA 1JE5A 1TWFB 3NPPA 1UAPA 4I7AA 2VW9A 2HCIA 3CCEA 2L0CA 2I5MX 2B2YC 1JICA 1YZ6A 2PMZE 3S14H 1WCMB 5M3FB 4FO2A 1LO5D 2IJ0A 1HR0L 4F7XA 2G5DA 2XNAC 4KJOA 2JQOA 2DY7A 3AFPA 3ITPA 2FFKB 3E6ZX 3I8ZA 3RLNA 3QG1A 2PYKA 2HIXA 2K5HA 2QDLA 3PIPA 4XDXA 2KBNA 4GN3B 5ELEA 3NBHA 2VB2X 2VNUD 4XYOA 2PNHA 3CCQA 1OXTA 1CFMA 2IX1A 1NBWA 4DV3Q 1VQNA 1MSHA 2EYFA 1PMRA 1A3UA 1ZEQX 1E1TA 3PQIA 4ZUJA 3CF5A 5LMUQ 3TDQA 2GA4B 1EU3A 4JG2A 2PCFB 4KKTA 4YWMA 4UHVA 1RIPA 3I72A 5JJKA 1BBXC 4DAVA 5EAYA 1XXGA 3VYTA 5C3XA 2OWOA 5C44G 1W2BA 1F2YA 2KEEA 2FMCA 5I9OA 4NPSA 3S17B 1ZXTA 1VQDA 2QCPX 2DGYA 3NE5B 5GAHC 3RLOA 3P7JA 5JEAH 2R92B 4FVMA 1XTCD 3A74A 1BBUA 5FLXL 1N34L 3CU7A 3S24A 4HJ9A 3CCLA 4DA2A 3DWPA 4HJ8A 3X3MA 3W1BA 4IQZA 2QGQA 1QZGA 1DCZA 3NP8A 5EBDA 1UUPA 4X3TA 2RVLA 1H95A 3FEWX 4CGYB 3MHBA 1ASYA 4V0BA 3VYUA 1E3PA 4QMGA 5E4XA 3DWAA 3HOYG 3J7AF 2KHJA 5COYA 2YU9B 2ZXPA 4GLAC 3I4MB 2Z4HA 5IP9G 1DGSA 3HEJA 3I2ZA 1F2LA 1U5KA 1W6KA 1JR0D 1MSGA 4GLVB 2ZXRA 3F1ZA 3SR1A 2N3SA 3EIVA 4Z9CB 1PRTF 4OO1I 1JE4A 4BS9A 1UE6A 4JC0A 1VMCA 4YWLA 3PO3H 2K05A 1FNUA 4OGQC 4A4IA 2G9DA 3CCUA 1SNCA 1N34Q 4A3MB 1S5DD 1I4HA 2D2CC 5C6AA 3T1HL 2KQ3A 1TWFH 2K5NA 4IUNA 1SYFA 2K5WA 1H9MA 1L0XB 1WCMH 2KHIA 5KYLA 1XTDA 1VQ8A 2LY7A 3CRKC 3L9AX 2K5QA 4WJWA 4FF2A 3M7NA 1V1QA 1F9SA 2JP1A 1AEXA 2J4XA 3N52A 5HURA 1FL0A 2A8VA 2MGSA 2JN4A 4X6AH 2WB1G 1SYCA 2RHSB 2F4IA 4ZRZA 4IOAA 1EIHA 5T1GA 1RJTA 1D5MC 1Y1VB 4QGUA 4C3HH 3AMUA 2E5LL 4ID6A 4A93B 5AFWA 2VB3X 4X3SA 2M2LA 1CZGA 2DNCA 1DOLA 4DR5L 2NVTH 1WTVA 1C0AA 4BA1I 1JWMD 2JA8H 3NTKA 1QOHA 1CHQD 3VYSA 3TZDA 2A69C 1YJNA 3KJPA 3FKIG 1EYAA 5JEAG 3PF4A 1Y8NB 2R6GA 5GAEC 1B53A 4DAPA 2F0MA 4NDXA 3A8KE 2XN9C 4HIKA 3GV3A 2XGTA
chains in the Genus database with same CATH topology
3PV0A 4OXPA 4OWWB 4XIGS 1RL2A 3S17H 2BH2A 3J80i 5JJLA 4MNOA 4JI5L 5FLMG 3J81c 4QY7A 5FJ8G 4B3RQ 1YI2A 1PH2A 1K3RA 2ZM6Q 3CXCA 2K50A 3K0XA 4DNIA 1A63A 4A3EG 3GDEA 3FKIH 1UE5A 2PI2E 5M3MG 4A3JG 2AMCB 3H0GG 4LF9Q 4YCVA 4YCWA 2JA5G 3RN5A 4L5RC 2OTJA 2N78A 3GTPH 1JT8A 4LF8Q 1X55A 1I50H 1AH9A 1WYDA 3I4NH 4A3BG 1IBLQ 4DR4Q 1K83H 2E5LQ 4A3CH 2ALYB 3AYHB 1VQFA 2B29A 2IHEA 3PIOA 4IJHA 4TVAB 4JV5L 2ZJRA 1QUQB 1HNWQ 1G6PA 1KIXA 1NE3A 4DV0L 1YITA 1QVGA 2IY5B 4JI6Q 1N9WA 1ASZA 5FJ8H 3AQQA 4UY8C 3T1YL 2MO1A 1SMXA 2PI2A 4DAYB 5HY6A 2BA0A 2UXCL 2AWOA 3EN2A 4JI0Q 3S1RH 2JK8A 2YU9H 1SN8A 5IP7G 2VL6A 4A3EH 3Q8DA 3BZCA 1HZAA 1L0WA 5M3MH 3I4MH 1IBKL 2JA5H 2VQEL 2IX0A 2NN6I 1HNXL 2YTVA 4P72A 1I3QH 3JAMc 3PO3G 3PF5A 1YVCA 3GTQH 1VQIA 2Q2IA 2KCMA 1NY4A 1VQ4A 3F8TA 3CC7A 4K0KL 1I6HH 4JYAQ 4PG3A 2PQAA 4LNQA 2HQLA 3A5UA 1PH4A 3RLFA 1X3GA 1T9HA 4R4QA 1M90C 1IXRA 5JJIA 1WCMG 1QVCA 5M3FG 4POGA 2JA9A 1AE3A 4R4CA 3RN2A 4JI5Q 1VQJA 3NENA 4DUZL 3HOVH 4X64Q 4A3IG 4IPHA 1XPOA 1HNZL 3CPWA 4APVA 4B3TQ 4BXXG 2LSSA 2CFMA 3K80C 5H1SE 1A62A 3KF6A 4GN5A 4BA2I 1MJEA 4IFDJ 1VQPA 3TRZA 3PSIA 2H5XA 3HKZE 1PFSA 5GROA 1MIUA 4GNXB 3SGIA 1TWGH 1PV4A 3B6YA 4BBRH 2NVYH 3PUYA 4HIMA 4A3KH 1Q82C 2B63G 2R7FA 2K52A 3E9IA 4DV6L 4JV5Q 3UE1A 3A0JA 1VQ7A 1IYJB 1Q1BA 3F2CA 5M3FH 4DV0Q 1JMCA 1N32L 3OW2A 3JC66 5BR8L 2RCNA 1Q8KA 1Q7YC 1MKHA 1TXYA 1PH3A 1YHAA 4GNXC 3IRBA 3OYYA 1O7IA 2UXCQ 3FHWA 2WFWA 4R4OA 4L5SA 1P8LA 1FGUA 3I4OA 1PA6A 2VUMH 4BXXH 1YHQA 1YHBA 3J80c 2QA4A 1PH8A 1IBKQ 4A3GH 1XPUA 2BA1A 3CC2A 1HNXQ 1J5EL 1XMQL 2CQOA 1L1OB 4UP7A 4DR7L 3M4PA 5E7NA 1Y1VH 1K73C 4A93H 4JI7L 5C4JH 3S16H 2I5HA 4L5QA 3CMAA 4LUOA 1IBLL 3K81C 4DR4L 2JEAI 1SRUA 3PUVA 5IYBH 4DUZQ 5GADC 2JE6I 2ZTEA 3CQZH 1EIFA 4RMFA 1PH9A 4BY7H 1HNWL 1WFQA 1GM5A 3UDIA 4JI6L 1KRSA 3BZKA 2Z0SA 4H02A 1SE8A 4YHHQ 2WAQG 3EBEA 1BKBA 1QVFA 3M4OH 1E24A 4UPAA 4JI0L 5FLXc 4JCVE 2R92G 2CWAA 3J81j 1E22A 4DR3L 1OXSC 4DUYQ 1WI5A 1X3FA 3CPFA 4DV7Q 1WJJA 1L2FA 1QUQA 1TWAH 4AIMA 4X65L 2L15A 2WP8J 2Z6KC 4JI3L 4DV6Q 1PH7A 1C7YA 3CD6A 3I4NG 3U4ZA 2B3GA 4DAMA 2UXDL 1VQOA 1A8VA 3HFZB 5BR8Q 1QZHA 4B3ML 1UWVA 1X56A 3KDFB 3HOXH 3KOJA 4OONA 5IY0A 1NJIC 3HOWH 1OXUA 2HT1A 3I7FA 4B3SL 4A3LH 3PO2H 1HZ9A 1Q46A 3NEMA 1IZ6A 2Q2HA 4R1JA 4X64L 4GKJL 2R92H 1EWIA 2D0PA 3L7ZC 1J5EQ 1XMQQ 2UUBL 4B3TL 4WJ3M 4YY3L 4DR7Q 4LUZA 5IYCH 1YBYA 4GS3A 1Y14B 2XTIA 3I4MG 3TREA 5IT9c 4DR2L 4JI7Q 4HIOA 4JOIA 1EOVA 2AHOB 4IJLA 1KQSA 2YV5A 5M5XH 1EFWA 5M5WH 1X3EA 3GTKH 4GOPC 2V1CC 3PUXA 4R4IA 2Q2UA 2RHQB 5ELOA 4YCUA 2Y0SE 2ATWA 2VS1A 4DR6Q 1D7QA 1HR0Q 3L2PA 3H3VH 3K7UC 4P75A 4AH6A 1OXXK 1Z9FA 2ES2A 3S1QH 1VQGA 3NBHB 4BY1H 3HOVG 1N36Q 2JA7H 2E2HH 3U4VA 4GNXA 2JA6G 2LXJA 2MFIA 3CMEA 1K8AC 1U0LA 1VQ9A 4DV4L 4DR3Q 1TWCH 1VQHA 2E2IH 3RR5A 4A3MG 4XTCS 4A75A 1TWHH 4RG1A 3M3YH 2BH8A 4MTNA 3STBC 4X65Q 1XPRA 1PYBA 4JI3Q 3ICEA 3S1MH 4HJ7A 2UXDQ 3D31A 2F52A 5C44H 4BBRG 1AE2A 2QEXA 4A3KG 2ZJQA 3PGZA 4B3MQ 1CSPA 4HJAA 2NZOA 3ER0A 1KL9A 2NVQH 1D8LA 5M5YH 4JI1Q 2AWNA 3FP9A 3M4QA 1J6QA 3CCSA 1N8RC 4FDBA 3TEHB 4B3SQ 3W1GA 3L0OA 1CKMA 3DLLA 2KENA 3MEFA 1L1OA 2JA6H 4IPGA 2EXDA 1HR0W 4GKJQ 5C0XG 1JJGA 2UUBQ 4LF4Q 1YIJA 2EIFA 2CWPA 3STBD 2YYZA 4YY3Q 4YHHL 1CSQA 3CCJA 2VUMG 5K36G 1B7YB 1UE7A 4A3FG 4A3MH 2OQKA 4A3GG 3CCVA 3ZJYC 4DV5Q 4DR2Q 4JI4Q 1VQLA 2E2JH 4X66Q 2ZTDA 2EQSA 4NXNL 4KHZA 2YTYA 3MXNB 4DUYL 2R93G 1Y1VG 4A3DH 3CC4A 4DV7L 4NXMQ 3HOZH 3HKSA 1PYSB 3PCOB 4A93G 1KXLA 4OX9L 4LUVA 2I0QA 4LFCL 1SLJA 2LXKA 1EYGA 5IWAL 3J7A5 5JEAJ 1KAWA 1EIYB 4EQ5A 3K8AA 4UP8A 5IYBG 3RZDH 4MZ9A 5C4XH 3ERSX 4QIWE 1YJ9A 2C35B 3HOYH 4BY7G 2UUCL 4BBSG 2I5LX 4A3FH 4DV4Q 5IE8A 2NVXH 4PMWA 3BU2A 1LM0A 1Q12A 5LMUL 3HKZG 1SFOH 1K8GA 3U58A 2WB1E 2A19A 4LW1A 1OTCA 3PUZA 4DV1L 4PZ8A 2R93H 2MO0A 2K4KA 1GO3E 2VQFL 1EQQA 3KDFA 4DPGA 4Y7NH 1JE5A 1VCIA 2VW9A 3G4SA 2MQHA 3CCEA 1PH5A 4GKKQ 4R4TA 2I5MX 5DLQE 1YZ6A 1KRTA 2PMZE 4PZ6A 3S14H 3TS2A 1Q86C 2UU9L 4OO1G 2UXBL 3G48A 4DR6L 4P74A 3HOXG 3HOWG 1HR0L 1P16A 1C9OA 2A1AA 1CKNB 1Z47A 3DM3A 4BBSH 1HZBA 3H15A 4POFA 3KLWA 1B70B 2JQOA 4A3LG 3PO2G 1N36L 3CP0A 3AFPA 3ULJA 3CCRA 3RLNA 1NTGA 5LMNW 4NXNQ 2HIXA 2K5HA 5IYCG 1EQRA 1XJVA 3LGJA 3PIPA 4ALPA 4IPDA 2KBNA 1W3SA 3OTOQ 4GN3B 3GTJH 3BJUA 4OWXB 2F3IA 2Q2TA 4LFCQ 4KLKA 2DUDA 5IWAQ 1Y1WH 4NB3A 4IFDG 4AYBE 2VNUD 2PNHA 1Q1EA 1OXTA 3CCQA 2UUAQ 2IX1A 4AQYL 1NBWA 5ELNA 4DV3Q 2OTLA 1VQNA 4JI1L 4IO9A 1JJCB 3UE0A 2N49A 3CW2C 1CKOA 2AKWB 2UUCQ 1VQ5A 1S40A 3S2DH 3HOUH 3S15H 1E1TA 3RNUA 4GOPB 4BY1G 3CF5A 3J7ZC 1JB7A 5LMUQ 2JA7G 3KF8B 5IYDH 4LF4L 3T1HQ 4YWMA 2D62A 1LTLA 4JG2A 4Y52H 4DV1Q 1RIPA 4JI8L 1WOCA 1X54A 4O0AA 2HIVA 4C3IH 2VQFQ 4KHPL 5JJKA 2K75A 1VS0A 2RF4A 4DV5L 4JI4L 1KHIA 1BVSA 5EAYA 4X66L 4GLXA 3UDGA 3K7AH 1XNQQ 4LF6L 4LFAL 2JJQA 1YNXA 3WWVA 2HHHQ 1YJWA 5C44G 2OWOA 4NXML 4GN4B 1N33L 2VY3A 1W2BA 2UU9Q 1B8AA 2GVAA 1PVOA 2UXBQ 4NPSA 4QQBX 