2UXBT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxbT00
4DV0T 4X66T 3T1YT 1HNXT 1HNZT 2F4VT 4K0KT 4GKJT 4JI8T 4DR4T 4DR2T 1I94T 4LF5T 1N36T 5LMNT 4JI6T 4LFAT 4AQYT 4X65T 4LFBT 1HNWT 4DUZT 4DUYT 4DR6T 4DR1T 1HR0T 4NXNT 1XMOT 4LFCT 4JI4T 2UUBT 1N34T 4DV7T 4JI3T 1N32T 2VQFT 4X64T 2UXBT 4JV5T 4KHPT 4JI2T 4DV4T 3T1HT 1XMQT 4X62T 4DR7T 4YHHT 1XNQT 4LF4T 4LF9T 4JYAT 3OTOT 4NXMT 5BR8T 1FJGT 4DV6T 2ZM6T 2UU9T 2HHHT 1N33T 1J5ET 1XNRT 4B3TT 2UUAT 4DV3T 4JI1T 2UXDT 4JI0T 2VQET 1IBLT 4DV5T 4LF8T 4DV1T 1IBKT 4DR3T 2UXCT 5IWAT 4DV2T 4JI7T 4OX9T 2E5LT 4JI5T 1IBMT 2UUCT 4LF7T 4LF6T 4GKKT 4B3ST 4DR5T 4B3RT 4YY3T 4B3MT 5LMUT
chains in the Genus database with same CATH superfamily
2Q9QC 2DLRA 3A8YC 3C50A 1NAFA 3T1YT 2X0YA 5AQUB 1X79A 1HNZT 2BG9B 2NTYA 2XM2A 1HX8A 2GK9A 2PG8A 2D2SA 2CE7A 2BS2A 2JRKA 1ZHCA 2XTLA 4F8HA 2F4VT 2DL1A 2BG9A 3CQCB 3UFGA 5L47A 3NWIA 5J0ZA 4JI8T 1AJ3A 4HEAA 2K24A 2YK0A 4HWCA 5L2LA 4DBRA 5JH7E 1D0YA 3A7MA 5AQSB 3IHRA 2FJEA 2HPJA 2OLTA 3KINB 3C98B 3N9LA 5DABA 5J1GA 5JDNA 5J2TE 3VRBA 3B57A 2XQ7A 5LHHB 2WDRA 2LKGA 5AQIB 2C5KT 2E9XC 5BMVE 4YTPA 5LB7B 2W4XA 5LHIB 1WRDA 3RX6A 4ILAA 3AE4A 5DQWA 1IAPA 3AB3B 5FVLA 1U4QA 5JDMA 2CEAA 1XZYA 2EHOD 3ZSTA 3ZJ1A 2ODUA 5JDGA 3LBXA 3OKQA 4TZ4C 3I0QA 3DP7A 4DO0A 2WS3A 3FBLA 4MHCA 1ZP0A 2LE8A 2IMLA 2MAWA 4PAGA 4XAXB 5F8PA 2ZLYA 3PUGA 1UCUA 5AQFB 4H9QC 1UK5A 2I6HA 5CGMA 4JEUB 5F3JA 4PJLA 2VB6A 3CPZA 2JMKA 5ETWA 2XAGB 5ABHA 4YT0A 1QUUA 4HN9A 2YKSA 5HEGA 1Y64B 3TLVA 5KXJA 1N32T 3MZKB 2VQFT 5HXRA 5JDFA 3P4SA 5LP6E 3DJBA 5HCJA 2LOSA 3NRXA 5AQRB 3ZJ2A 4A56A 1J5ET 2NW8A 4YXDA 5FMNA 2V5DA 4I4TE 2VKHA 2VKDA 2X0LB 3ZYMA 3C51A 1ZKEA 1XNQT 5AQQB 4LF4T 3TKLB 1FEWA 5GONE 2E9XB 2CXLA 5AQKB 3VR9A 3I9WA 4LF9T 5KDMC 2X9HA 3R84B 4YLHA 2LM9A 4IE6A 5JQGE 4JEHB 5LXTE 4AKGA 5HWXA 5HEHA 4JYAT 4AKRB 2CLYB 4NXMT 2ACXA 3EDVA 3N2OA 1IJ5A 2BZBA 3SWHA 4PW8A 3AEGA 5JR9B 4EXTA 2WDQA 2X51A 1BR4A 3KFWX 5C2TA 4Z90A 2FJAA 2ZM6T 2UU9T 3L39A 3FBZA 3OJAA 3UULA 4IL4A 4TUYE 2WMNA 5LGNB 4UR9A 2FJBA 5LJMA 2LRLA 2L3LA 3O4XE 4HFIA 2V26A 5AQMB 4IDQA 4A98A 3RHWA 2C0SA 1OEDA 1T72A 2XAJB 3HA4A 2H7OA 2XAQB 3LK2B 4DV3T 2KZ7B 4JI0T 1W0BA 3RRCA 4OYJA 3UQ4A 4HE8A 4YSYA 1J1JA 2XQYA 4IIJE 3AAIA 2CRBA 1XDPA 3E08A 4OK0A 2IAKA 4U2YA 2KT9A 4LF8T 3TLUA 4UIGA 4P0AA 3L3PA 5FXXA 4QH4A 1IBKT 4PFPA 2HPLA 4UXNB 2NW9A 3K3NA 2J62A 1J5WA 2WWUA 3H37A 4ILCA 1M62A 4HKAA 5LGTB 2BBJA 4HFEA 4HGAA 3KV6A 5AQOB 4ZZCA 3P4RA 5CA1E 2VKOA 5L3GB 3JC6D 3U3IA 1IBMT 3PV0F 3UU8A 2QVAA 1LVKA 5JR9C 4HFVA 2OA5A 3JADA 4HFDA 4LF6T 1E1HB 2PFVA 2WSSV 3NBXX 3PUYF 2XPKA 5FY1A 3NZPA 3UFEA 2DWGA 4QKNA 3VU7H 4EB6E 5TAOA 1D1BA 3AECA 4TWFA 4EZHA 4B3ST 3B5MA 3BQIA 3FXEB 2WY2A 4ZI3C 2IUBA 3ZMTB 2SPCA 3NZQA 4TV9E 3QK6A 4X5TA 4ZS3A 3CX6B 4N78D 3PJAA 2H3RA 3QC9A 4BJNA 3I1AA 1SUMB 2P9BA 3ONJA 4ILUA 1IJ6A 1CUNA 5LJNA 4COFA 2BG9E 4IE7A 4X66T 1HNXT 2W61A 4H63H 4B6XA 3P50A 2LLYA 4CQIA 4TN7B 1UUSA 5HXEA 2JJ9A 4G2AA 2V7MA 4IE5A 3W15B 2LOPA 4P1NA 1WR6A 3CKDA 4GK5E 2WM9A 