2UXBT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxbT00
2HHHT 1J5ET 3OTOT 4DR5T 4DV1T 1XMQT 4DV7T 4NXMT 1IBMT 2F4VT 4JI5T 5LMUT 1XMOT 2UUCT 1XNQT 1N34T 4LF8T 4JI3T 1N33T 4X65T 5LMNT 4DV4T 4YY3T 4LF9T 4JI4T 4YHHT 3T1HT 4KHPT 4GKKT 2ZM6T 4DV5T 4DR2T 4JI1T 4LFCT 1N32T 4X66T 1HNWT 4LFAT 4DUYT 4JI7T 1N36T 1FJGT 4DR4T 3T1YT 5BR8T 4B3TT 4JI6T 1IBKT 2UXBT 4B3RT 4DR7T 4DUZT 4DV6T 4DR1T 4AQYT 1I94T 2UXCT 2UUAT 5IWAT 4X64T 1HNXT 4JYAT 4DV2T 4JI8T 2VQET 4LF7T 4B3ST 4LF4T 4JI2T 2E5LT 1HNZT 4DR6T 4K0KT 4X62T 4B3MT 4DR3T 1IBLT 2UXDT 4JI0T 4GKJT 4NXNT 4OX9T 1HR0T 4LF6T 4DV3T 2UUBT 4DV0T 4LFBT 4JV5T 1XNRT 4LF5T 2UU9T 2VQFT
chains in the Genus database with same CATH superfamily
2XQ5A 4IE7A 3QB5A 2K3WA 1NAFA 2YOEA 3OYZA 1SUMB 4QH1A 3SRZA 1T98A 4PJMA 5LG3A 3HI2A 4X1YE 2X66A 2XQ7A 5LJMA 5H6QB 4CZZB 3ZLIA 4IL9A 4HWFA 3RHWA 2FJEA 5AQIB 5EK4A 3P4SA 3WAKA 2MTQA 2CXDA 4AI6A 3ZSSA 4LFAT 4MLKA 5FY0A 2C5JA 3ZSTA 3NKZA 3ZYLA 4U74A 2ODVA 4HFEA 2X0LB 5L4EA 4U31A 3FXDB 2X68A 4E7SA 3UT5E 4AQGA 2VVNA 3RYHE 4TNVA 5CA1E 3PUGA 3LFMA 2VL0A 3CVRA 3VHLA 5JQGE 2ACZA 2V5DA 5FY1A 2VKHA 5JDQA 4AKGA 4KHZF 2Z6EA 3QNUA 2W61A 3OJAA 4OHFA 1IBLT 2UXDT 3B57A 2LOSA 2WU5A 3P4RA 5E0OA 3ZYKA 3EUHA 5HAXA 3ZN1B 2VQFT 3QC9A 3HKEE 2Q9QB 2XM1A 3AA0B 5KMGP 4YTMA 3JAEA 2WQYA 1ZHCA 5L3BB 4O4JE 3H3AA 4KP3C 3CWZB 3P8CD 5HXEA 5HXCA 4H9RC 3BQLA 5L3GB 4O4LE 4OK0A 3T1HT 2E9XD 4DNDA 3NRYA 3MXZA 4KMCA 2WSSV 3UUNA 4CN4A 2IAKA 2WDQA 3AA6B 1XDOA 2W63A 2H3RA 1WLXA 3RRCA 3UUBA 2RA1A 2YU2A 5EZYE 1VCTA 2UXBT 2J4GA 4ZI2D 4DV6T 1AJ3A 2XQ8A 3OKQA 3QK6A 2EHOD 4QXCB 5JDMA 4YFSA 1KF6A 4PK5A 4AQYT 4TV8E 2WMNA 4OYKA 2W2UA 3ZMVB 4JI8T 2OA5A 2UXNB 4HWCA 5AQHB 5AQMB 5L47A 1J5WA 3RYIE 2WZHA 3PURA 1MMNA 3L09A 5HCMA 3FBZA 3K3QC 3RLFF 4ASKA 3TLSA 3AEAA 3Q2MA 2MBGA 4QXBB 1HG2A 4F8HA 3PE0A 1CHUA 4EOZB 2YINA 4UV8B 2NW7A 3VKGA 2K24A 2L3LA 3ZEFB 2JMKA 4AKHA 4JI3T 2H7OA 3H3MA 1KNPA 2JQHA 4JI4T 1UGOA 4H9PC 4GKKT 2ZM6T 4DR2T 4EB6E 2DL1A 4DUYT 5L3EB 2XQYA 4HWDA 2C5KT 2I0MA 3ONLC 3RIUA 3LK3B 3O1HA 2Q9QA 1MMGA 2DI4A 3UU6A 4HFIA 1MIVA 4O2AE 3PV0F 2MAWA 3DP7A 1BR1A 3CKDA 2WS3A 5HEOA 3N9NA 2LSKA 2JQ9A 1BR0A 2WB5A 5KX5E 2D0TA 4LF7T 3B5MA 4MHCA 4QHOA 2KT9A 1HX8A 4C91A 3AVSA 4ADZA 1YKEB 2FJBA 5JDLA 4LF6T 3N9PA 2G0UA 3ETUA 1XWMA 2KINB 4Z8XA 3VR8A 3OBVE 5FKYA 1XNRT 2NW8A 4YLHA 3KV5A 4O4IE 3E0ZA 4I55E 1T8BA 4JI5T 1XMOT 1XDPA 4HFCA 3AA7B 2DHRA 2WY2A 1UUSA 2PBIA 2YDRA 1KNZA 3JC6C 3VR9A 3IBPA 3JAFA 1WCRA 3C51A 4LFCT 3P4PA 1SE7A 1QSDA 3P4QA 1UX5A 2X0YA 5AQJB 2XUEA 4YSZA 5F8PA 3ZCJA 4HEAA 3AAIA 3ZJ2A 3KV6A 3FZLB 3V5SA 5FY7A 4NPPA 1SHZC 3J9X1 5FNVE 5JRCB 5L2LA 5IWAT 2CXFA 4GOUA 4HKAA 4EYYR 5HEJA 4TNWA 3KDSE 3VU7H 4U2YA 2XPKA 3AAEB 3R84B 2ZLYA 3PUQA 1HX1B 3AB3B 2I6HA 1M62A 5FXWA 5FXZA 4HN9A 2CA5A 3ZJ1A 5CGMA 4U72A 3K8PC 4X1KE 3KV4A 5ABFB 2W4XA 4J2CA 5AQRB 1XNQT 3AVRA 2LSGA 4ILBA 4DV4T 3Q5WA 4WYVA 4LF9T 2JQQA 3T8OA 1D1AA 2LRLA 4NUVA 2EHOB 5HYAA 3R6NA 1WFDA 1YQ4A 2CHNA 2IDOB 4GK5E 2MPKA 2GK9A 2LM9A 2WBLA 3AE9A 