2UXBT

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uxbT00
2UUAT 4DUYT 4X64T 4B3MT 4K0KT 1XNQT 4X62T 4JI5T 1I94T 2UXBT 1IBLT 4JYAT 4DV4T 5IWAT 4DR3T 4JI0T 2UXDT 4JI7T 1N34T 1XNRT 2UXCT 1N32T 4DV1T 4DR2T 4JI1T 4NXMT 2E5LT 4B3RT 4LFBT 4AQYT 4YHHT 4NXNT 2UU9T 1FJGT 4DV3T 2UUBT 1IBMT 4OX9T 4DV0T 4DV7T 2UUCT 4JI3T 4LF4T 4GKKT 4DR4T 4DR1T 3OTOT 4LF6T 5LMUT 4LF7T 4YY3T 3T1YT 4GKJT 4KHPT 4DR6T 1HNZT 2VQFT 4LF9T 2HHHT 1HNWT 2VQET 3T1HT 4X65T 4LF8T 1N33T 4DR7T 4DV2T 4JI2T 1HR0T 1HNXT 1IBKT 2ZM6T 5BR8T 4JI8T 4JV5T 4LFCT 2F4VT 1XMQT 4DV6T 4JI4T 1XMOT 4B3ST 4LFAT 1J5ET 4LF5T 1N36T 4JI6T 5LMNT 4DV5T 4X66T 4DR5T 4DUZT 4B3TT
chains in the Genus database with same CATH superfamily
4PW8A 2IMLA 3ZCIA 1HG5A 2J47A 4B3MT 3WI3A 3CX8B 3I9WA 3Q5DA 2CXFA 4GOUA 4PK6A 3G06A 2H7VC 1E7PA 1HCIA 3VKGA 2KNDA 4ZZCA 4I43B 3JCFA 2BG9A 4BJNA 3P4SA 3LSVA 2MPKA 3L8RA 1UX4A 2LE8A 3FBZA 3KVBA 1SUMB 5FVKA 4UVCB 1ZKEA 3N9MA 4KHPT 4KUMB 4BA9A 3AVSA 2D0UA 3R84B 3LK2B 5LJNA 1YKEB 3ZLIA 3P4PA 4EZ4A 4DO0A 5JDGA 5BR8T 1UCUA 1MNDA 4TWFA 5FL1A 3O1HA 2EHOD 2IC6A 1WR6A 2XM1A 1UX5A 5ABFB 5LGTB 3L3PA 3D0TA 4HGAA 3CMLA 2A9UA 5AQSB 2KWHA 4IGUA 3ZT5A 3IA3A 4DR5T 2K3WA 1SHZC 3EVYA 2E5VA 2LKHA 1HFAA 3CK6A 3PUVF 4DR3T 3BK9A 5JR9C 5JR9B 4HWDA 5HWYA 3K3NA 2KWIB 4JI1T 2XAHB 4CQIA 4COFA 5AQOB 3NZQA 2JMHA 5JDNA 3IBPA 3CVRA 5L3FB 4UF0B 2HN1A 2MOZA 2ODVA 1UGOA 2BVMA 1I6ZA 4U74A 5LGNB 3HKCE 3ZMZB 1XWMA 5CGMA 4UEMA 2H88A 2LSKA 1OEDC 1OEDB 2JIWA 4LMJA 4YLHA 1KNRA 1WRDA 5HYAA 5HEUA 3RKOA 4AKGA 5JDLA 2X9WA 3GMIA 2WM9A 3UU8A 2NP9A 5IUXA 3O1IA 5FL0A 4MALA 4TX5A 4WNKA 2VL0A 1Z8UA 3FB2A 3MKDA 1XZYA 1Z0PA 5J1GA 2DCFA 4HTEA 1ZEEA 2WBLA 4GYRA 3QB5K 4I55E 4ANJA 4TWDA 4A5XA 2V7LA 3GWHA 1MNEA 4E7ZA 3AAIA 4IIJE 3I0QA 3ZT7A 2X0YA 1EZ3A 2LOPA 5C2TA 4IDZA 2CHNA 4B3RT 4U2ZA 4ZZBA 5ABHA 3HKDE 2LRLA 5FVLA 4MBQA 5AQHB 4NUVA 2OA5A 5J2UE 3RF1A 2YOEA 5F3JA 4IDOA 4TZ4C 4PJLA 2N2NA 4UIGA 4CI2B 2YDRA 2RP4A 3HKBE 4LF8T 3E0ZA 3LBXB 4QH1A 3ZMVB 3ANWB 4PJJA 5LHHB 2E8IA 2QA7A 2ZMAA 3CIRA 4MFRA 2LLYA 4LFCT 2FJDA 2NW8A 3EI0A 1UUSA 3EAMA 4A97A 3RH3A 4EXTA 3UU3A 2V5DA 3AEGA 3FZKB 5AQVB 3DJBA 3OVUA 3AE3A 4OYKA 4BAYB 3RPUA 5AQTB 4UR9A 2WZHA 4O4IE 3P8CD 3I9YA 2UXBT 1IBLT 5AQJB 3B57A 2LSJA 3LK3B 4UV8B 1B7TA 3PV0F 4UV9B 3ZKRA 1LVKA 3RHWA 3CKDA 2CMRA 4O4JE 3AB3B 5LJMA 2OLTA 5LBQB 2W62A 2EHOB 2Y48B 4XZCA 5LGUB 2KT9A 2A72A 1JNZA 2C5IT 2IDOB 4HWIB 5H6QB 3ZN1B 2NTXA 2IW5B 3Q9DA 4HE8A 1YW0A 4H63H 4DMVA 4HKAA 5KX5E 3TLSA 2XUEA 3F2EA 2XQ8A 4ZI3D 1HR0T 3ZSTA 4Z8XA 3AE4A 5L3CB 2JQ9A 5AQQB 2V8SV 1X9BA 2LSIA 2I59A 3EABA 5EK3A 2LSGA 4U33A 3ZYMA 3FZFB 3T8OA 3RGLA 1O3XA 2ZM0A 2H89A 3I0OA 4OK0A 4DV5T 2E9XD 2CM0A 3P4QA 2CCQA 2FJAA 5CA0E 2W2UA 1YKHB 2BG9C 2BG9B 1U5PA 4OYJA 5ABGA 5LB7B 3DTOA 3LBXA 4ILCA 4QXCB 5C3JA 2FBWA 3ANWA 2LHRA 4ERRA 2YU1A 2CBIA 3N9NA 4O4LE 2V7JA 2VL8A 4X20E 5L3EB 1D0XA 2Y6XA 5LXTE 4IE5A 1IBMT 2M6IA 3JC6C 1D1BA 5FY1A 3NBXX 2UUCT 1UURA 3RIAA 4JUYA 3K8PC 4TNWA 4JI3T 3VKHA 4E7SA 5EK2A 4X5TA 3ZT6A 