1MIYA 2ZM8A 4EYUA 1YW0A 3O1IA 5IHYA 3I0OA 3ZN1B 1Z8UA 3RYHE 1WLXA 3EDUA 2CHNA 2H88A 2PBIA 1OEDE 2XQ5A 2YN6A 3MA9A 3M65A 4X20E 4JI6T 4E7ZA 4LFAT 1IZNB 3GA8A 1FMWA 1YQ3A 2KXPB 3AA0B 3H3MA 2CXFA 3TLWA 3KV5A 4IHJE 4KI0F 2C5IT 4ERRA 1U5PA 2IHR1 2VK9A 4ZI7E 4AQGA 2JMHA 4DUYT 3LK42 1FMVA 3PDYA 2Y8DA 2WAUA 3AA6B 4M1PA 3V5SA 5JTGA 4H9PC 5EK2A 3AEDA 2X66A 3HKBE 2V8SV 3KV9A 1HR0T 3LK3B 3AVRA 5FY0A 5CJ5A 3UUNA 5ABEA 1KNZA 4YJ3E 5LMUT 3BQLA 3LBXB 4PK5A 1XWMA 2WCAA 3P4QA 2W67A 4DBQA 5ABGA 4LFCT 2DHRA 2J47A 3RI5A 4JI4T 1D1AA 4JLEA 3Q5EA 2N1GA 2XY8B 3E22E 3MJXA 4A97A 2OV9A 4CXYA 3RH3A 4JI3T 4DNDA 4ILBA 3RIAA 2UUCT 3CMLA 4X64T 1KNRA 1YQ4A 2XJ7A 3PURA 4JV5T 2M67A 4DMVA 4ASKA 3VKHA 5AQNB 2FJDA 2M6IA 3RYIE 1HCIA 4IDZA 4NUVA 3T1HT 2CBJA 4ZI3D 1MIVA 1OXZA 3UU4A 4CI3B 1BR2A 4X62T 5H6QB 3MXZA 4HWDA 3Q2MA 3T8OA 4BJMA 1L0VA 4DMWA 2LEHA 5FXZA 4EGWA 5DJQC 1MMAA 5HYAA 3UT5E 3BQKA 2QYWA 3WI3A 4A5XA 3AEBA 2JQQA 4HFCA 3ZT7A 2K48A 1UGOA 3AVSA 3ESLA 3ZKRA 1WYBA 3OTOT 4I55E 2XHEB 1HX1B 3IBPA 3UTKA 3ANWB 3N9OA 3OYXA 3KDSE 4YSZA 3CWZB 2BVLA 3O1HA 2KNDA 2X9YA 4HFHA 3TLSA 3AE3A 3PJAJ 4AQFA 2RP4A 2HN1A 3PUVF 3PUZF 2XQAA 4UF0B 3CX8B 4HFBA 3CQXC 1JNRA 2LSKA 2PJQA 4O4IE 2XZEA 1NEKA 2MPKA 2KWIB 2WZIA 3UU6A 5IUXA 2Y6XA 2JPFA 1LKXA 2AE9A 2WU2A 4MFRA 4YFSA 2UUAT 2EHOC 2B1EA 4HTEA 2VQET 2V5CA 4GK0E 5AQHB 1YKEB 4UV9B 2WQYA 5L4EA 3GN5A 4JI7T 1SA0E 5HXSA 1QSDA 1B7TA 3FXDB 2NP9A 3I9YA 3S4UA 2WMOA 4MBQA 4H9NC 1MNEA 3AA1B 3MK7C 5H6RB 4ZI2C 4DR3T 1G73A 4X1KE 1HG2A 2R6GF 1E7PA 4YSXA 1H7CA 2UXXB 4QX7B 4NUUA 3U78A 2E5LT 2V6YA 4OX9T 4G63A 4ZXLA 4JI5T 3ZT6A 1EZ3A 2D0TA 1T98A 3IA3A 4UVBB 4AQFC 5FL1A 3WAJA 1WCRA 5ADXL 3ZYLA 2CPTA 2CXDA 4LMJA 1KFYA 4PJNA 4IDNA 3SFDA 3HKDE 4DIDB 4QX8B 4C90A 3PUQA 5JVDE 4DVDA 3J7Yq 2X9XA 4LF7T 1Z0PA 2Q9QD 1KF6A 2J4GA 3OYZA 3P7IA 5HXHA 5LHGB 4BA9A 4OHFA 3FZLB 4L9IA 4B3RT 2K9AA 2XQ8A 2RA1A 3Q5DA 3RQUA 2K3WA 4TV8E 2WP9A 3ETVA 2IW5B 3RYFE 3Q9DA 3K3OA 3PU3A 2WWVA 1DU2A 4GIWA 2BS3A 4HWHA 2LHRA 3C4XA 1ZEEA 2L8KA 2IDOB 3AEFA 3Q5XA 4NPPA 4I43B 2XQ9A 3C4WA 5LOVE 4GKJT 2XAFB 3PTRB 3QUJA 5L3FB 4ZHQE 4AKHA 5CA0E 4ADZA 4PNIA 4U7YA 1I94T 4QH5A 3VHLA 4DR2T 1T8BA 3ETUA 2ES0A 2XUEA 4ZZBA 4EOZB 5LMNT 4CN6A 3WAKA 1VRBA 1NWMX 2CCQA 3CIRA 4AQYT 4Z8XA 4X65T 3RC8A 2CBIA 3CVRA 3PE0A 3K1SA 4QXBB 1VCTA 2VL8A 2YEVC 4AKLA 1V9DA 3RIFA 4KHZF 3HKEE 2V7KA 2KSRA 2WU5A 2XQ6A 5JRCB 4NIQA 4YHJA 4O4HE 2W00A 3AE8A 2NW7A 1G8XA 3QB5K 4JUYA 2E8IA 2FUPA 4X1IE 4UVCB 5EK3A 4IREA 4WW0A 1LVFA 3N9NA 2JQ9A 4QH1A 4EAHA 4ZEYA 4CXWA 1QLBA 2EHOB 3L8RA 4H63V 4YTMA 5C3JA 2LKHA 3AXJB 1HS7A 2BBHA 1BR1A 4WNKA 2W2UA 1T7SA 5FXVA 3JAEA 4O2BE 2LRKA 4UEMA 1N34T 2X9WA 4ZI2D 4Z91A 3R6NA 2XQ4A 2MTQA 2X0HA 3F57A 1YKHB 4CN1A 2KINB 2N2NA 3FZMB 3ZPOA 5LG4A 2UXBT 3O9XA 5EK4A 4JI2T 4DV4T 4YJ2E 1W0AA 2M6BA 3FZHB 3X1DA 2YDQA 1D0XA 2BKPA 3N9QA 4YHHT 1SE7A 2YDRA 1ZV4X 2ACZA 3EABA 3LFMA 4U3CA 4WYVA 3AE9A 3IEEA 1VOMA 5HWYA 3MACA 5AQGB 4O2AE 2E5VA 3VR8A 1MMGA 3KVAA 2IC6A 3JC6C 5DQVA 4U2ZA 3EI0A 3FHNA 2AXDS 