2UXBT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxbT00
4KHPT 1J5ET 3T1YT 4DR1T 1XMOT 4K0KT 5IWAT 4JI3T 4YHHT 4LF8T 4OX9T 1N34T 4X62T 4DV1T 4B3TT 4DR7T 1IBMT 1N36T 2E5LT 4JI7T 1XNQT 2UXBT 1HNXT 3OTOT 4JI8T 4X64T 5LMUT 1HR0T 4LF6T 4DR6T 2UXCT 1N32T 1FJGT 4DV2T 4GKKT 4DV6T 1XNRT 4YY3T 5BR8T 4LFBT 4JI0T 4JI5T 4DV5T 4NXNT 2UUBT 1XMQT 4AQYT 2ZM6T 2F4VT 4LF4T 4X66T 4DR3T 4LF5T 4B3ST 2VQFT 2HHHT 4JI4T 4B3MT 1N33T 4DUYT 2UXDT 1IBKT 3T1HT 2UUAT 4JI2T 5LMNT 2VQET 4DR4T 4DV4T 4LF7T 4LFCT 4DV7T 4DV0T 4JI1T 4DR2T 4B3RT 4LFAT 4X65T 1I94T 1HNWT 1HNZT 4NXMT 4DUZT 4JYAT 2UU9T 4GKJT 1IBLT 4JI6T 4DR5T 2UUCT 4DV3T 4JV5T 4LF9T
chains in the Genus database with same CATH superfamily
2LHRA 4H9QC 3VR9A 2HN1A 3IHRA 4O8SA 2Y8DA 4PJJA 4H9SE 5LBMA 4PNIA 2HH7A 3QB5K 1SUMB 4OHFA 5JDLA 3RIFA 1FMWA 1WYCA 2AXDS 3H37A 4MBQA 2DWKA 2XUEA 4DR1T 5ETWA 4IL9A 4NIQA 2D0TA 4TWFA 2MBGA 5HEJA 4EYYR 4YHHT 3FZLB 3KBUA 2XQ5A 1E2AA 3JAFA 1Z0PA 1UUSA 2BKPA 2XY8B 4GK5E 4B3TT 1CUNA 4DR7T 1D1CA 1UX5A 2E9XC 5LYJE 4EOZB 4UVAB 1IBMT 3VKGA 5AQQB 3J9X1 4EYUA 4ILUA 5HWYA 4ILBA 5JR9A 4IIJE 5HYAA 4TV8E 1S94A 3ZN0B 1HNXT 3ZC0A 2LLYA 2IMLA 3SOLA 2FJAA 4PJNA 5F5WA 1UX4A 2VKOA 4JI8T 3UQ4A 2XAGB 2BDEA 3EHZA 2FBWA 3KFWX 3PUGA 3UUMA 1FEWA 3ZSTA 4YTNA 4U33A 5F3JA 1VRBA 5HXEA 3RI5A 2DL1A 3LG7A 3UU5A 4O4IE 4ZZCA 5CGMA 4YXDA 1N32T 1KF6A 1YKHB 2CMRA 4KBMB 4GKKT 1J5WA 2CLYC 4DMWA 3N9LA 4IDOA 4QH4A 2BVLA 5H6RB 3ABVA 3PU8A 5JQGE 3UT5E 1XDPA 2XAHB 4TNWA 3WAKA 3UU4A 4HFEA 3ZJ1A 2EHOD 3AE6A 4UV8B 2M6BA 3A5XA 2UXNB 3EDUA 3P50A 4JI5T 2KLQA 4ZI3D 5J2UE 2BS3A 3SFDA 2ZMAA 3ZLIA 4NXNT 3X1DA 2A9UA 3GMIA 5HAXA 3I0OA 5FXWA 3ZYMA 3L39A 4I50E 1HG2A 2JQHA 2N1GA 3ESLA 3I1AA 4FI5A 4KHZF 2LRLA 5L3EB 1V9DA 2CCQA 4YSYA 5KMGP 3CX7B 4AQYT 1KNZA 2VL8A 2RA1A 2WMOA 4IHJE 2E5VA 3LK42 1MIYA 3QK6A 2CWOA 4QXCB 1OEDA 2DHRA 3IF8B 4HFHA 3P4SA 2ODVA 4UF0A 4EEDA 2DCFA 4A5XA 5LHHB 3LDQB 3PUZF 2YDRA 3PDYA 3P4PA 2PBIA 1H7CA 5M4YA 3EI0A 4B3ST 2W0GA 3QUJA 4DNDA 5HXRA 3N2GE 2HHHT 4IE6A 4NUVA 2L3LA 2EHOA 2SPCA 2W67A 2WU5A 2YDQA 3PUXF 4OYKA 2WMNA 4UIGA 2K9AA 4UVBB 1GQEA 3FZMB 3TLSA 1N33T 2LRKA 3NWIA 1YQ4A 3PE0A 4CI2B 3ETVA 1WR0A 3PUVF 4YFSA 3AA7B 2X9YA 2EHOB 2CE7A 3M3ZB 2CWYA 5EK2A 2XQ3A 2YK0A 5ABEA 4P1NA 4TN7B 5LNKA 1KNRA 4UEMA 5DQWA 2LOSA 2W00A 4ZS2A 3VKHA 2LM2A 2XTLA 1R8IA 4X1YE 4LMLA 3FZKB 2VK9A 3N2OA 1FIOA 4O2AE 3UU6A 4LF7T 3DP7A 4KX6A 4G63A 2ODUA 4BA9A 2RP4A 4JI1T 4HWIB 3F2EA 3MACA 2PG8A 4A97A 3UULA 2NP9A 3FB2A 4H9PC 4LFAT 4X65T 1I94T 1HNWT 2V7MA 3KDSE 5L4EA 2OV9A 1HNZT 2RPAA 4MALA 3RKOA 5JR9B 1IJ6A 1BR4A 1SHZC 3QB5A 5H6QB 2YINA 3AE1A 1MMGA 2LSYA 3D0TA 4HN9A 4TZ4C 4EV6A 4NXMT 2VKHA 5HXSA 4GK0E 4PK6A 5DQVA 5JDHA 1QUUA 3HKCE 3B13A 5CA1E 3HKDE 3NRYA 2JQQA 4H9RC 3AXJB 4C91A 1B7TA 4ILCA 4IE5A 2CPTA 4EGWA 2NWBA 4OK0A 1E7PA 5L3GB 2MOZA 5LOVE 1XWMA 4U3CA 3DTOA 3RC3A 2NOXA 2K48A 4IREA 5FP3A 3WAJA 4U7IA 3PJAJ 4NUUA 2IC9A 1XMOT 2XM2A 3ZMZB 1WFDA 4H9NC 5CFBA 5HXHA 5IWAT 4JI3T 4YSZA 1Z8UA 4E7SA 1N34T 4HGAA 