4L5TA 5AJ3Q 4YWKA 3VDYA 4HJ5A 3CAMA 3I55A 1VQDA 2DGYA 1CUKA 1GKHA 5GAHC 3RZOH 4UP9A 3RLOA 5GAGC 1XNRQ 3I56A 5LMNL 4QL5A 2YTXA 2ZJPA 1LUZA 1Q81C 1GD7A 4P71A 5C0XI 5HGQA 3A74A 4DR1Q 1BBUA 2CCZA 4WJ4A 4ME3A 1N34L 3S24A 2ID0A 1IBMQ 3U50C 4HJ9A 3CCLA 1VQ6A 1E7ZA 2F4VQ 1NMGA 1VQCA 3KYHC 4HIDA 4HJ8A 4DR5Q 1FVIA 3TS0A 3G6EA 4OX9Q 4A3DG 4JBMA 3HOZG 2Y0SG 3W1BA 4AQYQ 2QGQA 5FLMH 1QZGA 1IL2A 4GKKL 3AEVA 4LF7Q 4DV2Q 1H95A 5GQOA 3M9BA 1UEBA 1A0IA 1ASYA 1XMOL 4X62L 4A3JH 1UE1A 2KCTA 3GD7A 3H0GH 5C4XG 1E3PA 1I94L 2CKZB 3HOYG 4LF5Q 2KHJA 4JI8Q 4GLAC 4KHPQ 4A3BH 1HJPA 1YEZA 2JEBI 4LFBL 5IP9G 1DGSA 4LF6Q 1FJGL 3I2ZA 4LFAQ 2N8NA 4C3JH 1N33Q 1U5KA 4QJFA 3OTOL 1G51A 3J81i 1VQMA 2R7ZG 1CKNA 2ASBA 4O2DA 2Z6KA 4DK6C 1SR3A 2K14A 4GLVB 3F1ZA 3M85A 5IP7H 3NELA 2UUAL 2N3SA 2FXQA 1E1OA 3EIVA 1HH2P 4P73A 4DV3L 1VQEA 2NN6G 4JI2L 4OO1I 2IT1A 4IOCA 1UE6A 3D0FA 4JC0A 3A5ZB 3KJOA 4YWLA 5LMNQ 4JOIC 3PO3H 1X65A 4A4IA 3CCUA 1N34Q 1PH6A 1VQKA 1EUJA 1GVPA 1OXVA 5IP9H 3T1HL 3UDXA 1TWFH 3CCMA 1PH1A 2K5NA 5C3EG 4DK3C 1V43A 1K9MC 1KC8C 1WCMH 2KHIA 1JJ2A 2R7ZH 3KFUA 1K0RA 1XTDA 2E8GA 1VQ8A 1XNQL 3S1NH 1S72A 2IHFA 3T1YQ 4A3IH 1X9NA 2HHHL 3M7NA 1V1QA 4JBJA 1Y1WG 1HZCA 4GOPA 2PQAB 3AFQA 1XMOQ 4KI0A 4PZ7A 3GTGH 3TQYA 4X62Q 1KD1C 1G291 2VZAA 4JBKA 4IFDI 3GTLH 1I94Q 4B3RL 3JAMi 5AJ3L 1FL0A 2WAQE 2OCEA 4J15A 3UDFA 2ZM6L 2VQEQ 1M1KC 2A8VA 2JA8G 2OQ0A 3H3VI 3HOUG 3GTOH 4X6AH 2ZTCA 1XNRL 2WB1G 1I5FA 5IYDG 3GTMH 1V9PA 2D0OA 4LF9L 2RHSB 2B63H 3G71A 1S3OA 4LFBQ 3KF6B 2GVBA 4JBWA 4C2MH 5C3EH 3F2DA 4DR1L 5J3BA 4LF8L 3PUWA 1FJGQ 4IOAA 4K0KQ 4QGUA 3GO5A 1IBML 3S2HH 4C3HH 4EX5A 2E5LL 1BBWA 3F2BA 4A76A 4TQUS 4IPCA 2F4VL 1LYLA 1L1OC 4DKAC 1VQAA 4DR5L 3E0EA 1HNZQ 3W5OA 4JI2Q 2NVTH 2NZHA 2MNAA 1VQBA 4BA1I 1C0AA 1X6OA 4LF7L 4DV2L 1SROA 3ULPA 2K5VA 2JA8H 3ULLA 1NMFA 3E9HA 1YJNA 2GN5A 2R7DA 3KJPA 3FKIG 5JEAG 4LF5L 3PF4A 2R6GA 5GAEC 4LWCA 1PHJA 1R9TH 5C0XJ 4OWTB 1N32Q 4A3CG 1MJCA 4HIKA 4JYAL 2XGTA 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 A;  4OXP A;  4OWW B;  4XIG S;  1RL2 A;  3S17 H;  2BH2 A;  3J80 i;  5JJL A;  4MNO A;  4JI5 L;  5FLM G;  3J81 c;  4QY7 A;  5FJ8 G;  4B3R Q;  1YI2 A;  1PH2 A;  1K3R A;  2ZM6 Q;  3CXC A;  2K50 A;  3K0X A;  4DNI A;  1A63 A;  4A3E G;  3GDE A;  3FKI H;  1UE5 A;  2PI2 E;  5M3M G;  4A3J G;  2AMC B;  3H0G G;  4LF9 Q;  4YCV A;  4YCW A;  2JA5 G;  3RN5 A;  4L5R C;  2OTJ A;  2N78 A;  3GTP H;  1JT8 A;  4LF8 Q;  1X55 A;  1I50 H;  1AH9 A;  1WYD A;  3I4N H;  4A3B G;  1IBL Q;  4DR4 Q;  1K83 H;  2E5L Q;  4A3C H;  2ALY B;  3AYH B;  1VQF A;  2B29 A;  2IHE A;  3PIO A;  4IJH A;  4TVA B;  4JV5 L;  2ZJR A;  1QUQ B;  1HNW Q;  1G6P A;  1KIX A;  1NE3 A;  4DV0 L;  1YIT A;  1QVG A;  2IY5 B;  4JI6 Q;  1N9W A;  1ASZ A;  5FJ8 H;  3AQQ A;  4UY8 C;  3T1Y L;  2MO1 A;  1SMX A;  2PI2 A;  4DAY B;  5HY6 A;  2BA0 A;  2UXC L;  2AWO A;  3EN2 A;  4JI0 Q;  3S1R H;  2JK8 A;  2YU9 H;  1SN8 A;  5IP7 G;  2VL6 A;  4A3E H;  3Q8D A;  3BZC A;  1HZA A;  1L0W A;  5M3M H;  3I4M H;  1IBK L;  2JA5 H;  2VQE L;  2IX0 A;  2NN6 I;  1HNX L;  2YTV A;  4P72 A;  1I3Q H;  3JAM c;  3PO3 G;  3PF5 A;  1YVC A;  3GTQ H;  1VQI A;  2Q2I A;  2KCM A;  1NY4 A;  1VQ4 A;  3F8T A;  3CC7 A;  4K0K L;  1I6H H;  4JYA Q;  4PG3 A;  2PQA A;  4LNQ A;  2HQL A;  3A5U A;  1PH4 A;  3RLF A;  1X3G A;  1T9H A;  4R4Q A;  1M90 C;  1IXR A;  5JJI A;  1WCM G;  1QVC A;  5M3F G;  4POG A;  2JA9 A;  1AE3 A;  4R4C A;  3RN2 A;  4JI5 Q;  1VQJ A;  3NEN A;  4DUZ L;  3HOV H;  4X64 Q;  4A3I G;  4IPH A;  1XPO A;  1HNZ L;  3CPW A;  4APV A;  4B3T Q;  4BXX G;  2LSS A;  2CFM A;  3K80 C;  5H1S E;  1A62 A;  3KF6 A;  4GN5 A;  4BA2 I;  1MJE A;  4IFD J;  1VQP A;  3TRZ A;  3PSI A;  2H5X A;  3HKZ E;  1PFS A;  5GRO A;  1MIU A;  4GNX B;  3SGI A;  1TWG H;  1PV4 A;  3B6Y A;  4BBR H;  2NVY H;  3PUY A;  4HIM A;  4A3K H;  1Q82 C;  2B63 G;  2R7F A;  2K52 A;  3E9I A;  4DV6 L;  4JV5 Q;  3UE1 A;  3A0J A;  1VQ7 A;  1IYJ B;  1Q1B A;  3F2C A;  5M3F H;  4DV0 Q;  1JMC A;  1N32 L;  3OW2 A;  3JC6 6;  5BR8 L;  2RCN A;  1Q8K A;  1Q7Y C;  1MKH A;  1TXY A;  1PH3 A;  1YHA A;  4GNX C;  3IRB A;  3OYY A;  1O7I A;  2UXC Q;  3FHW A;  2WFW A;  4R4O A;  4L5S A;  1P8L A;  1FGU A;  3I4O A;  1PA6 A;  2VUM H;  4BXX H;  1YHQ A;  1YHB A;  3J80 c;  2QA4 A;  1PH8 A;  1IBK Q;  4A3G H;  1XPU A;  2BA1 A;  3CC2 A;  1HNX Q;  1J5E L;  1XMQ L;  2CQO A;  1L1O B;  4UP7 A;  4DR7 L;  3M4P A;  5E7N A;  1Y1V H;  1K73 C;  4A93 H;  4JI7 L;  5C4J H;  3S16 H;  2I5H A;  4L5Q A;  3CMA A;  4LUO A;  1IBL L;  3K81 C;  4DR4 L;  2JEA I;  1SRU A;  3PUV A;  5IYB H;  4DUZ Q;  5GAD C;  2JE6 I;  2ZTE A;  3CQZ H;  1EIF A;  4RMF A;  1PH9 A;  4BY7 H;  1HNW L;  1WFQ A;  1GM5 A;  3UDI A;  4JI6 L;  1KRS A;  3BZK A;  2Z0S A;  4H02 A;  1SE8 A;  4YHH Q;  2WAQ G;  3EBE A;  1BKB A;  1QVF A;  3M4O H;  1E24 A;  4UPA A;  4JI0 L;  5FLX c;  4JCV E;  2R92 G;  2CWA A;  3J81 j;  1E22 A;  4DR3 L;  1OXS C;  4DUY Q;  1WI5 A;  1X3F A;  3CPF A;  4DV7 Q;  1WJJ A;  1L2F A;  1QUQ A;  1TWA H;  4AIM A;  4X65 L;  2L15 A;  2WP8 J;  2Z6K C;  4JI3 L;  4DV6 Q;  1PH7 A;  1C7Y A;  3CD6 A;  3I4N G;  3U4Z A;  2B3G A;  4DAM A;  2UXD L;  1VQO A;  1A8V A;  3HFZ B;  5BR8 Q;  1QZH A;  4B3M L;  1UWV A;  1X56 A;  3KDF B;  3HOX H;  3KOJ A;  4OON A;  5IY0 A;  1NJI C;  3HOW H;  1OXU A;  2HT1 A;  3I7F A;  4B3S L;  4A3L H;  3PO2 H;  1HZ9 A;  1Q46 A;  3NEM A;  1IZ6 A;  2Q2H A;  4R1J A;  4X64 L;  4GKJ L;  2R92 H;  1EWI A;  2D0P A;  3L7Z C;  1J5E Q;  1XMQ Q;  2UUB L;  4B3T L;  4WJ3 M;  4YY3 L;  4DR7 Q;  4LUZ A;  5IYC H;  1YBY A;  4GS3 A;  1Y14 B;  2XTI A;  3I4M G;  3TRE A;  5IT9 c;  4DR2 L;  4JI7 Q;  4HIO A;  4JOI A;  1EOV A;  2AHO B;  4IJL A;  1KQS A;  2YV5 A;  5M5X H;  1EFW A;  5M5W H;  1X3E A;  3GTK H;  4GOP C;  2V1C C;  3PUX A;  4R4I A;  2Q2U A;  2RHQ B;  5ELO A;  4YCU A;  2Y0S E;  2ATW A;  2VS1 A;  4DR6 Q;  1D7Q A;  1HR0 Q;  3L2P A;  3H3V H;  3K7U C;  4P75 A;  4AH6 A;  1OXX K;  1Z9F A;  2ES2 A;  3S1Q H;  1VQG A;  3NBH B;  4BY1 H;  3HOV G;  1N36 Q;  2JA7 H;  2E2H H;  3U4V A;  4GNX A;  2JA6 G;  2LXJ A;  2MFI A;  3CME A;  1K8A C;  1U0L A;  1VQ9 A;  4DV4 L;  4DR3 Q;  1TWC H;  1VQH A;  2E2I H;  3RR5 A;  4A3M G;  4XTC S;  4A75 A;  1TWH H;  4RG1 A;  3M3Y H;  2BH8 A;  4MTN A;  3STB C;  4X65 Q;  1XPR A;  1PYB A;  4JI3 Q;  3ICE A;  3S1M H;  4HJ7 A;  2UXD Q;  3D31 A;  2F52 A;  5C44 H;  4BBR G;  1AE2 A;  2QEX A;  4A3K G;  2ZJQ A;  3PGZ A;  4B3M Q;  1CSP A;  4HJA A;  2NZO A;  3ER0 A;  1KL9 A;  2NVQ H;  1D8L A;  5M5Y H;  4JI1 Q;  2AWN A;  3FP9 A;  3M4Q A;  1J6Q A;  3CCS A;  1N8R C;  4FDB A;  3TEH B;  4B3S Q;  3W1G A;  3L0O A;  1CKM A;  