2UXCI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcI00
4X66E 1I94I 1KVKA 4MYTA 1QZRA 2GS8A 2ZM6E 4JV5E 3WU6A 1ZXNA 4DU8A 1HNZI 1IBLE 2EFGA 3D4JA 5LMNE 1HNWI 1S4EA 4X65E 4LF6E 4GKJI 4DR6I 3CWVA 4JI5I 1FI4A 4DV1I 1Z0VA 1IBMI 4B3ME 1H7UA 1XMOI 4GKKI 1FKAE 5LMUE 3K17A 3H4LA 1HNXE 4JI2E 4JI2I 4P7AA 4DPTA 4X62I 4DR2I 3HULA 3F0NA 4HY1A 4JI1I 4LF9E 1H7SA 2UUCI 3ZM7A 4LFCE 5IT9C 2A2CA 4M1KA 4DR7I 4FW9A 1XNQI 2UU9I 4NXNI 4I3HA 4NXNE 4X64I 1RREA 1IBLI 4JI3I 3ZKBA 2V2QA 4DV2I 1Z5BA 2UUAE 4DV2E 3OTOI 4DR5I 2R42A 4JI8I 2VQEI 1A6FA 4DR2E 1VISA 4DR6E 4B3SI 3B82A 3B78A 1DARA 4RPFA 1U2RA 4DV0E 4B3MI 3V5RA 3GONA 4JYAI 3T1HE 2DEIA 4YY3E 2NPFA 4AQYE 1HNXI 1MU5A 4EMDA 4DR4E 5LMUI 4JI0E 3Q1QA 1HNWE 4DR5E 4DR1I 4JI0I 4X66I 2HKJA 2V2VA 4KHPI 2R3VA 5BR8I 3LTOA 1Z0EA 4LF6I 5A2QC 2V2ZA 2UXCE 4URLA 4R1FA 3J81C 2UU9E 1J5EI 1KIJA 2VQFE 4B3TE 4LF5I 1XNRI 4HXZA 3PYDA 4DPYA 3OTOE 1ELOA 4DR1E 1OJ4A 5IT9Q 4DR7E 2X36A 1B63A 1Z59A 4UT4A 4DUYI 4DV6E 3QT5A 1XHKA 1N33E 1FNMA 3M6AA 5GMEA 4DR3I 1ZM2A 4UTGA 1N36I 1EI1A 3PYEA 4HACB 3QT6A 2HFUA 1H73A 2ZBKB 4DV5E 4FN5A 2HFSA 1Z0BA 2OI2A 4JI7I 2F4VE 4WUBA 2J7KA 4DU7A 3QT7A 1HNZE 3J7AM 2BM1A 1S16A 2BV3A 4DV4E 4DPXA 4JYAE 4K0KE 2E5LI 1EA6A 1FJGE 4LFAI 4LFBI 1N33I 4DPUA 1ZM9A 3ZKDA 1ZM4A 5IWAE 3B8HA 2HHHI 4PRVA 4X65I 1D6TA 3ZZ0A 4P52A 1NHJA 4XTJA 2VQFI 4B3TI 1IBKI 2V8PA 4LF5E 1Z0WA 1H74A 4Z7YA 4JI6E 4LF4I 4DXLA 2E1RA 5FLXQ 4X64E 3J81Q 4GKKE 1FJGI 3LPSA 2UXCI 1Z5CA 4WUDA 1Z5AA 4DV5I 2HK2A 3JAMQ 2X7IA 3QT8A 1N0VC 5LL6R 2UUCE 4YHHI 2F4VI 4PU9A 3ZZTA 1MX0A 1NHHA 3K1JA 4FWHA 4DUYE 4DV6I 4DV7I 1HR0E 2UUBE 3WU5A 3ZZUA 1ZM3A 4DR3E 3WU4A 3WU3A 4FWGA 4OX9E 4DUZE 1RR9A 1I94E 4KQVA 2UUAI 2HK3A 2UXDE 2UXDI 1KTVA 1WUUA 3J80Q 1N34I 4JI3E 2VQEE 3LNUA 4DV3E 4USKA 2E5LE 2UUBI 3V2UC 4JI4I 4JI4E 3PYGA 4DV7E 1HR0I 4USMA 1FWLA 4OX9I 4NXMI 4B3RI 2HHHE 4DR4I 1XNQE 5BR8E 1Z0GA 4AQYI 2BM0A 4LFCI 5GMDA 4YY3I 1PIEA 4DUZI 1PVGA 4MYUA 4LF9I 1NHIA 3J7AG 4ZVIA 4Z7CA 4YHHE 4K0KI 4JI1E 1Z0CA 4JI5E 5FLXC 1N32I 1K47A 4DV0I 4NXME 2AJ4A 4HACA 2A2DA 4DPWA 4HYMA 5IWAI 4ED4A 3T1HI 2ZITA 1PKPA 4WUCA 2ZM6I 1N0UA 5LMNI 2V34A 2LJPA 3T1YI 4B3RE 4LFBE 4LFAE 2Q2EB 4DV3I 4LF7E 1J5EE 1XMQE 1ZXMA 4JG4A 4LF8E 1Z0TA 3JAMC 1XMOE 2XEXA 3PYFA 4FWDA 4JI7E 1NZ0A 2UXBI 1H72C 1N34E 4DV1E 4X62E 4DV4I 4KHPE 2CZ9A 1N36E 4LF7I 1FWKA 1KKHA 1N32E 5L3JA 1XMQI 2HKEA 4JV5I 4GKJE 1UEKA 2WW4A 1BKNA 2VF3A 2UXBE 1B62A 1MG7A 3J80C 1IBME 1XNRE 4B3SE 4LF8I 4PRXA 5A2QQ 4LF4E 4JI6I 2DEJA 4JI8E 3T1YE 1IBKE
chains in the Genus database with same CATH superfamily