2KWHA 2YKSA 4KUMB 4HFDA 2KXPB 3C4XA 5FXVA 4ASKA 2DWGA 3SWHA 2BS2A 2I0MA 3R84B 2Y48B 3ZJ2A 4ZXLA 1QLBA 4DV1T 5LGUB 4HWFA 1YD8G 3AA0B 3E22E 5LGNB 3PUAA 3KV4A 3AE7A 2XQ6A 2L8KA 2WP9A 2C5IT 4MHCA 5FVKA 5L3CB 3P4RA 3ZT5A 2LSJA 4CN6A 2XPKA 1M7KA 3AEDA 4PAGA 4UELA 2BZBA 5A1LA 3CIRA 1BR0A 4JLEA 1ZP0A 3MJXA 2CHNA 3AAIA 1LVFA 2V7KA 2XQAA 4GOUA 4PJLA 2A72A 3K8PC 4UF0B 2LOPA 4Z91A 5E0OA 3CQCB 3SS1A 3U78A 2B76A 4IL4A 5EZYE 4YTMA 3SFEA 5JTGA 1HR0T 3LK2B 4QXHB 2PJQA 2OLTA 1HS7A 5AQUB 3RHWA 4COFA 3LK3B 3PURA 2CXDA 2JJ9A 3KVBA 4EEBA 4WBNE 3N9NA 5LA6E 4ZEYA 3C4ZA 1HF8A 3LBXB 4YY3T 2VB6A 3TLVA 3FZHB 1EZ3A 4I0UA 5CB4E 1ZHCA 4DVDA 3RRCA 2XQYA 2YEVC 5IHYA 4LFBT 3ZSSA 2VKJA 3LBXA 2QYWA 4OYJA 5AQFB 4JI0T 5HEGA 4I43B 2VVSA 1NENA 3PV0F 4JUYA 2XSAA 2V7IA 1YW0A 2BVMA 2X9HA 2ACZA 4QKNA 4WYVA 3RIUA 5KDMC 4X5TA 4WZXA 3ZCJA 2KSRA 5FVLA 4K0UA 2ZM6T 3RC8A 2F4VT 5JR9C 3N9PA 3UQ7A 4YJ2E 3ZT6A 3R6NA 3O1HA 5JDNA 5L3DB 2E9XD 3VHLA 5FXXA 4P0AA 5J1GA 3A7MA 4LF4T 3OPCA 3I9WA 4V1Av 2J47A 1D0XA 2FJEA 2WWVA 2MTQA 3UFGA 2WB5A 4AQGA 4DR3T 3C4WA 4E7ZA 4U2YA 4X1KE 2K24A 4U7YA 2CEAA 4PFPA 1MMAA 2C5JA 4M1PA 5AQGB 4NPPA 1VCTA 3FXDB 3AXJA 3Q2MA 4QH1A 5EK3A 5EK4A 5FKYA 4DBRA 2BS4A 4O4HE 4PW8A 1X9BA 4MFRA 2WDQA 1MNDA 5AQVB 3NZPA 3NBXX 3OKQA 3AEFA 5FY7A 2UXDT 5FNVE 4AQFA 2IUBA 3AE4A 1HX8A 4Z8XA 2LSKA 2JQKA 2LEHA 3N9QA 5AFUL 4JI2T 3KVAA 3FBZA 4ISSA 3MXZA 5AQOB 2J4GA 2VQET 2LE8A 4EAHA 1T72A 2XQ8A 4Z90A 1W0AA 5AQSB 4ZZBA 3FXEB 5LJNA 5JRCB 4A56A 3RLFF 2FUPA 3RX6A 2XQ9A 4AKLA 1U4QA 4DV7T 2V1DB 2ACXA 2X68A 1KEYA 3PU3A 4P09A 5AQMB 4DR2T 4ILAA 5JRCA 4B3RT 2H89A 1O3XA 3HKEE 3P4WA 4HWHA 5FMNA 2XAQB 4L9IA 5DJQC 1KFYA 2JMHA 3UU8A 5JVDE 3ZN1B 3RYIE 2JRKA 4DUZT 2MPKA 2BKNA 2X66A 2WZIA 4U31A 4CQIA 2WY2A 4JYAT 5CJ5A 2WDRA 3H3MA 5HWXA 2XAJB 3ZYKA 1DU2A 4GKJT 2C5KT 4O2BE 3UUBA 2LHNA 3UUNA 4IDQA 3IEEA 4QWNB 5AQRB 2LSGA 4ZI7E 3ANWB 2KT9A 3AB3B 2UUCT 2KWIB 2CBJA 4IE7A 4ZS3A 5ABHA 1AJ3A 2MYSA 1IJ5A 2X9XA 4KP3C 1MMDA 5HCJA 4KHPT 2LM9A 4N78D 4PJMA 5ABGA 2IHR1 3ANWA 3SRZA 2CLYB 1NAFA 3GN5A 4O4JE 2QA7A 3OVUA 4TV9E 4TWHA 2BBHA 3RYCE 2E9XA 3UUXB 5AQIB 4LF8T 4OX9T 3F31A 2WAUA 3ONXA 2Q9QA 5AQHB 5ADXL 4DMVA 3RGLA 5KX5E 3GN5B 2PFVA 4AQFC 2H3RA 2VASA 2QRXA 2HPLA 2JMKA 3DJBA 3CX8B 3E0ZA 3H3AA 1ZV4X 3MA9A 3NZQA 4GYRA 2BG9B 1CHUA 2LT3A 3JAEA 1N36T 2Q9QB 1MMNA 1XNQT 4WNKA 2J62A 2UXBT 2EHOC 3RH3A 4EZ4A 1T8BA 5IYZE 4F8HA 4C90A 5JREA 4L0RA 2W2UA 5FL0A 3OTOT 1WLXA 3L09A 2YDSA 2LKGA 3Q5EA 1WYBA 5AQLB 3C98B 2DNXA 4F6RC 3C50A 5LGTB 3LSVA 4X64T 3AE5A 4UVCB 2XQ7A 3NRXA 5FY1A 4LF6T 3AA6B 3AE8A 3CQXC 2NTXA 3ONJA 4HE8A 5L4HA 3V5SA 4DR6T 3CMLA 4IE0A 5HXCA 1WCRA 3EVYA 4ZHQE 2KZ7B 2XSBA 2G0UA 2H7OA 2VWAA 4DV2T 4DV6T 2WSSV 2DI4A 4HEAA 5AQNB 5AQJB 3ETUA 3RYFE 2XZEA 5BR8T 2BG9E 4X1IE 3ZMSB 2WQYA 3M65A 1HX1B 3AEBA 1VOMA 4CXYA 4MLKA 2W61A 1ZEEA 4TNVA 1SA0E 4YJ3E 4UR9A 1J1JA 2ES0A 4H63H 4U74A 5LP6E 5L2LA 5IUXA 5KXJA 1HCIA 2D2SA 2ZM8A 1UGOA 3AEAA 1S35A 2IIUA 4WBOA 2V5CA 4BJNA 2Q9QD 2V6XA 2LJLA 2W66A 2I59A 