4X5TA 2VKJA 4HE8A 1FEWA 2E8IA 4P09A 4BJMA 2LEHA 4PFOA 2ZM8A 5J1GA 2QA7A 1XZYA 5DQWA 5ABGA 4AKLA 2X51A 4PNIA 4GIWA 3MJXA 1HCIA 2XTLA 1LRZA 5LHIB 2UUAT 3CX8B 4UXNB 4X64T 5A1LA 4IHJE 4IE6A 1Z0PA 4O2BE 4H9NC 3FZKB 5HWXA 3HKBE 3AEEA 3E08A 2J47A 3J7Yq 4X62T 3IEEA 2X9XA 2LOPA 4H9SE 4EZHA 2VASA 3C4ZA 2M6BA 4ANJA 1I6ZA 3ZC1A 5LNKA 2JIWA 2XAGB 2CBIA 2CBJA 2UUBT 4ZI7E 2KNDA 2CM0A 4C90A 3KBUA 4EEDA 2NOXA 2N1GA 4H9OC 5JRCA 1WYBA 4DV1T 4WZXA 4ILAA 2YN6A 5JDGA 2V5CA 1HF8A 1OXZA 1WR0A 1N33T 3CMLA 5AQFB 4ZOLE 3LG7A 3RKGA 5DQVA 1NWMX 2RPAA 3PTRB 5L4HA 1U5PA 1LVFA 2YDSA 4DVDA 2LSIA 3T1YT 4IE4A 2KSRA 2DWKA 2X0HA 1OEDB 1MMDA 1WYCA 5ABFA 2L8KA 1D1CA 1W0AA 4ISTA 5L3FB 5CA0E 3JC6D 4YSXA 5CJ5A 3NZQA 3EI0A 4QX7B 4KI0F 2UXCT 3TLWA 3RX6A 3GWHA 4Z91A 2EHOA 4AQFC 3LDQB 2X67A 2UXXB 1YXRA 4O4HE 3EAMA 5LGUB 1BR2A 3ONJA 3JCFA 3Q5XA 2IMLA 1Y01A 3FHNA 4OX9T 5HXSA 4ZEYA 4U7YA 4TN7B 4L5GA 4U2ZA 3OVUA 1JNRA 5FXVA 1UCUA 4CXXA 3ZMSB 3C4WA 4TUYE 1QLBA 1B7TA 5FMNA 1MMAA 2H89A 3RKOA 2V6XA 2FJAA 3P7IA 4H9QC 4DIDB 4QX8B 3LJCA 1T7SA 3UU4A 4YY3T 3M65A 3ZPOA 4IDPA 1Z8UA 2CE7A 4UVCB 4MBQA 2N2NA 4UF0B 4HFHA 3N2OA 1N32T 4X66T 3ONXA 1HNWT 2IHR1 3SS1A 4EEBA 5TAOA 5J0ZA 1D0YA 3AE4A 3ZMZB 2JRKA 1V9DA 5F3JA 3LBXB 1VRBA 3RPUA 4ZHQE 4PJJA 2E5VA 2A9UA 1YD8G 2K9AA 2BVMA 4IE5A 4PAGA 4IDNA 2QVAA 2CLYB 2LHNA 2ZM2A 3FZMB 3CQCB 2V7LA 3PUVF 2BG9B 2A2FX 3Q9DA 3NRXA 3ESLA 2CPTA 2LHRA 4B3MT 4G63A 2Q9QC 3EDVA 4JI0T 2XQ6A 2HH7A 4Z90A 1OEDA 3DJBA 4XZCA 4CQIA 4DO0A 4I50E 4H63V 3HR0A 4L9IA 3KVAA 2IUBA 4BA9A 3RRWA 4YJ2E 4FJOA 2ZM0A 5AQVB 5LMUT 4JLEA 1D1BA 2BS3A 4HGAA 2VKDA 3GMIA 2KWHA 3AEBA 5F5WA 2W00A 3D0TA 2XAFB 4DMWA 3ZT7A 3RC8A 2KZ7B 4JI1T 2W67A 1JNZA 4LMKA 3F57A 4U7IA 3SWHA 4DBRA 5JR9B 2BKPA 2ZMAA 5ADXL 4JUYA 3C98B 3RF1A 5L3DB 4ZI3D 3A5XA 2WDVA 5J2TE 1ZEEA 1LVKA 3N2KE 2W0GA 2BKOA 3WI3A 2W62A 2K48A 2CCQA 3UU3A 3RIAA 3MK7C 3UU5A 3CX6B 3ZT6A 5IYZE 2QGSA 2CHOA 3I1AA 4UF0A 5C3JA 1D0ZA 5AQOB 2YKSA 4OFZA 3TLVA 3EDUA 3PU3A 5AQSB 3LBXA 1ZOYA 2H7VC 3MKDA 5AFUL 2XSBA 2BBHA 5FL0A 1E2AA 4QXHB 3LSVA 1J5ET 4DR5T 4DV7T 2FUPA 2WWUA 3E22E 3PUYF 1MNDA 2BG9A 3ZMTB 5M4YA 3PUZF 2WWVA 2HPLA 1KEYA 3QB5K 4EXTA 5LHHB 1IAPA 2V1DB 5LG4A 2BVLA 5AQQB 2FJDA 3VRAA 4NIQA 3VKHA 1W09A 4KX6A 3AEFA 1GQEA 3U3IA 2BZBA 4UV9B 3ANWB 2WM9A 2LKHA 3N2GE 5C8YE 5BR8T 2X9YA 2LE8A 4I4TE 3P50A 3RYCE 4B3TT 1VCSA 2XM2A 3O1JA 4JI6T 4G2AA 2AXDS 5C2TA 4DUZT 2M6IA 4IGUA 2LSJA 2D0UA 3C64A 3ZCIA 5AQLB 3N5LA 2JJ9A 5CFBA 4IDOA 4P1NA 3S4UA 4GYSA 4YXDA 2YU1A 4JEHB 4PK4A 5LGNB 4U3CA 3FBLA 2FBWA 5JR9A 2LKGA 3KBTA 4NXNT 2OV9A 2NP9A 3CQXC 3UFEA 4DV0T 2CWYA 4F6RC 3UQ7A 4B6XA 3ZC0A 2XY8B 5KDMC 5CB4E 2QRXA 4QKNA 3JADA 1O3XA 4QH5A 2B76A 1WRDA 3UUXB 3WAJA 2PJQA 2Q9QD 2VURA 2OLTA 4WBOA 3AXJA 2BS4A 4Q25A 3RYFE 2I59A 4O8SA 3L3PA 2E9XB 2LSYA 1YW0A 5ABHA 2WMOA 4DV5T 5H6RB 4ISSA 3CPZA 2C0SA 4B3RT 4DR7T 2IW5B 2XHEB 3N9LA 4LMJA 3UUMA 2C5IT 3N9MA 2XSAA 3I0OA 4COFA 2LLYA 2DWGA 4K0UA 3RQWA 4L0RA 3ZT5A 3L8RA 4EIWA 3PUWF 3AE1A 1UK5A 1FIOA 2BDEA 3CIRA 