2E9XA 2VASA 3PU8A 4CN4A 4PK4A 4QXCB 5IWAT 2LM2A 5AQJB 2HHHT 1VCSA 1MMNA 1FIOA 2KMFA 2JQHA 2Q9QA 5AQTB 3RYCE 3OPCA 2C5JA 3B13A 1D0ZA 2LHNA 3ZMVB 3RIUC 1KK7A 2CHOA 2VWAA 2XQ3A 4IGUA 1WYCA 4CI2B 2CA5A 2W0GA 4DV2T 3F31A 5E0OA 1XNRT 2H89A 3C4ZA 3H3AA 4PJMA 5L3EB 3RRWA 4JI1T 2QRXA 1HFAA 3SRZA 2UXDT 5EZYE 3ZC1A 1HG5A 2CWYA 3ZCIA 5CFBA 1OEDB 1IBLT 3P4PA 2W63A 4AI6A 3RC3A 3ONXA 1MIWA 4ZOLE 4AIUA 4I0UA 2VVSA 2Y48B 4EIWA 4DV1T 1GQEA 4IE4A 4CI1B 4F6RC 2WZHA 2J1DG 1UURA 4GOUA 4MLKA 3JCFA 5JDLA 1XDOA 5FL0A 5JRCA 1BR0A 4P09A 2QGSA 3AA7B 4P0BA 2KLQA 3P4WA 5CB4E 5LBMA 4TWHA 3ZCJA 5AFUL 1X9BA 4GYRA 5JDQA 4U7IA 3EAMA 5HEJA 5KX5E 2LSGA 3UUBA 3ZMSB 5LG3A 3N5LA 2H7VC 1LRZA 3JAFA 1O3XA 4E7SA 5HEUA 4TX5A 2YDSA 4QWNB 5L4HA 5JDHA 3EVYA 5ABFB 3UQ7A 2LSIA 1ZOYA 1S94A 3AE5A 2W62A 3DTOA 4EV6A 4GKKT 3C64A 3ABVA 5LCYA 2WBLA 3PUXF 2VL0A 3KVBA 4YY3T 2A2FX 2LSJA 2A72A 2IIUA 2JQKA 3KV4A 4H9SE 4B3MT 4L0RA 4QXHB 1WR0A 3UU5A 2BKOA 4DV0T 2N9DA 4LMLA 3EUHA 3GMIA 3RIUA 3TLTA 3K3QC 4EYYR 4K0UA 4YTNA 1SHZC 2D5UA 5L3CB 2KWHA 5AQLB 4K0KT 5HXCA 4U33A 4MALA 2V6XA 4H9OC 1W9RA 5FY7A 3ZT5A 3LJCA 4GYSA 4I50E 4ISTA 4DR4T 4LF5T 5FP3A 5C8YE 5J2UE 1N36T 2DNXA 2NTXA 3PUAA 4PK6A 3SS1A 3A5XA 3V5UA 2V7JA 2ZM2A 2D0UA 4WBNE 2CWOA 3EHZA 4IL9A 4LFBT 2G0UA 4HWFA 5L3DB 3FZFB 1HNWT 5LNKA 3M3ZB 4DUZT 2A9UA 3HI2A 2YINA 4DR6T 2LJLA 1JNZA 2E9XD 4TWDA 3RKGA 1R8IA 5FKYA 2D9DA 3UUXB 2XASB 3HL6A 2ZMAA 4C91A 4DR1T 2B76A 3AE6A 3LG7A 2W66A 2WB5A 4CZZB 4NXNT 2XAHB 5LBQB 4AISA 3ZMZB 1XMOT 3O1JA 4WZXA 2VKJA 4AKIA 2EHOA 3AEEA 3AXJA 3LSVA 2BS4A 3AE2A 1YXRA 5AQVB 3VKGA 3LDQB 3NKZA 2ODVA 3PUSA 4O4JE 4IDPA 4PFOA 2HN2A 4WBOA 3RQWA 5M4YA 2UUBT 4H9RC 2BKNA 2PTFA 1US7B 4UELA 2I0MA 4DV7T 1HF8A 2XSAA 4LMKA 5HCMA 4J2CA 1M7KA 2QA7A 3HKCE 3CX7B 3SOLA 3ZLIA 2X67A 4KHPT 3PUWF 3N9MA 2RPAA 4EEDA 4Q25A 1OEDC 2YU2A 3K8PC 4PJJA 5A1LA 4KUMB 2BG9C 4U74A 1XMQT 3SFEA 3GN5B 2BVMA 4DR7T 1Y01A 3N9PA 4V1Av 3ZYKA 2V7LA 3NVOA 1KEYA 3AAAB 4KMCA 2YU1A 1D1CA 5JR9A 4OFZA 5HEOA 3L09A 3GWHA 4OYKA 3ZN0B 2NOXA 3OBVE 2CMRA 5BR8T 1FJGT 5FXWA 3P8CD 4ISSA 1OWAA 3NRYA 3HR0A 5LA6E 4DV6T 1HTJF 3ONLC 4UV8B 3ZMUB 3RKOA 3CK6A 4U31A 3F2EA 3AEAA 5KMGP 1S35A 3N2KE 4U72A 2CM0A 2FBWA 4JBWF 3ANWA 5FVKA 3RF1A 2DWKA 4HWIB 3ZSSA 1N33T 3RLFF 4EZ4A 1MMDA 2DI4A 3AAEB 5HAXA 2Q9QB 1W09A 4TNWA 2XSBA 3RPUA 1MNDA 2WDVA 4ZS2A 4TNVA 4B3TT 4CXXA 2YOEA 3RGLA 3E0ZA 1E2AA 4L5GA 4KP3C 3QB5A 2A3DA 3OVUA 1UX4A 4FJOA 4IDOA 3QOFA 3AE1A 2MBGA 5IYZE 4DV5T 4QHOA 5FNVE 4ANJA 5L3BB 4IE0A 4IT4A 4FI5A 2LT3A 2V6YB 3IF8B 4EEBA 2UXCT 5JREA 2MYSA 1CHUA 2IC9A 4KX6A 4O4LE 1NENA 1YD8G 3CQGB 3QNUA 2L9QA 3AE7A 5F5WA 2VVNA 3BK9A 5FYMA 2NR4A 3G06A 3J9X1 4AXPA 1KNPA 2CLYC 4KBMB 2MOZA 3ZEFB 2V7IA 5LGUB 3N2GE 2BDEA 4X1YE 5ABFA 2LSYA 3Q5WA 3UUMA 3MKDA 2HH7A 3D0TA 2UXNB 2VURA 3ZC0A 4XZCA 3KBTA 3KBUA 1WFDA 3FZKB 2NWBA 5AQPB 4UF0A 2ZM0A 3FB2A 4O8SA 2Z6EA 3UU3A 3VRAA 2I59A 2E2AA 4DR5T 1I6ZA 2K5BB 4UVAB 2X68A 2XM1A 2V1DB 1UX5A 4BAYB 4XBFB 5LYJE 2JIWA 2DCFA