1XMQT 4HWDA 3PUSA 4GIWA 3Q5WA 2PTFA 3G06A 4P0BA 4ISTA 1UK5A 1D1BA 1MNEA 2ZM0A 1OEDC 3O1JA 3PTRB 2X9WA 3AEEA 1E1HB 3K3OA 3O1IA 1KNPA 2N9DA 3V5UA 1OWAA 2E2AA 4DIDB 3AEGA 4JEHB 2WZHA 4LMKA 1MIVA 3RPUA 4J2CA 5FYMA 4CXXA 4ERRA 5LG4A 3B5MA 1QSDA 3RKGA 4QXBB 3AAAB 3AE9A 3AE2A 4JEUB 4JI4T 2XHEB 2V5DA 4LMJA 5HCMA 2LKHA 4B3MT 3W15B 2CA5A 2GK9A 4DUYT 2XQ4A 5JDQA 1ZOYA 2IC6A 3PJAA 2P9BA 1FMVA 1OEDE 3LFMA 3N2KE 3CKDA 3ONLC 3OYXA 4KI0F 3TLWA 3ZMUB 4CI3B 5JDMA 5LCYA 2NW8A 2V7JA 4BAYB 4LF9T 2A2FX 3F57A 4AIUA 2IW5B 1XZYA 3OJAA 2W62A 2E9XB 1KK7A 5JH7E 2JPFA 2X0HA 4BJMA 4DV4T 2AE9A 3IBPA 3L3PA 4IT4A 3JC6C 4PK5A 4XAXB 2W63A 3AECA 4ZI2C 2R6GF 4UXNB 1LVKA 3UFEA 5C3JA 3KV9A 5LHGB 3UTKA 3P4QA 1W0BA 3CWZB 3KBTA 5HEHA 2BG9A 4EXTA 5J0ZA 1LKXA 2MAWA 3Q5XA 4HFBA 2FJBA 3ZCIA 2X0YA 3K1SA 3ZPOA 3CQGB 5CA0E 3N9OA 3P7IA 3AA1B 4HFCA 1NEKA 3TLTA 5C8YE 4JBWF 2N2NA 3HR0A 4TX5A 4HTEA 4IDNA 5FL1A 2H88A 1BR1A 2CBIA 2VVNA 3KV6A 1IBLT 2K3WA 3GWHA 3PUWF 2WBLA 4XZCA 5DABA 3UU3A 1NWMX 2BBJA 1XDOA 4FJOA 2CHOA 2YN6A 4DV3T 4JV5T 2Z6EA 2J1DG 2CXLA 2ZM2A 3CPZA 3CVRA 3Q5DA 4PK4A 3WI3A 4CZZB 5LG3A 1J5ET 2CXFA 2K5BB 3N5LA 3T1YT 4ADZA 1HTJF 1IAPA 3AAEB 4QHOA 4K0KT 4YT0A 1D0ZA 2QGSA 2HPJA 2VURA 4IDZA 3JCFA 3I9YA 4YSXA 2V8SV 2WU2A 3KINB 4L5GA 4X62T 3TLUA 2JQ9A 3RQUA 2D0UA 3EUHA 2V26A 4EZHA 2ZLYA 5FXZA 1US7B 4ZI3C 2E5LT 4JI7T 3ZMVB 1I6ZA 2VKDA 2V6YA 3MKDA 4HWCA 1D0YA 2V7LA 3VR8A 2Q9QC 5F8PA 1W9RA 3ZYLA 2BG9C 2NTYA 4CN1A 2I6HA 3C64A 5LMUT 5LHIB 2V6YB 3Q9DA 1Y64B 2L9QA 4AI6A 4ZOLE 4HFVA 3RIAA 2XM1A 5JDFA 3VRBA 4KMCA 2UXCT 4Q25A 1LRZA 5AQPB 1FJGT 1Y01A 3PUQA 5AQKB 2CRBA 3ZC1A 4CI1B 1XNRT 1D1AA 1JNZA 2D9DA 1JNRA 2XJ7A 4HKAA 3HI2A 2NW7A 4YLHA 5TAOA 3VRAA 3ZKRA 3AVSA 4WW0A 3ZT7A 3I0QA 3P8CD 4IE4A 2WCAA 1X79A 1L0VA 3U3IA 3ZEFB 4GYSA 2X67A 3BQLA 3FBLA 4AKGA 2IAKA 2B1EA 4EB6E 2JIWA 3AVRA 1W09A 1UURA 4DV5T 3JADA 2YOEA 3QC9A 3KV5A 5LXTE 5LJMA 2UUBT 2CM0A 4QX7B 5L3FB 2Y6XA 1UCUA 4IDPA 1U5PA 3N9MA 4I4TE 3HL6A 3BK9A 5LBQB 2NR4A 3AE3A 3RF1A 3T8OA 4YTPA 1YQ3A 4AXPA 3E08A 2KNDA 3NVOA 2M67A 5J2TE 3ZMTB 3QOFA 3RYHE 4DO0A 2XAFB 3CK6A 2UXXB 2VL0A 3OBVE 4O4LE 2XASB 2YU1A 2WM9A 2A3DA 3CX6B 3BQKA 5AQTB 1HFAA 4X66T 2OA5A 3O9XA 3BQIA 4LF5T 4AKHA 1BR2A 2D5UA 2DLRA 4YHJA 5BMVE 3HA4A 4HFIA 3RRWA 1T98A 3GA8A 4PFOA 4OFZA 4TUYE 4U72A 5HEOA 2VQFT 4AKIA 1IZNB 4JI6T 2IDOB 4QX8B 3EDVA 5C2TA 1MIWA 3K3QC 4XBFB 3HKBE 1YXRA 2WWUA 3IA3A 2QVAA 3FZFB 4TWDA 2FJDA 1HG5A 4IGUA 3J7Yq 4CN4A 1T7SA 3T1HT 1IBKT 2HN2A 3EAMA 2UUAT 4X20E 4EIWA 3PUYF 3A8YC 5ABFB 1G73A 5L3BB 5LMNT 3LJCA 4H63V 4B6XA 5LB7B 2H7VC 5JDGA 2WS3A 4H9OC 4CXWA 3L8RA 4DR4T 2YU2A 4LFCT 3OYZA 2NW9A 4ANJA 4ZI2D 2X0LB 3TKLB 2KINB 2BKOA 2X51A 5ABFA 3QNUA 2KMFA 4DV0T 3O4XE 1WR6A 3K3NA 1YKEB 2W4XA 2C0SA 4AISA 1OEDB 2M6IA 3RIUC 5FY0A 2LSIA 4UV9B 1WRDA 4QH5A 3S4UA 3VU7H 4AKRB 1G8XA 3JC6D 5GONE 4DBQA 1M62A 1ZKEA 3EABA 2UU9T 1OXZA 4G2AA 4U2ZA 4A98A 1SE7A 3MZKB 3RQWA 3B57A 2E8IA 5HEUA 5L47A 2WDVA 3NKZA 3FHNA 4DR5T 1VCSA 3MK7C 3C51A 4I55E