1S35A 5HXHA 1IJ5A 4IT4A 4JI2T 5LYJE 4DR6T 4K0KT 2BKNA 4HFDA 3ANWA 2J62A 4P0AA 3NVOA 1HR0T 2NTXA 4MALA 4DV3T 5HWYA 3QUJA 3P4WA 3N9QA 4ZI2C 4YSYA 2VKOA 5JDHA 2HHHT 2EHOC 4BAYB 1U4QA 3N9OA 3Q5EA 4DMVA 4HWIB 4NXMT 3AE8A 1KFYA 4UVAB 2XQ9A 2IC6A 2VL8A 4CXYA 2V7MA 2JPFA 3CQGB 2JMHA 2MOZA 3H37A 5AQTB 2VVSA 3RC3A 2NR4A 2DNXA 4KBMB 2WU2A 3AE3A 3A7MA 1OEDE 5GONE 1MIYA 4YTNA 5JVDE 1L0VA 3BQKA 4I0UA 2E9XA 2D5UA 4XAXB 4ILCA 3TLUA 2J1DG 2XAJB 5KXJA 5EK3A 3AE2A 4LF4T 2ODUA 1LKXA 5JDFA 3AEDA 3RI5A 3UTKA 2RP4A 3A8YC 2P9BA 4V1Av 4JV5T 1HNZT 5ABEA 1H7CA 2CRBA 2WCAA 1IBMT 1J1JA 2V7KA 5L3CB 2VWAA 4EZ4A 3B13A 2WAUA 1OEDC 1W9RA 4BJNA 4QWNB 4TWFA 4WW0A 5AQKB 2A72A 5HEHA 4TWDA 2XASB 1SA0E 4QH4A 5HEGA 4DBQA 1OWAA 1HFAA 3L39A 2CWOA 4TZ4C 2D2SA 1FMVA 3UULA 2BG9E 1QUUA 3KVBA 4I43B 1NENA 5JTGA 3SOLA 3KINB 4A56A 2E5LT 3UU8A 3AE7A 3ETVA 4HTEA 2VB6A 5DJQC 3OPCA 1W0BA 4GKJT 5LJNA 4CI2B 2VK9A 5LOVE 4LFBT 3FXEB 5JDNA 4IIJE 5LA6E 3TLTA 4IDQA 3RIUC 3VRBA 3AA1B 4CI3B 3EHZA 3RIFA 2F4VT 4AQFA 2UUCT 1N34T 5HEUA 4AKIA 4YHJA 5FVLA 4E7ZA 3AECA 2XAQB 3KFWX 4EV6A 5EK2A 2KXPB 4YHHT 5HXRA 5FL1A 1UURA 2Y8DA 4EGWA 4CN6A 2Y6XA 4TX5A 4IDZA 2CLYC 3I9WA 1BR4A 3IA3A 4PFPA 4ZZBA 3ABVA 1T72A 2BG9C 2JQKA 4UEMA 3MZKB 5FVKA 2DCFA 1I94T 2XQAA 5LB7B 3K3NA 2V7JA 3ZKRA 4PW8A 3FZHB 2PG8A 5AQUB 2CXLA 2HN2A 2KMFA 3HA4A 2IIUA 5AQNB 1X79A 5LP6E 1ZV4X 4UELA 3PDYA 5LGTB 2HPJA 4AKRB 3AXJB 4ZS2A 3CK6A 4LF5T 2UU9T 1Y64B 2MYSA 4U33A 3EVYA 3LK42 3W15B 1YKHB 3GA8A 3C4XA 5JR9C 4LF8T 4WBNE 1NEKA 3O9XA 3G06A 4JBWF 3IF8B 3O4XE 1D0XA 4H63H 2XAHB 4XBFB 3UQ4A 3F2EA 3O1IA 1WR6A 4HFBA 2ES0A 2V6YB 3K3OA 4UR9A 2V7IA 1FJGT 2KLQA 4HWHA 4A97A 2HN1A 2KWIB 2V8SV 2N9DA 1IBKT 1KNRA 3Q5DA 4PK6A 1FMWA 4MFRA 1G73A 4ZZCA 3NBXX 4CXWA 1DU2A 1ZKEA 4GYRA 1HNXT 2M67A 2PFVA 3HL6A 2VQET 5IHYA 4X1IE 3HKDE 3GN5B 3AEGA 5FYMA 3CX7B 3MACA 5DABA 4ILUA 4N78D 4AXPA 2LM2A 1CUNA 3I9YA 3U78A 3PJAA 1G8XA 4AIUA 2XQ4A 1HTJF 4PJLA 5LCYA 1N36T 3LK2B 3NZPA 1IJ6A 1VOMA 3M3ZB 3OTOT 4AISA 2D9DA 4UIGA 3X1DA 4JEUB 2WZIA 5ETWA 5JREA 3HKCE 1YQ3A 1HS7A 5J2UE 1ZP0A 4ZS3A 5LMNT 3OYXA 4A5XA 3NWIA 4KHPT 2YK0A 1MNEA 2NW9A 2XJ7A 1HG5A 3F31A 1MIWA 4X20E 4JI7T 2W66A 4DR4T 2B1EA 1E1HB 3RGLA 1E7PA 4A98A 4DR1T 2X9WA 3AAAB 2WP9A 2CMRA 2DLRA 2NTYA 4YTPA 2LT3A 4JYAT 4YT0A 2V6YA 4NUUA 5LHGB 4ERRA 5AQPB 3PUAA 4GK0E 3RH3A 1US7B 2BS2A 3FZFB 3DTOA 3K1SA 3BK9A 3PJAJ 3BQIA 3PUXF 4M1PA 3AE6A 3I0QA 1R8IA 4EYUA 2E9XC 4CN1A 4IREA 1M7KA 3UFGA 3V5UA 1IZNB 1XMQT 4KUMB 2H88A 4P0BA 2XQ3A 4X65T 1UX4A 3EABA 3SFDA 3TKLB 4IE0A 3GN5A 4WNKA 5LXTE 2Y48B 2QYWA 3QOFA 2PTFA 3AE5A 2E2AA 5JH7E 3PUSA 4OYJA 4TWHA 2LJLA 3ZN0B 2AE9A 5FP3A 3SFEA 2R6GF 2IC9A 2BBJA 2CEAA 5AQGB 1S94A 5BMVE 3PU8A 3RQUA 5IUXA 4FI5A 2WDRA 2YDQA 3ZMUB 2XZEA 2SPCA 5HCJA 4LMLA 2ACXA 4CI1B 4DV2T 3IHRA 2V26A 4YJ3E 4EAHA 2NWBA 5LBMA 2YEVC 4B3ST 3C50A 4IL4A 2X9HA 3ZYMA 4ZXLA 2L9QA 4PJNA 4TV9E 1X9BA 5LBQB 4HFVA 4DR3T 4UVBB 2A3DA 3FB2A 1KK7A 4ZI3C 3MA9A 2LRKA 1EZ3A 2K5BB 3KV9A 5FXXA