chains in the Genus database with same CATH topology
4DV0T 4X66T 3T1YT 1HNXT 1HNZT 2F4VT 4K0KT 4GKJT 4JI8T 4DR4T 4DR2T 1I94T 4LF5T 1N36T 5LMNT 4JI6T 4LFAT 4AQYT 4X65T 4LFBT 1HNWT 4DUZT 4DUYT 4DR6T 4DR1T 1HR0T 4NXNT 1XMOT 4LFCT 4JI4T 2UUBT 1N34T 4DV7T 4JI3T 1N32T 2VQFT 4X64T 2UXBT 4JV5T 4KHPT 4JI2T 4DV4T 3T1HT 1XMQT 4X62T 4DR7T 4YHHT 1XNQT 4LF4T 4LF9T 4JYAT 3OTOT 4NXMT 5BR8T 1FJGT 4DV6T 2ZM6T 2UU9T 2HHHT 1N33T 1J5ET 1XNRT 4B3TT 2UUAT 4DV3T 4JI1T 2UXDT 4JI0T 2VQET 1IBLT 4DV5T 4LF8T 4DV1T 1IBKT 4DR3T 2UXCT 5IWAT 4DV2T 4JI7T 4OX9T 2E5LT 4JI5T 1IBMT 2UUCT 4LF7T 4LF6T 4GKKT 4B3ST 4DR5T 4B3RT 4YY3T 4B3MT 5LMUT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 T;  4X66 T;  3T1Y T;  1HNX T;  1HNZ T;  2F4V T;  4K0K T;  4GKJ T;  4JI8 T;  4DR4 T;  4DR2 T;  1I94 T;  4LF5 T;  1N36 T;  5LMN T;  4JI6 T;  4LFA T;  4AQY T;  4X65 T;  4LFB T;  1HNW T;  4DUZ T;  4DUY T;  4DR6 T;  4DR1 T;  1HR0 T;  4NXN T;  1XMO T;  4LFC T;  4JI4 T;  2UUB T;  1N34 T;  4DV7 T;  4JI3 T;  1N32 T;  2VQF T;  4X64 T;  2UXB T;  4JV5 T;  4KHP T;  4JI2 T;  4DV4 T;  3T1H T;  1XMQ T;  4X62 T;  4DR7 T;  4YHH T;  1XNQ T;  4LF4 T;  4LF9 T;  4JYA T;  3OTO T;  4NXM T;  5BR8 T;  1FJG T;  4DV6 T;  2ZM6 T;  2UU9 T;  2HHH T;  1N33 T;  1J5E T;  1XNR T;  4B3T T;  2UUA T;  4DV3 T;  4JI1 T;  2UXD T;  4JI0 T;  2VQE T;  1IBL T;  4DV5 T;  4LF8 T;  4DV1 T;  1IBK T;  4DR3 T;  2UXC T;  5IWA T;  4DV2 T;  4JI7 T;  4OX9 T;  2E5L T;  4JI5 T;  1IBM T;  2UUC T;  4LF7 T;  4LF6 T;  4GKK T;  4B3S T;  4DR5 T;  4B3R T;  4YY3 T;  4B3M T;  5LMU T; 
#chains in the Genus database with same CATH topology
 2Q9Q C;  2DLR A;  3A8Y C;  3C50 A;  1NAF A;  3T1Y T;  2X0Y A;  5AQU B;  1X79 A;  1HNZ T;  2BG9 B;  2NTY A;  2XM2 A;  1HX8 A;  2GK9 A;  2PG8 A;  2D2S A;  2CE7 A;  2BS2 A;  2JRK A;  1ZHC A;  2XTL A;  4F8H A;  2F4V T;  2DL1 A;  2BG9 A;  3CQC B;  3UFG A;  5L47 A;  3NWI A;  5J0Z A;  4JI8 T;  1AJ3 A;  4HEA A;  2K24 A;  2YK0 A;  4HWC A;  5L2L A;  4DBR A;  5JH7 E;  1D0Y A;  3A7M A;  5AQS B;  3IHR A;  2FJE A;  2HPJ A;  2OLT A;  3KIN B;  3C98 B;  3N9L A;  5DAB A;  5J1G A;  5JDN A;  5J2T E;  3VRB A;  3B57 A;  2XQ7 A;  5LHH B;  2WDR A;  2LKG A;  5AQI B;  2C5K T;  2E9X C;  5BMV E;  4YTP A;  5LB7 B;  2W4X A;  5LHI B;  1WRD A;  3RX6 A;  4ILA A;  3AE4 A;  5DQW A;  1IAP A;  3AB3 B;  5FVL A;  1U4Q A;  5JDM A;  2CEA A;  1XZY A;  2EHO D;  3ZST A;  3ZJ1 A;  2ODU A;  5JDG A;  3LBX A;  3OKQ A;  4TZ4 C;  3I0Q A;  3DP7 A;  4DO0 A;  2WS3 A;  3FBL A;  4MHC A;  1ZP0 A;  2LE8 A;  2IML A;  2MAW A;  4PAG A;  4XAX B;  5F8P A;  2ZLY A;  3PUG A;  1UCU A;  5AQF B;  4H9Q C;  1UK5 A;  2I6H A;  5CGM A;  4JEU B;  5F3J A;  4PJL A;  2VB6 A;  3CPZ A;  2JMK A;  5ETW A;  2XAG B;  5ABH A;  4YT0 A;  1QUU A;  4HN9 A;  2YKS A;  5HEG A;  1Y64 B;  3TLV A;  5KXJ A;  1N32 T;  3MZK B;  2VQF T;  5HXR A;  5JDF A;  3P4S A;  5LP6 E;  3DJB A;  5HCJ A;  2LOS A;  3NRX A;  5AQR B;  3ZJ2 A;  4A56 A;  1J5E T;  2NW8 A;  4YXD A;  5FMN A;  2V5D A;  4I4T E;  2VKH