2UXBT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxbT00
4AQYT 4LF4T 4DR6T 2F4VT 4B3TT 4DV3T 1IBKT 1XMOT 4B3RT 2VQET 4JV5T 4DV4T 4JI0T 4LF7T 4DR4T 4JYAT 3T1HT 4JI3T 2UUAT 4YY3T 1HNWT 4DV0T 1HNXT 4DR1T 4LF6T 2UXCT 2ZM6T 4X62T 4DR5T 4DV7T 4YHHT 4JI6T 2UUCT 4K0KT 4LF5T 1XNQT 4JI7T 4DUYT 1XNRT 2HHHT 1FJGT 4NXMT 4JI2T 1XMQT 1N32T 1I94T 4DV5T 4DR3T 5BR8T 3OTOT 4KHPT 2UXDT 4GKKT 3T1YT 4OX9T 1IBLT 4JI1T 1HNZT 4DV1T 2UU9T 4DV6T 4JI4T 4DUZT 4LF9T 1N33T 2VQFT 4LFAT 5IWAT 1IBMT 4B3ST 4B3MT 5LMNT 4JI5T 5LMUT 4LF8T 4DV2T 2UXBT 2E5LT 2UUBT 4X64T 4X66T 1N36T 1J5ET 4GKJT 4X65T 4DR2T 4NXNT 1N34T 1HR0T 4DR7T 4LFBT 4LFCT 4JI8T
chains in the Genus database with same CATH superfamily
2JJ9A 2F4VT 5F3JA 2FJBA 5HXCA 3RF1A 2PG8A 2L8KA 4GYRA 4PNIA 4X1IE 3U3IA 1ZEEA 2XAGB 2HPJA 1W9RA 3FBZA 4O4IE 4FJOA 3I0QA 4TV8E 4X62T 2X9XA 3RRCA 4X1KE 2JQQA 2UUCT 2BKOA 4DUYT 3AA0B 1IAPA 3P4PA 2V7KA 4HGAA 1ZHCA 1I94T 3RYIE 4I43B 3UULA 2LOPA 4QX8B 1IBLT 1MMGA 3N9NA 3LK3B 1MNEA 2BDEA 3I1AA 2YINA 4DMVA 4OK0A 1UGOA 4QXBB 3J7Yq 4CI3B 1W0AA 2K9AA 2CEAA 2E5LT 2YU2A 4U2YA 4V1Av 2M67A 3WI3A 1FEWA 3C50A 1MMDA 3AA6B 4X5TA 3LFMA 3PURA 3KBUA 1D0XA 2LM2A 4HKAA 2CXDA 2J62A 2KWHA 3UUNA 2CHNA 4JBWF 4X1YE 4ASKA 3PU3A 3MXZA 3VRBA 5J0ZA 5DQVA 2C5JA 5CGMA 2HPLA 1Y01A 3FZHB 5LHGB 3JC6D 5ADXL 3EDVA 4IDNA 4F6RC 4U7IA 3ZYLA 2VKJA 2LRKA 4HWFA 3UFEA 4YTNA 2I6HA 1O3XA 1LRZA 2CA5A 2XAFB 3UTKA 2ODVA 3N2GE 1WRDA 4ZZBA 1HG5A 4YT0A 3KFWX 2VQFT 2X68A 2FUPA 3K8PC 1YW0A 2CBJA 4ANJA 1HS7A 2YN6A 2A2FX 1IZNB 5LA6E 3RIUC 4G63A 4HFDA 2V5DA 2YU1A 5HEGA 5L2LA 3MZKB 2E8IA 5LOVE 2Q9QC 2KZ7B 4YSXA 2C5IT 3ANWA 4PFPA 2RPAA 2YDQA 1HX8A 2KNDA 4HE8A 2WDQA 4YHJA 3W15B 1VRBA 2XJ7A 2CWYA 3UUBA 4LF6T 3TKLB 3B5MA 4ILUA 3CWZB 2C5KT 2LT3A 4AQGA 4TN7B 1HFAA 2OV9A 3LJCA 3HR0A 1EZ3A 4IDPA 5JDFA 3H3MA 5A1LA 2EHOB 3Q5EA 4KX6A 3C4XA 4AKLA 4TZ4C 4Q25A 2LM9A 3RLFF 3B13A 1W0BA 5AQQB 2MAWA 4ISTA 4OX9T 4EYYR 3KINB 5JDNA 2W61A 5FXVA 5HWYA 2MTQA 3ZKRA 3M65A 4TWFA 4LFAT 5EK4A 2E9XB 1IBMT 1M7KA 5CFBA 5L4HA 3Q5WA 1CHUA 4KBMB 2FJDA 2XQ4A 3C98B 5DJQC 2UUBT 4KP3C 4X64T 4JLEA 5HYAA 4X66T 2JRKA 4UV8B 3HA4A 4HWCA 3P4SA 3C51A 2A72A 4A97A 1E1HB 4P0BA 5JDHA 3ZMUB 3J9X1 1J5WA 2LSJA 4I4TE 4HFEA 2W67A 2YKSA 3AA7B 2C0SA 4OYJA 2NTXA 3UT5E 3ABVA 5LBMA 3L09A 3MKDA 2XAQB 1MMAA 1D0YA 4IGUA 3IEEA 5AQKB 2V26A 2X0YA 4HFIA 5JR9A 4EEBA 1QLBA 3OTOT 4EZHA 1KEYA 3PV0F 4KHPT 5E0OA 4EGWA 5AQIB 2YK0A 3N9MA 2BG9E 4AKGA 4IDQA 3TLUA 4C91A 3ZJ1A 4JI1T 4DV6T 5FY7A 2X67A 4E7SA 3L3PA 2MYSA 4DVDA 3FXDB 1U4QA 2KINB 3EI0A 2PJQA 5CA0E 3O1JA 5DABA 4U7YA 2CLYB 3AECA 4EXTA 2D0UA 5KX5E 3HKBE 2IDOB 1MIVA 5L3BB 5L4EA 2CE7A 3PJAA 3IF8B 3RGLA 2H89A 2CWOA 5ABFA 1T8BA 4EEDA 3RC8A 3RYFE 3DTOA 4IDZA 2XY8B 4O4HE 5H6RB 3UU8A 2IC6A 1J1JA 2CXLA 2JQKA 1SHZC 2X0LB 4LF5T 1XNQT 5HAXA 2H7OA 1UX5A 3BQLA 4DV5T 5BR8T 3F57A 2W0GA 2RA1A 3UUMA 2DNXA 5HXSA 3P4RA 4PFOA 5HXEA 4MALA 4TV9E 2EHOC 5LXTE 3QB5A 3V5UA 4AISA 5F8PA 5FP3A 2BVMA 2G0UA 3MA9A 5C2TA 3AE6A 5AQTB 4MLKA 4XAXB 