chains in the Genus database with same CATH topology
2HHHT 1J5ET 3OTOT 4DR5T 4DV1T 1XMQT 4DV7T 4NXMT 1IBMT 2F4VT 4JI5T 5LMUT 1XMOT 2UUCT 1XNQT 1N34T 4LF8T 4JI3T 1N33T 4X65T 5LMNT 4DV4T 4YY3T 4LF9T 4JI4T 4YHHT 3T1HT 4KHPT 4GKKT 2ZM6T 4DV5T 4DR2T 4JI1T 4LFCT 1N32T 4X66T 1HNWT 4LFAT 4DUYT 4JI7T 1N36T 1FJGT 4DR4T 3T1YT 5BR8T 4B3TT 4JI6T 1IBKT 2UXBT 4B3RT 4DR7T 4DUZT 4DV6T 4DR1T 4AQYT 1I94T 2UXCT 2UUAT 5IWAT 4X64T 1HNXT 4JYAT 4DV2T 4JI8T 2VQET 4LF7T 4B3ST 4LF4T 4JI2T 2E5LT 1HNZT 4DR6T 4K0KT 4X62T 4B3MT 4DR3T 1IBLT 2UXDT 4JI0T 4GKJT 4NXNT 4OX9T 1HR0T 4LF6T 4DV3T 2UUBT 4DV0T 4LFBT 4JV5T 1XNRT 4LF5T 2UU9T 2VQFT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH T;  1J5E T;  3OTO T;  4DR5 T;  4DV1 T;  1XMQ T;  4DV7 T;  4NXM T;  1IBM T;  2F4V T;  4JI5 T;  5LMU T;  1XMO T;  2UUC T;  1XNQ T;  1N34 T;  4LF8 T;  4JI3 T;  1N33 T;  4X65 T;  5LMN T;  4DV4 T;  4YY3 T;  4LF9 T;  4JI4 T;  4YHH T;  3T1H T;  4KHP T;  4GKK T;  2ZM6 T;  4DV5 T;  4DR2 T;  4JI1 T;  4LFC T;  1N32 T;  4X66 T;  1HNW T;  4LFA T;  4DUY T;  4JI7 T;  1N36 T;  1FJG T;  4DR4 T;  3T1Y T;  5BR8 T;  4B3T T;  4JI6 T;  1IBK T;  2UXB T;  4B3R T;  4DR7 T;  4DUZ T;  4DV6 T;  4DR1 T;  4AQY T;  1I94 T;  2UXC T;  2UUA T;  5IWA T;  4X64 T;  1HNX T;  4JYA T;  4DV2 T;  4JI8 T;  2VQE T;  4LF7 T;  4B3S T;  4LF4 T;  4JI2 T;  2E5L T;  1HNZ T;  4DR6 T;  4K0K T;  4X62 T;  4B3M T;  4DR3 T;  1IBL T;  2UXD T;  4JI0 T;  4GKJ T;  4NXN T;  4OX9 T;  1HR0 T;  4LF6 T;  4DV3 T;  2UUB T;  4DV0 T;  4LFB T;  4JV5 T;  1XNR T;  4LF5 T;  2UU9 T;  2VQF T; 
#chains in the Genus database with same CATH topology
 2XQ5 A;  4IE7 A;  3QB5 A;  2K3W A;  1NAF A;  2YOE A;  3OYZ A;  1SUM B;  4QH1 A;  3SRZ A;  1T98 A;  4PJM A;  5LG3 A;  3HI2 A;  4X1Y E;  2X66 A;  2XQ7 A;  5LJM A;  5H6Q B;  4CZZ B;  3ZLI A;  4IL9 A;  4HWF A;  3RHW A;  2FJE A;  5AQI B;  5EK4 A;  3P4S A;  3WAK A;  2MTQ A;  2CXD A;  4AI6 A;  3ZSS A;  4LFA T;  4MLK A;  5FY0 A;  2C5J A;  3ZST A;  3NKZ A;  3ZYL A;  4U74 A;  2ODV A;  4HFE A;  2X0L B;  5L4E A;  4U31 A;  3FXD B;  2X68 A;  4E7S A;  3UT5 E;  4AQG A;  2VVN A;  3RYH E;  4TNV A;  5CA1 E;  3PUG A;  3LFM A;  2VL0 A;  3CVR A;  3VHL A;  5JQG E;  2ACZ A;  2V5D A;  5FY1 A;  2VKH A;  5JDQ A;  4AKG A;  4KHZ F;  2Z6E A;  3QNU A;  2W61 A;  3OJA A;  4OHF A;  1IBL T;  2UXD T;  3B57 A;  2LOS A;  2WU5 A;  3P4R A;  5E0O A;  3ZYK A;  3EUH A;  5HAX A;  3ZN1 B;  2VQF T;  3QC9 A;  3HKE E;  2Q9Q B;  2XM1 A;  3AA0 B;  5KMG P;  4YTM A;  3JAE A;  2WQY A;  1ZHC A;  5L3B B;  4O4J E;  3H3A A;  4KP3 C;  3CWZ B;  3P8C D;  5HXE A;  5HXC A;  4H9R C;  3BQL A;  5L3G B;  4O4L E;  4OK0 A;  3T1H T;  2E9X D;  4DND A;  3NRY A;  3MXZ A;  4KMC A;  2WSS V;  3UUN A;  4CN4 A;  2IAK A;  2WDQ A;  3AA6 B;  1XDO A;  2W63 A;  2H3R A;  1WLX A;  3RRC A;  3UUB A;  2RA1 A;  2YU2 A;  5EZY E;  1VCT A;  2UXB T;  2J4G A;  4ZI2 D;  4DV6 T;  1AJ3 A;  2XQ8 A;  3OKQ A;  3QK6 A;  2EHO D;  4QXC B;  5JDM A;  4YFS A;  1KF6 A;  4PK5 A;  4AQY T;  4TV8 E;  2WMN