A;  2VKD A;  2X0L B;  3ZYM A;  3C51 A;  1ZKE A;  1XNQ T;  5AQQ B;  4LF4 T;  3TKL B;  1FEW A;  5GON E;  2E9X B;  2CXL A;  5AQK B;  3VR9 A;  3I9W A;  4LF9 T;  5KDM C;  2X9H A;  3R84 B;  4YLH A;  2LM9 A;  4IE6 A;  5JQG E;  4JEH B;  5LXT E;  4AKG A;  5HWX A;  5HEH A;  4JYA T;  4AKR B;  2CLY B;  4NXM T;  2ACX A;  3EDV A;  3N2O A;  1IJ5 A;  2BZB A;  3SWH A;  4PW8 A;  3AEG A;  5JR9 B;  4EXT A;  2WDQ A;  2X51 A;  1BR4 A;  3KFW X;  5C2T A;  4Z90 A;  2FJA A;  2ZM6 T;  2UU9 T;  3L39 A;  3FBZ A;  3OJA A;  3UUL A;  4IL4 A;  4TUY E;  2WMN A;  5LGN B;  4UR9 A;  2FJB A;  5LJM A;  2LRL A;  2L3L A;  3O4X E;  4HFI A;  2V26 A;  5AQM B;  4IDQ A;  4A98 A;  3RHW A;  2C0S A;  1OED A;  1T72 A;  2XAJ B;  3HA4 A;  2H7O A;  2XAQ B;  3LK2 B;  4DV3 T;  2KZ7 B;  4JI0 T;  1W0B A;  3RRC A;  4OYJ A;  3UQ4 A;  4HE8 A;  4YSY A;  1J1J A;  2XQY A;  4IIJ E;  3AAI A;  2CRB A;  1XDP A;  3E08 A;  4OK0 A;  2IAK A;  4U2Y A;  2KT9 A;  4LF8 T;  3TLU A;  4UIG A;  4P0A A;  3L3P A;  5FXX A;  4QH4 A;  1IBK T;  4PFP A;  2HPL A;  4UXN B;  2NW9 A;  3K3N A;  2J62 A;  1J5W A;  2WWU A;  3H37 A;  4ILC A;  1M62 A;  4HKA A;  5LGT B;  2BBJ A;  4HFE A;  4HGA A;  3KV6 A;  5AQO B;  4ZZC A;  3P4R A;  5CA1 E;  2VKO A;  5L3G B;  3JC6 D;  3U3I A;  1IBM T;  3PV0 F;  3UU8 A;  2QVA A;  1LVK A;  5JR9 C;  4HFV A;  2OA5 A;  3JAD A;  4HFD A;  4LF6 T;  1E1H B;  2PFV A;  2WSS V;  3NBX X;  3PUY F;  2XPK A;  5FY1 A;  3NZP A;  3UFE A;  2DWG A;  4QKN A;  3VU7 H;  4EB6 E;  5TAO A;  1D1B A;  3AEC A;  4TWF A;  4EZH A;  4B3S T;  3B5M A;  3BQI A;  3FXE B;  2WY2 A;  4ZI3 C;  2IUB A;  3ZMT B;  2SPC A;  3NZQ A;  4TV9 E;  3QK6 A;  4X5T A;  4ZS3 A;  3CX6 B;  4N78 D;  3PJA A;  2H3R A;  3QC9 A;  4BJN A;  3I1A A;  1SUM B;  2P9B A;  3ONJ A;  4ILU A;  1IJ6 A;  1CUN A;  5LJN A;  4COF A;  2BG9 E;  4IE7 A;  4X66 T;  1HNX T;  2W61 A;  4H63 H;  4B6X A;  3P50 A;  2LLY A;  4CQI A;  4TN7 B;  1UUS A;  5HXE A;  2JJ9 A;  4G2A A;  2V7M A;  4IE5 A;  3W15 B;  2LOP A;  4P1N A;  1WR6 A;  3CKD A;  4GK5 E;  2WM9 A;  1MIY A;  2ZM8 A;  4EYU A;  1YW0 A;  3O1I A;  5IHY A;  3I0O A;  3ZN1 B;  1Z8U A;  3RYH E;  1WLX A;  3EDU A;  2CHN A;  2H88 A;  2PBI A;  1OED E;  2XQ5 A;  2YN6 A;  3MA9 A;  3M65 A;  4X20 E;  4JI6 T;  4E7Z A;  4LFA T;  1IZN B;  3GA8 A;  1FMW A;  1YQ3 A;  2KXP B;  3AA0 B;  3H3M A;  2CXF A;  3TLW A;  3KV5 A;  4IHJ E;  4KI0 F;  2C5I T;  4ERR A;  1U5P A;  2IHR 1;  2VK9 A;  4ZI7 E;  4AQG A;  2JMH A;  4DUY T;  3LK4 2;  1FMV A;  3PDY A;  2Y8D A;  2WAU A;  3AA6 B;  4M1P A;  3V5S A;  5JTG A;  4H9P C;  5EK2 A;  3AED A;  2X66 A;  3HKB E;  2V8S V;  3KV9 A;  1HR0 T;  3LK3 B;  3AVR A;  5FY0 A;  5CJ5 A;  3UUN A;  5ABE A;  1KNZ A;  4YJ3 E;  5LMU T;  3BQL A;  3LBX B;  4PK5 A;  1XWM A;  2WCA A;  3P4Q A;  2W67 A;  4DBQ A;  5ABG A;  4LFC T;  2DHR A;  2J47 A;  3RI5 A;  4JI4 T;  1D1A A;  4JLE A;  3Q5E A;  2N1G A;  2XY8 B;  3E22 E;  3MJX A;  4A97 A;  2OV9 A;  4CXY A;  3RH3 A;  4JI3 T;  4DND A;  4ILB A;  3RIA A;  2UUC T;  