chains in the Genus database with same CATH topology
4KHPT 1J5ET 3T1YT 4DR1T 1XMOT 4K0KT 5IWAT 4JI3T 4YHHT 4LF8T 4OX9T 1N34T 4X62T 4DV1T 4B3TT 4DR7T 1IBMT 1N36T 2E5LT 4JI7T 1XNQT 2UXBT 1HNXT 3OTOT 4JI8T 4X64T 5LMUT 1HR0T 4LF6T 4DR6T 2UXCT 1N32T 1FJGT 4DV2T 4GKKT 4DV6T 1XNRT 4YY3T 5BR8T 4LFBT 4JI0T 4JI5T 4DV5T 4NXNT 2UUBT 1XMQT 4AQYT 2ZM6T 2F4VT 4LF4T 4X66T 4DR3T 4LF5T 4B3ST 2VQFT 2HHHT 4JI4T 4B3MT 1N33T 4DUYT 2UXDT 1IBKT 3T1HT 2UUAT 4JI2T 5LMNT 2VQET 4DR4T 4DV4T 4LF7T 4LFCT 4DV7T 4DV0T 4JI1T 4DR2T 4B3RT 4LFAT 4X65T 1I94T 1HNWT 1HNZT 4NXMT 4DUZT 4JYAT 2UU9T 4GKJT 1IBLT 4JI6T 4DR5T 2UUCT 4DV3T 4JV5T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  1J5E T;  3T1Y T;  4DR1 T;  1XMO T;  4K0K T;  5IWA T;  4JI3 T;  4YHH T;  4LF8 T;  4OX9 T;  1N34 T;  4X62 T;  4DV1 T;  4B3T T;  4DR7 T;  1IBM T;  1N36 T;  2E5L T;  4JI7 T;  1XNQ T;  2UXB T;  1HNX T;  3OTO T;  4JI8 T;  4X64 T;  5LMU T;  1HR0 T;  4LF6 T;  4DR6 T;  2UXC T;  1N32 T;  1FJG T;  4DV2 T;  4GKK T;  4DV6 T;  1XNR T;  4YY3 T;  5BR8 T;  4LFB T;  4JI0 T;  4JI5 T;  4DV5 T;  4NXN T;  2UUB T;  1XMQ T;  4AQY T;  2ZM6 T;  2F4V T;  4LF4 T;  4X66 T;  4DR3 T;  4LF5 T;  4B3S T;  2VQF T;  2HHH T;  4JI4 T;  4B3M T;  1N33 T;  4DUY T;  2UXD T;  1IBK T;  3T1H T;  2UUA T;  4JI2 T;  5LMN T;  2VQE T;  4DR4 T;  4DV4 T;  4LF7 T;  4LFC T;  4DV7 T;  4DV0 T;  4JI1 T;  4DR2 T;  4B3R T;  4LFA T;  4X65 T;  1I94 T;  1HNW T;  1HNZ T;  4NXM T;  4DUZ T;  4JYA T;  2UU9 T;  4GKJ T;  1IBL T;  4JI6 T;  4DR5 T;  2UUC T;  4DV3 T;  4JV5 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 2LHR A;  4H9Q C;  3VR9 A;  2HN1 A;  3IHR A;  4O8S A;  2Y8D A;  4PJJ A;  4H9S E;  5LBM A;  4PNI A;  2HH7 A;  3QB5 K;  1SUM B;  4OHF A;  5JDL A;  3RIF A;  1FMW A;  1WYC A;  2AXD S;  3H37 A;  4MBQ A;  2DWK A;  2XUE A;  4DR1 T;  5ETW A;  4IL9 A;  4NIQ A;  2D0T A;  4TWF A;  2MBG A;  5HEJ A;  4EYY R;  4YHH T;  3FZL B;  3KBU A;  2XQ5 A;  1E2A A;  3JAF A;  1Z0P A;  1UUS A;  2BKP A;  2XY8 B;  4GK5 E;  4B3T T;  1CUN A;  4DR7 T;  1D1C A;  1UX5 A;  2E9X C;  5LYJ E;  4EOZ B;  4UVA B;  1IBM T;  3VKG A;  5AQQ B;  3J9X 1;  4EYU A;  4ILU A;  5HWY A;  4ILB A;  5JR9 A;  4IIJ E;  5HYA A;  4TV8 E;  1S94 A;  3ZN0 B;  1HNX T;  3ZC0 A;  2LLY A;  2IML A;  3SOL A;  2FJA A;  4PJN A;  5F5W A;  1UX4 A;  2VKO A;  4JI8 T;  3UQ4 A;  2XAG B;  2BDE A;  3EHZ A;  2FBW A;  3KFW X;  3PUG A;  3UUM A;  1FEW A;  3ZST A;  4YTN A;  4U33 A;  5F3J A;  1VRB A;  5HXE A;  3RI5 A;  2DL1 A;  3LG7 A;  3UU5 A;  4O4I E;  4ZZC A;  5CGM A;  4YXD A;  1N32 T;  1KF6 A;  1YKH B;  2CMR A;  4KBM B;  4GKK T;  1J5W A;  2CLY C;  4DMW A;  3N9L A;  4IDO A;  4QH4 A;  2BVL A;  5H6R B;  3ABV A;  3PU8 A;  5JQG E;  3UT5 E;  1XDP A;  2XAH B;  4TNW A;  3WAK A;  3UU4 A;  4HFE A;  3ZJ1 A;  2EHO D;  3AE6 A;  4UV8 B;  2M6B A;  3A5X A;  2UXN B;  3EDU A;  3P50 A;  4JI5 T;  2KLQ A;  4ZI3 D;  5J2U E;  2BS3 A;  3SFD A;  2ZMA A;  3ZLI A;  4NXN T;  3X1D A;  2A9U A;  3GMI A;  5HAX A;  3I0O