3VHLA 1J5WA 1D1AA 4YY3T 4GKJT 4HEAA 2VQFT 3H37A 3QNUA 5AQKB 4EEDA 4DR7T 2XASB 4JI8T 2DHRA 3ZC0A 2PG8A 2WWUA 2J4GA 3AE9A 5EZYE 1YXRA 2A3DA 2EHOA 3P50A 5HAXA 2M6BA 3NKZA 5L4HA 4TNVA 3UU5A 5FY0A 3IF8B 5HEJA 2VVSA 4YJ2E 5HXCA 5HXRA 4YTMA 5HXEA 3PJAJ 5IYZE 2XM2A 1T72A 2B1EA 2XQ9A 4CN1A 4U31A 3TLUA 3WAKA 4EGWA 4NXNT 4IDQA 4HFBA 2IAKA 2PBIA 2H7OA 1OWAA 4HWCA 4DBQA 2WCAA 2X67A 1MMDA 1US7B 4AKLA 1NENA 4DR1T 3Q5WA 4XAXB 4Z91A 1SA0E 4LF9T 4YTPA 2FUPA 2D0TA 2G0UA 3C50A 3EDVA 2FJEA 4Q25A 4DV2T 2YKSA 4AXPA 3EUHA 2CLYC 4YJ3E 2CLYB 4ZS2A 1IBKT 4UXNB 5ABEA 4DVDA 3PUXF 4AKIA 2BS2A 2NR4A 2XSAA 3ZMUB 4YXDA 2XPKA 3N5LA 1WR0A 4QXBB 5BMVE 4J2CA 3UFEA 4A98A 3O4XE 4IDNA 4V1Av 2UUAT 5LCYA 1I94T 4LMKA 3MJXA 1BR0A 2Q9QD 2X51A 3QB5A 2UXDT 4JI7T 4JEHB 2LSYA 4O4HE 5AFUL 3JAEA 3VRAA 3HI2A 2XQ5A 2LHNA 5JQGE 1S94A 2ZLYA 3ZJ2A 3RLFF 4ZI3C 3OBVE 3TLWA 5L3DB 5KMGP 2BBJA 4HN9A 4GIWA 4CI3B 2IHR1 5HCJA 3C51A 4DBRA 2IC9A 5FXZA 4DR4T 4YSXA 3U3IA 1KF6A 2AXDS 3AE5A 3CQCB 4Z90A 2X9YA 4DR6T 5FYMA 5DABA 4ILUA 4EEBA 4YSZA 4ZS3A 2V7MA 2E9XC 2E9XB 2YN6A 5HWXA 3TLTA 1IAPA 4ILBA 3AEFA 4PK5A 2QYWA 2RPAA 2XAFB 3SWHA 4XBFB 3IEEA 3AEBA 1XDOA 5M4YA 2ZM8A 1MIVA 2V1DB 2PFVA 5L2LA 4QXHB 4UVBB 3UQ4A 2CE7A 2LKGA 3WAJA 4X64T 1FEWA 3BQIA 4U7YA 2N9DA 2XHEB 4ADZA 5A1LA 3UU6A 4FI5A 4AI6A 3BQKA 3EDUA 5AQUB 4EAHA 4H9SE 2X9HA 2YDQA 1N32T 2C5KT 1WYBA 2W4XA 4U2YA 5HEHA 2Y8DA 3C64A 1ZP0A 5HXHA 1FMWA 2XQ3A 4IHJE 4U3CA 4O2AE 2WAUA 4M1PA 5FP3A 4KHZF 3PUSA 4AQFA 1MIYA 2XAGB 3V5SA 3N9PA 4ILAA 5AQIB 1IJ5A 3JAFA 5DQVA 2ACZA 2JJ9A 3KV4A 4EIWA 1HNXT 4IL4A 1OXZA 3UTKA 2Z6EA 3LDQB 2FJBA 2J62A 1J1JA 3ABVA 2F4VT 4EYYR 1CUNA 3UUMA 3FZHB 3RX6A 4C91A 4HFIA 3GN5A 4AIUA 1KNPA 4LF5T 2LRKA 3PUZF 3FXDB 5FKYA 5DQWA 3AAAB 2CXDA 1HX8A 3AAEB 3X1DA 3AA6B 5EK4A 4X1YE 3MXZA 4X1KE 2E9XA 4ZI7E 3L39A 2WDQA 4GYSA 4QKNA 2DWGA 3RIFA 2K5BB 2VKHA 5LOVE 2UXXB 5J0ZA 3ZJ1A 3ESLA 4AQYT 1KFYA 2BKOA 3PDYA 2MYSA 4AKHA 3AVRA 4CN4A 3UT5E 5AQLB 2XTLA 3PTRB 3M65A 4PK4A 2LM2A 2XAQB 1HF8A 4LF6T 5LMUT 3K3QC 4ZI2D 3J9X1 5HXSA 1BR1A 3T1HT 3N2OA 5CJ5A 2CPTA 5FXWA 2DI4A 2X0LB 4HFCA 1WFDA 3UU4A 2EHOC 1U4QA 5FXVA 4CXXA 3N9QA 2J1DG 3AE7A 5GONE 1YD8G 4KX6A 5AQGB 4WW0A 4EV6A 2C5JA 4B6XA 2V5CA 4B3ST 3IHRA 1HX1B 3RRCA 1IZNB 2M67A 3KV5A 5AQFB 2VKDA 3RYCE 3Q5EA 3F31A 3UULA 4I50E 2WP9A 4TUYE 3C4XA 5F5WA 2C0SA 2VKOA 1JNRA 1BR2A 2W66A 4CXWA 4EOZB 5LBMA 3U78A 2ACXA 2W63A 2YK0A 2BS4A 2UXCT 3KV6A 3ZPOA 5TAOA 3UQ7A 4WBOA 2LM9A 2HPJA 2V7IA 3ZYKA 4BJMA 3P7IA 4EYUA 3AECA 1T7SA 3K1SA 2LT3A 3AA0B 3C98B 4IT4A 3RQUA 4UELA 3MK7C 2WMNA 3KDSE 3UFGA 2WDRA 4IE4A 3KINB 2BBHA 4H63V 3NWIA 4JBWF 2CWYA 3CX7B 3KBUA 4JI2T 4I0UA 1NWMX 5HCMA 1H7CA 2V6YA 2WB5A 3HKEE 2DWKA 3FHNA 4DV6T 4UVAB 2V6XA 4IE6A 1HS7A 2K48A 4EZHA 5JRCB 4LFAT 1DU2A 2KLQA 1X79A 1MMGA 4YTNA 3ONJA 3P4RA 2W61A 3S4UA 4JLEA 4X62T 4P0BA 4JI5T 2LJLA 1D1CA 3CWZB 3ETVA 4IE0A 2XJ7A 2L9QA 4JI0T 1Y01A 2BKPA 4NIQA 4G2AA 4AKRB 3OPCA 4HWFA 5LHIB 3SFEA 2Q9QA 4DR2T 3C4ZA 1MMAA 4NXMT 1KK7A 3M3ZB 3OKQA 5J2TE 