3CML A;  4X64 T;  1KNR A;  1YQ4 A;  2XJ7 A;  3PUR A;  4JV5 T;  2M67 A;  4DMV A;  4ASK A;  3VKH A;  5AQN B;  2FJD A;  2M6I A;  3RYI E;  1HCI A;  4IDZ A;  4NUV A;  3T1H T;  2CBJ A;  4ZI3 D;  1MIV A;  1OXZ A;  3UU4 A;  4CI3 B;  1BR2 A;  4X62 T;  5H6Q B;  3MXZ A;  4HWD A;  3Q2M A;  3T8O A;  4BJM A;  1L0V A;  4DMW A;  2LEH A;  5FXZ A;  4EGW A;  5DJQ C;  1MMA A;  5HYA A;  3UT5 E;  3BQK A;  2QYW A;  3WI3 A;  4A5X A;  3AEB A;  2JQQ A;  4HFC A;  3ZT7 A;  2K48 A;  1UGO A;  3AVS A;  3ESL A;  3ZKR A;  1WYB A;  3OTO T;  4I55 E;  2XHE B;  1HX1 B;  3IBP A;  3UTK A;  3ANW B;  3N9O A;  3OYX A;  3KDS E;  4YSZ A;  3CWZ B;  2BVL A;  3O1H A;  2KND A;  2X9Y A;  4HFH A;  3TLS A;  3AE3 A;  3PJA J;  4AQF A;  2RP4 A;  2HN1 A;  3PUV F;  3PUZ F;  2XQA A;  4UF0 B;  3CX8 B;  4HFB A;  3CQX C;  1JNR A;  2LSK A;  2PJQ A;  4O4I E;  2XZE A;  1NEK A;  2MPK A;  2KWI B;  2WZI A;  3UU6 A;  5IUX A;  2Y6X A;  2JPF A;  1LKX A;  2AE9 A;  2WU2 A;  4MFR A;  4YFS A;  2UUA T;  2EHO C;  2B1E A;  4HTE A;  2VQE T;  2V5C A;  4GK0 E;  5AQH B;  1YKE B;  4UV9 B;  2WQY A;  5L4E A;  3GN5 A;  4JI7 T;  1SA0 E;  5HXS A;  1QSD A;  1B7T A;  3FXD B;  2NP9 A;  3I9Y A;  3S4U A;  2WMO A;  4MBQ A;  4H9N C;  1MNE A;  3AA1 B;  3MK7 C;  5H6R B;  4ZI2 C;  4DR3 T;  1G73 A;  4X1K E;  1HG2 A;  2R6G F;  1E7P A;  4YSX A;  1H7C A;  2UXX B;  4QX7 B;  4NUU A;  3U78 A;  2E5L T;  2V6Y A;  4OX9 T;  4G63 A;  4ZXL A;  4JI5 T;  3ZT6 A;  1EZ3 A;  2D0T A;  1T98 A;  3IA3 A;  4UVB B;  4AQF C;  5FL1 A;  3WAJ A;  1WCR A;  5ADX L;  3ZYL A;  2CPT A;  2CXD A;  4LMJ A;  1KFY A;  4PJN A;  4IDN A;  3SFD A;  3HKD E;  4DID B;  4QX8 B;  4C90 A;  3PUQ A;  5JVD E;  4DVD A;  3J7Y q;  2X9X A;  4LF7 T;  1Z0P A;  2Q9Q D;  1KF6 A;  2J4G A;  3OYZ A;  3P7I A;  5HXH A;  5LHG B;  4BA9 A;  4OHF A;  3FZL B;  4L9I A;  4B3R T;  2K9A A;  2XQ8 A;  2RA1 A;  3Q5D A;  3RQU A;  2K3W A;  4TV8 E;  2WP9 A;  3ETV A;  2IW5 B;  3RYF E;  3Q9D A;  3K3O A;  3PU3 A;  2WWV A;  1DU2 A;  4GIW A;  2BS3 A;  4HWH A;  2LHR A;  3C4X A;  1ZEE A;  2L8K A;  2IDO B;  3AEF A;  3Q5X A;  4NPP A;  4I43 B;  2XQ9 A;  3C4W A;  5LOV E;  4GKJ T;  2XAF B;  3PTR B;  3QUJ A;  5L3F B;  4ZHQ E;  4AKH A;  5CA0 E;  4ADZ A;  4PNI A;  4U7Y A;  1I94 T;  4QH5 A;  3VHL A;  4DR2 T;  1T8B A;  3ETU A;  2ES0 A;  2XUE A;  4ZZB A;  4EOZ B;  5LMN T;  4CN6 A;  3WAK A;  1VRB A;  1NWM X;  2CCQ A;  3CIR A;  4AQY T;  4Z8X A;  4X65 T;  3RC8 A;  2CBI A;  3CVR A;  3PE0 A;  3K1S A;  4QXB B;  1VCT A;  2VL8 A;  2YEV C;  4AKL A;  1V9D A;  3RIF A;  4KHZ F;  3HKE E;  2V7K A;  2KSR A;  2WU5 A;  2XQ6 A;  5JRC B;  4NIQ A;  4YHJ A;  4O4H E;  2W00 A;  3AE8 A;  2NW7 A;  1G8X A;  3QB5 K;  4JUY A;  2E8I A;  2FUP A;  4X1I E;  4UVC B;  5EK3 A;  4IRE A;  4WW0 A;  1LVF A;  3N9N A;  2JQ9 A;  4QH1 A;  4EAH A;  4ZEY A;  4CXW A;  1QLB A;  2EHO B;  3L8R A;  4H63 V;  4YTM A;  5C3J A;  2LKH A;  3AXJ B;  1HS7 A;  2BBH A;  1BR1 A;  4WNK A;  2W2U A;  1T7S A;  5FXV A;  3JAE A;  4O2B E;  2LRK A;  4UEM A;  