3DLL A;  2KEN A;  3MEF A;  1L1O A;  2JA6 H;  4IPG A;  2EXD A;  1HR0 W;  4GKJ Q;  5C0X G;  1JJG A;  2UUB Q;  4LF4 Q;  1YIJ A;  2EIF A;  2CWP A;  3STB D;  2YYZ A;  4YY3 Q;  4YHH L;  1CSQ A;  3CCJ A;  2VUM G;  5K36 G;  1B7Y B;  1UE7 A;  4A3F G;  4A3M H;  2OQK A;  4A3G G;  3CCV A;  3ZJY C;  4DV5 Q;  4DR2 Q;  4JI4 Q;  1VQL A;  2E2J H;  4X66 Q;  2ZTD A;  2EQS A;  4NXN L;  4KHZ A;  2YTY A;  3MXN B;  4DUY L;  2R93 G;  1Y1V G;  4A3D H;  3CC4 A;  4DV7 L;  4NXM Q;  3HOZ H;  3HKS A;  1PYS B;  3PCO B;  4A93 G;  1KXL A;  4OX9 L;  4LUV A;  2I0Q A;  4LFC L;  1SLJ A;  2LXK A;  1EYG A;  5IWA L;  3J7A 5;  5JEA J;  1KAW A;  1EIY B;  4EQ5 A;  3K8A A;  4UP8 A;  5IYB G;  3RZD H;  4MZ9 A;  5C4X H;  3ERS X;  4QIW E;  1YJ9 A;  2C35 B;  3HOY H;  4BY7 G;  2UUC L;  4BBS G;  2I5L X;  4A3F H;  4DV4 Q;  5IE8 A;  2NVX H;  4PMW A;  3BU2 A;  1LM0 A;  1Q12 A;  5LMU L;  3HKZ G;  1SFO H;  1K8G A;  3U58 A;  2WB1 E;  2A19 A;  4LW1 A;  1OTC A;  3PUZ A;  4DV1 L;  4PZ8 A;  2R93 H;  2MO0 A;  2K4K A;  1GO3 E;  2VQF L;  1EQQ A;  3KDF A;  4DPG A;  4Y7N H;  1JE5 A;  1VCI A;  2VW9 A;  3G4S A;  2MQH A;  3CCE A;  1PH5 A;  4GKK Q;  4R4T A;  2I5M X;  5DLQ E;  1YZ6 A;  1KRT A;  2PMZ E;  4PZ6 A;  3S14 H;  3TS2 A;  1Q86 C;  2UU9 L;  4OO1 G;  2UXB L;  3G48 A;  4DR6 L;  4P74 A;  3HOX G;  3HOW G;  1HR0 L;  1P16 A;  1C9O A;  2A1A A;  1CKN B;  1Z47 A;  3DM3 A;  4BBS H;  1HZB A;  3H15 A;  4POF A;  3KLW A;  1B70 B;  2JQO A;  4A3L G;  3PO2 G;  1N36 L;  3CP0 A;  3AFP A;  3ULJ A;  3CCR A;  3RLN A;  1NTG A;  5LMN W;  4NXN Q;  2HIX A;  2K5H A;  5IYC G;  1EQR A;  1XJV A;  3LGJ A;  3PIP A;  4ALP A;  4IPD A;  2KBN A;  1W3S A;  3OTO Q;  4GN3 B;  3GTJ H;  3BJU A;  4OWX B;  2F3I A;  2Q2T A;  4LFC Q;  4KLK A;  2DUD A;  5IWA Q;  1Y1W H;  4NB3 A;  4IFD G;  4AYB E;  2VNU D;  2PNH A;  1Q1E A;  1OXT A;  3CCQ A;  2UUA Q;  2IX1 A;  4AQY L;  1NBW A;  5ELN A;  4DV3 Q;  2OTL A;  1VQN A;  4JI1 L;  4IO9 A;  1JJC B;  3UE0 A;  2N49 A;  3CW2 C;  1CKO A;  2AKW B;  2UUC Q;  1VQ5 A;  1S40 A;  3S2D H;  3HOU H;  3S15 H;  1E1T A;  3RNU A;  4GOP B;  4BY1 G;  3CF5 A;  3J7Z C;  1JB7 A;  5LMU Q;  2JA7 G;  3KF8 B;  5IYD H;  4LF4 L;  3T1H Q;  4YWM A;  2D62 A;  1LTL A;  4JG2 A;  4Y52 H;  4DV1 Q;  1RIP A;  4JI8 L;  1WOC A;  1X54 A;  4O0A A;  2HIV A;  4C3I H;  2VQF Q;  4KHP L;  5JJK A;  2K75 A;  1VS0 A;  2RF4 A;  4DV5 L;  4JI4 L;  1KHI A;  1BVS A;  5EAY A;  4X66 L;  4GLX A;  3UDG A;  3K7A H;  1XNQ Q;  4LF6 L;  4LFA L;  2JJQ A;  1YNX A;  3WWV A;  2HHH Q;  1YJW A;  5C44 G;  2OWO A;  4NXM L;  4GN4 B;  1N33 L;  2VY3 A;  1W2B A;  2UU9 Q;  1B8A A;  2GVA A;  1PVO A;  2UXB Q;  4NPS A;  4QQB X;  4L5T A;  5AJ3 Q;  4YWK A;  3VDY A;  4HJ5 A;  3CAM A;  3I55 A;  1VQD A;  2DGY A;  1CUK A;  1GKH A;  5GAH C;  3RZO H;  4UP9 A;  3RLO A;  5GAG C;  1XNR Q;  3I56 A;  5LMN L;  4QL5 A;  2YTX A;  2ZJP A;  1LUZ A;  1Q81 C;  1GD7 A;  4P71 A;  5C0X I;  5HGQ A;  3A74 A;  4DR1 Q;  1BBU A;  2CCZ A;  4WJ4 A;  4ME3 A;  1N34 L;  3S24 A;  2ID0 A;  1IBM Q;  3U50 C;  4HJ9 A;  3CCL A;  1VQ6 A;  1E7Z A;  2F4V Q;  1NMG A;  1VQC A;  3KYH C;  4HID A;  4HJ8 A;  4DR5 Q;  1FVI A;  3TS0 A;  3G6E A;  4OX9 Q;  4A3D G;  4JBM A;  3HOZ G;  2Y0S G;  3W1B A;  4AQY Q;  2QGQ A;  5FLM H;  1QZG A;  1IL2 A;  4GKK L;  3AEV A;  4LF7 Q;  4DV2 Q;  1H95 A;  5GQO A;  3M9B A;  1UEB A;  1A0I A;  1ASY A;  1XMO L;  4X62 L;  4A3J H;  1UE1 A;  2KCT A;  3GD7 A;  3H0G H;  5C4X G;  1E3P A;  1I94 L;  2CKZ B;  3HOY G;  4LF5 Q;  2KHJ A;  4JI8 Q;  4GLA C;  4KHP Q;  4A3B H;  1HJP A;  1YEZ A;  2JEB I;  4LFB L;  5IP9 G;  1DGS A;  4LF6 Q;  1FJG L;  3I2Z A;  4LFA Q;  2N8N A;  4C3J H;  1N33 Q;  1U5K A;  4QJF A;  3OTO L;  1G51 A;  3J81 i;  1VQM A;  2R7Z G;  1CKN A;  2ASB A;  4O2D A;  2Z6K A;  4DK6 C;  1SR3 A;  2K14 A;  4GLV B;  3F1Z A;  3M85 A;  5IP7 H;  3NEL A;  2UUA L;  2N3S A;  2FXQ A;  1E1O A;  3EIV A;  1HH2 P;  4P73 A;  4DV3 L;  1VQE A;  2NN6 G;  4JI2 L;  4OO1 I;  2IT1 A;  4IOC A;  1UE6 A;  3D0F A;  4JC0 A;  3A5Z B;  3KJO A;  4YWL A;  5LMN Q;  4JOI C;  3PO3 H;  1X65 A;  4A4I A;  3CCU A;  1N34 Q;  1PH6 A;  1VQK A;  1EUJ A;  1GVP A;  1OXV A;  5IP9 H;  3T1H L;  3UDX A;  1TWF H;  3CCM A;  1PH1 A;  2K5N A;  5C3E G;  4DK3 C;  1V43 A;  1K9M C;  1KC8 C;  1WCM H;  2KHI A;  1JJ2 A;  2R7Z H;  3KFU A;  1K0R A;  1XTD A;  2E8G A;  1VQ8 A;  1XNQ L;  3S1N H;  1S72 A;  2IHF A;  3T1Y Q;  4A3I H;  1X9N A;  2HHH L;  3M7N A;  1V1Q A;  4JBJ A;  1Y1W G;  1HZC A;  4GOP A;  2PQA B;  3AFQ A;  1XMO Q;  4KI0 A;  4PZ7 A;  3GTG H;  3TQY A;  4X62 Q;  1KD1 C;  1G29 1;  2VZA A;  4JBK A;  4IFD I;  3GTL H;  1I94 Q;  4B3R L;  3JAM i;  5AJ3 L;  1FL0 A;  2WAQ E;  2OCE A;  4J15 A;  3UDF A;  2ZM6 L;  2VQE Q;  1M1K C;  2A8V A;  2JA8 G;  2OQ0 A;  3H3V I;  3HOU G;  3GTO H;  4X6A H;  2ZTC A;  1XNR L;  2WB1 G;  1I5F A;  5IYD G;  3GTM H;  1V9P A;  2D0O A;  4LF9 L;  2RHS B;  2B63 H;  3G71 A;  1S3O A;  4LFB Q;  3KF6 B;  2GVB A;  4JBW A;  4C2M H;  5C3E H;  3F2D A;  4DR1 L;  5J3B A;  4LF8 L;  3PUW A;  1FJG Q;  4IOA A;  4K0K Q;  4QGU A;  3GO5 A;  1IBM L;  3S2H H;  4C3H H;  4EX5 A;  2E5L L;  1BBW A;  3F2B A;  4A76 A;  4TQU S;  4IPC A;  2F4V L;  1LYL A;  1L1O C;  4DKA C;  1VQA A;  4DR5 L;  3E0E A;  1HNZ Q;  3W5O A;  4JI2 Q;  2NVT H;  2NZH A;  2MNA A;  1VQB A;  4BA1 I;  1C0A A;  1X6O A;  4LF7 L;  4DV2 L;  1SRO A;  3ULP A;  2K5V A;  2JA8 H;  3ULL A;  1NMF A;  3E9H A;  1YJN A;  2GN5 A;  2R7D A;  3KJP A;  3FKI G;  5JEA G;  4LF5 L;  3PF4 A;  2R6G A;  5GAE C;  4LWC A;  1PHJ A;  1R9T H;  5C0X J;  4OWT B;  1N32 Q;  4A3C G;  1MJC A;  4HIK A;  4JYA L;  2XGT A;  4AYB G; 
#chains in the Genus database with same CATH topology