A;  4OYK A;  2W2U A;  3ZMV B;  4JI8 T;  2OA5 A;  2UXN B;  4HWC A;  5AQH B;  5AQM B;  5L47 A;  1J5W A;  3RYI E;  2WZH A;  3PUR A;  1MMN A;  3L09 A;  5HCM A;  3FBZ A;  3K3Q C;  3RLF F;  4ASK A;  3TLS A;  3AEA A;  3Q2M A;  2MBG A;  4QXB B;  1HG2 A;  4F8H A;  3PE0 A;  1CHU A;  4EOZ B;  2YIN A;  4UV8 B;  2NW7 A;  3VKG A;  2K24 A;  2L3L A;  3ZEF B;  2JMK A;  4AKH A;  4JI3 T;  2H7O A;  3H3M A;  1KNP A;  2JQH A;  4JI4 T;  1UGO A;  4H9P C;  4GKK T;  2ZM6 T;  4DR2 T;  4EB6 E;  2DL1 A;  4DUY T;  5L3E B;  2XQY A;  4HWD A;  2C5K T;  2I0M A;  3ONL C;  3RIU A;  3LK3 B;  3O1H A;  2Q9Q A;  1MMG A;  2DI4 A;  3UU6 A;  4HFI A;  1MIV A;  4O2A E;  3PV0 F;  2MAW A;  3DP7 A;  1BR1 A;  3CKD A;  2WS3 A;  5HEO A;  3N9N A;  2LSK A;  2JQ9 A;  1BR0 A;  2WB5 A;  5KX5 E;  2D0T A;  4LF7 T;  3B5M A;  4MHC A;  4QHO A;  2KT9 A;  1HX8 A;  4C91 A;  3AVS A;  4ADZ A;  1YKE B;  2FJB A;  5JDL A;  4LF6 T;  3N9P A;  2G0U A;  3ETU A;  1XWM A;  2KIN B;  4Z8X A;  3VR8 A;  3OBV E;  5FKY A;  1XNR T;  2NW8 A;  4YLH A;  3KV5 A;  4O4I E;  3E0Z A;  4I55 E;  1T8B A;  4JI5 T;  1XMO T;  1XDP A;  4HFC A;  3AA7 B;  2DHR A;  2WY2 A;  1UUS A;  2PBI A;  2YDR A;  1KNZ A;  3JC6 C;  3VR9 A;  3IBP A;  3JAF A;  1WCR A;  3C51 A;  4LFC T;  3P4P A;  1SE7 A;  1QSD A;  3P4Q A;  1UX5 A;  2X0Y A;  5AQJ B;  2XUE A;  4YSZ A;  5F8P A;  3ZCJ A;  4HEA A;  3AAI A;  3ZJ2 A;  3KV6 A;  3FZL B;  3V5S A;  5FY7 A;  4NPP A;  1SHZ C;  3J9X 1;  5FNV E;  5JRC B;  5L2L A;  5IWA T;  2CXF A;  4GOU A;  4HKA A;  4EYY R;  5HEJ A;  4TNW A;  3KDS E;  3VU7 H;  4U2Y A;  2XPK A;  3AAE B;  3R84 B;  2ZLY A;  3PUQ A;  1HX1 B;  3AB3 B;  2I6H A;  1M62 A;  5FXW A;  5FXZ A;  4HN9 A;  2CA5 A;  3ZJ1 A;  5CGM A;  4U72 A;  3K8P C;  4X1K E;  3KV4 A;  5ABF B;  2W4X A;  4J2C A;  5AQR B;  1XNQ T;  3AVR A;  2LSG A;  4ILB A;  4DV4 T;  3Q5W A;  4WYV A;  4LF9 T;  2JQQ A;  3T8O A;  1D1A A;  2LRL A;  4NUV A;  2EHO B;  5HYA A;  3R6N A;  1WFD A;  1YQ4 A;  2CHN A;  2IDO B;  4GK5 E;  2MPK A;  2GK9 A;  2LM9 A;  2WBL A;  3AE9 A;  4X5T A;  2VKJ A;  4HE8 A;  1FEW A;  2E8I A;  4P09 A;  4BJM A;  2LEH A;  4PFO A;  2ZM8 A;  5J1G A;  2QA7 A;  1XZY A;  5DQW A;  5ABG A;  4AKL A;  2X51 A;  4PNI A;  4GIW A;  3MJX A;  1HCI A;  2XTL A;  1LRZ A;  5LHI B;  2UUA T;  3CX8 B;  4UXN B;  4X64 T;  5A1L A;  4IHJ E;  4IE6 A;  1Z0P A;  4O2B E;  4H9N C;  3FZK B;  5HWX A;  3HKB E;  3AEE A;  3E08 A;  2J47 A;  3J7Y q;  4X62 T;  3IEE A;  2X9X A;  2LOP A;  4H9S E;  4EZH A;  2VAS A;  3C4Z A;  2M6B A;  4ANJ A;  1I6Z A;  3ZC1 A;  5LNK A;  2JIW A;  2XAG B;  2CBI A;  2CBJ A;  2UUB T;  4ZI7 E;  2KND A;  2CM0 A;  4C90 A;  3KBU A;  4EED A;  2NOX A;  2N1G A;  4H9O C;  5JRC A;  1WYB A;  4DV1 T;  4WZX A;  4ILA A;  2YN6 A;  5JDG A;  2V5C A;  1HF8 A;  1OXZ A;  1WR0 A;  1N33 T;  3CML A;  5AQF B;  4ZOL E;  3LG7 A;  3RKG A;  5DQV A;  1NWM X;  2RPA A;  3PTR B;  5L4H A;  1U5P A;  1LVF A;  2YDS A;  4DVD A;  2LSI A;  3T1Y T;  4IE4 A;  2KSR A;  2DWK A;  2X0H A;  1OED B;  