4LFBT 2RA1A 4PNIA 3K3OA 3AE6A 2DLRA 5JDHA 1G73A 2QGSA 5JDFA 1CHUA 2ZM2A 2BKNA 4DV0T 3RYFE 3CQGB 4F8HA 3QUJA 2X0HA 3LFMA 4HWHA 4LF7T 2YU2A 2KMFA 3LK42 3VR8A 3BQLA 2XZEA 2R6GF 3PU8A 3RI5A 3RYHE 4DMWA 3RRWA 3Q2MA 2QVAA 1OEDE 2QRXA 1XMQT 3AA1B 3RYIE 3B5MA 1KEYA 2JQHA 2VASA 4HFVA 4O8SA 4O2BE 2VWAA 4YT0A 1FIOA 2UU9T 2PJQA 1VCTA 2W67A 5AQMB 1D0YA 1AJ3A 1QSDA 5IWAT 5JVDE 4ZI2C 2IUBA 1R8IA 4YFSA 4AQFC 2XQ4A 3PUGA 2JRKA 2JQQA 2VVNA 1G8XA 1WYCA 5JRCA 3VRBA 2I0MA 5CA1E 3PUYF 1D0ZA 2K24A 3RQWA 3ZMTB 4MHCA 3OTOT 2NW7A 4GK0E 1HG2A 3KV9A 3PU3A 1W09A 3ETUA 2HHHT 2VQET 2JQKA 4X1IE 3PURA 5JREA 3GN5B 2VKJA 4H9QC 3Q5XA 4PFPA 1WCRA 2KSRA 4H9RC 4OFZA 2NTYA 3RC3A 2MAWA 2XQ6A 4TN7B 4KP3C 3A7MA 2LEHA 5ETWA 2X68A 4K0UA 2CEAA 5LHGB 3MACA 4KBMB 4U72A 3ZMSB 3HR0A 4B3TT 4H9PC 4K0KT 2SPCA 5L3GB 2HH7A 5C8YE 4C90A 3N9LA 1M62A 2WMOA 4ZEYA 1YQ3A 4MLKA 4DIDB 2WDVA 4DV1T 2E2AA 3AE8A 1Y64B 1MIWA 4WZXA 2WY2A 4PFOA 3GA8A 2WS3A 2WZIA 1FJGT 5L3BB 3ZEFB 4KMCA 4OX9T 3PE0A 5FMNA 5LG4A 1WLXA 4DV7T 2JPFA 2L3LA 4LF4T 3AEEA 3JC6D 4GKKT 2BZBA 1NAFA 3MA9A 2P9BA 3T1YT 2XQAA 5CFBA 4L9IA 1E1HB 4X65T 4NUUA 3VR9A 1GQEA 3N2KE 2MBGA 2WQYA 2XQYA 3AXJB 1QLBA 3OYXA 4KI0F 4JI4T 3F57A 3OYZA 1XMOT 2NW9A 4HFHA 3AE2A 1N36T 4JI6T 3ONXA 3OJAA 4IDPA 2CBJA 2I6HA 3NVOA 4DUZT 3CPZA 1XDPA 4DUYT 3ZYLA 4I4TE 5FXXA 3L09A 5JTGA 3J7Yq 3TKLB 1XNQT 3UUXB 5ABFA 4DNDA 2W0GA 1L0VA 2BG9E 2BVLA 3ZSSA 4PAGA 4ASKA 5FY7A 1LVFA 1QUUA 1ZV4X 2YINA 3C4WA 4P0AA 3RIUC 3MZKB 4YHHT 2CA5A 4DV3T 4HFEA 1KNZA 3LJCA 5JR9A 3ZC1A 4F6RC 3KBTA 4ISSA 2A2FX 3I1AA 4JEUB 3SFDA 2H3RA 5LA6E 2X66A 1LKXA 4FJOA 2IIUA 2V6YB 3NRYA 3E22E 1HNZT 1HNWT 2WU2A 2KZ7B 4UF0A 4CXYA 2JMKA 2NWBA 3DP7A 2DNXA 4U7IA 2VB6A 1FMVA 3PUQA 3JADA 4QH4A 3LG7A 3R6NA 1W0BA 3P4WA 4NPPA 5FNVE 3B13A 2YEVC 2HN2A 5JDQA 1VCSA 1T98A 5AQNB 1OEDA 2GK9A 4QHOA 2KXPB 3AA7B 3A5XA 2KINB 3CX6B 2Q9QC 2Q9QB 4OHFA 4P1NA 4ZXLA 3ONLC 1ZOYA 2VURA 3VU7H 4QX8B 1BR4A 4JYAT 4AQGA 1VRBA 2WU5A 4YSYA 1UK5A 1T8BA 2B76A 5F8PA 4L0RA 2UXNB 4P09A 5H6RB 3NZPA 1S35A 4HFDA 5JDMA 1YQ4A 5AQRB 3O9XA 4PJMA 5IHYA 3RC8A 3AXJA 2D9DA 2L8KA 2BDEA 3TLVA 5HEOA 3HL6A 5DJQC 3AEAA 4EB6E 2UUBT 3ZN0B 2N1GA 2ODUA 2LOSA 3PJAA 2WSSV 4PJNA 4TV9E 3H3MA 3QC9A 4YHJA 5LNKA 3N9OA 3AEDA 4CN6A 4QX7B 3EHZA 4QH5A 2ES0A 3SRZA 2OV9A 4TV8E 3KFWX 3V5UA 3QOFA 2YDSA 3UUNA 2AE9A 5AQPB 1E2AA 2XAJB 1MMNA 5LG3A 2ZM6T 2PTFA 1V9DA 3RIUA 4CI1B 1W9RA 4AISA 2V7KA 4ISTA 2XSBA 3AE1A 3SOLA 1SE7A 4GK5E 1HTJF 2NOXA 1VOMA 4WYVA 2K9AA 3KVAA 2D5UA 3HA4A 2BS3A 5ADXL 4DV4T 5KDMC 3SS1A 5L4EA 1N34T 1XNRT 5JH7E 3O1JA 5E0OA 3CQXC 4CZZB 2VK9A 4IE7A 4IL9A 2E5LT 1IJ6A 1LRZA 3FZMB 2XQ7A 3N2GE 3A8YC 4ZHQE 4L5GA 4WBNE 2XY8B 4QWNB 4TWHA 2X9XA 5CB4E 4IREA 2V26A 4A56A 3H3AA 4LMLA 5L47A 2CHOA 3UUBA 3RKGA 2WWVA 3QK6A 1N33T 2HPLA 5LYJE 2W00A 2D2SA 3FZLB 3FBLA 2CXLA 1ZHCA 2CWOA 5HEGA 3E08A 5KXJA 1W0AA 1NEKA 4JV5T 1M7KA 3FXEB 4H9OC 4N78D 2MTQA 2CRBA 4ZOLE 1J5ET 3W15B 3NRXA 3PUAA 3PUWF 4G63A 5LMNT 4H9NC 2DL1A 5LP6E 3ZCJA 4X66T