 2XRS D;  3PV0 A;  4NP5 A;  3S17 H;  4M8A A;  1K0S A;  1CHP D;  3HOW B;  5FJ8 G;  1BO0 A;  1UNS A;  4JK1 C;  2EOT A;  2NTS A;  3K0X A;  3S15 B;  4K8I A;  4YCW A;  2JA5 G;  3SXH A;  2EY1 A;  3NQI A;  3KK7 A;  3T53 B;  1WYD A;  1MHW C;  2E5L Q;  4A3C H;  3AYH B;  2B29 A;  4IUQ A;  2K5D A;  2MHV A;  4G4K A;  2MP1 A;  1NE3 A;  4DV0 L;  1QVG A;  2IY5 B;  3IAY A;  2E76 C;  1Q8I A;  2MO1 A;  2F0Q A;  4GZY C;  1IL8 A;  4ZK9 B;  2UXC L;  1GUN A;  2YU9 H;  2IW3 A;  1E2W A;  4BY1 B;  3I4M H;  1SEB D;  3RZO B;  3T13 A;  2IX0 A;  4HSV A;  1QCB D;  3PO3 G;  2BE5 C;  2E2I B;  1VQ4 A;  1HPC A;  3BVZ A;  5A35 A;  2HQL A;  2K01 A;  1PH4 A;  3RLF A;  1M90 C;  2E2D C;  1WCM G;  1QVC A;  4FXK C;  5M3F G;  1HRJ A;  1AE3 A;  1LTR D;  3GP7 A;  5M5Y B;  4X64 Q;  1XPO A;  1EOT A;  5FKA C;  1HNZ L;  3AB9 A;  3CPW A;  1LTS D;  5KND A;  3K80 C;  1O7Z A;  4K5X A;  3CHB D;  1VQP A;  3TRZ A;  2NB0 A;  1F9Q A;  1PV4 A;  2PQE A;  3B6Y A;  3NTH A;  1Q82 C;  4DFA A;  3E9I A;  4DV6 L;  3R3O A;  3UE1 A;  2HD3 A;  2F0T A;  3F2C A;  1VF7 A;  4CDD C;  2Y0S B;  4DV0 Q;  1JMC A;  4L63 B;  5BR8 L;  1D6E C;  1IYU A;  4G7O C;  1TXY A;  1PH3 A;  4CKC A;  1YHA A;  2UXC Q;  1PYW D;  2DJG C;  5K36 H;  1OO9 B;  4BXX H;  1YHQ A;  1YHB A;  2BA1 A;  3CC2 A;  4DN4 M;  2DNE A;  1BXT A;  1Y1V H;  1X3Q A;  3EA6 A;  2EY2 A;  4KN4 C;  4A93 H;  4XT3 B;  3O13 A;  1IBL L;  4DR4 L;  2FHT A;  1TS5 A;  2R7Z B;  3EVQ A;  2ZTE A;  1LT3 D;  1HNW L;  5IOD A;  1GM5 A;  4JI6 L;  2XWJ B;  1G2T A;  5IGG A;  2Z0S A;  3EBE A;  4NW2 A;  1ILP A;  1E24 A;  2EYM A;  5A2Q L;  2R92 G;  3J81 j;  3GTO B;  4DUY Q;  2A73 B;  1X3F A;  2V4D A;  1WJJ A;  1F2M A;  2K1B A;  4X65 L;  5C3E B;  4DV6 Q;  2Z6K C;  3C46 A;  4OX9 Q;  3CD6 A;  3DM1 A;  1NCV A;  1NR4 A;  4K8J A;  1VQO A;  3HFZ B;  5BR8 Q;  1GUW A;  1UWV A;  1X56 A;  3RUZ A;  3HOW H;  1LAB A;  3I7F A;  1BQQ T;  4RH6 A;  5E1F A;  4QIW B;  2J7Z A;  1J8I A;  4A3L H;  5FLX E;  2OXP A;  1Q46 A;  3NEM A;  4R1J A;  4KK7 A;  4DF7 A;  1CK1 A;  3LWU A;  5G3L D;  3QIA A;  2XSC A;  3J7A V;  5IYC H;  3I4M G;  1Y14 B;  1QB5 D;  3TRE A;  4JOI A;  1PRT B;  1IHZ A;  4L8J A;  5M5W H;  1XWE A;  4GOP C;  4HCS A;  2R3Z A;  2V1C C;  4YCU A;  2Y0S E;  4DR6 Q;  2VS1 A;  1B2T A;  2SOB A;  4BY1 H;  4HCE A;  2F0H A;  2H1E A;  3DMU A;  1K8A C;  2E2I H;  1KDA A;  4M1U B;  3RR5 A;  4A3M G;  5JJZ A;  1TY2 A;  2XVS A;  4X65 Q;  1XPR A;  3ICE A;  4H7B A;  2A68 C;  4HJ7 A;  3D31 A;  4OHJ A;  2IPK D;  2ZJQ A;  4LK1 C;  1XX8 A;  3M4Y A;  1WTQ A;  1D8L A;  5M5Y H;  4FDB A;  3TEH B;  1Y8O B;  3W1G A;  3DLL A;  4CDF C;  2ZXO A;  4MTK A;  1SBB B;  2CWP A;  3STB D;  5K36 G;  1K8O A;  5CV7 A;  3CCV A;  3ZJY C;  1PFB A;  1JB3 A;  1I3Q B;  4RCO A;  2EQS A;  4NXN L;  3G6J B;  2B8F A;  3MXN B;  1Y1V G;  1IKM A;  2B2U C;  1KLG D;  3CC4 A;  1BCP D;  4A93 G;  1G91 A;  3BDC A;  1I6H B;  4LFC L;  1EYG A;  3BYY B;  4K5V A;  4QIW E;  2C35 B;  3DXJ C;  4OL7 A;  2UUC L;  2B39 A;  3I3C A;  1DD2 A;  4EQP A;  1SFO H;  1K8G A;  2A19 A;  1OTC A;  4DV1 L;  3V2T A;  2R93 H;  2MO0 A;  2XRQ D;  1EQQ A;  1TWG B;  4DPG A;  2NVY B;  1VCI A;  4PZ6 A;  3TS2 A;  1Q86 C;  3L3O C;  4IUR A;  2UXB L;  4FF1 A;  4A3I B;  3HOW G;  4BBS H;  1HZB A;  3KLW A;  4A3L G;  3NWT A;  1LT5 D;  1CTM A;  2ENB A;  1ESR A;  4DXF A;  1NTG A;  3FPU B;  5LMN W;  3I91 A;  4NXN Q;  5IYC G;  3DEO A;  3LGJ A;  2KA7 A;  5LHY 1;  1W3S A;  4RKL A;  3S16 B;  3BJU A;  4OWX B;  2F3I A;  4LFC Q;  1TR5 A;  2RSO A;  4KLK A;  2C9O A;  1DON A;  1CM9 A;  2D9U A;  1DXM A;  4AQY L;  5ELN A;  4JI1 L;  2B8G A;  2WII B;  1CKO A;  2AKW B;  3BDL A;  2UUC Q;  1Q3L A;  3S2D H;  4B08 A;  3R2I A;  3P1H A;  4BY1 G;  5IYD H;  1RHP A;  3KF8 B;  4LF4 L;  1PZK D;  4DV1 Q;  2K75 A;  4WRD A;  3U9S A;  1CQV A;  4JI4 L;  1BVS A;  4O1N A;  2WAC A;  4X66 L;  5CV6 A;  2HHH Q;  1YJW A;  4NXM L;  1EZ8 A;  2VY3 A;  4Q0F A;  1B8A A;  2UXB Q;  4O42 A;  2NWG A;  3DEP A;  3D4R A;  3VDY A;  4IZ8 A;  1B44 D;  4KN7 C;  1XNR Q;  1LTA D;  3MXN A;  2ZJP A;  5LMN L;  1Q81 C;  2EYH A;  1GD7 A;  4DR1 Q;  1Q90 A;  1AP0 A;  4WJ4 A;  5CC4 A;  2Z8L A;  4Q5V A;  1VQ6 A;  2ID0 A;  2RDF A;  3GTP B;  1I50 B;  1NMG A;  3M7G A;  1VQC A;  4ULL A;  3KYH C;  4HID A;  1FVI A;  4JBM A;  2Y0S G;  4AQY Q;  5FLM H;  1IL2 A;  4LF7 Q;  4DV2 Q;  1PZI D;  4QUC A;  1UEB A;  4X62 L;  1UE1 A;  3GD7 A;  2O5I C;  3W2D A;  2A68 D;  1EY6 A;  5D3D A;  1TII D;  1S5E D;  4FXD A;  1PTO D;  1HJP A;  1YEZ A;  4RGO S;  4CJ1 B;  1KAA A;  1A6X A;  3GTQ B;  2RDG A;  2OEO A;  1STA A;  1TY0 A;  1D5X C;  2NTT A;  2R7Z G;  2X6L A;  1DOM A;  2CVR A;  2KJX A;  4BWG B;  5BN3 A;  4XQN A;  5IGF A;  3JAM L;  3MXG A;  3T51 B;  4CJ0 B;  5IGE A;  4DV3 L;  1HH2 P;  2K7V A;  4QB4 A;  2NN6 G;  2IT1 A;  4IOC A;  2JA6 B;  1TKW B;  3KJO A;  1AW7 A;  5LMN Q;  1EQT A;  1PH6 A;  5IP9 H;  1OXV A;  3UDX A;  3CCM A;  1RD9 D;  5ISR A;  5C3E G;  4I7Z C;  1KC8 C;  4BBR B;  1E2Z A;  1RCV D;  4A3K B;  4KTA A;  5CBA E;  3KFU A;  1K0R A;  4N9T A;  4I65 A;  4A3I H;  4JBJ A;  1EYC A;  4TKO B;  5A2Q E;  1QNK A;  4KI0 A;  4PZ7 A;  3VR3 A;  3KF8 A;  1C8C A;  4X62 Q;  3BZD B;  2VZA A;  3JAM i;  2OCE A;  3I90 A;  3UDF A;  2OQ0 A;  2DY8 A;  3H3V I;  4TRD A;  2NVX B;  3GTM H;  1I5F A;  5IYD G;  3MFG A;  4LF9 L;  3NHH A;  2DJF C;  1LT6 D;  3SVM A;  3PUW A;  1PFN A;  1T5X D;  2Z1C A;  1XYI A;  5CV9 A;  1BBW A;  4A76 A;  1LYL A;  4DKA C;  1GUG A;  2NZH A;  2MNA A;  1VQB A;  4N9P A;  1SRO A;  3ULL A;  2E75 C;  2KVM A;  2F3W A;  3HKZ B;  2BOS A;  3GV6 A;  2VXW A;  3SK6 A;  2PO4 A;  5C0X J;  1N32 Q;  1TWA B;  5FLX c;  4OXP A;  1KLU D;  4K5W A;  2JSO A;  5FLM G;  3HOX B;  4QY7 A;  1PH2 A;  5BN5 A;  5CYU A;  1A63 A;  3GDE A;  3FKI H;  1UE5 A;  2PI2 E;  4IUV A;  2AMC B;  1WTW A;  4YCV A;  1JQY D;  4LF9 Q;  2OTJ A;  3GTP H;  2F0I A;  1X55 A;  1I50 H;  5M9O A;  3QB3 A;  3URY A;  1NUC A;  1SNQ A;  4KD4 A;  3QR8 A;  1K83 H;  5ELC A;  2A6E D;  2ALY B;  4OIJ A;  1PFM A;  4IJH A;  1YNN D;  1TQO A;  4JV5 L;  1ASZ A;  3VYR A;  2RDH A;  5FJ8 H;  4UY8 C;  1QE6 A;  2PI2 A;  2BA0 A;  3OPO A;  4JI0 Q;  3S1R H;  2JK8 A;  1H9S B;  2N88 A;  2VL6 A;  3BZC A;  2JA5 H;  2JA7 B;  3FDT A;  3K0Y A;  1HNX L;  2YTV A;  1T5E A;  4P72 A;  1S5F D;  3GTQ H;  2KCM A;  1NY4 A;  3EQL C;  3M3Y B;  3CC7 A;  2KHS A;  3A5U A;  1T9H A;  4DGZ A;  4KMU C;  3VA5 A;  2A5H A;  1SYB A;  2I07 B;  3RN2 A;  1S5B D;  3HG9 A;  4R8N A;  2I46 A;  2NYZ D;  4IPH A;  4A3I G;  2P5Z X;  4APV A;  1S5C D;  2CFM A;  5J1Z A;  1PDQ A;  4GN5 A;  4IFD J;  3PMF A;  1CA6 A;  2LFN A;  2H5X A;  2N55 A;  1STH A;  3HKZ E;  1PFS A;  4ZAI A;  2RKS A;  3SK8 A;  3SGI A;  2JYO A;  4BBR H;  3VA7 A;  4A3K H;  4HIM A;  4F87 A;  1JOQ A;  4JV5 Q;  3A0J A;  5M3F H;  1ONL A;  4FNF A;  3MXP A;  2BDO A;  3ND9 A;  3H94 A;  1EL0 A;  4HED A;  1MKH A;  2F0W A;  4GNX C;  3IRB A;  5C0X H;  1O7I A;  5ELF A;  3VR4 A;  2WFW A;  1DJR D;  4L5S A;  2J0T D;  1FGU A;  3I4O A;  3A56 A;  4C1N I;  1XPU A;  5KYI A;  1HNX Q;  2SDF A;  1L1O B;  4DR7 L;  5E7N A;  2F3V A;  1K73 C;  1WD0 A;  2I5H A;  3CMA A;  3WOE A;  4Y7N B;  1U4R A;  4P2C B;  1SRU A;  3PUV A;  5IYB H;  3EJI A;  1HTL D;  4RMF A;  5KNC A;  2HUG A;  5KEE A;  1KRS A;  3I70 A;  4UPA A;  2K03 A;  4IUU A;  1CQF A;  2KCN A;  5EPJ A;  2RQX A;  1ZKO A;  3CPF A;  2KED A;  4DV7 Q;  1B3A A;  1TWA H;  1BNZ A;  1C7Y A;  4C2M B;  4JI3 L;  4ZUI A;  2UXD L;  1C4Q A;  3GTJ B;  3KDF B;  3HOX H;  5IY0 A;  1OXU A;  3KLS A;  4CJ2 C;  4F88 A;  1Y1W B;  2HT1 A;  2WKD A;  