2NN6F 4IZKB 4X66E 1I94I 1KVKA 5FWKA 4MYTA 1QZRA 2GS8A 2ZM6E 5C0XB 4JV5E 3WU6A 1ZXNA 4DU8A 1HNZI 2IOPA 1IBLE 2EFGA 1R6MA 3M7ND 4MQYA 2PNZB 2F1DA 3D4JA 5LMNE 1HNWI 2JT2A 2NN6E 5JEAA 1S4EA 4X65E 4LF6E 4GKJI 1YHCA 3M7NG 4DR6I 2O1WA 3CWVA 4JI5I 3HKMA 2J65A 1FI4A 2PNLA 2Z5BB 4DV1I 1Z0VA 1IBMI 1OYSA 4B3ME 1H7UA 2NN6B 5K36E 1XMOI 4GKKI 1FKAE 5LMUE 3K17A 3UHMA 3H4LA 1HNXE 4JI2E 4IZJB 4P7AA 4JI2I 3M85D 2O1TA 4DPTA 4X62I 4DR2I 1Y60A 3HULA 3F0NA 4HY1A 2IESA 4JI1I 3GMEA 4LF9E 1H7SA 2UUCI 2JEBB 3ZM7A 5DRRA 5DRPA 1Y6ZA 5IT9C 4LFCE 2A2CA 4M1KA 3PS2A 2PO0B 1USVA 4IS9A 4DR7I 3GCMA 4FW9A 2UU9I 1XNQI 3U1YA 2CVEA 4NXNI 4I3HA 4NXNE 4X64I 1RREA 1IBLI 4JI3I 3ZKBA 2V2QA 4DV2I 1Z5BA 4IZKA 5C0XF 2UUAE 4DV2E 4IFDE 2WNRA 3OTOI 4DR5I 5K36F 5DRQA 1E3PA 2R42A 4LOMA 1XXEA 4JI8I 3P06A 2VQEI 3PS1A 1YH8A 1A6FA 4BA2B 4DR2E 3P3CA 1VISA 4U3DA 2BR2A 4DR6E 3PS3A 4B3SI 3B82A 4IZJA 3B78A 1DARA 4RPFA 1U2RA 4DV0E 4B3MI 3V5RA 3GONA 4JYAI 2DEIA 3T1HE 4YY3E 2NPFA 4AQYE 4MU1A 1HNXI 1MU5A 4EMDA 4DR4E 5LMUI 4JI0E 3Q1QA 2GQ0A 2NN6D 1HNWE 2PO1A 4DR5E 4DR1I 4JI0I 2JEAA 4IFDA 4AIDA 4X66I 2HKJA 2V2VA 4KHPI 2R3VA 5BR8I 3LTOA 1Z0EA 4LF6I 5A2QC 2NN6A 4MU0A 2V2ZA 4OKGA 2UXCE 4URLA 4R1FA 3J81C 3KRNA 2UU9E 1J5EI 3CDIA 4LCHA 1KIJA 2VQFE 4B3TE 4LF5I 1XNRI 4OO1E 4HXZA 3CDJA 3PYDA 4DPYA 3OTOE 1ELOA 4DR1E 3NZKA 2JE6A 1OJ4A 1Y4SA 5IT9Q 5K36B 4DR7E 2X36A 1B63A 1Z59A 4UT4A 4IFDC 4DUYI 4DV6E 3QT5A 1XHKA 5EKWA 4OO1B 1FNMA 1N33E 3M6AA 5GMEA 4DR3I 1ZM2A 4UTGA 1UDQA 5DROA 1N36I 2VESA 1EI1A 4BA1A 3PYEA 4HACB 1OYPA 3QT6A 2HFUA 5C0XE 1H73A 2ZBKB 5EL9A 4FN5A 4DV5E 2HFSA 1Z0BA 2PO0A 2OI2A 4JI7I 2F4VE 4WUBA 2C38B 2J7KA 4DU7A 5DNLA 3QT7A 1HNZE 3J7AM 2BM1A 4IZJD 4FW4A 2JEBA 2C37A 1S16A 2BV3A 4DV4E 1Y5YA 4DPXA 4JYAE 1UDNA 2E5LI 4K0KE 1EA6A 1FJGE 5JEAB 4LFAI 4LFBI 1N33I 2Z5CA 1Y4UA 2AE8A 4DPUA 1ZM9A 3ZKDA 1ZM4A 2PO2B 5IWAE 3H1CA 3B8HA 2IERA 2HHHI 4PRVA 4N3OA 4X65I 1D6TA 2BA1G 3ZZ0A 4IFDD 4P52A 1NHJA 3L7ZB 2C38A 4XTJA 2VQFI 4B3TI 1IBKI 2V8PA 4LF5E 1Z0WA 1H74A 4Z7YA 1UDOA 3PRYA 4NBQA 4JI6E 4LF4I 4DXLA 2E1RA 5C0XD 2WP8A 5FLXQ 4X64E 3J81Q 4GKKE 1FJGI 4OO1F 3LPSA 2UXCI 1Z5CA 4WUDA 1Z5AA 4DV5I 4MDTA 2HK2A 3JAMQ 2X7IA 3QT8A 1N0VC 5LL6R 2UUCE 2O1VA 2C39B 4YHHI 4BA2A 2F4VI 4PU9A 3ZZTA 4FW7A 2BA0G 3L7ZA 1MX0A 3Q6MA 1NHHA 3K1JA 4J3DA 4FWHA 4DUYE 4DV6I 4LPFA 4DV7I 1HR0E 2BA1D 3P3GA 4OO1A 1E3HA 2UUBE 2Z5EA 3WU5A 3ZZUA 1ZM3A 4DR3E 3WU4A 3WU3A 4FWGA 5C0XC 4OX9E 4DUZE 1RR9A 1I94E 4KQVA 5JEAF 2UUAI 4FW3A 5K36A 1OYRA 2HK3A 2UXDE 4AIMA 1KTVA 2UXDI 1WUUA 3J80Q 1N34I 4JI3E 3P76A 2VQEE 3LNUA 2Z5CB 4DV3E 4USKA 2E5LE 3GLLA 2UUBI 3V2UC 4JI4I 4JI4E 3PYGA 4FW5A 4DV7E 1HR0I 4USMA 1FWLA 5C0XA 3M85G 4OX9I 4OO1C 3DD6A 4NXMI 4IFDB 1P42A 2GO3A 5K36C 4QNKA 4B3RI 2HHHE 4DR4I 1XNQE 5BR8E 2PO2A 4U3BA 1Z0GA 2PNZA 4AQYI 2BM0A 4QNJA 4LFCI 5GMDA 4YY3I 1PIEA 4DUZI 2PNMA 1PVGA 1RHYA 3HJCA 4MYUA 1NHIA 4LF9I 3J7AG 4ZVIA 4Z7CA 4YHHE 4K0KI 4JI1E 1Z0CA 4MU3A 1USUA 3B4TA 4JI5E 2O3ZA 5FLXC 3P3EA 3U1KA 1N32I 1K47A 5DNXA 4DV0I 4NXME 2AJ4A 2JE6B 4HACA 4OZEA 2A2DA 4DPWA 