chains in the Genus database with same CATH topology
2UUAT 4DUYT 4X64T 4B3MT 4K0KT 1XNQT 4X62T 4JI5T 1I94T 2UXBT 1IBLT 4JYAT 4DV4T 5IWAT 4DR3T 4JI0T 2UXDT 4JI7T 1N34T 1XNRT 2UXCT 1N32T 4DV1T 4DR2T 4JI1T 4NXMT 2E5LT 4B3RT 4LFBT 4AQYT 4YHHT 4NXNT 2UU9T 1FJGT 4DV3T 2UUBT 1IBMT 4OX9T 4DV0T 4DV7T 2UUCT 4JI3T 4LF4T 4GKKT 4DR4T 4DR1T 3OTOT 4LF6T 5LMUT 4LF7T 4YY3T 3T1YT 4GKJT 4KHPT 4DR6T 1HNZT 2VQFT 4LF9T 2HHHT 1HNWT 2VQET 3T1HT 4X65T 4LF8T 1N33T 4DR7T 4DV2T 4JI2T 1HR0T 1HNXT 1IBKT 2ZM6T 5BR8T 4JI8T 4JV5T 4LFCT 2F4VT 1XMQT 4DV6T 4JI4T 1XMOT 4B3ST 4LFAT 1J5ET 4LF5T 1N36T 4JI6T 5LMNT 4DV5T 4X66T 4DR5T 4DUZT 4B3TT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA T;  4DUY T;  4X64 T;  4B3M T;  4K0K T;  1XNQ T;  4X62 T;  4JI5 T;  1I94 T;  2UXB T;  1IBL T;  4JYA T;  4DV4 T;  5IWA T;  4DR3 T;  4JI0 T;  2UXD T;  4JI7 T;  1N34 T;  1XNR T;  2UXC T;  1N32 T;  4DV1 T;  4DR2 T;  4JI1 T;  4NXM T;  2E5L T;  4B3R T;  4LFB T;  4AQY T;  4YHH T;  4NXN T;  2UU9 T;  1FJG T;  4DV3 T;  2UUB T;  1IBM T;  4OX9 T;  4DV0 T;  4DV7 T;  2UUC T;  4JI3 T;  4LF4 T;  4GKK T;  4DR4 T;  4DR1 T;  3OTO T;  4LF6 T;  5LMU T;  4LF7 T;  4YY3 T;  3T1Y T;  4GKJ T;  4KHP T;  4DR6 T;  1HNZ T;  2VQF T;  4LF9 T;  2HHH T;  1HNW T;  2VQE T;  3T1H T;  4X65 T;  4LF8 T;  1N33 T;  4DR7 T;  4DV2 T;  4JI2 T;  1HR0 T;  1HNX T;  1IBK T;  2ZM6 T;  5BR8 T;  4JI8 T;  4JV5 T;  4LFC T;  2F4V T;  1XMQ T;  4DV6 T;  4JI4 T;  1XMO T;  4B3S T;  4LFA T;  1J5E T;  4LF5 T;  1N36 T;  4JI6 T;  5LMN T;  4DV5 T;  4X66 T;  4DR5 T;  4DUZ T;  4B3T T; 
#chains in the Genus database with same CATH topology
 4PW8 A;  2IML A;  3ZCI A;  1HG5 A;  2J47 A;  4B3M T;  3WI3 A;  3CX8 B;  3I9W A;  3Q5D A;  2CXF A;  4GOU A;  4PK6 A;  3G06 A;  2H7V C;  1E7P A;  1HCI A;  3VKG A;  2KND A;  4ZZC A;  4I43 B;  3JCF A;  2BG9 A;  4BJN A;  3P4S A;  3LSV A;  2MPK A;  3L8R A;  1UX4 A;  2LE8 A;  3FBZ A;  3KVB A;  1SUM B;  5FVK A;  4UVC B;  1ZKE A;  3N9M A;  4KHP T;  4KUM B;  4BA9 A;  3AVS A;  2D0U A;  3R84 B;  3LK2 B;  5LJN A;  1YKE B;  3ZLI A;  3P4P A;  4EZ4 A;  4DO0 A;  5JDG A;  5BR8 T;  1UCU A;  1MND A;  4TWF A;  5FL1 A;  3O1H A;  2EHO D;  2IC6 A;  1WR6 A;  2XM1 A;  1UX5 A;  5ABF B;  5LGT B;  3L3P A;  3D0T A;  4HGA A;  3CML A;  2A9U A;  5AQS B;  2KWH A;  4IGU A;  3ZT5 A;  3IA3 A;  4DR5 T;  2K3W A;  1SHZ C;  3EVY A;  2E5V A;  2LKH A;  1HFA A;  3CK6 A;  3PUV F;  4DR3 T;  3BK9 A;  5JR9 C;  5JR9 B;  4HWD A;  5HWY A;  3K3N A;  2KWI B;  4JI1 T;  2XAH B;  4CQI A;  4COF A;  5AQO B;  3NZQ A;  2JMH A;  5JDN A;  3IBP A;  3CVR A;  5L3F B;  4UF0 B;  2HN1 A;  2MOZ A;  2ODV A;  1UGO A;  2BVM A;  1I6Z A;  4U74 A;  5LGN B;  3HKC E;  3ZMZ B;  1XWM A;  5CGM A;  4UEM A;  2H88 A;  2LSK A;  1OED C;  1OED B;  2JIW A;  4LMJ A;  4YLH A;  1KNR A;  1WRD A;  5HYA A;  5HEU A;  3RKO A;  4AKG A;  5JDL A;  2X9W A;  3GMI A;  2WM9 A;  3UU8 A;  2NP9 A;  5IUX A;  3O1I A;  5FL0 A;  4MAL A;  4TX5 A;  4WNK A;  2VL0 A;  1Z8U A;  3FB2 A;  3MKD A;  1XZY A;  1Z0P