4RGM A;  1IZ6 A;  2Q2H A;  4X64 L;  3NXW A;  3A54 A;  2R92 H;  2D0P A;  4CHT B;  3HOU B;  4WJ3 M;  4YY3 L;  4DR7 Q;  2XTI A;  3A8J E;  1U4L A;  4YIJ A;  3OMG A;  5E4W C;  1EOV A;  1D1K A;  2F0S A;  3IKJ A;  3I4L A;  1X3E A;  3IFD A;  4IFD H;  2Q2U A;  3K7A B;  2ATW A;  1D7Q A;  1A3T A;  4J1M A;  2EJM A;  2SNM A;  2B2W C;  4AH6 A;  1Z9F A;  2ES2 A;  1BUV T;  2QDB A;  1N36 Q;  2JA7 H;  3U4V A;  4H13 C;  2EZV A;  2JA6 G;  1HXY D;  2K6A A;  2LXJ A;  1AZP A;  1C48 A;  3CME A;  3KLR A;  4DV4 L;  1GUS A;  5EGT A;  1VQH A;  4IUP A;  4A75 A;  1SYD A;  4RG1 A;  3M3Y H;  3STB C;  4JI3 Q;  2UXD Q;  4TSS A;  4BBR G;  3JAM E;  4A3K G;  3PGZ A;  3OIQ A;  4HJA A;  4AYB B;  1JOK A;  2AWN A;  3CCS A;  3TZU A;  1LV9 A;  2F0P A;  1BCP C;  1L1O A;  3MFY A;  1SE2 A;  5C0X G;  1YIJ A;  4YY3 Q;  4A3E B;  1B7Y B;  2Z4I A;  5M3M B;  4A3M H;  3H0G B;  4DV5 Q;  3BVG A;  3MWY W;  3OWF A;  5J22 A;  1S4Z A;  4A3B B;  1D2B A;  4DUY L;  2Z9H A;  5FO9 B;  4MN3 A;  3TP7 A;  1PYS B;  4OX9 L;  4LUV A;  2I0Q A;  1SLJ A;  2L55 A;  3P20 A;  2LXK A;  4C3J B;  2AUK A;  2F0K A;  3J7A 5;  4EQN A;  3K8A A;  5IYB G;  3NUC A;  4MZ9 A;  4RHR A;  2EJF C;  2I5L X;  2O2L D;  4DV4 Q;  3D8G A;  4DU9 A;  3QOJ A;  4PMW A;  4K2K A;  2LS0 1;  3HKZ G;  2E74 C;  3ERQ A;  3PUZ A;  5IGC A;  5J39 A;  1FNW A;  2VQF L;  3AU7 A;  3KDF A;  4Y7N H;  4X3K A;  3G4S A;  3F2U A;  4GKK Q;  5DLQ E;  5CR3 A;  2UU9 L;  3G48 A;  3TP8 A;  4DR6 L;  4P74 A;  3HOX G;  4PQX A;  1CKN B;  1Z47 A;  1SNM A;  2CQA A;  3OSO A;  3H15 A;  3GTL B;  3CP0 A;  2B2V A;  3CCR A;  5LL6 S;  3K5L A;  5EJW A;  5JVG 3;  1EQR A;  2EYJ A;  1PXU A;  3CKI B;  4ALP A;  4IPD A;  3Q6S A;  3OTO Q;  3GTJ H;  2TSS A;  5JOB A;  1U9R A;  1Y1W H;  4IFD G;  4AYB E;  1RKN A;  2UUA Q;  4IO9 A;  1JJC B;  2N49 A;  3CW2 C;  1VQ5 A;  3E5S A;  1S40 A;  3SE0 A;  3HOU H;  3S15 H;  2OF1 A;  3RNU A;  2NZ1 D;  4ZYS A;  1JB7 A;  2JA7 G;  3M4O B;  2D62 A;  4HMI A;  2L5T A;  1X54 A;  5KRU A;  2VQF Q;  4KHP L;  1VS0 A;  2KUM A;  2KCC A;  1KHI A;  2F0G A;  3ND8 A;  1BOS A;  3MZ5 A;  4GLX A;  1XNQ Q;  3K7A H;  4LF6 L;  5JPM C;  4LFA L;  2JJQ A;  1YNX A;  3WWV A;  1QWY A;  2B2U A;  2UU9 Q;  5EPL A;  4JVZ A;  5AJ3 Q;  4YWK A;  4HJ5 A;  3CAM A;  5I2X A;  3I55 A;  4RA8 A;  1I6V C;  3RZO H;  5GAG C;  4X3U A;  2K28 A;  3I56 A;  1V8Q A;  1LUZ A;  4P71 A;  2Q8I B;  4ME3 A;  2PW7 A;  1IBM Q;  2L9H A;  3FVQ A;  1E7Z A;  1HQM C;  5G3L F;  5CGK A;  3J81 L;  2F4V Q;  3I4N B;  4OEL B;  1SYG A;  5FO8 B;  3TS0 A;  1PTO C;  4UAI A;  3G6E A;  2SNS A;  2EDG A;  3GQB A;  3GTK B;  4DXG A;  4QCL A;  3AEV A;  2XWB B;  5DM6 3;  1ENC A;  5GQO A;  1A0I A;  5EKK A;  1XMO L;  3D4W A;  1ET9 A;  1ZYR D;  3H0G H;  1I94 L;  2CKZ B;  1U4P A;  1LT4 D;  4R9W A;  4LF5 Q;  1V1O A;  4KHP Q;  4A3B H;  1KTK A;  1STE A;  2JEB I;  1SDF A;  4LFB L;  1RDP D;  1BF4 A;  4LF6 Q;  1FJG L;  4LFA Q;  4C3J H;  1CA5 A;  1G51 A;  2CW0 D;  3J81 i;  3K5N A;  1VQM A;  1CKN A;  2ASB A;  4O2D A;  2AQ2 B;  1K28 A;  1A15 A;  1AN8 A;  3OMC A;  3NEL A;  4JI2 L;  2FXQ A;  3Q24 A;  1A3V A;  3D0F A;  4JOI C;  1X65 A;  1GVP A;  1YNJ D;  3KBX A;  5D65 A;  1PH1 A;  2PZT A;  2E2J B;  1J9O A;  1K9M C;  1E0B A;  2WV6 D;  4EGV A;  3NK9 A;  2R7Z H;  3RD4 A;  2E8G A;  1I4Q A;  3LNN A;  1S72 A;  2IHF A;  1VMP A;  1U4M A;  1CT1 D;  5D14 A;  3T1Y Q;  1X9N A;  2HHH L;  1Y1W G;  2PQA B;  1EY4 A;  1XMO Q;  1BCP F;  2NN6 H;  3SEB A;  3TQY A;  1G29 1;  5IGD A;  4JBK A;  2FMM A;  3GTL H;  1I94 Q;  4S3S A;  2VQE Q;  1F9P A;  2ZM6 L;  4B9X A;  2VUM B;  3HOU G;  3WDN A;  4A3F B;  3GTO H;  1XNR L;  1V9P A;  2D0O A;  4PMB A;  4LFB Q;  3G71 A;  1S3O A;  1SND A;  2GVB A;  4JBW A;  5C3E H;  4DR1 L;  1JWU D;  4LF8 L;  1FJG Q;  4K0K Q;  3E3X A;  2EJG C;  1MGS A;  3GO5 A;  3TP5 A;  2BDN A;  4EX5 A;  5C4J B;  3OOC A;  2QEJ C;  4TQU S;  3J80 L;  5COR A;  2PZW A;  4J6H A;  1VQA A;  3E0E A;  5EKI A;  2QIL A;  4JI2 Q;  2B2T A;  1EY8 A;  1X6O A;  4LF7 L;  4DV2 L;  2K5V A;  3CQZ B;  4BY7 B;  4HTH A;  5EPK A;  1GHJ A;  4CDC C;  2R7D A;  1DM0 B;  1M4V A;  1A2U A;  1W6J A;  2F0N A;  3DUZ A;  4OWT B;  4KJN A;  3X3N A;  4JYA L;  4AYB G;  4U67 3;  1IYV A;  4OWW B;  4XIG S;  1RL2 A;  3J80 i;  2A6E C;  4KKU A;  4JI5 L;  1YNN C;  2HDL A;  3IL8 A;  1K3R A;  2F1M A;  3FRP B;  3UI2 A;  2ZM6 Q;  1WTH A;  4KHV A;  3PO2 B;  1X3P A;  1GHK A;  4A3E G;  2F0F A;  5M3M G;  3H0G G;  3RN5 A;  2N78 A;  2X69 A;  4LF8 Q;  1TS2 A;  4KY5 A;  1B50 A;  1AH9 A;  3I4N H;  4A3B G;  1STY A;  2Q8T A;  1HUM A;  1VQF A;  2IHE A;  1TS4 A;  2F0U A;  3HP3 A;  4PV1 C;  5M5X B;  5KNB A;  1SE3 A;  1QUQ B;  4C3J G;  1HHV A;  1G6P A;  1KIX A;  5E3F A;  1YIT A;  1SMX A;  4DAY B;  2B2Y A;  5HY6 A;  4DNR B;  3EN2 A;  5IT9 L;  3N6R A;  3LWE A;  1SN8 A;  1VDZ A;  3Q8D A;  4JW0 A;  1L0W A;  2E2H B;  1I4R A;  2NN6 I;  5DNF A;  1I3Q H;  5KGU A;  3JAM c;  1YVC A;  1TWC B;  1WTO A;  4CKE A;  1HA6 A;  1ENA A;  3H3V C;  2L1B A;  1M8A A;  1I6H H;  4G7Z C;  4KD3 A;  4PG3 A;  2PQA A;  4JYA Q;  1II3 A;  3TP6 A;  1X3G A;  5JJI A;  1ROD A;  5NUC A;  3BYT B;  4POG A;  2JA9 A;  4ABN A;  4MIU A;  4R4C A;  4JI5 Q;  1VQJ A;  2M9V A;  2WKC A;  3NWS A;  4B3T Q;  5H1S E;  1A62 A;  3T56 B;  1KNA A;  1MIU A;  4GNX B;  4G7H C;  3K5O A;  1TWG H;  1JC7 A;  2NVY H;  1EY5 A;  2HDM A;  2K52 A;  2LMC B;  2BCO A;  4A3D B;  4B9W A;  1PTO F;  1IYJ B;  1JOO A;  3HOZ B;  1N32 L;  3JC6 6;  2RCN A;  1Q8K A;  5IOC A;  3OYY A;  4PNY A;  1P8L A;  1PA6 A;  2VUM H;  2K04 A;  2FJ2 A;  3RZD B;  5C4X B;  5IIF A;  2Z6B A;  5D3I B;  5F2D A;  1XMQ L;  2CQO A;  1EYD A;  4UP7 A;  3M4P A;  3P75 A;  4JI7 L;  5C4J H;  3S16 H;  4L5Q A;  1FR3 A;  4ZKC B;  5C5M A;  4LUO A;  3Q22 A;  4MHE A;  2JEA I;  1KDB A;  3TME A;  4FXG C;  3TN2 A;  5GAD C;  2JE6 I;  3CQZ H;  1EIF A;  4BY7 H;  5EQ0 A;  3NQT A;  1H9R A;  3UDI A;  1SXT A;  1TT2 A;  4YHH Q;  3BDO A;  2EPB A;  4KKS A;  1BKB A;  1QVF A;  4HMJ A;  4JI0 L;  2CH4 W;  1B4O A;  2NUC A;  1E22 A;  3DHQ A;  4HR7 B;  1OXS C;  2L12 A;  1JOR A;  2EE1 A;  1WI5 A;  4HAE A;  1L2F A;  1QUQ A;  2L15 A;  1PH7 A;  1WTP A;  1HA5 A;  3I4N G;  4C3H B;  2L11 A;  1A8V A;  1EWH A;  4DAY A;  4B3M L;  4OO1 H;  3KOJ A;  2K32 A;  4KY7 A;  3VR2 A;  3KBG A;  2NVT B;  1EY7 A;  3PO2 H;  1HZ9 A;  1NR2 A;  2L4N A;  2JA8 B;  3L7Z C;  2UUB L;  1XMQ Q;  3J81 E;  4H44 C;  1SNP A;  3MAQ A;  2EY5 A;  4DR2 L;  4JI7 Q;  3T16 A;  4HIO A;  4RHS A;  4C3I B;  1KQS A;  1I4G A;  2YV5 A;  5M5X H;  1EFW A;  1ENF A;  3PUX A;  4R4I A;  1AFP A;  5ELO A;  2RSN A;  1HR0 Q;  1NSN S;  3K7U C;  4P75 A;  