1R6LA 4HYMA 5IWAI 4ED4A 3T1HI 2ZITA 1PKPA 4WUCA 2ZM6I 1N0UA 2WP8B 5LMNI 2V34A 2LJPA 4OO1D 3T1YI 1VI7A 2O1UA 4B3RE 4LFBE 4LFAE 2Q2EB 4ISAA 2GO4A 4DV3I 4LF7E 4IFDF 2JEAB 3K85A 1J5EE 2C37B 1XMQE 1ZXMA 4GQUA 4JG4A 2CG9A 4LF8E 1Z0TA 3JAMC 1XMOE 2XEXA 3PYFA 5ELWA 4LCGA 5JEAD 4FWDA 4JI7E 1NZ0A 2Z5BA 2UXBI 1H72C 1N34E 2C39A 4DV1E 4X62E 4DV4I 4KHPE 4LCFA 1HK7A 2CZ9A 1N36E 5K36D 1UDSA 4LF7I 4AM3A 1KKHA 1FWKA 1N32E 4FW6A 5L3JA 2BR2B 1XMQI 2HKEA 3Q6NA 2PO1B 4JV5I 2BA0D 4MU4A 4GKJE 1UEKA 2IOQA 2WW4A 1BKNA 2VF3A 2UXBE 5JEAE 1B62A 1MG7A 3J80C 2WNRB 1IBME 1XNRE 4B3SE 4LF8I 4PRXA 5A2QQ 5JEAC 4BA1B 4LF4E 2CGEA 4JI6I 2DEJA 4JI8E 2NN6C 3T1YE 1IBKE
chains in the Genus database with same CATH topology
4IZKB 4X66E 1I94I 1KVKA 5FWKA 4MYTA 1QZRA 2GS8A 2ZM6E 4JV5E 3WU6A 1ZXNA 4DU8A 1HNZI 2IOPA 1IBLE 2EFGA 3D4JA 5LMNE 1HNWI 1S4EA 4X65E 4LF6E 4GKJI 4DR6I 2O1WA 3CWVA 4JI5I 1FI4A 2PNLA 2Z5BB 4DV1I 1Z0VA 1IBMI 4B3ME 1H7UA 1XMOI 4GKKI 1FKAE 5LMUE 3K17A 3H4LA 1HNXE 4JI2E 4IZJB 4P7AA 4JI2I 2O1TA 4DPTA 4X62I 4DR2I 3HULA 3F0NA 4HY1A 4JI1I 4LF9E 1H7SA 2UUCI 3ZM7A 4LFCE 1Y6ZA 5IT9C 2A2CA 4M1KA 1USVA 4DR7I 4FW9A 1XNQI 2UU9I 4NXNI 4I3HA 4NXNE 4X64I 1RREA 1IBLI 4JI3I 3ZKBA 2V2QA 4DV2I 1Z5BA 4IZKA 2UUAE 4DV2E 3OTOI 4DR5I 2R42A 4JI8I 3P06A 2VQEI 1A6FA 4DR2E 1VISA 4DR6E 4B3SI 3B82A 4IZJA 3B78A 1DARA 4RPFA 1U2RA 4DV0E 4B3MI 3V5RA 3GONA 4JYAI 3T1HE 2DEIA 4YY3E 2NPFA 4AQYE 1HNXI 1MU5A 4EMDA 4DR4E 5LMUI 4JI0E 3Q1QA 2GQ0A 1HNWE 4DR5E 4DR1I 4JI0I 4X66I 2HKJA 2V2VA 4KHPI 2R3VA 5BR8I 3LTOA 1Z0EA 4LF6I 5A2QC 2V2ZA 2UXCE 4URLA 4R1FA 3J81C 2UU9E 1J5EI 1KIJA 2VQFE 4B3TE 4LF5I 1XNRI 4HXZA 3PYDA 4DPYA 3OTOE 1ELOA 4DR1E 1OJ4A 1Y4SA 5IT9Q 4DR7E 2X36A 1B63A 1Z59A 4UT4A 4DUYI 4DV6E 3QT5A 1XHKA 1N33E 1FNMA 3M6AA 5GMEA 4DR3I 1ZM2A 4UTGA 1N36I 1EI1A 3PYEA 4HACB 3QT6A 2HFUA 1H73A 2ZBKB 4DV5E 4FN5A 2HFSA 1Z0BA 2OI2A 4JI7I 2F4VE 4WUBA 2J7KA 4DU7A 3QT7A 1HNZE 3J7AM 2BM1A 4IZJD 1S16A 2BV3A 4DV4E 4DPXA 4JYAE 4K0KE 2E5LI 1EA6A 1FJGE 4LFAI 4LFBI 1N33I 2Z5CA 1Y4UA 4DPUA 1ZM9A 3ZKDA 1ZM4A 5IWAE 3B8HA 2HHHI 4PRVA 4X65I 4N3OA 1D6TA 3ZZ0A 4P52A 1NHJA 4XTJA 2VQFI 4B3TI 1IBKI 2V8PA 4LF5E 1Z0WA 1H74A 4Z7YA 4JI6E 3PRYA 4LF4I 4DXLA 2E1RA 5FLXQ 4X64E 3J81Q 4GKKE 1FJGI 3LPSA 2UXCI 1Z5CA 4WUDA 1Z5AA 4DV5I 2HK2A 3JAMQ 2X7IA 3QT8A 1N0VC 5LL6R 2UUCE 2O1VA 4YHHI 2F4VI 4PU9A 3ZZTA 1MX0A 3Q6MA 1NHHA 3K1JA 4FWHA 4DUYE 4DV6I 4DV7I 1HR0E 2UUBE 2Z5EA 3WU5A 3ZZUA 1ZM3A 4DR3E 3WU4A 3WU3A 4FWGA 4OX9E 4DUZE 1RR9A 1I94E 4KQVA 2UUAI 2HK3A 2UXDE 2UXDI 1KTVA 1WUUA 3J80Q 1N34I 4JI3E 2VQEE 3LNUA 2Z5CB 4DV3E 4USKA 2E5LE 2UUBI 3V2UC 4JI4I 4JI4E 3PYGA 4DV7E 1HR0I 4USMA 1FWLA 4OX9I 4NXMI 4B3RI 2HHHE 4DR4I 1XNQE 5BR8E 1Z0GA 4AQYI 2BM0A 4LFCI 5GMDA 4YY3I 1PIEA 4DUZI 2PNMA 1PVGA 3HJCA 4MYUA 1NHIA 4LF9I 3J7AG 4ZVIA 4Z7CA 4YHHE 