2XQ3A 4L9IA 4YSYA 5EK3A 3RKGA 1X79A 4WBOA 5FL1A 3JAEA 2W00A 2E9XC 1E2AA 4ISSA 4CI1B 4YLHA 4X65T 2PFVA 3LSVA 4U74A 1I6ZA 1N34T 4AKHA 2V7MA 4UV9B 4LFCT 4YSZA 2V6YA 4DNDA 4H9PC 2KSRA 3LK2B 3T1HT 3JCFA 2X0HA 5LHIB 3RC3A 2OA5A 1XDOA 2I59A 4PJMA 2QYWA 2WB5A 1T98A 4I55E 3K3NA 4GK5E 4AI6A 2NP9A 2WS3A 1XMQT 2CHOA 1YD8G 5AQRB 5L47A 5IHYA 2VB6A 2N2NA 5L3CB 4AQFC 2YDSA 4Z8XA 4J2CA 2WQYA 3PJAJ 4ZI7E 4HEAA 4DUZT 3I9WA 3E08A 3PTRB 4PW8A 3ZEFB 5AQMB 3AE8A 2JPFA 2CRBA 2CLYC 2WM9A 3OBVE 3NBXX 3K3QC 3ZPOA 5AQGB 1D1AA 3PUZF 4PJLA 3UQ7A 3ETVA 3TLVA 1UUSA 2XTLA 4GOUA 4ZS3A 2XQ7A 2PBIA 2BS2A 3KV9A 2JMKA 3BQIA 2X66A 2LSGA 3P4QA 4MBQA 5JDGA 1WLXA 2NR4A 2VVSA 3NRYA 2CXFA 4P09A 4MFRA 4DV7T 2XPKA 2NWBA 3FZMB 3ZSTA 4I0UA 4EB6E 5L3EB 3AEAA 1FMVA 3PUWF 4WBNE 4WNKA 2UXNB 2IW5B 1NEKA 3G06A 4GK0E 4BA9A 2B1EA 2WP9A 4DR3T 2WWUA 1BR1A 5FL0A 2NTYA 5HEJA 2VL8A 3ANWB 5FVLA 2LEHA 3H37A 3PUXF 5FY0A 2HN2A 3Q5DA 3ZCJA 2XASB 1OEDE 3EABA 3MJXA 4I50E 3NZPA 1KF6A 5IWAT 4B3ST 2M6BA 2A9UA 5IUXA 2X9YA 3QUJA 3RHWA 3JC6C 4ZXLA 4ADZA 3N9QA 4TNWA 3CIRA 1LVKA 5L3FB 4TWDA 4XZCA 3UUXB 4CXXA 2ZM2A 2J47A 3NKZA 1M62A 1UX4A 2P9BA 4B3TT 2WZHA 2H3RA 1VCTA 3CQXC 3AEEA 2K48A 4BJMA 3C64A 4JI0T 4JYAT 3FZFB 3ZMVB 4DBRA 5FYMA 2Y48B 3BK9A 1YKHB 5J2TE 5FXZA 3VU7H 4UVAB 5HCMA 4ZI3D 3N9OA 1BR0A 2LHRA 2D9DA 2ZM8A 4IE6A 3AA1B 5LGUB 2IAKA 5FMNA 4AKRB 2L9QA 4YJ3E 3N2KE 3P50A 3T8OA 1N32T 2XSBA 4NIQA 3ZSSA 2BKNA 1HF8A 4G2AA 2V6XA 2YDRA 2VL0A 5LGNB 2V8SV 4WYVA 4AIUA 3UFGA 1WFDA 5AQHB 4LMJA 4JUYA 1Z8UA 2J4GA 1HX1B 1WR0A 3X1DA 1U5PA 4NUVA 2BKPA 5IYZE 2CMRA 3JAFA 2QVAA 1W09A 2IUBA 2ACXA 4E7ZA 2CCQA 4QHOA 4EAHA 1SE7A 5JR9B 4A56A 1E7PA 3K3OA 4CZZB 5JQGE 2KWIB 3KV6A 4N78D 3OVUA 3ZT7A 3F31A 1XMOT 4B3RT 5F5WA 3ZCIA 2SPCA 1ZKEA 2VKHA 4U2ZA 3RX6A 2E5VA 3QOFA 3LG7A 3FXEB 2ZMAA 3AE1A 3ZT6A 3AEDA 4DIDB 3RQWA 5AQFB 1YQ4A 1FJGT 4NXMT 1XWMA 1SUMB 2B76A 2JQHA 2Y6XA 4PK6A 5L3DB 3Q9DA 1SA0E 2XQ6A 3ZN0B 4K0UA 2JMHA 2KT9A 5AQOB 3CMLA 5ABFB 4DV1T 4F8HA 4PJJA 5CA1E 5LG3A 2NW8A 4QXHB 5LJNA 1D0ZA 3HKCE 5HEUA 3RKOA 2AE9A 2XQYA 4UIGA 5AQNB 2DI4A 2LSIA 2MBGA 2X51A 5FNVE 5HXHA 3Q2MA 2X9WA 1Z0PA 1GQEA 1OEDA 1T7SA 4YTMA 3AEBA 3NWIA 4LFBT 3O4XE 4O2AE 4AQYT 1L0VA 1UURA 4OHFA 4CN6A 1MIWA 3CVRA 2CM0A 2MPKA 4WZXA 4DV4T 3KDSE 1UK5A 1ZP0A 3CX6B 2BS3A 4YY3T 3WAKA 1YQ3A 4ERRA 3UU4A 1US7B 1T72A 2J1DG 4YXDA 4O4LE 2YEVC 3ZLIA 3KBTA 2V7IA 3PUYF 2VKDA 2V6YB 4A5XA 3AE2A 3A5XA 3AE9A 4B6XA 3RYHE 2W2UA 3PDYA 3ZN1B 3CPZA 4EYUA 3UQ4A 2VURA 5CB4E 2XSAA 4ZS2A 3CX7B 5JH7E 1N33T 5FY1A 1V9DA 5EZYE 4BJNA 4DO0A 4O2BE 2WU5A 3V5SA 1N36T 4UXNB 3E22E 1J5ET 4QH1A 4ZI2D 2IIUA 3LBXB 1HR0T 1IJ6A 1LKXA 3AE3A 2WSSV 3FZKB 5JR9C 4ILBA 2DWGA 2CPTA 2H88A 5JRCA 4X20E 4LF7T 4DR4T 3FB2A 4NPPA 1B7TA 2OLTA 2UUAT 2KMFA 2XUEA 1NWMX 1NENA 3KVAA 5LHHB 4LMKA 4ZHQE 3VKGA 2LOSA 3ZYKA 2FJAA 2D2SA 4HWDA 4UF0A 3RI5A 3OKQA 4COFA 2GK9A 5LG4A 4UEMA 4KI0F 1BR4A 2WDVA 2LKHA 2L3LA 3AXJA 3VKHA 1MNDA 2DL1A 5TAOA 4EIWA 2DHRA 2NW9A 2N9DA 3SS1A 5LCYA 1HG2A 4LF9T 3LBXA 