A;  5J1G A;  2DCF A;  4HTE A;  1ZEE A;  2WBL A;  4GYR A;  3QB5 K;  4I55 E;  4ANJ A;  4TWD A;  4A5X A;  2V7L A;  3GWH A;  1MNE A;  4E7Z A;  3AAI A;  4IIJ E;  3I0Q A;  3ZT7 A;  2X0Y A;  1EZ3 A;  2LOP A;  5C2T A;  4IDZ A;  2CHN A;  4B3R T;  4U2Z A;  4ZZB A;  5ABH A;  3HKD E;  2LRL A;  5FVL A;  4MBQ A;  5AQH B;  4NUV A;  2OA5 A;  5J2U E;  3RF1 A;  2YOE A;  5F3J A;  4IDO A;  4TZ4 C;  4PJL A;  2N2N A;  4UIG A;  4CI2 B;  2YDR A;  2RP4 A;  3HKB E;  4LF8 T;  3E0Z A;  3LBX B;  4QH1 A;  3ZMV B;  3ANW B;  4PJJ A;  5LHH B;  2E8I A;  2QA7 A;  2ZMA A;  3CIR A;  4MFR A;  2LLY A;  4LFC T;  2FJD A;  2NW8 A;  3EI0 A;  1UUS A;  3EAM A;  4A97 A;  3RH3 A;  4EXT A;  3UU3 A;  2V5D A;  3AEG A;  3FZK B;  5AQV B;  3DJB A;  3OVU A;  3AE3 A;  4OYK A;  4BAY B;  3RPU A;  5AQT B;  4UR9 A;  2WZH A;  4O4I E;  3P8C D;  3I9Y A;  2UXB T;  1IBL T;  5AQJ B;  3B57 A;  2LSJ A;  3LK3 B;  4UV8 B;  1B7T A;  3PV0 F;  4UV9 B;  3ZKR A;  1LVK A;  3RHW A;  3CKD A;  2CMR A;  4O4J E;  3AB3 B;  5LJM A;  2OLT A;  5LBQ B;  2W62 A;  2EHO B;  2Y48 B;  4XZC A;  5LGU B;  2KT9 A;  2A72 A;  1JNZ A;  2C5I T;  2IDO B;  4HWI B;  5H6Q B;  3ZN1 B;  2NTX A;  2IW5 B;  3Q9D A;  4HE8 A;  1YW0 A;  4H63 H;  4DMV A;  4HKA A;  5KX5 E;  3TLS A;  2XUE A;  3F2E A;  2XQ8 A;  4ZI3 D;  1HR0 T;  3ZST A;  4Z8X A;  3AE4 A;  5L3C B;  2JQ9 A;  5AQQ B;  2V8S V;  1X9B A;  2LSI A;  2I59 A;  3EAB A;  5EK3 A;  2LSG A;  4U33 A;  3ZYM A;  3FZF B;  3T8O A;  3RGL A;  1O3X A;  2ZM0 A;  2H89 A;  3I0O A;  4OK0 A;  4DV5 T;  2E9X D;  2CM0 A;  3P4Q A;  2CCQ A;  2FJA A;  5CA0 E;  2W2U A;  1YKH B;  2BG9 C;  2BG9 B;  1U5P A;  4OYJ A;  5ABG A;  5LB7 B;  3DTO A;  3LBX A;  4ILC A;  4QXC B;  5C3J A;  2FBW A;  3ANW A;  2LHR A;  4ERR A;  2YU1 A;  2CBI A;  3N9N A;  4O4L E;  2V7J A;  2VL8 A;  4X20 E;  5L3E B;  1D0X A;  2Y6X A;  5LXT E;  4IE5 A;  1IBM T;  2M6I A;  3JC6 C;  1D1B A;  5FY1 A;  3NBX X;  2UUC T;  1UUR A;  3RIA A;  4JUY A;  3K8P C;  4TNW A;  4JI3 T;  3VKH A;  4E7S A;  5EK2 A;  4X5T A;  3ZT6 A;  3VHL A;  1J5W A;  1D1A A;  4YY3 T;  4GKJ T;  4HEA A;  2VQF T;  3H37 A;  3QNU A;  5AQK B;  4EED A;  4DR7 T;  2XAS B;  4JI8 T;  2DHR A;  3ZC0 A;  2PG8 A;  2WWU A;  2J4G A;  3AE9 A;  5EZY E;  1YXR A;  2A3D A;  2EHO A;  3P50 A;  5HAX A;  2M6B A;  3NKZ A;  5L4H A;  4TNV A;  3UU5 A;  5FY0 A;  3IF8 B;  5HEJ A;  2VVS A;  4YJ2 E;  5HXC A;  5HXR A;  4YTM A;  5HXE A;  3PJA J;  5IYZ E;  2XM2 A;  1T72 A;  2B1E A;  2XQ9 A;  4CN1 A;  4U31 A;  3TLU A;  3WAK A;  4EGW A;  4NXN T;  4IDQ A;  4HFB A;  2IAK A;  2PBI A;  2H7O A;  1OWA A;  4HWC A;  4DBQ A;  2WCA A;  2X67 A;  1MMD A;  1US7 B;  4AKL A;  1NEN A;  4DR1 T;  3Q5W A;  4XAX B;  4Z91 A;  1SA0 E;  4LF9 T;  4YTP A;  2FUP A;  2D0T A;  2G0U A;  3C50 A;  3EDV A;  2FJE A;  4Q25 A;  4DV2 T;  2YKS A;  4AXP A;  3EUH A;  2CLY C;  4YJ3 E;  2CLY B;  4ZS2 A;  1IBK T;  4UXN B;  5ABE A;  4DVD A;  3PUX F;  4AKI A;  2BS2 A;  2NR4 A;  2XSA A;  3ZMU B;  4YXD A;  2XPK A;  3N5L A;  1WR0 A;  