A;  5FXW A;  3ZYM A;  3L39 A;  4I50 E;  1HG2 A;  2JQH A;  2N1G A;  3ESL A;  3I1A A;  4FI5 A;  4KHZ F;  2LRL A;  5L3E B;  1V9D A;  2CCQ A;  4YSY A;  5KMG P;  3CX7 B;  4AQY T;  1KNZ A;  2VL8 A;  2RA1 A;  2WMO A;  4IHJ E;  2E5V A;  3LK4 2;  1MIY A;  3QK6 A;  2CWO A;  4QXC B;  1OED A;  2DHR A;  3IF8 B;  4HFH A;  3P4S A;  2ODV A;  4UF0 A;  4EED A;  2DCF A;  4A5X A;  5LHH B;  3LDQ B;  3PUZ F;  2YDR A;  3PDY A;  3P4P A;  2PBI A;  1H7C A;  5M4Y A;  3EI0 A;  4B3S T;  2W0G A;  3QUJ A;  4DND A;  5HXR A;  3N2G E;  2HHH T;  4IE6 A;  4NUV A;  2L3L A;  2EHO A;  2SPC A;  2W67 A;  2WU5 A;  2YDQ A;  3PUX F;  4OYK A;  2WMN A;  4UIG A;  2K9A A;  4UVB B;  1GQE A;  3FZM B;  3TLS A;  1N33 T;  2LRK A;  3NWI A;  1YQ4 A;  3PE0 A;  4CI2 B;  3ETV A;  1WR0 A;  3PUV F;  4YFS A;  3AA7 B;  2X9Y A;  2EHO B;  2CE7 A;  3M3Z B;  2CWY A;  5EK2 A;  2XQ3 A;  2YK0 A;  5ABE A;  4P1N A;  4TN7 B;  5LNK A;  1KNR A;  4UEM A;  5DQW A;  2LOS A;  2W00 A;  4ZS2 A;  3VKH A;  2LM2 A;  2XTL A;  1R8I A;  4X1Y E;  4LML A;  3FZK B;  2VK9 A;  3N2O A;  1FIO A;  4O2A E;  3UU6 A;  4LF7 T;  3DP7 A;  4KX6 A;  4G63 A;  2ODU A;  4BA9 A;  2RP4 A;  4JI1 T;  4HWI B;  3F2E A;  3MAC A;  2PG8 A;  4A97 A;  3UUL A;  2NP9 A;  3FB2 A;  4H9P C;  4LFA T;  4X65 T;  1I94 T;  1HNW T;  2V7M A;  3KDS E;  5L4E A;  2OV9 A;  1HNZ T;  2RPA A;  4MAL A;  3RKO A;  5JR9 B;  1IJ6 A;  1BR4 A;  1SHZ C;  3QB5 A;  5H6Q B;  2YIN A;  3AE1 A;  1MMG A;  2LSY A;  3D0T A;  4HN9 A;  4TZ4 C;  4EV6 A;  4NXM T;  2VKH A;  5HXS A;  4GK0 E;  4PK6 A;  5DQV A;  5JDH A;  1QUU A;  3HKC E;  3B13 A;  5CA1 E;  3HKD E;  3NRY A;  2JQQ A;  4H9R C;  3AXJ B;  4C91 A;  1B7T A;  4ILC A;  4IE5 A;  2CPT A;  4EGW A;  2NWB A;  4OK0 A;  1E7P A;  5L3G B;  2MOZ A;  5LOV E;  1XWM A;  4U3C A;  3DTO A;  3RC3 A;  2NOX A;  2K48 A;  4IRE A;  5FP3 A;  3WAJ A;  4U7I A;  3PJA J;  4NUU A;  2IC9 A;  1XMO T;  2XM2 A;  3ZMZ B;  1WFD A;  4H9N C;  5CFB A;  5HXH A;  5IWA T;  4JI3 T;  4YSZ A;  1Z8U A;  4E7S A;  1N34 T;  4HGA A;  2KWH A;  2YKS A;  4KUM B;  4HFD A;  2KXP B;  3C4X A;  5FXV A;  4ASK A;  2DWG A;  3SWH A;  2BS2 A;  2I0M A;  3R84 B;  2Y48 B;  3ZJ2 A;  4ZXL A;  1QLB A;  4DV1 T;  5LGU B;  4HWF A;  1YD8 G;  3AA0 B;  3E22 E;  5LGN B;  3PUA A;  3KV4 A;  3AE7 A;  2XQ6 A;  2L8K A;  2WP9 A;  2C5I T;  4MHC A;  5FVK A;  5L3C B;  3P4R A;  3ZT5 A;  2LSJ A;  4CN6 A;  2XPK A;  1M7K A;  3AED A;  4PAG A;  4UEL A;  2BZB A;  5A1L A;  3CIR A;  1BR0 A;  4JLE A;  1ZP0 A;  3MJX A;  2CHN A;  3AAI A;  1LVF A;  2V7K A;  2XQA A;  4GOU A;  4PJL A;  2A72 A;  3K8P C;  4UF0 B;  2LOP A;  4Z91 A;  5E0O A;  3CQC B;  3SS1 A;  3U78 A;  2B76 A;  4IL4 A;  5EZY E;  4YTM A;  3SFE A;  5JTG A;  1HR0 T;  3LK2 B;  4QXH B;  2PJQ A;  2OLT A;  1HS7 A;  5AQU B;  3RHW A;  4COF A;  3LK3 B;  3PUR A;  2CXD A;  2JJ9 A;  3KVB A;  4EEB A;  4WBN E;  3N9N A;  5LA6 E;  4ZEY A;  3C4Z A;  1HF8 A;  3LBX B;  4YY3 T;  2VB6 A;  3TLV A;  3FZH B;  1EZ3 A;  4I0U A;  5CB4 E;  1ZHC A;  4DVD