3ONXA 4C90A 4MHCA 4IE5A 2DLRA 2ES0A 5J2UE 3PUVF 4H9NC 4H9SE 5FXWA 4QH4A 3TLSA 1NAFA 3NZQA 1MMNA 3GA8A 5HCJA 1WCRA 4TWHA 2AXDS 3L8RA 4PAGA 4L0RA 4QH5A 4ILCA 3ZT5A 3N9PA 3RYCE 4DV3T 4GYSA 3LK42 4P1NA 3EDUA 3HI2A 2VQET 2BG9A 2DCFA 2K24A 3C4ZA 4L5GA 5H6QB 4A98A 1G73A 2BS4A 2LHNA 1HNWT 4DV0T 1OXZA 3RIUA 2WU2A 3AVSA 3SOLA 1H7CA 3LDQB 3P8CD 2R6GF 4U33A 3EHZA 3A8YC 4UVBB 4YHHT 4JI6T 2Z6EA 2XAHB 5AQVB 4JI7T 2Q9QA 5LBQB 2NOXA 5C8YE 4KUMB 3O9XA 3NRXA 2N1GA 2ACZA 3ZMZB 2LE8A 3MK7C 3SWHA 2BBHA 4KMCA 4GKKT 4CN4A 3CQGB 3T1YT 5C3JA 3N5LA 4WW0A 2UU9T 4IIJE 4QXCB 3UU6A 1CUNA 2W4XA 2XAJB 4EV6A 1HCIA 3O1HA 1X9BA 4IREA 2V5CA 4HFHA 2VVNA 3ZJ2A 4IL9A 2WY2A 2XM2A 4DR2T 4EOZB 2K3WA 3PUAA 1R8IA 4AXPA 3PUGA 5GONE 1XDPA 3IHRA 3UU5A 4CQIA 1D1CA 5KDMC 3MACA 2WMOA 4PK5A 4H9QC 5LJMA 2X9HA 4ZEYA 1WYCA 3CQCB 4UELA 1WR6A 3DP7A 4QWNB 5M4YA 4DBQA 5HEOA 4TNVA 3PU8A 4CI2B 5JDLA 3PUQA 5AQUB 4PJNA 4CXWA 2Q9QD 4K0KT 3AE5A 3N2OA 2LSKA 2YOEA 3I0OA 2XQ9A 1Y64B 2HHHT 5LB7B 2VWAA 4JI2T 4ZOLE 3ZYMA 2BG9C 3QB5K 3U78A 3P7IA 4CXYA 3VRAA 3OPCA 2UXDT 3B57A 1YXRA 3VR8A 3CX8B 5CJ5A 5LYJE 3QNUA 3RRWA 3RPUA 1VCSA 3AAEB 2IHR1 2VK9A 1G8XA 3I9YA 1ZOYA 1DU2A 1BR2A 2KLQA 2LKGA 2E2AA 1S94A 3M3ZB 2WDRA 4ZI3C 3WAJA 2V7JA 4Z90A 4DR7T 3R6NA 2XZEA 4QX7B 5ETWA 3ZC0A 3S4UA 3AE7A 4GIWA 4H9OC 1IBKT 3GMIA 4JEHB 3D0TA 4JV5T 4IE7A 2XM1A 4ILAA 4IE0A 3GN5B 3L39A 2W62A 5LNKA 2JQ9A 5JVDE 1D1BA 4DMWA 2UXCT 3RIFA 1IJ5A 2ODUA 3RH3A 3UU3A 1QUUA 4PK4A 2BVLA 5FXXA 5JDMA 4H9RC 1XNRT 3CKDA 2I0MA 2IMLA 3SFDA 2XQ8A 2W63A 3AE4A 1OEDB 5KMGP 3SRZA 3DJBA 4M1PA 3IA3A 3EUHA 2Y8DA 2FJEA 5JREA 3ONLC 5AFUL 1KNZA 3PUSA 2ZM0A 4YFSA 3ZMTB 2CBIA 3AB3B 4H63V 1ZV4X 3FHNA 3TLWA 3EVYA 4IHJE 3P4WA 2VKOA 1S35A 3KV4A 3OYZA 1OWAA 5BMVE 4UVCB 1JNZA 4DV2T 5FKYA 3K1SA 2V7LA 2IC9A 3RQUA 4GKJT 2WCAA 1FMWA 4KHZF 3GN5A 4U31A 4OFZA 2EHOA 3CK6A 2LRLA 4TX5A 3GWHA 1FIOA 3R84B 3KVBA 2BZBA 4CN1A 3EAMA 4LF4T 3HL6A 3E0ZA 1AJ3A 3Q5XA 4H63H 4ZZCA 4JEUB 4Z91A 3VR9A 5AQLB 4JI3T 4U3CA 2E9XA 4LMLA 2LSYA 2ZM6T 2V1DB 3AEGA 2K5BB 3QK6A 4DR5T 5LP6E 4IDOA 2QRXA 2M6IA 3QC9A 5FVKA 5JDQA 3H3AA 2QGSA 5AQJB 4HTEA 5LGTB 1QSDA 5JTGA 5HEHA 2RP4A 4FI5A 4U72A 2HH7A 5L3GB 2NW7A 2VASA 4HN9A 3ZMSB 5JRCB 3F2EA 3VHLA 1HNZT 4XBFB 3NVOA 4HWHA 2H7VC 2WBLA 4EZ4A 4B3MT 4JI5T 4HFVA 2PTFA 1VOMA 5HXRA 2UXBT 3AEFA 2MOZA 3O1IA 1HTJF 4UF0B 2WZIA 3HKEE 2JIWA 2EHOD 5AQSB 4P0AA 3OYXA 1KK7A 2XQ5A 4AQFA 4NUUA 4UR9A 3ESLA 4BAYB 1KFYA 4JI8T 1XZYA 3AXJB 4DR6T 5EK2A 3ONJA 1MIYA 3C4WA 5DQWA 4O8SA 4IE4A 2A3DA 3AAAB 2D0TA 2E9XD 1UCUA 3IBPA 1HNXT 4DR1T 5ABGA 2KXPB 4IL4A 3KV5A 2XHEB 4O4JE 2WWVA 3N9LA 2XQAA 3AAIA 4OYKA 4YJ2E 1JNRA 4TUYE 2DWKA 1KNRA 2LJLA 3BQKA 5ABHA 1LVFA 4HFBA 1OEDC 4HFCA 3JADA 4AKIA 4ZI2C 3A7MA 2BG9B 4JI4T 3TLTA 5ABEA 1WYBA 2QA7A 3ZC1A 2D5UA 5LMNT 5LMUT 4LF8T 3SFEA 4IT4A 4HWIB 5J1GA 5KXJA 4YTPA 3RIAA 4QKNA 3OJAA 3AVRA 3HKDE 2UXXB 1KNPA 2LLYA 5AQPB 2FBWA 2Q9QB 3FZLB 2WAUA 4NXNT 3PE0A 3FBLA 2HN1A 3ETUA 1YKEB 5HWXA 2W66A 2ZLYA 2WMNA 2BBJA