4K0KI 4JI1E 1Z0CA 1USUA 4JI5E 5FLXC 1N32I 1K47A 4DV0I 4NXME 2AJ4A 4HACA 2A2DA 4DPWA 4HYMA 5IWAI 4ED4A 3T1HI 2ZITA 1PKPA 4WUCA 2ZM6I 1N0UA 5LMNI 2V34A 2LJPA 3T1YI 2O1UA 4B3RE 4LFBE 4LFAE 2Q2EB 4DV3I 4LF7E 3K85A 1J5EE 1XMQE 1ZXMA 4JG4A 2CG9A 4LF8E 1Z0TA 3JAMC 1XMOE 2XEXA 3PYFA 4FWDA 4JI7E 1NZ0A 2Z5BA 2UXBI 1H72C 1N34E 4DV1E 4X62E 4DV4I 4KHPE 1HK7A 2CZ9A 1N36E 4LF7I 1FWKA 1KKHA 1N32E 5L3JA 1XMQI 2HKEA 3Q6NA 4JV5I 4GKJE 1UEKA 2IOQA 2WW4A 1BKNA 2VF3A 2UXBE 1B62A 1MG7A 3J80C 1IBME 1XNRE 4B3SE 4LF8I 5A2QQ 4PRXA 4LF4E 2CGEA 4JI6I 2DEJA 4JI8E 3T1YE 1IBKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  1I94 I;  1KVK A;  4MYT A;  1QZR A;  2GS8 A;  2ZM6 E;  4JV5 E;  3WU6 A;  1ZXN A;  4DU8 A;  1HNZ I;  1IBL E;  2EFG A;  3D4J A;  5LMN E;  1HNW I;  1S4E A;  4X65 E;  4LF6 E;  4GKJ I;  4DR6 I;  3CWV A;  4JI5 I;  1FI4 A;  4DV1 I;  1Z0V A;  1IBM I;  4B3M E;  1H7U A;  1XMO I;  4GKK I;  1FKA E;  5LMU E;  3K17 A;  3H4L A;  1HNX E;  4JI2 E;  4JI2 I;  4P7A A;  4DPT A;  4X62 I;  4DR2 I;  3HUL A;  3F0N A;  4HY1 A;  4JI1 I;  4LF9 E;  1H7S A;  2UUC I;  3ZM7 A;  4LFC E;  5IT9 C;  2A2C A;  4M1K A;  4DR7 I;  4FW9 A;  1XNQ I;  2UU9 I;  4NXN I;  4I3H A;  4NXN E;  4X64 I;  1RRE A;  1IBL I;  4JI3 I;  3ZKB A;  2V2Q A;  4DV2 I;  1Z5B A;  2UUA E;  4DV2 E;  3OTO I;  4DR5 I;  2R42 A;  4JI8 I;  2VQE I;  1A6F A;  4DR2 E;  1VIS A;  4DR6 E;  4B3S I;  3B82 A;  3B78 A;  1DAR A;  4RPF A;  1U2R A;  4DV0 E;  4B3M I;  3V5R A;  3GON A;  4JYA I;  3T1H E;  2DEI A;  4YY3 E;  2NPF A;  4AQY E;  1HNX I;  1MU5 A;  4EMD A;  4DR4 E;  5LMU I;  4JI0 E;  3Q1Q A;  1HNW E;  4DR5 E;  4DR1 I;  4JI0 I;  4X66 I;  2HKJ A;  2V2V A;  4KHP I;  2R3V A;  5BR8 I;  3LTO A;  1Z0E A;  4LF6 I;  5A2Q C;  2V2Z A;  2UXC E;  4URL A;  4R1F A;  3J81 C;  2UU9 E;  1J5E I;  1KIJ A;  2VQF E;  4B3T E;  4LF5 I;  1XNR I;  4HXZ A;  3PYD A;  4DPY A;  3OTO E;  1ELO A;  4DR1 E;  1OJ4 A;  5IT9 Q;  4DR7 E;  2X36 A;  1B63 A;  1Z59 A;  4UT4 A;  4DUY I;  4DV6 E;  3QT5 A;  1XHK A;  1N33 E;  1FNM A;  3M6A A;  5GME A;  4DR3 I;  1ZM2 A;  4UTG A;  1N36 I;  1EI1 A;  3PYE A;  4HAC B;  3QT6 A;  2HFU A;  1H73 A;  2ZBK B;  4DV5 E;  4FN5 A;  2HFS A;  1Z0B A;  2OI2 A;  4JI7 I;  2F4V E;  4WUB A;  2J7K A;  4DU7 A;  3QT7 A;  1HNZ E;  3J7A M;  2BM1 A;  1S16 A;  2BV3 A;  4DV4 E;  4DPX A;  4JYA E;  4K0K E;  2E5L I;  1EA6 A;  1FJG E;  4LFA I;  4LFB I;  1N33 I;  4DPU A;  1ZM9 A;  3ZKD A;  1ZM4 A;  5IWA E;  3B8H A;  2HHH I;  4PRV A;  4X65 I;  1D6T A;  3ZZ0 A;  4P52 A;  1NHJ A;  4XTJ A;  2VQF I;  4B3T I;  1IBK I;  2V8P A;  4LF5 E;  1Z0W A;  1H74 A;  4Z7Y A;  4JI6 E;  4LF4 I;  4DXL A;  2E1R A;  5FLX Q;  4X64 E;  3J81 Q;  4GKK E;  1FJG I;  3LPS A;  2UXC I;  1Z5C A;  4WUD A;  1Z5A A;  4DV5 I;  2HK2 A;  3JAM Q;  2X7I A;  3QT8 A;  1N0V C;  5LL6 R;  2UUC E;  4YHH I;  2F4V I;  4PU9 A;  3ZZT A;  1MX0 A;  1NHH A;  3K1J A;  4FWH A;  4DUY E;  4DV6 I;  4DV7 I;  1HR0 E;  2UUB E;  3WU5 A;  3ZZU A;  1ZM3 A;  4DR3 E;  3WU4 A;  3WU3 A;  4FWG A;  4OX9 E;  4DUZ E;  1RR9 A;  1I94 E;  4KQV A;  2UUA I;  2HK3 A;  2UXD E;  2UXD I;  1KTV A;  1WUU A;  3J80 Q;  1N34 I;  4JI3 E;  2VQE E;  3LNU A;  4DV3 E;  4USK A;  2E5L E;  2UUB I;  3V2U C;  4JI4 I;  4JI4 E;  3PYG A;  4DV7 E;  1HR0 I;  4USM A;  1FWL A;  4OX9 I;  4NXM I;  4B3R I;  2HHH E;  4DR4 I;  1XNQ E;  5BR8 E;  1Z0G A;  4AQY I;  2BM0 A;  4LFC I;  5GMD A;  4YY3 I;  1PIE A;  4DUZ I;  1PVG A;  4MYU A;  4LF9 I;  1NHI A;  3J7A G;  4ZVI A;  4Z7C A;  4YHH E;  4K0K I;  4JI1 E;  1Z0C A;  4JI5 E;  5FLX C;  1N32 I;  1K47 A;  4DV0 I;  4NXM E;  2AJ4 A;  4HAC A;  2A2D A;  4DPW A;  4HYM A;  5IWA I;  4ED4 A;  3T1H I;  2ZIT A;  1PKP A;  4WUC A;  2ZM6 I;  1N0U A;  5LMN I;  2V34 A;  2LJP A;  3T1Y I;  4B3R E;  4LFB E;  4LFA E;  2Q2E B;  4DV3 I;  4LF7 E;  1J5E E;  1XMQ E;  1ZXM A;  4JG4 A;  4LF8 E;  1Z0T A;  3JAM C;  1XMO E;  2XEX A;  3PYF A;  4FWD A;  4JI7 E;  1NZ0 A;  2UXB I;  1H72 C;  1N34 E;  4DV1 E;  4X62 E;  4DV4 I;  4KHP E;  2CZ9 A;  1N36 E;  4LF7 I;  1FWK A;  1KKH A;  1N32 E;  5L3J A;  1XMQ I;  2HKE A;  4JV5 I;  4GKJ E;  1UEK A;  2WW4 A;  1BKN A;  2VF3 A;  2UXB E;  1B62 A;  1MG7 A;  3J80 C;  1IBM E;  1XNR E;  4B3S E;  4LF8 I;  4PRX A;  5A2Q Q;  4LF4 E;  4JI6 I;  2DEJ A;  4JI8 E;  3T1Y E;  1IBK E; 
#chains in the Genus database with same CATH topology
 2NN6 F;  4IZK B;  4X66 E;  1I94 I;  1KVK A;  5FWK A;  4MYT A;  1QZR A;  2GS8 A;  2ZM6 E;  5C0X B;  4JV5 E;  3WU6 A;  1ZXN A;  4DU8 A;  1HNZ I;  2IOP A;  1IBL E;  2EFG A;  1R6M A;  3M7N D;  4MQY A;  2PNZ B;  2F1D A;  3D4J A;  5LMN E;  1HNW I;  2JT2 A;  2NN6 E;  5JEA A;  1S4E A;  4X65 E;  4LF6 E;  4GKJ I;  1YHC A;  3M7N G;  4DR6 I;  2O1W A;  3CWV A;  4JI5 I;  3HKM A;  2J65 A;  1FI4 A;  2PNL A;  2Z5B B;  4DV1 I;  1Z0V A;  1IBM I;  1OYS A;  4B3M E;  1H7U A;  2NN6 B;  5K36 E;  1XMO I;  4GKK I;  1FKA E;  5LMU E;  3K17 A;  3UHM A;  3H4L A;  1HNX E;  4JI2 E;  4IZJ B;  4P7A A;  4JI2 I;  3M85 D;  2O1T A;  4DPT A;  4X62 I;  4DR2 I;  1Y60 A;  3HUL A;  3F0N A;  4HY1 A;  2IES A;  4JI1 I;  3GME A;  4LF9 E;  1H7S A;  2UUC I;  2JEB B;  3ZM7 A;  5DRR A;  5DRP A;  1Y6Z A;  5IT9 C;  4LFC E;  2A2C A;  4M1K A;  3PS2 A;  2PO0 B;  1USV A;  4IS9 A;  4DR7 I;  3GCM A;  4FW9 A;  2UU9 I;  1XNQ I;  3U1Y A;  2CVE A;  4NXN I;  4I3H A;  4NXN E;  4X64 I;  1RRE A;  1IBL I;  4JI3 I;  3ZKB A;  2V2Q A;  4DV2 I;  1Z5B A;  4IZK A;  5C0X F;  2UUA E;  4DV2 E;  4IFD E;  2WNR A;  3OTO I;  4DR5 I;  5K36 F;  5DRQ A;  1E3P A;  2R42 A;  4LOM A;  1XXE A;  4JI8 I;  3P06 A;  2VQE I;  3PS1 A;  1YH8 A;  1A6F A;  4BA2 B;  4DR2 E;  