A;  3RRC A;  2XQY A;  2YEV C;  5IHY A;  4LFB T;  3ZSS A;  2VKJ A;  3LBX A;  2QYW A;  4OYJ A;  5AQF B;  4JI0 T;  5HEG A;  4I43 B;  2VVS A;  1NEN A;  3PV0 F;  4JUY A;  2XSA A;  2V7I A;  1YW0 A;  2BVM A;  2X9H A;  2ACZ A;  4QKN A;  4WYV A;  3RIU A;  5KDM C;  4X5T A;  4WZX A;  3ZCJ A;  2KSR A;  5FVL A;  4K0U A;  2ZM6 T;  3RC8 A;  2F4V T;  5JR9 C;  3N9P A;  3UQ7 A;  4YJ2 E;  3ZT6 A;  3R6N A;  3O1H A;  5JDN A;  5L3D B;  2E9X D;  3VHL A;  5FXX A;  4P0A A;  5J1G A;  3A7M A;  4LF4 T;  3OPC A;  3I9W A;  4V1A v;  2J47 A;  1D0X A;  2FJE A;  2WWV A;  2MTQ A;  3UFG A;  2WB5 A;  4AQG A;  4DR3 T;  3C4W A;  4E7Z A;  4U2Y A;  4X1K E;  2K24 A;  4U7Y A;  2CEA A;  4PFP A;  1MMA A;  2C5J A;  4M1P A;  5AQG B;  4NPP A;  1VCT A;  3FXD B;  3AXJ A;  3Q2M A;  4QH1 A;  5EK3 A;  5EK4 A;  5FKY A;  4DBR A;  2BS4 A;  4O4H E;  4PW8 A;  1X9B A;  4MFR A;  2WDQ A;  1MND A;  5AQV B;  3NZP A;  3NBX X;  3OKQ A;  3AEF A;  5FY7 A;  2UXD T;  5FNV E;  4AQF A;  2IUB A;  3AE4 A;  1HX8 A;  4Z8X A;  2LSK A;  2JQK A;  2LEH A;  3N9Q A;  5AFU L;  4JI2 T;  3KVA A;  3FBZ A;  4ISS A;  3MXZ A;  5AQO B;  2J4G A;  2VQE T;  2LE8 A;  4EAH A;  1T72 A;  2XQ8 A;  4Z90 A;  1W0A A;  5AQS B;  4ZZB A;  3FXE B;  5LJN A;  5JRC B;  4A56 A;  3RLF F;  2FUP A;  3RX6 A;  2XQ9 A;  4AKL A;  1U4Q A;  4DV7 T;  2V1D B;  2ACX A;  2X68 A;  1KEY A;  3PU3 A;  4P09 A;  5AQM B;  4DR2 T;  4ILA A;  5JRC A;  4B3R T;  2H89 A;  1O3X A;  3HKE E;  3P4W A;  4HWH A;  5FMN A;  2XAQ B;  4L9I A;  5DJQ C;  1KFY A;  2JMH A;  3UU8 A;  5JVD E;  3ZN1 B;  3RYI E;  2JRK A;  4DUZ T;  2MPK A;  2BKN A;  2X66 A;  2WZI A;  4U31 A;  4CQI A;  2WY2 A;  4JYA T;  5CJ5 A;  2WDR A;  3H3M A;  5HWX A;  2XAJ B;  3ZYK A;  1DU2 A;  4GKJ T;  2C5K T;  4O2B E;  3UUB A;  2LHN A;  3UUN A;  4IDQ A;  3IEE A;  4QWN B;  5AQR B;  2LSG A;  4ZI7 E;  3ANW B;  2KT9 A;  3AB3 B;  2UUC T;  2KWI B;  2CBJ A;  4IE7 A;  4ZS3 A;  5ABH A;  1AJ3 A;  2MYS A;  1IJ5 A;  2X9X A;  4KP3 C;  1MMD A;  5HCJ A;  4KHP T;  2LM9 A;  4N78 D;  4PJM A;  5ABG A;  2IHR 1;  3ANW A;  3SRZ A;  2CLY B;  1NAF A;  3GN5 A;  4O4J E;  2QA7 A;  3OVU A;  4TV9 E;  4TWH A;  2BBH A;  3RYC E;  2E9X A;  3UUX B;  5AQI B;  4LF8 T;  4OX9 T;  3F31 A;  2WAU A;  3ONX A;  2Q9Q A;  5AQH B;  5ADX L;  4DMV A;  3RGL A;  5KX5 E;  3GN5 B;  2PFV A;  4AQF C;  2H3R A;  2VAS A;  2QRX A;  2HPL A;  2JMK A;  3DJB A;  3CX8 B;  3E0Z A;  3H3A A;  1ZV4 X;  3MA9 A;  3NZQ A;  4GYR A;  2BG9 B;  1CHU A;  2LT3 A;  3JAE A;  1N36 T;  2Q9Q B;  1MMN A;  1XNQ T;  4WNK A;  2J62 A;  2UXB T;  2EHO C;  3RH3 A;  4EZ4 A;  1T8B A;  5IYZ E;  4F8H A;  4C90 A;  5JRE A;  4L0R A;  2W2U A;  5FL0 A;  3OTO T;  1WLX A;  3L09 A;  2YDS A;  2LKG A;  3Q5E A;  1WYB A;  5AQL B;  3C98 B;  2DNX A;  4F6R C;  3C50 A;  5LGT B;  3LSV A;  4X64 T;  3AE5 A;  4UVC B;  2XQ7 A;  3NRX A;  5FY1 A;  4LF6 T;  3AA6 B;  3AE8 A;  3CQX C;  2NTX A;  3ONJ A;  4HE8 A;  5L4H A;  3V5S A;  4DR6 T;  3CML A;  4IE0 A;  5HXC A;  1WCR A;  3EVY A;  4ZHQ E;  2KZ7 B;  2XSB A;  2G0U A;  2H7O A;  2VWA A;  4DV2 T;  4DV6 T;  2WSS V;  2DI4 A;  4HEA A;  5AQN B;  5AQJ B;  3ETU A;  3RYF E;  2XZE A;  5BR8 T;  2BG9 E;  4X1I E;  3ZMS B;  2WQY A;  3M65 A;  1HX1 B;  3AEB A;  1VOM A;  4CXY A;  4MLK A;  2W61 A;  1ZEE A;  4TNV A;  1SA0 E;  4YJ3 E;  4UR9 A;  1J1J A;  2ES0 A;  4H63 H;  4U74 A;  5LP6 E;  5L2L A;  5IUX A;  5KXJ A;  1HCI A;  2D2S A;  2ZM8 A;  1UGO A;  3AEA A;  1S35 A;  2IIU A;  4WBO A;  2V5C A;  4BJN A;  2Q9Q D;  2V6X A;  2LJL A;  2W66 A;  2I59 A;  1XMQ T;  4HWD A;  3PUS A;  4GIW A;  3Q5W A;  2PTF A;  3G06 A;  4P0B A;  4IST A;  1UK5 A;  1D1B A;  1MNE A;  2ZM0 A;  1OED C;  3O1J A;  3PTR B;  2X9W A;  3AEE A;  1E1H B;  3K3O A;  3O1I A;  1KNP A;  2N9D A;  3V5U A;  1OWA A;  2E2A A;  4DID B;  3AEG A;  4JEH B;  2WZH A;  4LMK A;  1MIV A;  3RPU A;  4J2C A;  5FYM A;  4CXX A;  4ERR A;  5LG4 A;  3B5M A;  1QSD A;  3RKG A;  4QXB B;  3AAA B;  3AE9 A;  3AE2 A;  4JEU B;  4JI4 T;  2XHE B;  2V5D A;  4LMJ A;  5HCM A;  2LKH A;  4B3M T;  3W15 B;  2CA5 A;  2GK9 A;  4DUY T;  2XQ4 A;  5JDQ A;  1ZOY A;  2IC6 A;  3PJA A;  2P9B A;  1FMV A;  1OED E;  3LFM A;  3N2K E;  3CKD A;  3ONL C;  3OYX A;  4KI0 F;  3TLW A;  3ZMU B;  4CI3 B;  5JDM A;  5LCY A;  2NW8 A;  2V7J A;  4BAY B;  4LF9 T;  2A2F X;  3F57 A;  4AIU A;  2IW5 B;  1XZY A;  3OJA A;  2W62 A;  2E9X B;  1KK7 A;  5JH7 E;  2JPF A;  2X0H A;  4BJM A;  4DV4 T;  2AE9 A;  3IBP A;  3L3P A;  4IT4 A;  3JC6 C;  4PK5 A;  4XAX B;  2W63 A;  3AEC A;  4ZI2 C;  2R6G F;  4UXN B;  1LVK A;  3UFE A;  5C3J A;  3KV9 A;  5LHG B;  3UTK A;  3P4Q A;  1W0B A;  3CWZ B;  3KBT A;  5HEH A;  2BG9 A;  4EXT A;  5J0Z A;  1LKX A;  2MAW A;  3Q5X A;  4HFB A;  2FJB A;  3ZCI A;  2X0Y A;  3K1S A;  3ZPO A;  3CQG B;  5CA0 E;  3N9O A;  3P7I A;  3AA1 B;  4HFC A;  1NEK A;  3TLT A;  5C8Y E;  4JBW F;  2N2N A;  3HR0 A;  4TX5 A;  4HTE A;  4IDN A;  5FL1 A;  2H88 A;  1BR1 A;  2CBI A;  2VVN A;  3KV6 A;  1IBL T;  2K3W A;  3GWH A;  3PUW F;  2WBL A;  4XZC A;  5DAB A;  3UU3 A;  1NWM X;  2BBJ A;  1XDO A;  4FJO A;  2CHO A;  2YN6 A;  4DV3 T;  4JV5 T;  2Z6E A;  2J1D G;  2CXL A;  2ZM2 A;  3CPZ A;  3CVR A;  3Q5D A;  4PK4 A;  3WI3 A;  4CZZ B;  5LG3 A;  1J5E T;  2CXF A;  2K5B B;  3N5L A;  3T1Y T;  4ADZ A;  1HTJ F;  1IAP A;  3AAE B;  4QHO A;  4K0K T;  4YT0 A;  1D0Z A;  2QGS A;  2HPJ A;  2VUR A;  4IDZ A;  3JCF A;  3I9Y A;  4YSX A;  2V8S V;  2WU2 A;  3KIN B;  4L5G A;  4X62 T;  3TLU A;  2JQ9 A;  3RQU A;  2D0U A;  3EUH A;  2V26 A;  4EZH A;  2ZLY A;  5FXZ A;  1US7 B;  4ZI3 C;  2E5L T;  4JI7 T;  3ZMV B;  1I6Z A;  2VKD A;  2V6Y A;  3MKD A;  4HWC A;  1D0Y A;  2V7L A;  3VR8 A;  2Q9Q C;  5F8P A;  1W9R A;  3ZYL A;  2BG9 C;  2NTY A;  4CN1 A;  2I6H A;  3C64 A;  5LMU T;  5LHI B;  2V6Y B;  3Q9D A;  1Y64 B;  2L9Q A;  4AI6 A;  4ZOL E;  4HFV A;  3RIA A;  2XM1 A;  5JDF A;  3VRB A;  4KMC A;  2UXC T;  4Q25 A;  1LRZ A;  5AQP B;  1FJG T;  1Y01 A;  3PUQ A;  5AQK B;  2CRB A;  3ZC1 A;  4CI1 B;  1XNR T;  1D1A A;  1JNZ A;  2D9D A;  1JNR A;  2XJ7 A;  4HKA A;  3HI2 A;  2NW7 A;  4YLH A;  5TAO A;  3VRA A;  3ZKR A;  3AVS A;  4WW0 A;  3ZT7 A;  3I0Q A;  3P8C D;  4IE4 A;  2WCA A;  1X79 A;  1L0V A;  3U3I A;  3ZEF B;  4GYS A;  2X67 A;  3BQL A;  3FBL A;  4AKG A;  2IAK A;  2B1E A;  4EB6 E;  2JIW A;  3AVR A;  1W09 A;  1UUR A;  4DV5 T;  3JAD A;  2YOE A;  3QC9 A;  3KV5 A;  5LXT E;  5LJM A;  2UUB T;  2CM0 A;  4QX7 B;  5L3F B;  2Y6X A;  1UCU A;  4IDP A;  1U5P A;  3N9M A;  4I4T E;  3HL6 A;  3BK9 A;  5LBQ B;  2NR4 A;  3AE3 A;  3RF1 A;  3T8O A;  4YTP A;  1YQ3 A;  4AXP A;  3E08 A;  2KND A;  3NVO A;  2M67 A;  5J2T E;  3ZMT B;  3QOF A;  3RYH E;  4DO0 A;  2XAF B;  3CK6 A;  2UXX B;  2VL0 A;  3OBV E;  4O4L E;  2XAS B;  2YU1 A;  2WM9 A;  2A3D A;  3CX6 B;  3BQK A;  5AQT B;  1HFA A;  4X66 T;  2OA5 A;  3O9X A;  3BQI A;  4LF5 T;  4AKH A;  1BR2 A;  2D5U A;  2DLR A;  4YHJ A;  5BMV E;  3HA4 A;  4HFI A;  3RRW A;  1T98 A;  3GA8 A;  4PFO A;  4OFZ A;  4TUY E;  4U72 A;  5HEO A;  2VQF T;  4AKI A;  1IZN B;  4JI6 T;  2IDO B;  4QX8 B;  3EDV A;  5C2T A;  1MIW A;  3K3Q C;  4XBF B;  3HKB E;  1YXR A;  2WWU A;  3IA3 A;  2QVA A;  3FZF B;  4TWD A;  2FJD A;  1HG5 A;  4IGU A;  3J7Y q;  4CN4 A;  1T7S A;  3T1H T;  1IBK T;  2HN2 A;  3EAM A;  2UUA T;  4X20 E;  4EIW A;  3PUY F;  3A8Y C;  5ABF B;  1G73 A;  5L3B B;  5LMN T;  3LJC A;  4H63 V;  4B6X A;  5LB7 B;  2H7V C;  5JDG A;  2WS3 A;  4H9O C;  4CXW A;  3L8R A;  4DR4 T;  2YU2 A;  4LFC T;  3OYZ A;  2NW9 A;  4ANJ A;  4ZI2 D;  2X0L B;  3TKL B;  2KIN B;  2BKO A;  2X51 A;  5ABF A;  3QNU A;  2KMF A;  4DV0 T;  3O4X E;  1WR6 A;  3K3N A;  1YKE B;  2W4X A;  2C0S A;  4AIS A;  1OED B;  2M6I A;  3RIU C;  5FY0 A;  2LSI A;  4UV9 B;  1WRD A;  4QH5 A;  3S4U A;  3VU7 H;  4AKR B;  1G8X A;  3JC6 D;  5GON E;  4DBQ A;  1M62 A;  1ZKE A;  3EAB A;  2UU9 T;  1OXZ A;  4G2A A;  4U2Z A;  4A98 A;  1SE7 A;  3MZK B;  3RQW A;  3B57 A;  2E8I A;  5HEU A;  5L47 A;  2WDV A;  3NKZ A;  3FHN A;  4DR5 T;  1VCS A;  3MK7 C;  3C51 A;  4I55 E; 
#chains in the Genus database with same CATH homology
 4KHP T;  1J5E T;  3T1Y T;  4DR1 T;  1XMO T;  4K0K T;  5IWA T;  4JI3 T;  4YHH T;  4LF8 T;  4OX9 T;  1N34 T;  4X62 T;  4DV1 T;  4B3T T;  4DR7 T;  1IBM T;  1N36 T;  2E5L T;  4JI7 T;  1XNQ T;  2UXB T;  1HNX T;  3OTO T;  4JI8 T;  4X64 T;  5LMU T;  1HR0 T;  4LF6 T;  4DR6 T;  2UXC T;  1N32 T;  1FJG T;  4DV2 T;  4GKK T;  4DV6 T;  1XNR T;  4YY3 T;  5BR8 T;  4LFB T;  4JI0 T;  4JI5 T;  4DV5 T;  4NXN T;  2UUB T;  1XMQ T;  4AQY T;  2ZM6 T;  2F4V T;  4LF4 T;  4X66 T;  4DR3 T;  4LF5 T;  4B3S T;  2VQF T;  2HHH T;  4JI4 T;  4B3M T;  1N33 T;  4DUY T;  2UXD T;  1IBK T;  3T1H T;  2UUA T;  4JI2 T;  5LMN T;  2VQE T;  4DR4 T;  4DV4 T;  4LF7 T;  4LFC T;  4DV7 T;  4DV0 T;  4JI1 T;  4DR2 T;  4B3R T;  4LFA T;  4X65 T;  1I94 T;  1HNW T;  1HNZ T;  4NXM T;  4DUZ T;  4JYA T;  2UU9 T;  4GKJ T;  1IBL T;  4JI6 T;  4DR5 T;  2UUC T;  4DV3 T;  4JV5 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...