4JPB W;  1OXX K;  4R8I A;  1TVX A;  1WVL A;  1O80 A;  2E2H H;  4GNX A;  1ET6 A;  1TWC H;  1Y69 U;  4XTC S;  1BCP B;  2A6H D;  4OEM B;  2BH8 A;  5JAV A;  5C4H A;  1PYB A;  4XXE A;  2F52 A;  4OIK A;  2QEX A;  1LTG D;  4B3M Q;  2NZO A;  3ER0 A;  4DNT B;  5FOB B;  1PRT D;  1DZ1 A;  4RCN A;  1GJX A;  3FP9 A;  1N8R C;  5IGB A;  2JXM B;  3L0O A;  1CKM A;  1GOZ A;  2G9H D;  1EU4 A;  2Q8R E;  3MEF A;  2JA6 H;  1JJG A;  2UUB Q;  2EYO A;  2AQ3 B;  1FYC A;  3CCJ A;  2YYZ A;  4FF3 A;  2VUM G;  4A3J B;  3V05 A;  4A3F G;  2OQK A;  4DR2 Q;  1V1P B;  3SHL A;  1EEF D;  5I6W A;  2ZTD A;  5EBC A;  5LL6 X;  4KHZ A;  3A55 A;  3KLS X;  4A3D H;  4DV7 L;  3HOZ H;  1BR9 A;  4FF4 A;  3PCO B;  4RGT A;  4CDE C;  3SK4 A;  5IWA L;  1F77 A;  3R8B A;  1LLR D;  3BG3 A;  2A74 C;  3RZD H;  5C4X H;  3ERS X;  1YJ9 A;  1CZW A;  4BY7 G;  3OWE B;  2NVX H;  4ODG A;  1LM0 A;  1Q12 A;  2MJ8 A;  5JPN C;  4LW1 A;  1RF2 D;  3J80 E;  2EVB A;  1GO3 E;  2K4K A;  2MQH A;  2EXZ A;  1PH5 A;  4R4T A;  1KRT A;  4C56 C;  3PIO 3;  3QWN A;  4OO1 G;  3S1N B;  3RMH A;  5I4D A;  1P16 A;  1C9O A;  2A1A A;  3DM3 A;  1ML0 D;  4ILW A;  4F8M A;  2B2W A;  5I9P A;  2MUY A;  3GTG B;  3MTS A;  3QJY A;  4POF A;  1B70 B;  3PO2 G;  1N36 L;  3ULJ A;  2ICE C;  4ZKB B;  5DEH A;  3Q0A A;  1G8Z D;  2OT2 A;  1XJV A;  2B63 B;  5FK9 C;  2Q2T A;  5C3W A;  3S2H B;  2DUD A;  5IWA Q;  2O4X A;  4NB3 A;  2IX3 A;  1Q1E A;  1H9S A;  2OTL A;  4K6D A;  1SMY C;  2RBM A;  4QUF A;  4ZLT F;  3UE0 A;  3S9W A;  1B9N A;  5L37 A;  4GOP B;  3IFT A;  3J7Z C;  3T1H Q;  1EY0 A;  4Y52 H;  1LTL A;  1SSO A;  5CMD A;  4JI8 L;  1WOC A;  4C3I H;  4O0A A;  2HIV A;  2RF4 A;  4N8X 1;  4DV5 L;  4XQJ A;  1SJH D;  3FMC A;  4RAU C;  1K8M A;  3UDG A;  5IT9 E;  1R9T B;  1N33 L;  4GN4 B;  1PVO A;  3TSS A;  2GVA A;  2EY6 A;  3MEH A;  4RWS C;  2R61 A;  2AQ1 B;  4QQB X;  4L5T A;  4LMQ D;  1CUK A;  1GKH A;  1V1P A;  2WAQ B;  3HZX A;  4UP9 A;  1PTO B;  3MA2 B;  3D6W A;  3C3L A;  4QL5 A;  2YTX A;  3K5M A;  5C0X I;  5HGQ A;  2CCZ A;  1Z7T A;  1IKL A;  1ZYR C;  1G6Z A;  3U50 C;  5C4Z A;  3K58 A;  1RTN A;  3WOF A;  4HN7 A;  3HS0 C;  4A3D G;  4DR5 Q;  5M5W B;  3HOZ G;  4GKK L;  2KEC A;  1VF5 C;  4KY6 A;  1PZJ D;  3M9B A;  4XYQ A;  2CW0 C;  3FPP A;  1LTT D;  4A3J H;  1KDC A;  2KCT A;  3K59 A;  5C4X G;  4K14 A;  1HTP A;  4JI8 Q;  5CV4 A;  4C1N K;  2IL8 A;  4ZCK A;  1SJE D;  3NSW A;  4RFB A;  4E6I A;  1B9M A;  1LTI D;  1PLF A;  2N8N A;  3KUP A;  1N33 Q;  4QJF A;  3U9O A;  3OTO L;  1YNJ C;  4FYD A;  5T1I A;  1EY9 A;  2Z6K A;  4DK6 C;  1SR3 A;  2K14 A;  2NBF A;  3M85 A;  5IP7 H;  2UUA L;  1E1O A;  4P73 A;  3HOV B;  1STB A;  1VQE A;  1HUN A;  3A5Z B;  1D1I A;  3Q23 A;  1VQK A;  1EUJ A;  3A7A B;  2PPB C;  4DK3 C;  1V43 A;  4PMC A;  1B1Z A;  1JJ2 A;  4C3H G;  3S1N H;  1XNQ L;  2K33 A;  1I4P A;  1HZC A;  4GOP A;  3AFQ A;  3GTG H;  5I6Y A;  1BDO A;  1G2S A;  1KD1 C;  4IFD I;  1HFN A;  3C1E A;  4B3R L;  5AJ3 L;  2WAQ E;  2JA8 G;  4J15 A;  1M1K C;  4IAL A;  1MD2 D;  3QO2 A;  4A3G B;  2ZTC A;  2QW7 A;  1QNU A;  1O7Y A;  2B63 H;  1SFO B;  4G57 A;  3ONA B;  3KF6 B;  4C2M H;  3F2D A;  1E2V A;  1SYE A;  5J3B A;  4EVO A;  4C3I G;  2R93 B;  5KIX A;  5BN4 A;  1IBM L;  3LX0 A;  3S2H H;  3J7Y W;  4H0L C;  3F2B A;  3EFX D;  4IPC A;  3K6O A;  2F4V L;  1TU2 B;  1L1O C;  4ZQ3 A;  2O5J C;  1B3Q A;  1HNZ Q;  1HCZ A;  3W5O A;  3ULP A;  4BBS B;  3OHX C;  2ICI A;  2F03 A;  1NMF A;  1CI3 M;  2PZU A;  3E9H A;  1ILQ A;  2GN5 A;  4LF5 L;  1F2Z A;  1R4P B;  4LWC A;  1PHJ A;  1R9T H;  4J8Q A;  4A3C G;  1SMY D;  3NTI A;  1MJC A;  2HCC A;  3E0J A;  1GUO A;  2BH2 A;  5JJL A;  1KAB A;  4MNO A;  2A69 D;  4WFN 3;  2TMP A;  3J81 c;  1PTO H;  4B3R Q;  1YI2 A;  2F0V A;  4L6T B;  3CXC A;  2K50 A;  4DNI A;  3S2D B;  1H9J A;  1LAC A;  4A3J G;  5EKL A;  1ICF B;  4L5R C;  3MC0 B;  2CH4 A;  1IBL Q;  2WIN B;  4DR4 Q;  3PIO A;  2DN8 A;  4TVA B;  1H9K A;  2ZJR A;  3D6C A;  1FD7 D;  3I73 A;  1EZ6 A;  1HNW Q;  1EWC A;  3V96 A;  1N9W A;  4JI6 Q;  3AQQ A;  3T1Y L;  1MI2 A;  4RGN A;  2B2V C;  1EIG A;  2AWO A;  1IW7 C;  5IP7 G;  4A3E H;  3S1Q B;  1HZA A;  5M3M H;  1I4X A;  1IBK L;  4KV6 A;  2VQE L;  3G7L A;  5JVH 3;  2KOL A;  3PF5 A;  1LTB D;  2RA4 A;  1VQI A;  2Q2I A;  4K6L A;  3VR6 A;  1TWH B;  3F8T A;  3H91 A;  3S1M B;  4ME5 A;  4K0K L;  4LNQ A;  5I2Y A;  4R4Q A;  4U68 A;  5C44 B;  1IXR A;  3PIP 3;  4XT1 B;  2NVQ B;  3NEN A;  4DUZ L;  3HOV H;  5C5L A;  4N8F A;  3MVV A;  2BE5 D;  3ZYY X;  5DM7 3;  4BXX G;  2LSS A;  3KF6 A;  4BA2 I;  1MJE A;  3PSI A;  5GRO A;  3HRZ C;  3PUY A;  2B63 G;  2R7F A;  2FIN B;  1EFI D;  2PW5 A;  3C1F A;  3CRL C;  1O7L A;  1VQ7 A;  1Q1B A;  1RTO A;  1STG A;  3MXU A;  3OW2 A;  1HFG A;  1Q7Y C;  2MPM A;  4CKB A;  1GXD C;  3FHW A;  4R4O A;  4DK0 A;  1GUT A;  2F0E A;  3ERO A;  3SDZ A;  3J80 c;  1X32 A;  3BS1 A;  3R2T A;  2QA4 A;  5K5P A;  1PH8 A;  1IBK Q;  3HOY B;  4A3G H;  3T4A C;  1J5E L;  1QJO A;  2XIW A;  5CBE E;  1SAP A;  1D5Z C;  4RKB A;  3K81 C;  2RCF A;  1L0Y B;  4HSP A;  1DYQ A;  4NKL A;  4DUZ Q;  1PH9 A;  3S14 B;  1WFQ A;  1WD1 A;  3BZK A;  4H02 A;  4DK1 A;  1SE8 A;  3QOL A;  2WAQ G;  3M4O H;  4JCV E;  2CWA A;  4DR3 L;  3GTM B;  4UDU C;  3VR5 A;  4AIM A;  5TSS A;  2F0O A;  2WP8 J;  1EQV A;  1FGB D;  4EQO A;  4XQQ A;  2B3G A;  3U4Z A;  4DAM A;  1A2T A;  1QG7 A;  1QZH A;  2EYL A;  1NJI C;  4OON A;  2C5C A;  1NNX A;  2AUJ D;  4B3S L;  3H6M A;  4GKJ L;  1EWI A;  3W3A A;  1J5E Q;  4CBV A;  4B3T L;  1KNE A;  3D4D A;  4LUZ A;  1YBY A;  2WB1 B;  4GS3 A;  1NAP A;  5IT9 c;  1JWS D;  3H09 A;  1ESF A;  3SK5 A;  2AHO B;  4IJL A;  1QIL A;  2IWH A;  3GTK H;  3A8I E;  2PMZ B;  2A6H C;  2D5D A;  2RHQ B;  1JCK B;  5CV8 A;  2HQE A;  1Z6H A;  1FNV A;  2PNR C;  3L2P A;  3H3V H;  3TBI B;  5FO7 B;  3S1Q H;  1VQG A;  1O78 A;  1PRT C;  3NBH B;  3HOV G;  2X6G A;  4WOR A;  1SNO A;  2MFI A;  1U0L A;  1VQ9 A;  4DR3 Q;  1DOK A;  1SE4 A;  3FKI B;  5CV5 A;  3BVM A;  3DWQ A;  1TWH H;  4MTN A;  2QKI C;  3S1M H;  3OW7 A;  5ELB A;  1R4Q B;  5C44 H;  1AE2 A;  4FP5 D;  1K83 B;  1CSP A;  2B2T C;  3D3R A;  1MBY A;  1KL9 A;  2NVQ H;  1IW7 D;  4JI1 Q;  3M4Q A;  5DAU A;  1J6Q A;  3R93 A;  1WTR A;  4B3S Q;  2EYP A;  2KEN A;  4IN3 A;  4GKJ Q;  1UEA B;  2SEB D;  2EXD A;  4IPG A;  1HR0 W;  3HGB A;  3S1R B;  1Y8P B;  2EIF A;  4LF4 Q;  1JT8 A;  4YHH L;  1CSQ A;  4K2L A;  1UE7 A;  4A3G G;  5ELD A;  1HQR D;  2JA5 B;  4JI4 Q;  2F0D A;  1VQL A;  4LAA A;  1EEI D;  2E2J H;  4X66 Q;  4IUT A;  1K3B C;  2ZT9 C;  2YTY A;  2R93 G;  2CHB D;  3C2P A;  4NXM Q;  3HKS A;  3K57 A;  