1MMD A;  1WYC A;  5ABF A;  2L8K A;  1D1C A;  1W0A A;  4IST A;  5L3F B;  5CA0 E;  3JC6 D;  4YSX A;  5CJ5 A;  3NZQ A;  3EI0 A;  4QX7 B;  4KI0 F;  2UXC T;  3TLW A;  3RX6 A;  3GWH A;  4Z91 A;  2EHO A;  4AQF C;  3LDQ B;  2X67 A;  2UXX B;  1YXR A;  4O4H E;  3EAM A;  5LGU B;  1BR2 A;  3ONJ A;  3JCF A;  3Q5X A;  2IML A;  1Y01 A;  3FHN A;  4OX9 T;  5HXS A;  4ZEY A;  4U7Y A;  4TN7 B;  4L5G A;  4U2Z A;  3OVU A;  1JNR A;  5FXV A;  1UCU A;  4CXX A;  3ZMS B;  3C4W A;  4TUY E;  1QLB A;  1B7T A;  5FMN A;  1MMA A;  2H89 A;  3RKO A;  2V6X A;  2FJA A;  3P7I A;  4H9Q C;  4DID B;  4QX8 B;  3LJC A;  1T7S A;  3UU4 A;  4YY3 T;  3M65 A;  3ZPO A;  4IDP A;  1Z8U A;  2CE7 A;  4UVC B;  4MBQ A;  2N2N A;  4UF0 B;  4HFH A;  3N2O A;  1N32 T;  4X66 T;  3ONX A;  1HNW T;  2IHR 1;  3SS1 A;  4EEB A;  5TAO A;  5J0Z A;  1D0Y A;  3AE4 A;  3ZMZ B;  2JRK A;  1V9D A;  5F3J A;  3LBX B;  1VRB A;  3RPU A;  4ZHQ E;  4PJJ A;  2E5V A;  2A9U A;  1YD8 G;  2K9A A;  2BVM A;  4IE5 A;  4PAG A;  4IDN A;  2QVA A;  2CLY B;  2LHN A;  2ZM2 A;  3FZM B;  3CQC B;  2V7L A;  3PUV F;  2BG9 B;  2A2F X;  3Q9D A;  3NRX A;  3ESL A;  2CPT A;  2LHR A;  4B3M T;  4G63 A;  2Q9Q C;  3EDV A;  4JI0 T;  2XQ6 A;  2HH7 A;  4Z90 A;  1OED A;  3DJB A;  4XZC A;  4CQI A;  4DO0 A;  4I50 E;  4H63 V;  3HR0 A;  4L9I A;  3KVA A;  2IUB A;  4BA9 A;  3RRW A;  4YJ2 E;  4FJO A;  2ZM0 A;  5AQV B;  5LMU T;  4JLE A;  1D1B A;  2BS3 A;  4HGA A;  2VKD A;  3GMI A;  2KWH A;  3AEB A;  5F5W A;  2W00 A;  3D0T A;  2XAF B;  4DMW A;  3ZT7 A;  3RC8 A;  2KZ7 B;  4JI1 T;  2W67 A;  1JNZ A;  4LMK A;  3F57 A;  4U7I A;  3SWH A;  4DBR A;  5JR9 B;  2BKP A;  2ZMA A;  5ADX L;  4JUY A;  3C98 B;  3RF1 A;  5L3D B;  4ZI3 D;  3A5X A;  2WDV A;  5J2T E;  1ZEE A;  1LVK A;  3N2K E;  2W0G A;  2BKO A;  3WI3 A;  2W62 A;  2K48 A;  2CCQ A;  3UU3 A;  3RIA A;  3MK7 C;  3UU5 A;  3CX6 B;  3ZT6 A;  5IYZ E;  2QGS A;  2CHO A;  3I1A A;  4UF0 A;  5C3J A;  1D0Z A;  5AQO B;  2YKS A;  4OFZ A;  3TLV A;  3EDU A;  3PU3 A;  5AQS B;  3LBX A;  1ZOY A;  2H7V C;  3MKD A;  5AFU L;  2XSB A;  2BBH A;  5FL0 A;  1E2A A;  4QXH B;  3LSV A;  1J5E T;  4DR5 T;  4DV7 T;  2FUP A;  2WWU A;  3E22 E;  3PUY F;  1MND A;  2BG9 A;  3ZMT B;  5M4Y A;  3PUZ F;  2WWV A;  2HPL A;  1KEY A;  3QB5 K;  4EXT A;  5LHH B;  1IAP A;  2V1D B;  5LG4 A;  2BVL A;  5AQQ B;  2FJD A;  3VRA A;  4NIQ A;  3VKH A;  1W09 A;  4KX6 A;  3AEF A;  1GQE A;  3U3I A;  2BZB A;  4UV9 B;  3ANW B;  2WM9 A;  2LKH A;  3N2G E;  5C8Y E;  5BR8 T;  2X9Y A;  2LE8 A;  4I4T E;  3P50 A;  3RYC E;  4B3T T;  1VCS A;  2XM2 A;  3O1J A;  4JI6 T;  4G2A A;  2AXD S;  5C2T A;  4DUZ T;  2M6I A;  4IGU A;  2LSJ A;  2D0U A;  3C64 A;  3ZCI A;  5AQL B;  3N5L A;  2JJ9 A;  5CFB A;  4IDO A;  4P1N A;  3S4U A;  4GYS A;  4YXD A;  2YU1 A;  4JEH B;  4PK4 A;  5LGN B;  4U3C A;  3FBL A;  2FBW A;  5JR9 A;  2LKG A;  3KBT A;  4NXN T;  2OV9 A;  2NP9 A;  3CQX C;  3UFE A;  4DV0 T;  2CWY A;  4F6R C;  3UQ7 A;  4B6X A;  3ZC0 A;  2XY8 B;  5KDM C;  5CB4 E;  