chains in the Genus database with same CATH topology
4AQYT 4LF4T 4DR6T 2F4VT 4B3TT 4DV3T 1IBKT 1XMOT 4B3RT 2VQET 4JV5T 4DV4T 4JI0T 4LF7T 4DR4T 4JYAT 3T1HT 4JI3T 2UUAT 4YY3T 1HNWT 4DV0T 1HNXT 4DR1T 4LF6T 2UXCT 2ZM6T 4X62T 4DR5T 4DV7T 4YHHT 4JI6T 2UUCT 4K0KT 4LF5T 1XNQT 4JI7T 4DUYT 1XNRT 2HHHT 1FJGT 4NXMT 4JI2T 1XMQT 1N32T 1I94T 4DV5T 4DR3T 5BR8T 3OTOT 4KHPT 2UXDT 4GKKT 3T1YT 4OX9T 1IBLT 4JI1T 1HNZT 4DV1T 2UU9T 4DV6T 4JI4T 4DUZT 4LF9T 1N33T 2VQFT 4LFAT 5IWAT 1IBMT 4B3ST 4B3MT 5LMNT 4JI5T 5LMUT 4LF8T 4DV2T 2UXBT 2E5LT 2UUBT 4X64T 4X66T 1N36T 1J5ET 4GKJT 4X65T 4DR2T 4NXNT 1N34T 1HR0T 4DR7T 4LFBT 4LFCT 4JI8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY T;  4LF4 T;  4DR6 T;  2F4V T;  4B3T T;  4DV3 T;  1IBK T;  1XMO T;  4B3R T;  2VQE T;  4JV5 T;  4DV4 T;  4JI0 T;  4LF7 T;  4DR4 T;  4JYA T;  3T1H T;  4JI3 T;  2UUA T;  4YY3 T;  1HNW T;  4DV0 T;  1HNX T;  4DR1 T;  4LF6 T;  2UXC T;  2ZM6 T;  4X62 T;  4DR5 T;  4DV7 T;  4YHH T;  4JI6 T;  2UUC T;  4K0K T;  4LF5 T;  1XNQ T;  4JI7 T;  4DUY T;  1XNR T;  2HHH T;  1FJG T;  4NXM T;  4JI2 T;  1XMQ T;  1N32 T;  1I94 T;  4DV5 T;  4DR3 T;  5BR8 T;  3OTO T;  4KHP T;  2UXD T;  4GKK T;  3T1Y T;  4OX9 T;  1IBL T;  4JI1 T;  1HNZ T;  4DV1 T;  2UU9 T;  4DV6 T;  4JI4 T;  4DUZ T;  4LF9 T;  1N33 T;  2VQF T;  4LFA T;  5IWA T;  1IBM T;  4B3S T;  4B3M T;  5LMN T;  4JI5 T;  5LMU T;  4LF8 T;  4DV2 T;  2UXB T;  2E5L T;  2UUB T;  4X64 T;  4X66 T;  1N36 T;  1J5E T;  4GKJ T;  4X65 T;  4DR2 T;  4NXN T;  1N34 T;  1HR0 T;  4DR7 T;  4LFB T;  4LFC T;  4JI8 T; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  2F4V T;  5F3J A;  2FJB A;  5HXC A;  3RF1 A;  2PG8 A;  2L8K A;  4GYR A;  4PNI A;  4X1I E;  3U3I A;  1ZEE A;  2XAG B;  2HPJ A;  1W9R A;  3FBZ A;  4O4I E;  4FJO A;  3I0Q A;  4TV8 E;  4X62 T;  2X9X A;  3RRC A;  4X1K E;  2JQQ A;  2UUC T;  2BKO A;  4DUY T;  3AA0 B;  1IAP A;  3P4P A;  2V7K A;  4HGA A;  1ZHC A;  1I94 T;  3RYI E;  4I43 B;  3UUL A;  2LOP A;  4QX8 B;  1IBL T;  1MMG A;  3N9N A;  3LK3 B;  1MNE A;  2BDE A;  3I1A A;  2YIN A;  4DMV A;  4OK0 A;  1UGO A;  4QXB B;  3J7Y q;  4CI3 B;  1W0A A;  2K9A A;  2CEA A;  2E5L T;  2YU2 A;  4U2Y A;  4V1A v;  2M67 A;  3WI3 A;  1FEW A;  3C50 A;  1MMD A;  3AA6 B;  4X5T A;  3LFM A;  3PUR A;  3KBU A;  1D0X A;  2LM2 A;  4HKA A;  2CXD A;  2J62 A;  2KWH A;  3UUN A;  2CHN A;  4JBW F;  4X1Y E;  4ASK A;  3PU3 A;  3MXZ A;  3VRB A;  5J0Z A;  5DQV A;  2C5J A;  5CGM A;  2HPL A;  1Y01 A;  3FZH B;  5LHG B;  3JC6 D;  5ADX L;  3EDV A;  4IDN A;  4F6R C;  4U7I A;  3ZYL A;  2VKJ A;  2LRK A;  4HWF A;  3UFE A;  4YTN A;  2I6H A;  1O3X A;  1LRZ A;  2CA5 A;  2XAF B;  3UTK A;  2ODV A;  3N2G E;  1WRD A;  4ZZB A;  1HG5 A;  4YT0 A;  3KFW X;  2VQF T;  2X68 A;  2FUP A;  3K8P C;  1YW0 A;  2CBJ A;  4ANJ A;  1HS7 A;  2YN6 A;  2A2F X;  1IZN B;  5LA6 E;  3RIU C;  4G63 A;  4HFD A;  2V5D A;  2YU1 A;  5HEG A;  5L2L A;  3MZK B;  2E8I A;  5LOV E;  2Q9Q C;  2KZ7 B;  4YSX A;  2C5I T;  3ANW A;  4PFP A;  