1N34 T;  2X9W A;  4ZI2 D;  4Z91 A;  3R6N A;  2XQ4 A;  2MTQ A;  2X0H A;  3F57 A;  1YKH B;  4CN1 A;  2KIN B;  2N2N A;  3FZM B;  3ZPO A;  5LG4 A;  2UXB T;  3O9X A;  5EK4 A;  4JI2 T;  4DV4 T;  4YJ2 E;  1W0A A;  2M6B A;  3FZH B;  3X1D A;  2YDQ A;  1D0X A;  2BKP A;  3N9Q A;  4YHH T;  1SE7 A;  2YDR A;  1ZV4 X;  2ACZ A;  3EAB A;  3LFM A;  4U3C A;  4WYV A;  3AE9 A;  3IEE A;  1VOM A;  5HWY A;  3MAC A;  5AQG B;  4O2A E;  2E5V A;  3VR8 A;  1MMG A;  3KVA A;  2IC6 A;  3JC6 C;  5DQV A;  4U2Z A;  3EI0 A;  3FHN A;  2AXD S;  2E9X A;  2VAS A;  3PU8 A;  4CN4 A;  4PK4 A;  4QXC B;  5IWA T;  2LM2 A;  5AQJ B;  2HHH T;  1VCS A;  1MMN A;  1FIO A;  2KMF A;  2JQH A;  2Q9Q A;  5AQT B;  3RYC E;  3OPC A;  2C5J A;  3B13 A;  1D0Z A;  2LHN A;  3ZMV B;  3RIU C;  1KK7 A;  2CHO A;  2VWA A;  2XQ3 A;  4IGU A;  1WYC A;  4CI2 B;  2CA5 A;  2W0G A;  4DV2 T;  3F31 A;  5E0O A;  1XNR T;  2H89 A;  3C4Z A;  3H3A A;  4PJM A;  5L3E B;  3RRW A;  4JI1 T;  2QRX A;  1HFA A;  3SRZ A;  2UXD T;  5EZY E;  3ZC1 A;  1HG5 A;  2CWY A;  3ZCI A;  5CFB A;  1OED B;  1IBL T;  3P4P A;  2W63 A;  4AI6 A;  3RC3 A;  3ONX A;  1MIW A;  4ZOL E;  4AIU A;  4I0U A;  2VVS A;  2Y48 B;  4EIW A;  4DV1 T;  1GQE A;  4IE4 A;  4CI1 B;  4F6R C;  2WZH A;  2J1D G;  1UUR A;  4GOU A;  4MLK A;  3JCF A;  5JDL A;  1XDO A;  5FL0 A;  5JRC A;  1BR0 A;  4P09 A;  2QGS A;  3AA7 B;  4P0B A;  2KLQ A;  3P4W A;  5CB4 E;  5LBM A;  4TWH A;  3ZCJ A;  5AFU L;  1X9B A;  4GYR A;  5JDQ A;  4U7I A;  3EAM A;  5HEJ A;  5KX5 E;  2LSG A;  3UUB A;  3ZMS B;  5LG3 A;  3N5L A;  2H7V C;  1LRZ A;  3JAF A;  1O3X A;  4E7S A;  5HEU A;  4TX5 A;  2YDS A;  4QWN B;  5L4H A;  5JDH A;  3EVY A;  5ABF B;  3UQ7 A;  2LSI A;  1ZOY A;  1S94 A;  3AE5 A;  2W62 A;  3DTO A;  4EV6 A;  4GKK T;  3C64 A;  3ABV A;  5LCY A;  2WBL A;  3PUX F;  2VL0 A;  3KVB A;  4YY3 T;  2A2F X;  2LSJ A;  2A72 A;  2IIU A;  2JQK A;  3KV4 A;  4H9S E;  4B3M T;  4L0R A;  4QXH B;  1WR0 A;  3UU5 A;  2BKO A;  4DV0 T;  2N9D A;  4LML A;  3EUH A;  3GMI A;  3RIU A;  3TLT A;  3K3Q C;  4EYY R;  4K0U A;  4YTN A;  1SHZ C;  2D5U A;  5L3C B;  2KWH A;  5AQL B;  4K0K T;  5HXC A;  4U33 A;  4MAL A;  2V6X A;  4H9O C;  1W9R A;  5FY7 A;  3ZT5 A;  3LJC A;  4GYS A;  4I50 E;  4IST A;  4DR4 T;  4LF5 T;  5FP3 A;  5C8Y E;  5J2U E;  1N36 T;  2DNX A;  2NTX A;  3PUA A;  4PK6 A;  3SS1 A;  3A5X A;  3V5U A;  2V7J A;  2ZM2 A;  2D0U A;  4WBN E;  2CWO A;  3EHZ A;  4IL9 A;  4LFB T;  2G0U A;  4HWF A;  5L3D B;  3FZF B;  1HNW T;  5LNK A;  3M3Z B;  4DUZ T;  2A9U A;  3HI2 A;  2YIN A;  4DR6 T;  2LJL A;  1JNZ A;  2E9X D;  4TWD A;  3RKG A;  1R8I A;  5FKY A;  2D9D A;  3UUX B;  2XAS B;  3HL6 A;  2ZMA A;  4C91 A;  4DR1 T;  2B76 A;  3AE6 A;  3LG7 A;  2W66 A;  2WB5 A;  4CZZ B;  4NXN T;  2XAH B;  5LBQ B;  4AIS A;  3ZMZ B;  1XMO T;  3O1J A;  4WZX A;  2VKJ A;  4AKI A;  2EHO A;  3AEE A;  3AXJ A;  3LSV A;  2BS4 A;  3AE2 A;  1YXR A;  5AQV B;  3VKG A;  3LDQ B;  3NKZ A;  2ODV A;  3PUS A;  4O4J E;  4IDP A;  4PFO A;  2HN2 