4QXB B;  5BMV E;  4J2C A;  3UFE A;  4A98 A;  3O4X E;  4IDN A;  4V1A v;  2UUA T;  5LCY A;  1I94 T;  4LMK A;  3MJX A;  1BR0 A;  2Q9Q D;  2X51 A;  3QB5 A;  2UXD T;  4JI7 T;  4JEH B;  2LSY A;  4O4H E;  5AFU L;  3JAE A;  3VRA A;  3HI2 A;  2XQ5 A;  2LHN A;  5JQG E;  1S94 A;  2ZLY A;  3ZJ2 A;  3RLF F;  4ZI3 C;  3OBV E;  3TLW A;  5L3D B;  5KMG P;  2BBJ A;  4HN9 A;  4GIW A;  4CI3 B;  2IHR 1;  5HCJ A;  3C51 A;  4DBR A;  2IC9 A;  5FXZ A;  4DR4 T;  4YSX A;  3U3I A;  1KF6 A;  2AXD S;  3AE5 A;  3CQC B;  4Z90 A;  2X9Y A;  4DR6 T;  5FYM A;  5DAB A;  4ILU A;  4EEB A;  4YSZ A;  4ZS3 A;  2V7M A;  2E9X C;  2E9X B;  2YN6 A;  5HWX A;  3TLT A;  1IAP A;  4ILB A;  3AEF A;  4PK5 A;  2QYW A;  2RPA A;  2XAF B;  3SWH A;  4XBF B;  3IEE A;  3AEB A;  1XDO A;  5M4Y A;  2ZM8 A;  1MIV A;  2V1D B;  2PFV A;  5L2L A;  4QXH B;  4UVB B;  3UQ4 A;  2CE7 A;  2LKG A;  3WAJ A;  4X64 T;  1FEW A;  3BQI A;  4U7Y A;  2N9D A;  2XHE B;  4ADZ A;  5A1L A;  3UU6 A;  4FI5 A;  4AI6 A;  3BQK A;  3EDU A;  5AQU B;  4EAH A;  4H9S E;  2X9H A;  2YDQ A;  1N32 T;  2C5K T;  1WYB A;  2W4X A;  4U2Y A;  5HEH A;  2Y8D A;  3C64 A;  1ZP0 A;  5HXH A;  1FMW A;  2XQ3 A;  4IHJ E;  4U3C A;  4O2A E;  2WAU A;  4M1P A;  5FP3 A;  4KHZ F;  3PUS A;  4AQF A;  1MIY A;  2XAG B;  3V5S A;  3N9P A;  4ILA A;  5AQI B;  1IJ5 A;  3JAF A;  5DQV A;  2ACZ A;  2JJ9 A;  3KV4 A;  4EIW A;  1HNX T;  4IL4 A;  1OXZ A;  3UTK A;  2Z6E A;  3LDQ B;  2FJB A;  2J62 A;  1J1J A;  3ABV A;  2F4V T;  4EYY R;  1CUN A;  3UUM A;  3FZH B;  3RX6 A;  4C91 A;  4HFI A;  3GN5 A;  4AIU A;  1KNP A;  4LF5 T;  2LRK A;  3PUZ F;  3FXD B;  5FKY A;  5DQW A;  3AAA B;  2CXD A;  1HX8 A;  3AAE B;  3X1D A;  3AA6 B;  5EK4 A;  4X1Y E;  3MXZ A;  4X1K E;  2E9X A;  4ZI7 E;  3L39 A;  2WDQ A;  4GYS A;  4QKN A;  2DWG A;  3RIF A;  2K5B B;  2VKH A;  5LOV E;  2UXX B;  5J0Z A;  3ZJ1 A;  3ESL A;  4AQY T;  1KFY A;  2BKO A;  3PDY A;  2MYS A;  4AKH A;  3AVR A;  4CN4 A;  3UT5 E;  5AQL B;  2XTL A;  3PTR B;  3M65 A;  4PK4 A;  2LM2 A;  2XAQ B;  1HF8 A;  4LF6 T;  5LMU T;  3K3Q C;  4ZI2 D;  3J9X 1;  5HXS A;  1BR1 A;  3T1H T;  3N2O A;  5CJ5 A;  2CPT A;  5FXW A;  2DI4 A;  2X0L B;  4HFC A;  1WFD A;  3UU4 A;  2EHO C;  1U4Q A;  5FXV A;  4CXX A;  3N9Q A;  2J1D G;  3AE7 A;  5GON E;  1YD8 G;  4KX6 A;  5AQG B;  4WW0 A;  4EV6 A;  2C5J A;  4B6X A;  2V5C A;  4B3S T;  3IHR A;  1HX1 B;  3RRC A;  1IZN B;  2M67 A;  3KV5 A;  5AQF B;  2VKD A;  3RYC E;  3Q5E A;  3F31 A;  3UUL A;  4I50 E;  2WP9 A;  4TUY E;  3C4X A;  5F5W A;  2C0S A;  2VKO A;  1JNR A;  1BR2 A;  2W66 A;  4CXW A;  4EOZ B;  5LBM A;  3U78 A;  2ACX A;  2W63 A;  2YK0 A;  2BS4 A;  2UXC T;  3KV6 A;  3ZPO A;  5TAO A;  3UQ7 A;  4WBO A;  2LM9 A;  2HPJ A;  2V7I A;  3ZYK A;  4BJM A;  3P7I A;  4EYU A;  3AEC A;  1T7S A;  3K1S A;  2LT3 A;  3AA0 B;  3C98 B;  4IT4 A;  3RQU A;  4UEL A;  3MK7 C;  2WMN A;  3KDS E;  3UFG A;  2WDR A;  4IE4 A;  3KIN B;  2BBH A;  4H63 V;  3NWI A;  4JBW F;  2CWY A;  3CX7 B;  3KBU A;  4JI2 T;  4I0U A;  1NWM X;  5HCM A;  1H7C A;  2V6Y A;  2WB5 A;  3HKE E;  2DWK A;  3FHN A;  4DV6 T;  4UVA B;  2V6X A;  4IE6 A;  1HS7 A;  2K48 A;  4EZH A;  5JRC B;  4LFA T;  1DU2 A;  2KLQ A;  1X79 A;  1MMG A;  4YTN A;  3ONJ A;  3P4R A;  2W61 A;  3S4U A;  4JLE A;  4X62 T;  4P0B A;  4JI5 T;  2LJL A;  1D1C A;  3CWZ B;  3ETV A;  4IE0 A;  2XJ7 A;  2L9Q A;  4JI0 T;  1Y01 A;  2BKP A;  4NIQ A;  4G2A A;  4AKR B;  3OPC A;  4HWF A;  5LHI B;  3SFE A;  2Q9Q A;  4DR2 T;  3C4Z A;  1MMA A;  4NXM T;  1KK7 A;  3M3Z B;  3OKQ A;  5J2T E;  4LFB T;  2RA1 A;  4PNI A;  3K3O A;  3AE6 A;  2DLR A;  5JDH A;  1G73 A;  2QGS A;  5JDF A;  1CHU A;  2ZM2 A;  2BKN A;  4DV0 T;  3RYF E;  3CQG B;  4F8H A;  3QUJ A;  2X0H A;  3LFM A;  4HWH A;  4LF7 T;  2YU2 A;  2KMF A;  3LK4 2;  3VR8 A;  3BQL A;  2XZE A;  2R6G F;  3PU8 A;  3RI5 A;  3RYH E;  4DMW A;  3RRW A;  3Q2M A;  2QVA A;  1OED E;  2QRX A;  1XMQ T;  3AA1 B;  3RYI E;  3B5M A;  1KEY A;  2JQH A;  2VAS A;  4HFV A;  4O8S A;  4O2B E;  2VWA A;  4YT0 A;  1FIO A;  2UU9 T;  2PJQ A;  1VCT A;  2W67 A;  5AQM B;  1D0Y A;  1AJ3 A;  1QSD A;  5IWA T;  5JVD E;  4ZI2 C;  2IUB A;  1R8I A;  4YFS A;  4AQF C;  2XQ4 A;  3PUG A;  2JRK A;  2JQQ A;  2VVN A;  1G8X A;  1WYC A;  5JRC A;  3VRB A;  2I0M A;  5CA1 E;  3PUY F;  1D0Z A;  2K24 A;  3RQW A;  3ZMT B;  4MHC A;  3OTO T;  2NW7 A;  4GK0 E;  1HG2 A;  3KV9 A;  3PU3 A;  1W09 A;  3ETU A;  2HHH T;  2VQE T;  2JQK A;  4X1I E;  3PUR A;  5JRE A;  3GN5 B;  2VKJ A;  4H9Q C;  3Q5X A;  4PFP A;  1WCR A;  2KSR A;  4H9R C;  4OFZ A;  2NTY A;  3RC3 A;  2MAW A;  2XQ6 A;  4TN7 B;  4KP3 C;  3A7M A;  2LEH A;  5ETW A;  2X68 A;  4K0U A;  2CEA A;  5LHG B;  3MAC A;  4KBM B;  4U72 A;  3ZMS B;  3HR0 A;  4B3T T;  4H9P C;  4K0K T;  2SPC A;  5L3G B;  2HH7 A;  5C8Y E;  4C90 A;  3N9L A;  1M62 A;  2WMO A;  4ZEY A;  1YQ3 A;  4MLK A;  4DID B;  2WDV A;  4DV1 T;  2E2A A;  3AE8 A;  1Y64 B;  1MIW A;  4WZX A;  2WY2 A;  4PFO A;  3GA8 A;  2WS3 A;  2WZI A;  1FJG T;  5L3B B;  3ZEF B;  4KMC A;  4OX9 T;  3PE0 A;  5FMN A;  5LG4 A;  1WLX A;  4DV7 T;  2JPF A;  2L3L A;  4LF4 T;  3AEE A;  3JC6 D;  4GKK T;  2BZB A;  1NAF A;  3MA9 A;  2P9B A;  3T1Y T;  2XQA A;  5CFB A;  4L9I A;  1E1H B;  4X65 T;  4NUU A;  3VR9 A;  1GQE A;  3N2K E;  2MBG A;  2WQY A;  2XQY A;  3AXJ B;  1QLB A;  3OYX A;  4KI0 F;  4JI4 T;  3F57 A;  3OYZ A;  1XMO T;  2NW9 A;  4HFH A;  3AE2 A;  1N36 T;  4JI6 T;  3ONX A;  3OJA A;  4IDP A;  2CBJ A;  2I6H A;  3NVO A;  4DUZ T;  3CPZ A;  1XDP A;  4DUY T;  3ZYL A;  4I4T E;  5FXX A;  3L09 A;  5JTG A;  3J7Y q;  3TKL B;  1XNQ T;  3UUX B;  5ABF A;  4DND A;  2W0G A;  1L0V A;  2BG9 E;  2BVL A;  3ZSS A;  4PAG A;  4ASK A;  5FY7 A;  1LVF A;  1QUU A;  1ZV4 X;  2YIN A;  3C4W A;  4P0A A;  3RIU C;  3MZK B;  4YHH T;  2CA5 A;  4DV3 T;  4HFE A;  1KNZ A;  3LJC A;  5JR9 A;  3ZC1 A;  4F6R C;  3KBT A;  4ISS A;  2A2F X;  3I1A A;  4JEU B;  3SFD A;  2H3R A;  5LA6 E;  2X66 A;  1LKX A;  4FJO A;  2IIU A;  2V6Y B;  3NRY A;  3E22 E;  1HNZ T;  1HNW T;  2WU2 