2RPA A;  2YDQ A;  1HX8 A;  2KND A;  4HE8 A;  2WDQ A;  4YHJ A;  3W15 B;  1VRB A;  2XJ7 A;  2CWY A;  3UUB A;  4LF6 T;  3TKL B;  3B5M A;  4ILU A;  3CWZ B;  2C5K T;  2LT3 A;  4AQG A;  4TN7 B;  1HFA A;  2OV9 A;  3LJC A;  3HR0 A;  1EZ3 A;  4IDP A;  5JDF A;  3H3M A;  5A1L A;  2EHO B;  3Q5E A;  4KX6 A;  3C4X A;  4AKL A;  4TZ4 C;  4Q25 A;  2LM9 A;  3RLF F;  3B13 A;  1W0B A;  5AQQ B;  2MAW A;  4IST A;  4OX9 T;  4EYY R;  3KIN B;  5JDN A;  2W61 A;  5FXV A;  5HWY A;  2MTQ A;  3ZKR A;  3M65 A;  4TWF A;  4LFA T;  5EK4 A;  2E9X B;  1IBM T;  1M7K A;  5CFB A;  5L4H A;  3Q5W A;  1CHU A;  4KBM B;  2FJD A;  2XQ4 A;  3C98 B;  5DJQ C;  2UUB T;  4KP3 C;  4X64 T;  4JLE A;  5HYA A;  4X66 T;  2JRK A;  4UV8 B;  3HA4 A;  4HWC A;  3P4S A;  3C51 A;  2A72 A;  4A97 A;  1E1H B;  4P0B A;  5JDH A;  3ZMU B;  3J9X 1;  1J5W A;  2LSJ A;  4I4T E;  4HFE A;  2W67 A;  2YKS A;  3AA7 B;  2C0S A;  4OYJ A;  2NTX A;  3UT5 E;  3ABV A;  5LBM A;  3L09 A;  3MKD A;  2XAQ B;  1MMA A;  1D0Y A;  4IGU A;  3IEE A;  5AQK B;  2V26 A;  2X0Y A;  4HFI A;  5JR9 A;  4EEB A;  1QLB A;  3OTO T;  4EZH A;  1KEY A;  3PV0 F;  4KHP T;  5E0O A;  4EGW A;  5AQI B;  2YK0 A;  3N9M A;  2BG9 E;  4AKG A;  4IDQ A;  3TLU A;  4C91 A;  3ZJ1 A;  4JI1 T;  4DV6 T;  5FY7 A;  2X67 A;  4E7S A;  3L3P A;  2MYS A;  4DVD A;  3FXD B;  1U4Q A;  2KIN B;  3EI0 A;  2PJQ A;  5CA0 E;  3O1J A;  5DAB A;  4U7Y A;  2CLY B;  3AEC A;  4EXT A;  2D0U A;  5KX5 E;  3HKB E;  2IDO B;  1MIV A;  5L3B B;  5L4E A;  2CE7 A;  3PJA A;  3IF8 B;  3RGL A;  2H89 A;  2CWO A;  5ABF A;  1T8B A;  4EED A;  3RC8 A;  3RYF E;  3DTO A;  4IDZ A;  2XY8 B;  4O4H E;  5H6R B;  3UU8 A;  2IC6 A;  1J1J A;  2CXL A;  2JQK A;  1SHZ C;  2X0L B;  4LF5 T;  1XNQ T;  5HAX A;  2H7O A;  1UX5 A;  3BQL A;  4DV5 T;  5BR8 T;  3F57 A;  2W0G A;  2RA1 A;  3UUM A;  2DNX A;  5HXS A;  3P4R A;  4PFO A;  5HXE A;  4MAL A;  4TV9 E;  2EHO C;  5LXT E;  3QB5 A;  3V5U A;  4AIS A;  5F8P A;  5FP3 A;  2BVM A;  2G0U A;  3MA9 A;  5C2T A;  3AE6 A;  5AQT B;  4MLK A;  4XAX B;  2XQ3 A;  4L9I A;  4YSY A;  5EK3 A;  3RKG A;  1X79 A;  4WBO A;  5FL1 A;  3JAE A;  2W00 A;  2E9X C;  1E2A A;  4ISS A;  4CI1 B;  4YLH A;  4X65 T;  2PFV A;  3LSV A;  4U74 A;  1I6Z A;  1N34 T;  4AKH A;  2V7M A;  4UV9 B;  4LFC T;  4YSZ A;  2V6Y A;  4DND A;  4H9P C;  2KSR A;  3LK2 B;  3T1H T;  3JCF A;  2X0H A;  5LHI B;  3RC3 A;  2OA5 A;  1XDO A;  2I59 A;  4PJM A;  2QYW A;  2WB5 A;  1T98 A;  4I55 E;  3K3N A;  4GK5 E;  4AI6 A;  2NP9 A;  2WS3 A;  1XMQ T;  2CHO A;  1YD8 G;  5AQR B;  5L47 A;  5IHY A;  2VB6 A;  2N2N A;  5L3C B;  4AQF C;  2YDS A;  4Z8X A;  4J2C A;  2WQY A;  3PJA J;  4ZI7 E;  4HEA A;  4DUZ T;  3I9W A;  3E08 A;  3PTR B;  4PW8 A;  3ZEF B;  5AQM B;  3AE8 A;  2JPF A;  2CRB A;  2CLY C;  2WM9 A;  3OBV E;  3NBX X;  3K3Q C;  3ZPO A;  5AQG B;  1D1A A;  3PUZ F;  4PJL A;  3UQ7 A;  3ETV A;  3TLV A;  1UUS A;  2XTL A;  4GOU A;  4ZS3 A;  2XQ7 A;  2PBI A;  2BS2 A;  3KV9 A;  2JMK A;  3BQI A;  2X66 A;  2LSG A;  3P4Q