3P3C A;  1VIS A;  4U3D A;  2BR2 A;  4DR6 E;  3PS3 A;  4B3S I;  3B82 A;  4IZJ A;  3B78 A;  1DAR A;  4RPF A;  1U2R A;  4DV0 E;  4B3M I;  3V5R A;  3GON A;  4JYA I;  2DEI A;  3T1H E;  4YY3 E;  2NPF A;  4AQY E;  4MU1 A;  1HNX I;  1MU5 A;  4EMD A;  4DR4 E;  5LMU I;  4JI0 E;  3Q1Q A;  2GQ0 A;  2NN6 D;  1HNW E;  2PO1 A;  4DR5 E;  4DR1 I;  4JI0 I;  2JEA A;  4IFD A;  4AID A;  4X66 I;  2HKJ A;  2V2V A;  4KHP I;  2R3V A;  5BR8 I;  3LTO A;  1Z0E A;  4LF6 I;  5A2Q C;  2NN6 A;  4MU0 A;  2V2Z A;  4OKG A;  2UXC E;  4URL A;  4R1F A;  3J81 C;  3KRN A;  2UU9 E;  1J5E I;  3CDI A;  4LCH A;  1KIJ A;  2VQF E;  4B3T E;  4LF5 I;  1XNR I;  4OO1 E;  4HXZ A;  3CDJ A;  3PYD A;  4DPY A;  3OTO E;  1ELO A;  4DR1 E;  3NZK A;  2JE6 A;  1OJ4 A;  1Y4S A;  5IT9 Q;  5K36 B;  4DR7 E;  2X36 A;  1B63 A;  1Z59 A;  4UT4 A;  4IFD C;  4DUY I;  4DV6 E;  3QT5 A;  1XHK A;  5EKW A;  4OO1 B;  1FNM A;  1N33 E;  3M6A A;  5GME A;  4DR3 I;  1ZM2 A;  4UTG A;  1UDQ A;  5DRO A;  1N36 I;  2VES A;  1EI1 A;  4BA1 A;  3PYE A;  4HAC B;  1OYP A;  3QT6 A;  2HFU A;  5C0X E;  1H73 A;  2ZBK B;  5EL9 A;  4FN5 A;  4DV5 E;  2HFS A;  1Z0B A;  2PO0 A;  2OI2 A;  4JI7 I;  2F4V E;  4WUB A;  2C38 B;  2J7K A;  4DU7 A;  5DNL A;  3QT7 A;  1HNZ E;  3J7A M;  2BM1 A;  4IZJ D;  4FW4 A;  2JEB A;  2C37 A;  1S16 A;  2BV3 A;  4DV4 E;  1Y5Y A;  4DPX A;  4JYA E;  1UDN A;  2E5L I;  4K0K E;  1EA6 A;  1FJG E;  5JEA B;  4LFA I;  4LFB I;  1N33 I;  2Z5C A;  1Y4U A;  2AE8 A;  4DPU A;  1ZM9 A;  3ZKD A;  1ZM4 A;  2PO2 B;  5IWA E;  3H1C A;  3B8H A;  2IER A;  2HHH I;  4PRV A;  4N3O A;  4X65 I;  1D6T A;  2BA1 G;  3ZZ0 A;  4IFD D;  4P52 A;  1NHJ A;  3L7Z B;  2C38 A;  4XTJ A;  2VQF I;  4B3T I;  1IBK I;  2V8P A;  4LF5 E;  1Z0W A;  1H74 A;  4Z7Y A;  1UDO A;  3PRY A;  4NBQ A;  4JI6 E;  4LF4 I;  4DXL A;  2E1R A;  5C0X D;  2WP8 A;  5FLX Q;  4X64 E;  3J81 Q;  4GKK E;  1FJG I;  4OO1 F;  3LPS A;  2UXC I;  1Z5C A;  4WUD A;  1Z5A A;  4DV5 I;  4MDT A;  2HK2 A;  3JAM Q;  2X7I A;  3QT8 A;  1N0V C;  5LL6 R;  2UUC E;  2O1V A;  2C39 B;  4YHH I;  4BA2 A;  2F4V I;  4PU9 A;  3ZZT A;  4FW7 A;  2BA0 G;  3L7Z A;  1MX0 A;  3Q6M A;  1NHH A;  3K1J A;  4J3D A;  4FWH A;  4DUY E;  4DV6 I;  4LPF A;  4DV7 I;  1HR0 E;  2BA1 D;  3P3G A;  4OO1 A;  1E3H A;  2UUB E;  2Z5E A;  3WU5 A;  3ZZU A;  1ZM3 A;  4DR3 E;  3WU4 A;  3WU3 A;  4FWG A;  5C0X C;  4OX9 E;  4DUZ E;  1RR9 A;  1I94 E;  4KQV A;  5JEA F;  2UUA I;  4FW3 A;  5K36 A;  1OYR A;  2HK3 A;  2UXD E;  4AIM A;  1KTV A;  2UXD I;  1WUU A;  3J80 Q;  1N34 I;  4JI3 E;  3P76 A;  2VQE E;  3LNU A;  2Z5C B;  4DV3 E;  4USK A;  2E5L E;  3GLL A;  2UUB I;  3V2U C;  4JI4 I;  4JI4 E;  3PYG A;  4FW5 A;  4DV7 E;  1HR0 I;  4USM A;  1FWL A;  5C0X A;  3M85 G;  4OX9 I;  4OO1 C;  3DD6 A;  4NXM I;  4IFD B;  1P42 A;  2GO3 