A;  2KZ7 B;  4UF0 A;  4CXY A;  2JMK A;  2NWB A;  3DP7 A;  2DNX A;  4U7I A;  2VB6 A;  1FMV A;  3PUQ A;  3JAD A;  4QH4 A;  3LG7 A;  3R6N A;  1W0B A;  3P4W A;  4NPP A;  5FNV E;  3B13 A;  2YEV C;  2HN2 A;  5JDQ A;  1VCS A;  1T98 A;  5AQN B;  1OED A;  2GK9 A;  4QHO A;  2KXP B;  3AA7 B;  3A5X A;  2KIN B;  3CX6 B;  2Q9Q C;  2Q9Q B;  4OHF A;  4P1N A;  4ZXL A;  3ONL C;  1ZOY A;  2VUR A;  3VU7 H;  4QX8 B;  1BR4 A;  4JYA T;  4AQG A;  1VRB A;  2WU5 A;  4YSY A;  1UK5 A;  1T8B A;  2B76 A;  5F8P A;  4L0R A;  2UXN B;  4P09 A;  5H6R B;  3NZP A;  1S35 A;  4HFD A;  5JDM A;  1YQ4 A;  5AQR B;  3O9X A;  4PJM A;  5IHY A;  3RC8 A;  3AXJ A;  2D9D A;  2L8K A;  2BDE A;  3TLV A;  5HEO A;  3HL6 A;  5DJQ C;  3AEA A;  4EB6 E;  2UUB T;  3ZN0 B;  2N1G A;  2ODU A;  2LOS A;  3PJA A;  2WSS V;  4PJN A;  4TV9 E;  3H3M A;  3QC9 A;  4YHJ A;  5LNK A;  3N9O A;  3AED A;  4CN6 A;  4QX7 B;  3EHZ A;  4QH5 A;  2ES0 A;  3SRZ A;  2OV9 A;  4TV8 E;  3KFW X;  3V5U A;  3QOF A;  2YDS A;  3UUN A;  2AE9 A;  5AQP B;  1E2A A;  2XAJ B;  1MMN A;  5LG3 A;  2ZM6 T;  2PTF A;  1V9D A;  3RIU A;  4CI1 B;  1W9R A;  4AIS A;  2V7K A;  4IST A;  2XSB A;  3AE1 A;  3SOL A;  1SE7 A;  4GK5 E;  1HTJ F;  2NOX A;  1VOM A;  4WYV A;  2K9A A;  3KVA A;  2D5U A;  3HA4 A;  2BS3 A;  5ADX L;  4DV4 T;  5KDM C;  3SS1 A;  5L4E A;  1N34 T;  1XNR T;  5JH7 E;  3O1J A;  5E0O A;  3CQX C;  4CZZ B;  2VK9 A;  4IE7 A;  4IL9 A;  2E5L T;  1IJ6 A;  1LRZ A;  3FZM B;  2XQ7 A;  3N2G E;  3A8Y C;  4ZHQ E;  4L5G A;  4WBN E;  2XY8 B;  4QWN B;  4TWH A;  2X9X A;  5CB4 E;  4IRE A;  2V26 A;  4A56 A;  3H3A A;  4LML A;  5L47 A;  2CHO A;  3UUB A;  3RKG A;  2WWV A;  3QK6 A;  1N33 T;  2HPL A;  5LYJ E;  2W00 A;  2D2S A;  3FZL B;  3FBL A;  2CXL A;  1ZHC A;  2CWO A;  5HEG A;  3E08 A;  5KXJ A;  1W0A A;  1NEK A;  4JV5 T;  1M7K A;  3FXE B;  4H9O C;  4N78 D;  2MTQ A;  2CRB A;  4ZOL E;  1J5E T;  3W15 B;  3NRX A;  3PUA A;  3PUW F;  4G63 A;  5LMN T;  4H9N C;  2DL1 A;  5LP6 E;  3ZCJ A;  4X66 T; 
#chains in the Genus database with same CATH homology
 2UUA T;  4DUY T;  4X64 T;  4B3M T;  4K0K T;  1XNQ T;  4X62 T;  4JI5 T;  1I94 T;  2UXB T;  1IBL T;  4JYA T;  4DV4 T;  5IWA T;  4DR3 T;  4JI0 T;  2UXD T;  4JI7 T;  1N34 T;  1XNR T;  2UXC T;  1N32 T;  4DV1 T;  4DR2 T;  4JI1 T;  4NXM T;  2E5L T;  4B3R T;  4LFB T;  4AQY T;  4YHH T;  4NXN T;  2UU9 T;  1FJG T;  4DV3 T;  2UUB T;  1IBM T;  4OX9 T;  4DV0 T;  4DV7 T;  2UUC T;  4JI3 T;  4LF4 T;  4GKK T;  4DR4 T;  4DR1 T;  3OTO T;  4LF6 T;  5LMU T;  4LF7 T;  4YY3 T;  3T1Y T;  4GKJ T;  4KHP T;  4DR6 T;  1HNZ T;  2VQF T;  4LF9 T;  2HHH T;  1HNW T;  2VQE T;  3T1H T;  4X65 T;  4LF8 T;  1N33 T;  4DR7 T;  4DV2 T;  4JI2 T;  1HR0 T;  1HNX T;  1IBK T;  2ZM6 T;  5BR8 T;  4JI8 T;  4JV5 T;  4LFC T;  2F4V T;  1XMQ T;  4DV6 T;  4JI4 T;  1XMO T;  4B3S T;  4LFA T;  1J5E T;  4LF5 T;  1N36 T;  4JI6 T;  5LMN T;  4DV5 T;  4X66 T;  4DR5 T;  4DUZ T;  4B3T T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...