A;  4MBQ A;  5JDG A;  1WLX A;  2NR4 A;  2VVS A;  3NRY A;  2CXF A;  4P09 A;  4MFR A;  4DV7 T;  2XPK A;  2NWB A;  3FZM B;  3ZST A;  4I0U A;  4EB6 E;  5L3E B;  3AEA A;  1FMV A;  3PUW F;  4WBN E;  4WNK A;  2UXN B;  2IW5 B;  1NEK A;  3G06 A;  4GK0 E;  4BA9 A;  2B1E A;  2WP9 A;  4DR3 T;  2WWU A;  1BR1 A;  5FL0 A;  2NTY A;  5HEJ A;  2VL8 A;  3ANW B;  5FVL A;  2LEH A;  3H37 A;  3PUX F;  5FY0 A;  2HN2 A;  3Q5D A;  3ZCJ A;  2XAS B;  1OED E;  3EAB A;  3MJX A;  4I50 E;  3NZP A;  1KF6 A;  5IWA T;  4B3S T;  2M6B A;  2A9U A;  5IUX A;  2X9Y A;  3QUJ A;  3RHW A;  3JC6 C;  4ZXL A;  4ADZ A;  3N9Q A;  4TNW A;  3CIR A;  1LVK A;  5L3F B;  4TWD A;  4XZC A;  3UUX B;  4CXX A;  2ZM2 A;  2J47 A;  3NKZ A;  1M62 A;  1UX4 A;  2P9B A;  4B3T T;  2WZH A;  2H3R A;  1VCT A;  3CQX C;  3AEE A;  2K48 A;  4BJM A;  3C64 A;  4JI0 T;  4JYA T;  3FZF B;  3ZMV B;  4DBR A;  5FYM A;  2Y48 B;  3BK9 A;  1YKH B;  5J2T E;  5FXZ A;  3VU7 H;  4UVA B;  5HCM A;  4ZI3 D;  3N9O A;  1BR0 A;  2LHR A;  2D9D A;  2ZM8 A;  4IE6 A;  3AA1 B;  5LGU B;  2IAK A;  5FMN A;  4AKR B;  2L9Q A;  4YJ3 E;  3N2K E;  3P50 A;  3T8O A;  1N32 T;  2XSB A;  4NIQ A;  3ZSS A;  2BKN A;  1HF8 A;  4G2A A;  2V6X A;  2YDR A;  2VL0 A;  5LGN B;  2V8S V;  4WYV A;  4AIU A;  3UFG A;  1WFD A;  5AQH B;  4LMJ A;  4JUY A;  1Z8U A;  2J4G A;  1HX1 B;  1WR0 A;  3X1D A;  1U5P A;  4NUV A;  2BKP A;  5IYZ E;  2CMR A;  3JAF A;  2QVA A;  1W09 A;  2IUB A;  2ACX A;  4E7Z A;  2CCQ A;  4QHO A;  4EAH A;  1SE7 A;  5JR9 B;  4A56 A;  1E7P A;  3K3O A;  4CZZ B;  5JQG E;  2KWI B;  3KV6 A;  4N78 D;  3OVU A;  3ZT7 A;  3F31 A;  1XMO T;  4B3R T;  5F5W A;  3ZCI A;  2SPC A;  1ZKE A;  2VKH A;  4U2Z A;  3RX6 A;  2E5V A;  3QOF A;  3LG7 A;  3FXE B;  2ZMA A;  3AE1 A;  3ZT6 A;  3AED A;  4DID B;  3RQW A;  5AQF B;  1YQ4 A;  1FJG T;  4NXM T;  1XWM A;  1SUM B;  2B76 A;  2JQH A;  2Y6X A;  4PK6 A;  5L3D B;  3Q9D A;  1SA0 E;  2XQ6 A;  3ZN0 B;  4K0U A;  2JMH A;  2KT9 A;  5AQO B;  3CML A;  5ABF B;  4DV1 T;  4F8H A;  4PJJ A;  5CA1 E;  5LG3 A;  2NW8 A;  4QXH B;  5LJN A;  1D0Z A;  3HKC E;  5HEU A;  3RKO A;  2AE9 A;  2XQY A;  4UIG A;  5AQN B;  2DI4 A;  2LSI A;  2MBG A;  2X51 A;  5FNV E;  5HXH A;  3Q2M A;  2X9W A;  1Z0P A;  1GQE A;  1OED A;  1T7S A;  4YTM A;  3AEB A;  3NWI A;  4LFB T;  3O4X E;  4O2A E;  4AQY T;  1L0V A;  1UUR A;  4OHF A;  4CN6 A;  1MIW A;  3CVR A;  2CM0 A;  2MPK A;  4WZX A;  4DV4 T;  3KDS E;  1UK5 A;  1ZP0 A;  3CX6 B;  2BS3 A;  4YY3 T;  3WAK A;  1YQ3 A;  4ERR A;  3UU4 A;  1US7 B;  1T72 A;  2J1D G;  4YXD A;  4O4L E;  2YEV C;  3ZLI A;  3KBT A;  2V7I A;  3PUY F;  2VKD A;  2V6Y B;  4A5X A;  3AE2 A;  3A5X A;  3AE9 A;  4B6X A;  3RYH E;  2W2U A;  3PDY A;  3ZN1 B;  3CPZ A;  4EYU A;  3UQ4 A;  2VUR A;  5CB4 E;  2XSA A;  4ZS2 A;  3CX7 B;  5JH7 E;  1N33 T;  5FY1 A;  1V9D A;  5EZY E;  4BJN A;  4DO0 A;  4O2B E;  2WU5 A;  3V5S A;  1N36 T;  4UXN B;  3E22 E;  1J5E T;  4QH1 A;  4ZI2 D;  2IIU A;  3LBX B;  1HR0 T;  1IJ6 A;  1LKX A;  3AE3 A;  