A;  4WBO A;  3RQW A;  5M4Y A;  2UUB T;  4H9R C;  2BKN A;  2PTF A;  1US7 B;  4UEL A;  2I0M A;  4DV7 T;  1HF8 A;  2XSA A;  4LMK A;  5HCM A;  4J2C A;  1M7K A;  2QA7 A;  3HKC E;  3CX7 B;  3SOL A;  3ZLI A;  2X67 A;  4KHP T;  3PUW F;  3N9M A;  2RPA A;  4EED A;  4Q25 A;  1OED C;  2YU2 A;  3K8P C;  4PJJ A;  5A1L A;  4KUM B;  2BG9 C;  4U74 A;  1XMQ T;  3SFE A;  3GN5 B;  2BVM A;  4DR7 T;  1Y01 A;  3N9P A;  4V1A v;  3ZYK A;  2V7L A;  3NVO A;  1KEY A;  3AAA B;  4KMC A;  2YU1 A;  1D1C A;  5JR9 A;  4OFZ A;  5HEO A;  3L09 A;  3GWH A;  4OYK A;  3ZN0 B;  2NOX A;  3OBV E;  2CMR A;  5BR8 T;  1FJG T;  5FXW A;  3P8C D;  4ISS A;  1OWA A;  3NRY A;  3HR0 A;  5LA6 E;  4DV6 T;  1HTJ F;  3ONL C;  4UV8 B;  3ZMU B;  3RKO A;  3CK6 A;  4U31 A;  3F2E A;  3AEA A;  5KMG P;  1S35 A;  3N2K E;  4U72 A;  2CM0 A;  2FBW A;  4JBW F;  3ANW A;  5FVK A;  3RF1 A;  2DWK A;  4HWI B;  3ZSS A;  1N33 T;  3RLF F;  4EZ4 A;  1MMD A;  2DI4 A;  3AAE B;  5HAX A;  2Q9Q B;  1W09 A;  4TNW A;  2XSB A;  3RPU A;  1MND A;  2WDV A;  4ZS2 A;  4TNV A;  4B3T T;  4CXX A;  2YOE A;  3RGL A;  3E0Z A;  1E2A A;  4L5G A;  4KP3 C;  3QB5 A;  2A3D A;  3OVU A;  1UX4 A;  4FJO A;  4IDO A;  3QOF A;  3AE1 A;  2MBG A;  5IYZ E;  4DV5 T;  4QHO A;  5FNV E;  4ANJ A;  5L3B B;  4IE0 A;  4IT4 A;  4FI5 A;  2LT3 A;  2V6Y B;  3IF8 B;  4EEB A;  2UXC T;  5JRE A;  2MYS A;  1CHU A;  2IC9 A;  4KX6 A;  4O4L E;  1NEN A;  1YD8 G;  3CQG B;  3QNU A;  2L9Q A;  3AE7 A;  5F5W A;  2VVN A;  3BK9 A;  5FYM A;  2NR4 A;  3G06 A;  3J9X 1;  4AXP A;  1KNP A;  2CLY C;  4KBM B;  2MOZ A;  3ZEF B;  2V7I A;  5LGU B;  3N2G E;  2BDE A;  4X1Y E;  5ABF A;  2LSY A;  3Q5W A;  3UUM A;  3MKD A;  2HH7 A;  3D0T A;  2UXN B;  2VUR A;  3ZC0 A;  4XZC A;  3KBT A;  3KBU A;  1WFD A;  3FZK B;  2NWB A;  5AQP B;  4UF0 A;  2ZM0 A;  3FB2 A;  4O8S A;  2Z6E A;  3UU3 A;  3VRA A;  2I59 A;  2E2A A;  4DR5 T;  1I6Z A;  2K5B B;  4UVA B;  2X68 A;  2XM1 A;  2V1D B;  1UX5 A;  4BAY B;  4XBF B;  5LYJ E;  2JIW A;  2DCF A; 
#chains in the Genus database with same CATH homology
 4DV0 T;  4X66 T;  3T1Y T;  1HNX T;  1HNZ T;  2F4V T;  4K0K T;  4GKJ T;  4JI8 T;  4DR4 T;  4DR2 T;  1I94 T;  4LF5 T;  1N36 T;  5LMN T;  4JI6 T;  4LFA T;  4AQY T;  4X65 T;  4LFB T;  1HNW T;  4DUZ T;  4DUY T;  4DR6 T;  4DR1 T;  1HR0 T;  4NXN T;  1XMO T;  4LFC T;  4JI4 T;  2UUB T;  1N34 T;  4DV7 T;  4JI3 T;  1N32 T;  2VQF T;  4X64 T;  2UXB T;  4JV5 T;  4KHP T;  4JI2 T;  4DV4 T;  3T1H T;  1XMQ T;  4X62 T;  4DR7 T;  4YHH T;  1XNQ T;  4LF4 T;  4LF9 T;  4JYA T;  3OTO T;  4NXM T;  5BR8 T;  1FJG T;  4DV6 T;  2ZM6 T;  2UU9 T;  2HHH T;  1N33 T;  1J5E T;  1XNR T;  4B3T T;  2UUA T;  4DV3 T;  4JI1 T;  2UXD T;  4JI0 T;  2VQE T;  1IBL T;  4DV5 T;  4LF8 T;  4DV1 T;  1IBK T;  4DR3 T;  2UXC T;  5IWA T;  4DV2 T;  4JI7 T;  4OX9 T;  2E5L T;  4JI5 T;  1IBM T;  2UUC T;  4LF7 T;  4LF6 T;  4GKK T;  4B3S T;  4DR5 T;  4B3R T;  4YY3 T;  4B3M T;  5LMU T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...