2QRX A;  4QKN A;  3JAD A;  1O3X A;  4QH5 A;  2B76 A;  1WRD A;  3UUX B;  3WAJ A;  2PJQ A;  2Q9Q D;  2VUR A;  2OLT A;  4WBO A;  3AXJ A;  2BS4 A;  4Q25 A;  3RYF E;  2I59 A;  4O8S A;  3L3P A;  2E9X B;  2LSY A;  1YW0 A;  5ABH A;  2WMO A;  4DV5 T;  5H6R B;  4ISS A;  3CPZ A;  2C0S A;  4B3R T;  4DR7 T;  2IW5 B;  2XHE B;  3N9L A;  4LMJ A;  3UUM A;  2C5I T;  3N9M A;  2XSA A;  3I0O A;  4COF A;  2LLY A;  2DWG A;  4K0U A;  3RQW A;  4L0R A;  3ZT5 A;  3L8R A;  4EIW A;  3PUW F;  3AE1 A;  1UK5 A;  1FIO A;  2BDE A;  3CIR A;  1S35 A;  5HXH A;  1IJ5 A;  4IT4 A;  4JI2 T;  5LYJ E;  4DR6 T;  4K0K T;  2BKN A;  4HFD A;  3ANW A;  2J62 A;  4P0A A;  3NVO A;  1HR0 T;  2NTX A;  4MAL A;  4DV3 T;  5HWY A;  3QUJ A;  3P4W A;  3N9Q A;  4ZI2 C;  4YSY A;  2VKO A;  5JDH A;  2HHH T;  2EHO C;  4BAY B;  1U4Q A;  3N9O A;  3Q5E A;  4DMV A;  4HWI B;  4NXM T;  3AE8 A;  1KFY A;  4UVA B;  2XQ9 A;  2IC6 A;  2VL8 A;  4CXY A;  2V7M A;  2JPF A;  3CQG B;  2JMH A;  2MOZ A;  3H37 A;  5AQT B;  2VVS A;  3RC3 A;  2NR4 A;  2DNX A;  4KBM B;  2WU2 A;  3AE3 A;  3A7M A;  1OED E;  5GON E;  1MIY A;  4YTN A;  5JVD E;  1L0V A;  3BQK A;  4I0U A;  2E9X A;  2D5U A;  4XAX B;  4ILC A;  3TLU A;  2J1D G;  2XAJ B;  5KXJ A;  5EK3 A;  3AE2 A;  4LF4 T;  2ODU A;  1LKX A;  5JDF A;  3AED A;  3RI5 A;  3UTK A;  2RP4 A;  3A8Y C;  2P9B A;  4V1A v;  4JV5 T;  1HNZ T;  5ABE A;  1H7C A;  2CRB A;  2WCA A;  1IBM T;  1J1J A;  2V7K A;  5L3C B;  2VWA A;  4EZ4 A;  3B13 A;  2WAU A;  1OED C;  1W9R A;  4BJN A;  4QWN B;  4TWF A;  4WW0 A;  5AQK B;  2A72 A;  5HEH A;  4TWD A;  2XAS B;  1SA0 E;  4QH4 A;  5HEG A;  4DBQ A;  1OWA A;  1HFA A;  3L39 A;  2CWO A;  4TZ4 C;  2D2S A;  1FMV A;  3UUL A;  2BG9 E;  1QUU A;  3KVB A;  4I43 B;  1NEN A;  5JTG A;  3SOL A;  3KIN B;  4A56 A;  2E5L T;  3UU8 A;  3AE7 A;  3ETV A;  4HTE A;  2VB6 A;  5DJQ C;  3OPC A;  1W0B A;  4GKJ T;  5LJN A;  4CI2 B;  2VK9 A;  5LOV E;  4LFB T;  3FXE B;  5JDN A;  4IIJ E;  5LA6 E;  3TLT A;  4IDQ A;  3RIU C;  3VRB A;  3AA1 B;  4CI3 B;  3EHZ A;  3RIF A;  2F4V T;  4AQF A;  2UUC T;  1N34 T;  5HEU A;  4AKI A;  4YHJ A;  5FVL A;  4E7Z A;  3AEC A;  2XAQ B;  3KFW X;  4EV6 A;  5EK2 A;  2KXP B;  4YHH T;  5HXR A;  5FL1 A;  1UUR A;  2Y8D A;  4EGW A;  4CN6 A;  2Y6X A;  4TX5 A;  4IDZ A;  2CLY C;  3I9W A;  1BR4 A;  3IA3 A;  4PFP A;  4ZZB A;  3ABV A;  1T72 A;  2BG9 C;  2JQK A;  4UEM A;  3MZK B;  5FVK A;  2DCF A;  1I94 T;  2XQA A;  5LB7 B;  3K3N A;  2V7J A;  3ZKR A;  4PW8 A;  3FZH B;  2PG8 A;  5AQU B;  2CXL A;  2HN2 A;  2KMF A;  3HA4 A;  2IIU A;  5AQN B;  1X79 A;  5LP6 E;  1ZV4 X;  4UEL A;  3PDY A;  5LGT B;  2HPJ A;  4AKR B;  3AXJ B;  4ZS2 A;  3CK6 A;  4LF5 T;  2UU9 T;  1Y64 B;  2MYS A;  4U33 A;  3EVY A;  3LK4 2;  3W15 B;  1YKH B;  3GA8 A;  3C4X A;  5JR9 C;  4LF8 T;  4WBN E;  1NEK A;  3O9X A;  3G06 A;  4JBW F;  3IF8 B;  3O4X E;  1D0X A;  4H63 H;  2XAH B;  4XBF B;  3UQ4 A;  3F2E A;  3O1I A;  1WR6 A;  4HFB A;  2ES0 A;  2V6Y B;  3K3O A;  4UR9 A;  2V7I A;  1FJG