2WSS V;  3FZK B;  5JR9 C;  4ILB A;  2DWG A;  2CPT A;  2H88 A;  5JRC A;  4X20 E;  4LF7 T;  4DR4 T;  3FB2 A;  4NPP A;  1B7T A;  2OLT A;  2UUA T;  2KMF A;  2XUE A;  1NWM X;  1NEN A;  3KVA A;  5LHH B;  4LMK A;  4ZHQ E;  3VKG A;  2LOS A;  3ZYK A;  2FJA A;  2D2S A;  4HWD A;  4UF0 A;  3RI5 A;  3OKQ A;  4COF A;  2GK9 A;  5LG4 A;  4UEM A;  4KI0 F;  1BR4 A;  2WDV A;  2LKH A;  2L3L A;  3AXJ A;  3VKH A;  1MND A;  2DL1 A;  5TAO A;  4EIW A;  2DHR A;  2NW9 A;  2N9D A;  3SS1 A;  5LCY A;  1HG2 A;  4LF9 T;  3LBX A;  3ONX A;  4C90 A;  4MHC A;  4IE5 A;  2DLR A;  2ES0 A;  5J2U E;  3PUV F;  4H9N C;  4H9S E;  5FXW A;  4QH4 A;  3TLS A;  1NAF A;  3NZQ A;  1MMN A;  3GA8 A;  5HCJ A;  1WCR A;  4TWH A;  2AXD S;  3L8R A;  4PAG A;  4L0R A;  4QH5 A;  4ILC A;  3ZT5 A;  3N9P A;  3RYC E;  4DV3 T;  4GYS A;  3LK4 2;  4P1N A;  3EDU A;  3HI2 A;  2VQE T;  2BG9 A;  2DCF A;  2K24 A;  3C4Z A;  4L5G A;  5H6Q B;  4A98 A;  1G73 A;  2BS4 A;  2LHN A;  1HNW T;  4DV0 T;  1OXZ A;  3RIU A;  2WU2 A;  3AVS A;  3SOL A;  1H7C A;  3LDQ B;  3P8C D;  2R6G F;  4U33 A;  3EHZ A;  3A8Y C;  4UVB B;  4YHH T;  4JI6 T;  2Z6E A;  2XAH B;  5AQV B;  4JI7 T;  2Q9Q A;  5LBQ B;  2NOX A;  5C8Y E;  4KUM B;  3O9X A;  3NRX A;  2N1G A;  2ACZ A;  3ZMZ B;  2LE8 A;  3MK7 C;  3SWH A;  2BBH A;  4KMC A;  4GKK T;  4CN4 A;  3CQG B;  3T1Y T;  5C3J A;  3N5L A;  4WW0 A;  2UU9 T;  4IIJ E;  4QXC B;  3UU6 A;  1CUN A;  2W4X A;  2XAJ B;  4EV6 A;  1HCI A;  3O1H A;  1X9B A;  4IRE A;  2V5C A;  4HFH A;  2VVN A;  3ZJ2 A;  4IL9 A;  2WY2 A;  2XM2 A;  4DR2 T;  4EOZ B;  2K3W A;  3PUA A;  1R8I A;  4AXP A;  3PUG A;  5GON E;  1XDP A;  3IHR A;  3UU5 A;  4CQI A;  1D1C A;  5KDM C;  3MAC A;  2WMO A;  4PK5 A;  4H9Q C;  5LJM A;  2X9H A;  4ZEY A;  1WYC A;  3CQC B;  4UEL A;  1WR6 A;  3DP7 A;  4QWN B;  5M4Y A;  4DBQ A;  5HEO A;  4TNV A;  3PU8 A;  4CI2 B;  5JDL A;  3PUQ A;  5AQU B;  4PJN A;  4CXW A;  2Q9Q D;  4K0K T;  3AE5 A;  3N2O A;  2LSK A;  2YOE A;  3I0O A;  2XQ9 A;  1Y64 B;  2HHH T;  5LB7 B;  2VWA A;  4JI2 T;  4ZOL E;  3ZYM A;  2BG9 C;  3QB5 K;  3U78 A;  3P7I A;  4CXY A;  3VRA A;  3OPC A;  2UXD T;  3B57 A;  1YXR A;  3VR8 A;  3CX8 B;  5CJ5 A;  5LYJ E;  3QNU A;  3RRW A;  3RPU A;  1VCS A;  3AAE B;  2IHR 1;  2VK9 A;  1G8X A;  3I9Y A;  1ZOY A;  1DU2 A;  1BR2 A;  2KLQ A;  2LKG A;  2E2A A;  1S94 A;  3M3Z B;  2WDR A;  4ZI3 C;  3WAJ A;  2V7J A;  4Z90 A;  4DR7 T;  3R6N A;  2XZE A;  4QX7 B;  5ETW A;  3ZC0 A;  3S4U A;  3AE7 A;  4GIW A;  4H9O C;  1IBK T;  3GMI A;  4JEH B;  3D0T A;  4JV5 T;  4IE7 A;  2XM1 A;  4ILA A;  4IE0 A;  3GN5 B;  3L39 A;  2W62 A;  5LNK A;  2JQ9 A;  5JVD E;  1D1B A;  4DMW A;  2UXC T;  3RIF A;  1IJ5 A;  2ODU A;  3RH3 A;  3UU3 A;  1QUU A;  4PK4 A;  2BVL A;  5FXX A;  5JDM A;  4H9R C;  1XNR T;  3CKD A;  2I0M A;  2IML A;  3SFD A;  2XQ8 A;  2W63 A;  3AE4 A;  1OED B;  5KMG P;  3SRZ A;  3DJB A;  4M1P A;  3IA3 A;  3EUH A;  2Y8D A;  2FJE A;  5JRE A;  3ONL C;  5AFU L;  1KNZ A;  3PUS A;  2ZM0 A;  4YFS A;  3ZMT