A;  5K36 C;  4QNK A;  4B3R I;  2HHH E;  4DR4 I;  1XNQ E;  5BR8 E;  2PO2 A;  4U3B A;  1Z0G A;  2PNZ A;  4AQY I;  2BM0 A;  4QNJ A;  4LFC I;  5GMD A;  4YY3 I;  1PIE A;  4DUZ I;  2PNM A;  1PVG A;  1RHY A;  3HJC A;  4MYU A;  1NHI A;  4LF9 I;  3J7A G;  4ZVI A;  4Z7C A;  4YHH E;  4K0K I;  4JI1 E;  1Z0C A;  4MU3 A;  1USU A;  3B4T A;  4JI5 E;  2O3Z A;  5FLX C;  3P3E A;  3U1K A;  1N32 I;  1K47 A;  5DNX A;  4DV0 I;  4NXM E;  2AJ4 A;  2JE6 B;  4HAC A;  4OZE A;  2A2D A;  4DPW A;  1R6L A;  4HYM A;  5IWA I;  4ED4 A;  3T1H I;  2ZIT A;  1PKP A;  4WUC A;  2ZM6 I;  1N0U A;  2WP8 B;  5LMN I;  2V34 A;  2LJP A;  4OO1 D;  3T1Y I;  1VI7 A;  2O1U A;  4B3R E;  4LFB E;  4LFA E;  2Q2E B;  4ISA A;  2GO4 A;  4DV3 I;  4LF7 E;  4IFD F;  2JEA B;  3K85 A;  1J5E E;  2C37 B;  1XMQ E;  1ZXM A;  4GQU A;  4JG4 A;  2CG9 A;  4LF8 E;  1Z0T A;  3JAM C;  1XMO E;  2XEX A;  3PYF A;  5ELW A;  4LCG A;  5JEA D;  4FWD A;  4JI7 E;  1NZ0 A;  2Z5B A;  2UXB I;  1H72 C;  1N34 E;  2C39 A;  4DV1 E;  4X62 E;  4DV4 I;  4KHP E;  4LCF A;  1HK7 A;  2CZ9 A;  1N36 E;  5K36 D;  1UDS A;  4LF7 I;  4AM3 A;  1KKH A;  1FWK A;  1N32 E;  4FW6 A;  5L3J A;  2BR2 B;  1XMQ I;  2HKE A;  3Q6N A;  2PO1 B;  4JV5 I;  2BA0 D;  4MU4 A;  4GKJ E;  1UEK A;  2IOQ A;  2WW4 A;  1BKN A;  2VF3 A;  2UXB E;  5JEA E;  1B62 A;  1MG7 A;  3J80 C;  2WNR B;  1IBM E;  1XNR E;  4B3S E;  4LF8 I;  4PRX A;  5A2Q Q;  5JEA C;  4BA1 B;  4LF4 E;  2CGE A;  4JI6 I;  2DEJ A;  4JI8 E;  2NN6 C;  3T1Y E;  1IBK E; 
#chains in the Genus database with same CATH homology
 4IZK B;  4X66 E;  1I94 I;  1KVK A;  5FWK A;  4MYT A;  1QZR A;  2GS8 A;  2ZM6 E;  4JV5 E;  3WU6 A;  1ZXN A;  4DU8 A;  1HNZ I;  2IOP A;  1IBL E;  2EFG A;  3D4J A;  5LMN E;  1HNW I;  1S4E A;  4X65 E;  4LF6 E;  4GKJ I;  4DR6 I;  2O1W A;  3CWV A;  4JI5 I;  1FI4 A;  2PNL A;  2Z5B B;  4DV1 I;  1Z0V A;  1IBM I;  4B3M E;  1H7U A;  1XMO I;  4GKK I;  1FKA E;  5LMU E;  3K17 A;  3H4L A;  1HNX E;  4JI2 E;  4IZJ B;  4P7A A;  4JI2 I;  2O1T A;  4DPT A;  4X62 I;  4DR2 I;  3HUL A;  3F0N A;  4HY1 A;  4JI1 I;  4LF9 E;  1H7S A;  2UUC I;  3ZM7 A;  4LFC E;  1Y6Z A;  5IT9 C;  2A2C A;  4M1K A;  1USV A;  4DR7 I;  4FW9 A;  1XNQ I;  2UU9 I;  4NXN I;  4I3H A;  4NXN E;  4X64 I;  1RRE A;  1IBL I;  4JI3 I;  3ZKB A;  2V2Q A;  4DV2 I;  1Z5B A;  4IZK A;  2UUA E;  4DV2 E;  3OTO I;  4DR5 I;  2R42 A;  4JI8 I;  3P06 A;  2VQE I;  1A6F A;  4DR2 E;  1VIS A;  4DR6 E;  4B3S I;  3B82 A;  4IZJ A;  3B78 A;  1DAR A;  4RPF A;  1U2R A;  4DV0 E;  4B3M I;  3V5R A;  3GON A;  4JYA I;  3T1H E;  2DEI A;  4YY3 E;  2NPF A;  4AQY E;  1HNX I;  1MU5 A;  4EMD A;  4DR4 E;  5LMU I;  4JI0 E;  3Q1Q A;  2GQ0 A;  1HNW E;  4DR5 E;  4DR1 I;  4JI0 I;  4X66 I;  2HKJ A;  2V2V A;  4KHP I;  2R3V A;  5BR8 I;  3LTO A;  1Z0E A;  4LF6 I;  