T;  2KLQ A;  4HWH A;  4A97 A;  2HN1 A;  2KWI B;  2V8S V;  2N9D A;  1IBK T;  1KNR A;  3Q5D A;  4PK6 A;  1FMW A;  4MFR A;  1G73 A;  4ZZC A;  3NBX X;  4CXW A;  1DU2 A;  1ZKE A;  4GYR A;  1HNX T;  2M67 A;  2PFV A;  3HL6 A;  2VQE T;  5IHY A;  4X1I E;  3HKD E;  3GN5 B;  3AEG A;  5FYM A;  3CX7 B;  3MAC A;  5DAB A;  4ILU A;  4N78 D;  4AXP A;  2LM2 A;  1CUN A;  3I9Y A;  3U78 A;  3PJA A;  1G8X A;  4AIU A;  2XQ4 A;  1HTJ F;  4PJL A;  5LCY A;  1N36 T;  3LK2 B;  3NZP A;  1IJ6 A;  1VOM A;  3M3Z B;  3OTO T;  4AIS A;  2D9D A;  4UIG A;  3X1D A;  4JEU B;  2WZI A;  5ETW A;  5JRE A;  3HKC E;  1YQ3 A;  1HS7 A;  5J2U E;  1ZP0 A;  4ZS3 A;  5LMN T;  3OYX A;  4A5X A;  3NWI A;  4KHP T;  2YK0 A;  1MNE A;  2NW9 A;  2XJ7 A;  1HG5 A;  3F31 A;  1MIW A;  4X20 E;  4JI7 T;  2W66 A;  4DR4 T;  2B1E A;  1E1H B;  3RGL A;  1E7P A;  4A98 A;  4DR1 T;  2X9W A;  3AAA B;  2WP9 A;  2CMR A;  2DLR A;  2NTY A;  4YTP A;  2LT3 A;  4JYA T;  4YT0 A;  2V6Y A;  4NUU A;  5LHG B;  4ERR A;  5AQP B;  3PUA A;  4GK0 E;  3RH3 A;  1US7 B;  2BS2 A;  3FZF B;  3DTO A;  3K1S A;  3BK9 A;  3PJA J;  3BQI A;  3PUX F;  4M1P A;  3AE6 A;  3I0Q A;  1R8I A;  4EYU A;  2E9X C;  4CN1 A;  4IRE A;  1M7K A;  3UFG A;  3V5U A;  1IZN B;  1XMQ T;  4KUM B;  2H88 A;  4P0B A;  2XQ3 A;  4X65 T;  1UX4 A;  3EAB A;  3SFD A;  3TKL B;  4IE0 A;  3GN5 A;  4WNK A;  5LXT E;  2Y48 B;  2QYW A;  3QOF A;  2PTF A;  3AE5 A;  2E2A A;  5JH7 E;  3PUS A;  4OYJ A;  4TWH A;  2LJL A;  3ZN0 B;  2AE9 A;  5FP3 A;  3SFE A;  2R6G F;  2IC9 A;  2BBJ A;  2CEA A;  5AQG B;  1S94 A;  5BMV E;  3PU8 A;  3RQU A;  5IUX A;  4FI5 A;  2WDR A;  2YDQ A;  3ZMU B;  2XZE A;  2SPC A;  5HCJ A;  4LML A;  2ACX A;  4CI1 B;  4DV2 T;  3IHR A;  2V26 A;  4YJ3 E;  4EAH A;  2NWB A;  5LBM A;  2YEV C;  4B3S T;  3C50 A;  4IL4 A;  2X9H A;  3ZYM A;  4ZXL A;  2L9Q A;  4PJN A;  4TV9 E;  1X9B A;  5LBQ B;  4HFV A;  4DR3 T;  4UVB B;  2A3D A;  3FB2 A;  1KK7 A;  4ZI3 C;  3MA9 A;  2LRK A;  1EZ3 A;  2K5B B;  3KV9 A;  5FXX A; 
#chains in the Genus database with same CATH homology
 2HHH T;  1J5E T;  3OTO T;  4DR5 T;  4DV1 T;  1XMQ T;  4DV7 T;  4NXM T;  1IBM T;  2F4V T;  4JI5 T;  5LMU T;  1XMO T;  2UUC T;  1XNQ T;  1N34 T;  4LF8 T;  4JI3 T;  1N33 T;  4X65 T;  5LMN T;  4DV4 T;  4YY3 T;  4LF9 T;  4JI4 T;  4YHH T;  3T1H T;  4KHP T;  4GKK T;  2ZM6 T;  4DV5 T;  4DR2 T;  4JI1 T;  4LFC T;  1N32 T;  4X66 T;  1HNW T;  4LFA T;  4DUY T;  4JI7 T;  1N36 T;  1FJG T;  4DR4 T;  3T1Y T;  5BR8 T;  4B3T T;  4JI6 T;  1IBK T;  2UXB T;  4B3R T;  4DR7 T;  4DUZ T;  4DV6 T;  4DR1 T;  4AQY T;  1I94 T;  2UXC T;  2UUA T;  5IWA T;  4X64 T;  1HNX T;  4JYA T;  4DV2 T;  4JI8 T;  2VQE T;  4LF7 T;  4B3S T;  4LF4 T;  4JI2 T;  2E5L T;  1HNZ T;  4DR6 T;  4K0K T;  4X62 T;  4B3M T;  4DR3 T;  1IBL T;  2UXD T;  4JI0 T;  4GKJ T;  4NXN T;  4OX9 T;  1HR0 T;  4LF6 T;  4DV3 T;  2UUB T;  4DV0 T;  4LFB T;  4JV5 T;  1XNR T;  4LF5 T;  2UU9 T;  2VQF T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...