B;  2CBI A;  3AB3 B;  4H63 V;  1ZV4 X;  3FHN A;  3TLW A;  3EVY A;  4IHJ E;  3P4W A;  2VKO A;  1S35 A;  3KV4 A;  3OYZ A;  1OWA A;  5BMV E;  4UVC B;  1JNZ A;  4DV2 T;  5FKY A;  3K1S A;  2V7L A;  2IC9 A;  3RQU A;  4GKJ T;  2WCA A;  1FMW A;  4KHZ F;  3GN5 A;  4U31 A;  4OFZ A;  2EHO A;  3CK6 A;  2LRL A;  4TX5 A;  3GWH A;  1FIO A;  3R84 B;  3KVB A;  2BZB A;  4CN1 A;  3EAM A;  4LF4 T;  3HL6 A;  3E0Z A;  1AJ3 A;  3Q5X A;  4H63 H;  4ZZC A;  4JEU B;  4Z91 A;  3VR9 A;  5AQL B;  4JI3 T;  4U3C A;  2E9X A;  4LML A;  2LSY A;  2ZM6 T;  2V1D B;  3AEG A;  2K5B B;  3QK6 A;  4DR5 T;  5LP6 E;  4IDO A;  2QRX A;  2M6I A;  3QC9 A;  5FVK A;  5JDQ A;  3H3A A;  2QGS A;  5AQJ B;  4HTE A;  5LGT B;  1QSD A;  5JTG A;  5HEH A;  2RP4 A;  4FI5 A;  4U72 A;  2HH7 A;  5L3G B;  2NW7 A;  2VAS A;  4HN9 A;  3ZMS B;  5JRC B;  3F2E A;  3VHL A;  1HNZ T;  4XBF B;  3NVO A;  4HWH A;  2H7V C;  2WBL A;  4EZ4 A;  4B3M T;  4JI5 T;  4HFV A;  2PTF A;  1VOM A;  5HXR A;  2UXB T;  3AEF A;  2MOZ A;  3O1I A;  1HTJ F;  4UF0 B;  2WZI A;  3HKE E;  2JIW A;  2EHO D;  5AQS B;  4P0A A;  3OYX A;  1KK7 A;  2XQ5 A;  4AQF A;  4NUU A;  4UR9 A;  3ESL A;  4BAY B;  1KFY A;  4JI8 T;  1XZY A;  3AXJ B;  4DR6 T;  5EK2 A;  3ONJ A;  1MIY A;  3C4W A;  5DQW A;  4O8S A;  4IE4 A;  2A3D A;  3AAA B;  2D0T A;  2E9X D;  1UCU A;  3IBP A;  1HNX T;  4DR1 T;  5ABG A;  2KXP B;  4IL4 A;  3KV5 A;  2XHE B;  4O4J E;  2WWV A;  3N9L A;  2XQA A;  3AAI A;  4OYK A;  4YJ2 E;  1JNR A;  4TUY E;  2DWK A;  1KNR A;  2LJL A;  3BQK A;  5ABH A;  1LVF A;  4HFB A;  1OED C;  4HFC A;  3JAD A;  4AKI A;  4ZI2 C;  3A7M A;  2BG9 B;  4JI4 T;  3TLT A;  5ABE A;  1WYB A;  2QA7 A;  3ZC1 A;  2D5U A;  5LMN T;  5LMU T;  4LF8 T;  3SFE A;  4IT4 A;  4HWI B;  5J1G A;  5KXJ A;  4YTP A;  3RIA A;  4QKN A;  3OJA A;  3AVR A;  3HKD E;  2UXX B;  1KNP A;  2LLY A;  5AQP B;  2FBW A;  2Q9Q B;  3FZL B;  2WAU A;  4NXN T;  3PE0 A;  3FBL A;  2HN1 A;  3ETU A;  1YKE B;  5HWX A;  2W66 A;  2ZLY A;  2WMN A;  2BBJ A; 
#chains in the Genus database with same CATH homology
 4AQY T;  4LF4 T;  4DR6 T;  2F4V T;  4B3T T;  4DV3 T;  1IBK T;  1XMO T;  4B3R T;  2VQE T;  4JV5 T;  4DV4 T;  4JI0 T;  4LF7 T;  4DR4 T;  4JYA T;  3T1H T;  4JI3 T;  2UUA T;  4YY3 T;  1HNW T;  4DV0 T;  1HNX T;  4DR1 T;  4LF6 T;  2UXC T;  2ZM6 T;  4X62 T;  4DR5 T;  4DV7 T;  4YHH T;  4JI6 T;  2UUC T;  4K0K T;  4LF5 T;  1XNQ T;  4JI7 T;  4DUY T;  1XNR T;  2HHH T;  1FJG T;  4NXM T;  4JI2 T;  1XMQ T;  1N32 T;  1I94 T;  4DV5 T;  4DR3 T;  5BR8 T;  3OTO T;  4KHP T;  2UXD T;  4GKK T;  3T1Y T;  4OX9 T;  1IBL T;  4JI1 T;  1HNZ T;  4DV1 T;  2UU9 T;  4DV6 T;  4JI4 T;  4DUZ T;  4LF9 T;  1N33 T;  2VQF T;  4LFA T;  5IWA T;  1IBM T;  4B3S T;  4B3M T;  5LMN T;  4JI5 T;  5LMU T;  4LF8 T;  4DV2 T;  2UXB T;  2E5L T;  2UUB T;  4X64 T;  4X66 T;  1N36 T;  1J5E T;  4GKJ T;  4X65 T;  4DR2 T;  4NXN T;  1N34 T;  1HR0 T;  4DR7 T;  4LFB T;  4LFC T;  4JI8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...