5A2Q C;  2V2Z A;  2UXC E;  4URL A;  4R1F A;  3J81 C;  2UU9 E;  1J5E I;  1KIJ A;  2VQF E;  4B3T E;  4LF5 I;  1XNR I;  4HXZ A;  3PYD A;  4DPY A;  3OTO E;  1ELO A;  4DR1 E;  1OJ4 A;  1Y4S A;  5IT9 Q;  4DR7 E;  2X36 A;  1B63 A;  1Z59 A;  4UT4 A;  4DUY I;  4DV6 E;  3QT5 A;  1XHK A;  1N33 E;  1FNM A;  3M6A A;  5GME A;  4DR3 I;  1ZM2 A;  4UTG A;  1N36 I;  1EI1 A;  3PYE A;  4HAC B;  3QT6 A;  2HFU A;  1H73 A;  2ZBK B;  4DV5 E;  4FN5 A;  2HFS A;  1Z0B A;  2OI2 A;  4JI7 I;  2F4V E;  4WUB A;  2J7K A;  4DU7 A;  3QT7 A;  1HNZ E;  3J7A M;  2BM1 A;  4IZJ D;  1S16 A;  2BV3 A;  4DV4 E;  4DPX A;  4JYA E;  4K0K E;  2E5L I;  1EA6 A;  1FJG E;  4LFA I;  4LFB I;  1N33 I;  2Z5C A;  1Y4U A;  4DPU A;  1ZM9 A;  3ZKD A;  1ZM4 A;  5IWA E;  3B8H A;  2HHH I;  4PRV A;  4X65 I;  4N3O A;  1D6T A;  3ZZ0 A;  4P52 A;  1NHJ A;  4XTJ A;  2VQF I;  4B3T I;  1IBK I;  2V8P A;  4LF5 E;  1Z0W A;  1H74 A;  4Z7Y A;  4JI6 E;  3PRY A;  4LF4 I;  4DXL A;  2E1R A;  5FLX Q;  4X64 E;  3J81 Q;  4GKK E;  1FJG I;  3LPS A;  2UXC I;  1Z5C A;  4WUD A;  1Z5A A;  4DV5 I;  2HK2 A;  3JAM Q;  2X7I A;  3QT8 A;  1N0V C;  5LL6 R;  2UUC E;  2O1V A;  4YHH I;  2F4V I;  4PU9 A;  3ZZT A;  1MX0 A;  3Q6M A;  1NHH A;  3K1J A;  4FWH A;  4DUY E;  4DV6 I;  4DV7 I;  1HR0 E;  2UUB E;  2Z5E A;  3WU5 A;  3ZZU A;  1ZM3 A;  4DR3 E;  3WU4 A;  3WU3 A;  4FWG A;  4OX9 E;  4DUZ E;  1RR9 A;  1I94 E;  4KQV A;  2UUA I;  2HK3 A;  2UXD E;  2UXD I;  1KTV A;  1WUU A;  3J80 Q;  1N34 I;  4JI3 E;  2VQE E;  3LNU A;  2Z5C B;  4DV3 E;  4USK A;  2E5L E;  2UUB I;  3V2U C;  4JI4 I;  4JI4 E;  3PYG A;  4DV7 E;  1HR0 I;  4USM A;  1FWL A;  4OX9 I;  4NXM I;  4B3R I;  2HHH E;  4DR4 I;  1XNQ E;  5BR8 E;  1Z0G A;  4AQY I;  2BM0 A;  4LFC I;  5GMD A;  4YY3 I;  1PIE A;  4DUZ I;  2PNM A;  1PVG A;  3HJC A;  4MYU A;  1NHI A;  4LF9 I;  3J7A G;  4ZVI A;  4Z7C A;  4YHH E;  4K0K I;  4JI1 E;  1Z0C A;  1USU A;  4JI5 E;  5FLX C;  1N32 I;  1K47 A;  4DV0 I;  4NXM E;  2AJ4 A;  4HAC A;  2A2D A;  4DPW A;  4HYM A;  5IWA I;  4ED4 A;  3T1H I;  2ZIT A;  1PKP A;  4WUC A;  2ZM6 I;  1N0U A;  5LMN I;  2V34 A;  2LJP A;  3T1Y I;  2O1U A;  4B3R E;  4LFB E;  4LFA E;  2Q2E B;  4DV3 I;  4LF7 E;  3K85 A;  1J5E E;  1XMQ E;  1ZXM A;  4JG4 A;  2CG9 A;  4LF8 E;  1Z0T A;  3JAM C;  1XMO E;  2XEX A;  3PYF A;  4FWD A;  4JI7 E;  1NZ0 A;  2Z5B A;  2UXB I;  1H72 C;  1N34 E;  4DV1 E;  4X62 E;  4DV4 I;  4KHP E;  1HK7 A;  2CZ9 A;  1N36 E;  4LF7 I;  1FWK A;  1KKH A;  1N32 E;  5L3J A;  1XMQ I;  2HKE A;  3Q6N A;  4JV5 I;  4GKJ E;  1UEK A;  2IOQ A;  2WW4 A;  1BKN A;  2VF3 A;  2UXB E;  1B62 A;  1MG7 A;  3J80 C;  1IBM E;  1XNR E;  4B3S E;  4LF8 I;  5A2Q Q;  4PRX A;  4LF4 E;  2CGE A;  4JI6 I;  2DEJ A;  4JI8 E;  3T1Y E;  1IBK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...