1KXL A;  2M00 A;  1AZQ A;  3A7L A;  2F0J A;  2F0L A;  2QF7 A;  5JEA J;  1KAW A;  1EIY B;  4V19 0;  4EQ5 A;  1WTX A;  4UP8 A;  4LJZ C;  4NMZ A;  3HOY H;  4BBS G;  1TS3 A;  4A3F H;  2H4O A;  5IE8 A;  1STN A;  3BU2 A;  3NBI A;  5LMU L;  5HGT A;  3PO3 B;  3U58 A;  4QF4 A;  2WB1 E;  1ICW A;  1F9R A;  4PZ8 A;  3OIP A;  2LKV A;  1JE5 A;  1TWF B;  3NPP A;  1UAP A;  4I7A A;  2VW9 A;  2HCI A;  3CCE A;  2L0C A;  2I5M X;  2B2Y C;  1JIC A;  1YZ6 A;  2PMZ E;  3S14 H;  1WCM B;  5M3F B;  4FO2 A;  1LO5 D;  2IJ0 A;  1HR0 L;  4F7X A;  2G5D A;  2XNA C;  4KJO A;  2JQO A;  2DY7 A;  3AFP A;  3ITP A;  2FFK B;  3E6Z X;  3I8Z A;  3RLN A;  3QG1 A;  2PYK A;  2HIX A;  2K5H A;  2QDL A;  3PIP A;  4XDX A;  2KBN A;  4GN3 B;  5ELE A;  3NBH A;  2VB2 X;  2VNU D;  4XYO A;  2PNH A;  3CCQ A;  1OXT A;  1CFM A;  2IX1 A;  1NBW A;  4DV3 Q;  1VQN A;  1MSH A;  2EYF A;  1PMR A;  1A3U A;  1ZEQ X;  1E1T A;  3PQI A;  4ZUJ A;  3CF5 A;  5LMU Q;  3TDQ A;  2GA4 B;  1EU3 A;  4JG2 A;  2PCF B;  4KKT A;  4YWM A;  4UHV A;  1RIP A;  3I72 A;  5JJK A;  1BBX C;  4DAV A;  5EAY A;  1XXG A;  3VYT A;  5C3X A;  2OWO A;  5C44 G;  1W2B A;  1F2Y A;  2KEE A;  2FMC A;  5I9O A;  4NPS A;  3S17 B;  1ZXT A;  1VQD A;  2QCP X;  2DGY A;  3NE5 B;  5GAH C;  3RLO A;  3P7J A;  5JEA H;  2R92 B;  4FVM A;  1XTC D;  3A74 A;  1BBU A;  5FLX L;  1N34 L;  3CU7 A;  3S24 A;  4HJ9 A;  3CCL A;  4DA2 A;  3DWP A;  4HJ8 A;  3X3M A;  3W1B A;  4IQZ A;  2QGQ A;  1QZG A;  1DCZ A;  3NP8 A;  5EBD A;  1UUP A;  4X3T A;  2RVL A;  1H95 A;  3FEW X;  4CGY B;  3MHB A;  1ASY A;  4V0B A;  3VYU A;  1E3P A;  4QMG A;  5E4X A;  3DWA A;  3HOY G;  3J7A F;  2KHJ A;  5COY A;  2YU9 B;  2ZXP A;  4GLA C;  3I4M B;  2Z4H A;  5IP9 G;  1DGS A;  3HEJ A;  3I2Z A;  1F2L A;  1U5K A;  1W6K A;  1JR0 D;  1MSG A;  4GLV B;  2ZXR A;  3F1Z A;  3SR1 A;  2N3S A;  3EIV A;  4Z9C B;  1PRT F;  4OO1 I;  1JE4 A;  4BS9 A;  1UE6 A;  4JC0 A;  1VMC A;  4YWL A;  3PO3 H;  2K05 A;  1FNU A;  4OGQ C;  4A4I A;  2G9D A;  3CCU A;  1SNC A;  1N34 Q;  4A3M B;  1S5D D;  1I4H A;  2D2C C;  5C6A A;  3T1H L;  2KQ3 A;  1TWF H;  2K5N A;  4IUN A;  1SYF A;  2K5W A;  1H9M A;  1L0X B;  1WCM H;  2KHI A;  5KYL A;  1XTD A;  1VQ8 A;  2LY7 A;  3CRK C;  3L9A X;  2K5Q A;  4WJW A;  4FF2 A;  3M7N A;  1V1Q A;  1F9S A;  2JP1 A;  1AEX A;  2J4X A;  3N52 A;  5HUR A;  1FL0 A;  2A8V A;  2MGS A;  2JN4 A;  4X6A H;  2WB1 G;  1SYC A;  2RHS B;  2F4I A;  4ZRZ A;  4IOA A;  1EIH A;  5T1G A;  1RJT A;  1D5M C;  1Y1V B;  4QGU A;  4C3H H;  3AMU A;  2E5L L;  4ID6 A;  4A93 B;  5AFW A;  2VB3 X;  4X3S A;  2M2L A;  1CZG A;  2DNC A;  1DOL A;  4DR5 L;  2NVT H;  1WTV A;  1C0A A;  4BA1 I;  1JWM D;  2JA8 H;  3NTK A;  1QOH A;  1CHQ D;  3VYS A;  3TZD A;  2A69 C;  1YJN A;  3KJP A;  3FKI G;  1EYA A;  5JEA G;  3PF4 A;  1Y8N B;  2R6G A;  5GAE C;  1B53 A;  4DAP A;  2F0M A;  4NDX A;  3A8K E;  2XN9 C;  4HIK A;  3GV3 A;  2XGT A; 
#chains in the Genus database with same CATH homology
 3PV0 A;  4OXP A;  4OWW B;  4XIG S;  1RL2 A;  3S17 H;  2BH2 A;  3J80 i;  5JJL A;  4MNO A;  4JI5 L;  5FLM G;  3J81 c;  4QY7 A;  5FJ8 G;  4B3R Q;  1YI2 A;  1PH2 A;  1K3R A;  2ZM6 Q;  3CXC A;  2K50 A;  3K0X A;  4DNI A;  1A63 A;  4A3E G;  3GDE A;  3FKI H;  1UE5 A;  2PI2 E;  5M3M G;  4A3J G;  2AMC B;  3H0G G;  4LF9 Q;  4YCV A;  4YCW A;  2JA5 G;  3RN5 A;  4L5R C;  2OTJ A;  2N78 A;  3GTP H;  1JT8 A;  4LF8 Q;  1X55 A;  1I50 H;  1AH9 A;  1WYD A;  3I4N H;  4A3B G;  1IBL Q;  4DR4 Q;  1K83 H;  2E5L Q;  4A3C H;  2ALY B;  3AYH B;  1VQF A;  2B29 A;  2IHE A;  3PIO A;  4IJH A;  4TVA B;  4JV5 L;  2ZJR A;  1QUQ B;  1HNW Q;  1G6P A;  1KIX A;  1NE3 A;  4DV0 L;  1YIT A;  1QVG A;  2IY5 B;  4JI6 Q;  1N9W A;  1ASZ A;  5FJ8 H;  3AQQ A;  4UY8 C;  3T1Y L;  2MO1 A;  1SMX A;  2PI2 A;  4DAY B;  5HY6 A;  2BA0 A;  2UXC L;  2AWO A;  3EN2 A;  4JI0 Q;  3S1R H;  2JK8 A;  2YU9 H;  1SN8 A;  5IP7 G;  2VL6 A;  4A3E H;  3Q8D A;  3BZC A;  1HZA A;  1L0W A;  5M3M H;  3I4M H;  1IBK L;  2JA5 H;  2VQE L;  2IX0 A;  2NN6 I;  1HNX L;  2YTV A;  4P72 A;  1I3Q H;  3JAM c;  3PO3 G;  3PF5 A;  1YVC A;  3GTQ H;  1VQI A;  2Q2I A;  2KCM A;  1NY4 A;  1VQ4 A;  3F8T A;  3CC7 A;  4K0K L;  1I6H H;  4JYA Q;  4PG3 A;  2PQA A;  4LNQ A;  2HQL A;  3A5U A;  1PH4 A;  3RLF A;  1X3G A;  1T9H A;  4R4Q A;  1M90 C;  1IXR A;  5JJI A;  1WCM G;  1QVC A;  5M3F G;  4POG A;  2JA9 A;  1AE3 A;  4R4C A;  3RN2 A;  4JI5 Q;  1VQJ A;  3NEN A;  4DUZ L;  3HOV H;  4X64 Q;  4A3I G;  4IPH A;  1XPO A;  1HNZ L;  3CPW A;  4APV A;  4B3T Q;  4BXX G;  2LSS A;  2CFM A;  3K80 C;  5H1S E;  1A62 A;  3KF6 A;  4GN5 A;  4BA2 I;  1MJE A;  4IFD J;  1VQP A;  3TRZ A;  3PSI A;  2H5X A;  3HKZ E;  1PFS A;  5GRO A;  1MIU A;  4GNX B;  3SGI A;  1TWG H;  1PV4 A;  3B6Y A;  4BBR H;  2NVY H;  3PUY A;  4HIM A;  4A3K H;  1Q82 C;  2B63 G;  2R7F A;  2K52 A;  3E9I A;  4DV6 L;  4JV5 Q;  3UE1 A;  3A0J A;  1VQ7 A;  1IYJ B;  1Q1B A;  3F2C A;  5M3F H;  4DV0 Q;  1JMC A;  1N32 L;  3OW2 A;  3JC6 6;  5BR8 L;  2RCN A;  1Q8K A;  1Q7Y C;  1MKH A;  1TXY A;  1PH3 A;  1YHA A;  4GNX C;  3IRB A;  3OYY A;  1O7I A;  2UXC Q;  3FHW A;  2WFW A;  4R4O A;  4L5S A;  1P8L A;  1FGU A;  3I4O A;  1PA6 A;  2VUM H;  4BXX H;  1YHQ A;  1YHB A;  3J80 c;  2QA4 A;  1PH8 A;  1IBK Q;  4A3G H;  1XPU A;  2BA1 A;  3CC2 A;  1HNX Q;  1J5E L;  1XMQ L;  2CQO A;  1L1O B;  4UP7 A;  4DR7 L;  3M4P A;  5E7N A;  1Y1V H;  1K73 C;  4A93 H;  4JI7 L;  5C4J H;  3S16 H;  2I5H A;  4L5Q A;  3CMA A;  4LUO A;  1IBL L;  3K81 C;  4DR4 L;  2JEA I;  1SRU A;  3PUV A;  5IYB H;  4DUZ Q;  5GAD C;  2JE6 I;  2ZTE A;  3CQZ H;  1EIF A;  4RMF A;  1PH9 A;  4BY7 H;  1HNW L;  1WFQ A;  1GM5 A;  3UDI A;  4JI6 L;  1KRS A;  3BZK A;  2Z0S A;  4H02 A;  1SE8 A;  4YHH Q;  2WAQ G;  3EBE A;  1BKB A;  1QVF A;  3M4O H;  1E24 A;  4UPA A;  4JI0 L;  5FLX c;  4JCV E;  2R92 G;  2CWA A;  3J81 j;  1E22 A;  4DR3 L;  1OXS C;  4DUY Q;  1WI5 A;  1X3F A;  3CPF A;  4DV7 Q;  1WJJ A;  1L2F A;  1QUQ A;  1TWA H;  4AIM A;  4X65 L;  2L15 A;  2WP8 J;  2Z6K C;  4JI3 L;  4DV6 Q;  1PH7 A;  1C7Y A;  3CD6 A;  3I4N G;  3U4Z A;  2B3G A;  4DAM A;  2UXD L;  1VQO A;  1A8V A;  3HFZ B;  5BR8 Q;  1QZH A;  4B3M L;  1UWV A;  1X56 A;  3KDF B;  3HOX H;  3KOJ A;  4OON A;  5IY0 A;  1NJI C;  3HOW H;  1OXU A;  2HT1 A;  3I7F A;  4B3S L;  4A3L H;  3PO2 H;  1HZ9 A;  1Q46 A;  3NEM A;  1IZ6 A;  2Q2H A;  4R1J A;  4X64 L;  4GKJ L;  2R92 H;  1EWI A;  2D0P A;  3L7Z C;  1J5E Q;  1XMQ Q;  2UUB L;  4B3T L;  4WJ3 M;  4YY3 L;  4DR7 Q;  4LUZ A;  5IYC H;  1YBY A;  4GS3 A;  1Y14 B;  2XTI A;  3I4M G;  3TRE A;  5IT9 c;  4DR2 L;  4JI7 Q;  4HIO A;  4JOI A;  1EOV A;  2AHO B;  4IJL A;  1KQS A;  2YV5 A;  5M5X H;  1EFW A;  5M5W H;  1X3E A;  3GTK H;  4GOP C;  2V1C C;  3PUX A;  4R4I A;  2Q2U A;  2RHQ B;  5ELO A;  4YCU A;  2Y0S E;  2ATW A;  2VS1 A;  4DR6 Q;  1D7Q A;  1HR0 Q;  3L2P A;  3H3V H;  3K7U C;  4P75 A;  4AH6 A;  1OXX K;  1Z9F A;  2ES2 A;  3S1Q H;  1VQG A;  3NBH B;  4BY1 H;  3HOV G;  1N36 Q;  2JA7 H;  2E2H H;  3U4V A;  4GNX A;  2JA6 G;  2LXJ A;  2MFI A;  3CME A;  1K8A C;  1U0L A;  1VQ9 A;  4DV4 L;  4DR3 Q;  1TWC H;  1VQH A;  2E2I H;  3RR5 A;  4A3M G;  4XTC S;  4A75 A;  1TWH H;  4RG1 A;  3M3Y H;  2BH8 A;  4MTN A;  3STB C;  4X65 Q;  1XPR A;  1PYB A;  4JI3 Q;  3ICE A;  3S1M H;  4HJ7 A;  2UXD Q;  3D31 A;  2F52 A;  5C44 H;  4BBR G;  1AE2 A;  2QEX A;  4A3K G;  2ZJQ A;  3PGZ A;  4B3M Q;  1CSP A;  4HJA A;  2NZO A;  3ER0 A;  1KL9 A;  2NVQ H;  1D8L A;  5M5Y H;  4JI1 Q;  2AWN A;  3FP9 A;  3M4Q A;  1J6Q A;  3CCS A;  1N8R C;  4FDB A;  3TEH B;  4B3S Q;  3W1G A;  3L0O A;  1CKM A;  3DLL A;  2KEN A;  3MEF A;  1L1O A;  2JA6 H;  4IPG A;  2EXD A;  1HR0 W;  4GKJ Q;  5C0X G;  1JJG A;  2UUB Q;  4LF4 Q;  1YIJ A;  2EIF A;  2CWP A;  3STB D;  2YYZ A;  4YY3 Q;  4YHH L;  1CSQ A;  3CCJ A;  2VUM G;  5K36 G;  1B7Y B;  1UE7 A;  4A3F G;  4A3M H;  2OQK A;  4A3G G;  3CCV A;  3ZJY C;  4DV5 Q;  4DR2 Q;  4JI4 Q;  1VQL A;  2E2J H;  4X66 Q;  2ZTD A;  2EQS A;  4NXN L;  4KHZ A;  2YTY A;  3MXN B;  4DUY L;  2R93 G;  1Y1V G;  4A3D H;  3CC4 A;  4DV7 L;  4NXM Q;  3HOZ H;  3HKS A;  1PYS B;  3PCO B;  4A93 G;  1KXL A;  4OX9 L;  4LUV A;  2I0Q A;  4LFC L;  1SLJ A;  2LXK A;  1EYG A;  5IWA L;  3J7A 5;  5JEA J;  1KAW A;  1EIY B;  4EQ5 A;  3K8A A;  4UP8 A;  5IYB G;  3RZD H;  4MZ9 A;  5C4X H;  3ERS X;  4QIW E;  1YJ9 A;  2C35 B;  3HOY H;  4BY7 G;  2UUC L;  4BBS G;  2I5L X;  4A3F H;  4DV4 Q;  5IE8 A;  2NVX H;  4PMW A;  3BU2 A;  1LM0 A;  1Q12 A;  5LMU L;  3HKZ G;  1SFO H;  1K8G A;  3U58 A;  2WB1 E;  2A19 A;  4LW1 A;  1OTC A;  3PUZ A;  4DV1 L;  4PZ8 A;  2R93 H;  2MO0 A;  2K4K A;  1GO3 E;  2VQF L;  1EQQ A;  3KDF A;  4DPG A;  4Y7N H;  1JE5 A;  1VCI A;  2VW9 A;  3G4S A;  2MQH A;  3CCE A;  1PH5 A;  4GKK Q;  4R4T A;  2I5M X;  5DLQ E;  1YZ6 A;  1KRT A;  2PMZ E;  4PZ6 A;  3S14 H;  3TS2 A;  1Q86 C;  2UU9 L;  4OO1 G;  2UXB L;  3G48 A;  4DR6 L;  4P74 A;  3HOX G;  3HOW G;  1HR0 L;  1P16 A;  1C9O A;  2A1A A;  1CKN B;  1Z47 A;  3DM3 A;  4BBS H;  1HZB A;  3H15 A;  4POF A;  3KLW A;  1B70 B;  2JQO A;  4A3L G;  3PO2 G;  1N36 L;  3CP0 A;  3AFP A;  3ULJ A;  3CCR A;  3RLN A;  1NTG A;  5LMN W;  4NXN Q;  2HIX A;  2K5H A;  5IYC G;  1EQR A;  1XJV A;  3LGJ A;  3PIP A;  4ALP A;  4IPD A;  2KBN A;  1W3S A;  3OTO Q;  4GN3 B;  3GTJ H;  3BJU A;  4OWX B;  2F3I A;  2Q2T A;  4LFC Q;  4KLK A;  2DUD A;  5IWA Q;  1Y1W H;  4NB3 A;  4IFD G;  4AYB E;  2VNU D;  2PNH A;  1Q1E A;  1OXT A;  3CCQ A;  2UUA Q;  2IX1 A;  4AQY L;  1NBW A;  5ELN A;  4DV3 Q;  2OTL A;  1VQN A;  4JI1 L;  4IO9 A;  1JJC B;  3UE0 A;  2N49 A;  3CW2 C;  1CKO A;  2AKW B;  2UUC Q;  1VQ5 A;  1S40 A;  3S2D H;  3HOU H;  3S15 H;  1E1T A;  3RNU A;  4GOP B;  4BY1 G;  3CF5 A;  3J7Z C;  1JB7 A;  5LMU Q;  2JA7 G;  3KF8 B;  5IYD H;  4LF4 L;  3T1H Q;  4YWM A;  2D62 A;  1LTL A;  4JG2 A;  4Y52 H;  4DV1 Q;  1RIP A;  4JI8 L;  1WOC A;  1X54 A;  4O0A A;  2HIV A;  4C3I H;  2VQF Q;  4KHP L;  5JJK A;  2K75 A;  1VS0 A;  2RF4 A;  4DV5 L;  4JI4 L;  1KHI A;  1BVS A;  5EAY A;  4X66 L;  4GLX A;  3UDG A;  3K7A H;  1XNQ Q;  4LF6 L;  4LFA L;  2JJQ A;  1YNX A;  3WWV A;  2HHH Q;  1YJW A;  5C44 G;  2OWO A;  4NXM L;  4GN4 B;  1N33 L;  2VY3 A;  1W2B A;  2UU9 Q;  1B8A A;  2GVA A;  1PVO A;  2UXB Q;  4NPS A;  4QQB X;  4L5T A;  5AJ3 Q;  4YWK A;  3VDY A;  4HJ5 A;  3CAM A;  3I55 A;  1VQD A;  2DGY A;  1CUK A;  1GKH A;  5GAH C;  3RZO H;  4UP9 A;  3RLO A;  5GAG C;  1XNR Q;  3I56 A;  5LMN L;  4QL5 A;  2YTX A;  2ZJP A;  1LUZ A;  1Q81 C;  1GD7 A;  4P71 A;  5C0X I;  5HGQ A;  3A74 A;  4DR1 Q;  1BBU A;  2CCZ A;  4WJ4 A;  4ME3 A;  1N34 L;  3S24 A;  2ID0 A;  1IBM Q;  3U50 C;  4HJ9 A;  3CCL A;  1VQ6 A;  1E7Z A;  2F4V Q;  1NMG A;  1VQC A;  3KYH C;  4HID A;  4HJ8 A;  4DR5 Q;  1FVI A;  3TS0 A;  3G6E A;  4OX9 Q;  4A3D G;  4JBM A;  3HOZ G;  2Y0S G;  3W1B A;  4AQY Q;  2QGQ A;  5FLM H;  1QZG A;  1IL2 A;  4GKK L;  3AEV A;  4LF7 Q;  4DV2 Q;  1H95 A;  5GQO A;  3M9B A;  1UEB A;  1A0I A;  1ASY A;  1XMO L;  4X62 L;  4A3J H;  1UE1 A;  2KCT A;  3GD7 A;  3H0G H;  5C4X G;  1E3P A;  1I94 L;  2CKZ B;  3HOY G;  4LF5 Q;  2KHJ A;  4JI8 Q;  4GLA C;  4KHP Q;  4A3B H;  1HJP A;  1YEZ A;  2JEB I;  4LFB L;  5IP9 G;  1DGS A;  4LF6 Q;  1FJG L;  3I2Z A;  4LFA Q;  2N8N A;  4C3J H;  1N33 Q;  1U5K A;  4QJF A;  3OTO L;  1G51 A;  3J81 i;  1VQM A;  2R7Z G;  1CKN A;  2ASB A;  4O2D A;  2Z6K A;  4DK6 C;  1SR3 A;  2K14 A;  4GLV B;  3F1Z A;  3M85 A;  5IP7 H;  3NEL A;  2UUA L;  2N3S A;  2FXQ A;  1E1O A;  3EIV A;  1HH2 P;  4P73 A;  4DV3 L;  1VQE A;  2NN6 G;  4JI2 L;  4OO1 I;  2IT1 A;  4IOC A;  1UE6 A;  3D0F A;  4JC0 A;  3A5Z B;  3KJO A;  4YWL A;  5LMN Q;  4JOI C;  3PO3 H;  1X65 A;  4A4I A;  3CCU A;  1N34 Q;  1PH6 A;  1VQK A;  1EUJ A;  1GVP A;  1OXV A;  5IP9 H;  3T1H L;  3UDX A;  1TWF H;  3CCM A;  1PH1 A;  2K5N A;  5C3E G;  4DK3 C;  1V43 A;  1K9M C;  1KC8 C;  1WCM H;  2KHI A;  1JJ2 A;  2R7Z H;  3KFU A;  1K0R A;  1XTD A;  2E8G A;  1VQ8 A;  1XNQ L;  3S1N H;  1S72 A;  2IHF A;  3T1Y Q;  4A3I H;  1X9N A;  2HHH L;  3M7N A;  1V1Q A;  4JBJ A;  1Y1W G;  1HZC A;  4GOP A;  2PQA B;  3AFQ A;  1XMO Q;  4KI0 A;  4PZ7 A;  3GTG H;  3TQY A;  4X62 Q;  1KD1 C;  1G29 1;  2VZA A;  4JBK A;  4IFD I;  3GTL H;  1I94 Q;  4B3R L;  3JAM i;  5AJ3 L;  1FL0 A;  2WAQ E;  2OCE A;  4J15 A;  3UDF A;  2ZM6 L;  2VQE Q;  1M1K C;  2A8V A;  2JA8 G;  2OQ0 A;  3H3V I;  3HOU G;  3GTO H;  4X6A H;  2ZTC A;  1XNR L;  2WB1 G;  1I5F A;  5IYD G;  3GTM H;  1V9P A;  2D0O A;  4LF9 L;  2RHS B;  2B63 H;  3G71 A;  1S3O A;  4LFB Q;  3KF6 B;  2GVB A;  4JBW A;  4C2M H;  5C3E H;  3F2D A;  4DR1 L;  5J3B A;  4LF8 L;  3PUW A;  1FJG Q;  4IOA A;  4K0K Q;  4QGU A;  3GO5 A;  1IBM L;  3S2H H;  4C3H H;  4EX5 A;  2E5L L;  1BBW A;  3F2B A;  4A76 A;  4TQU S;  4IPC A;  2F4V L;  1LYL A;  1L1O C;  4DKA C;  1VQA A;  4DR5 L;  3E0E A;  1HNZ Q;  3W5O A;  4JI2 Q;  2NVT H;  2NZH A;  2MNA A;  1VQB A;  4BA1 I;  1C0A A;  1X6O A;  4LF7 L;  4DV2 L;  1SRO A;  3ULP A;  2K5V A;  2JA8 H;  3ULL A;  1NMF A;  3E9H A;  1YJN A;  2GN5 A;  2R7D A;  3KJP A;  3FKI G;  5JEA G;  4LF5 L;  3PF4 A;  2R6G A;  5GAE C;  4LWC A;  1PHJ A;  1R9T H;  5C0X J;  4OWT B;  1N32 Q;  4A3C G;  1MJC A;  4HIK A;  4JYA L;  2XGT A;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...