2UXCI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcI00
3T1HE 4WUCA 1IBLE 4DPYA 1MU5A 2GS8A 4ED4A 4DPXA 4X64I 1FJGI 4B3ME 1Z0BA 3J7AG 4DV2I 1RR9A 1Z0EA 4LF9E 4LFAI 1IBME 4DV6E 1N36I 2X36A 1XMOI 3J80C 4LF6E 4B3SI 2Q2EB 4LF5I 2V2ZA 4EMDA 3OTOI 4JI7E 2UXDI 3F0NA 2HKJA 4P52A 3Q1QA 3WU4A 3LTOA 4URLA 1J5EI 1HNWI 4KQVA 4LFBE 4DR4I 2VQFE 2UU9E 1N32I 5LMNI 1FNMA 2ZBKB 1HNXI 1S16A 1Z0TA 2HK3A 4JI5I 4X64E 1FJGE 2DEJA 4DV2E 3QT5A 2VF3A 4DV3I 4LFAE 1N36E 4DV4I 3PYGA 1XMOE 4JI4I 4B3SE 4LF5E 1ZM4A 4DPUA 5BR8I 3J80Q 3OTOE 2UXDE 1ZM2A 4WUBA 1N34I 2R42A 4PRVA 1KKHA 1HNWE 4DR4E 4YY3I 2AJ4A 4JI2I 4DU7A 5LMNE 1N32E 2E5LI 4X66I 4JYAI 1MG7A 2R3VA 2CZ9A 1VISA 2OI2A 4JI5E 2V2QA 1XMQI 2BM1A 4HACB 4DV7I 2V2VA 1WUUA 1H74A 4DV3E 4HYMA 1Z0CA 2E1RA 4DV4E 3K17A 1XNQI 3HULA 1Z0WA 3T1YI 1OJ4A 4USKA 2HFUA 1ELOA 5BR8E 1H73A 1FI4A 4K0KI 2BM0A 1N34E 2UXBE 2XEXA 3QT7A 2UXCI 4FWDA 4UTGA 4YY3E 3PYEA 3PYFA 4DR7I 4JI2E 2E5LE 4X66E 2V8PA 4JYAE 4UT4A 1B62A 1RREA 4GKJI 1XMQE 1N0UA 4NXMI 1FWLA 4DV7E 2UUCE 2NPFA 1NHIA 1XNQE 2A2CA 2F4VI 3T1YE 4LFCI 1XNRI 4K0KE 4FN5A 3WU3A 5GMDA 1N0VC 5FLXC 1EA6A 4USMA 4DV1I 4P7AA 2HKEA 4DR5I 2UXCE 4DPWA 4XTJA 2UUBI 3ZKBA 4DR7E 4B3TI 4LF8I 3LPSA 4DV5I 4M1KA 4NXNI 1A6FA 3B82A 2WW4A 2UXBI 4GKJE 4NXME 4YHHI 4KHPI 3QT6A 4Z7CA 3CWVA 1DARA 4GKKI 1NHJA 4RPFA 4DV0I 4DR3I 1Z0VA 2V34A 5L3JA 2F4VE 4LFCE 1XNRE 4DR6I 3K1JA 1HNZI 4ZVIA 4LF4I 4FWGA 4PU9A 2BV3A 4DV1E 4MYTA 2UUCI 3V5RA 4DR5E 3ZM7A 1UEKA 1Z0GA 5FLXQ 2UUBE 1Z59A 4JI1E 4DR1I 4B3TE 4HXZA 1KTVA 4LF8E 3ZZ0A 4DV5E 4JI0E 4NXNE 3V2UC 1FWKA 4DUZI 2HHHI 1Z5CA 4YHHE 1ZXNA 4KHPE 4OX9I 4GKKE 3D4JA 1IBKE 3J7AM 4DV0E 4DR3E 1KVKA 4DUYI 4FW9A 2EFGA 3QT8A 3JAMC 4DR2I 3J81C 5LMUI 2HK2A 4DR6E 1MX0A 3WU5A 1PVGA 1PKPA 1HNZE 1ZXMA 4X65I 4LF4E 2A2DA 1FKAE 1H7SA 4DXLA 1EI1A 4JV5I 1S4EA 1QZRA 1ZM9A 4HY1A 4X62I 1B63A 1I94I 4DR1E 4PRXA 5IWAI 1Z5AA 1N33I 2VQEI 4DUZE 1BKNA 2J7KA 3PYDA 2HHHE 3B8HA 2ZM6E 4OX9E 5IT9C 4B3RI 1Z5BA 1KIJA 4DUYE 4AQYI 2ZITA 1U2RA 4JI1I 5A2QC 4DR2E 5LMUE 1HR0I 4JI0I 1D6TA 4JI8I 4LF7I 4JI3I 3B78A 3JAMQ 3J81Q 2UUAI 4I3HA 4JI6I 4Z7YA 4HACA 4X65E 1IBKI 1NZ0A 1PIEA 3T1HI 5LL6R 4MYUA 1IBLI 4JG4A 3H4LA 3WU6A 4JV5E 1NHHA 4DU8A 4X62E 3M6AA 2DEIA 1I94E 1ZM3A 4B3MI 1K47A 5GMEA 4DPTA 5IWAE 4LF9I 2HFSA 3ZZTA 1IBMI 4DV6I 1N33E 2VQEE 1J5EE 4LF6I 1H72C 3LNUA 4B3RE 4JI7I 4AQYE 3GONA 2X7IA 1HNXE 5IT9Q 1HR0E 4R1FA 3ZZUA 1XHKA 4JI8E 4LF7E 1H7UA 4JI3E 3ZKDA 5A2QQ 4LFBI 2VQFI 2UU9I 2UUAE 2ZM6I 4WUDA 4JI6E 2LJPA 4FWHA 4JI4E
chains in the Genus database with same CATH superfamily
3T1HE 4WUCA 1IBLE 4DPYA 1MU5A 2NN6F 2PNZB 3CDJA 2IESA 2GS8A 4ED4A 4DPXA 4FW5A 4X64I 1FJGI 4B3ME 1Z0BA 3J7AG 3P06A 5DROA 4DV2I 2C38A 1RR9A 4IFDA 1Z0EA 4LF9E 4LFAI 1IBME 4DV6E 1N36I 1OYSA 2X36A 3HKMA 1XMOI 3J80C 4LF6E 1UDOA 4B3SI 2Q2EB 4LF5I 3PS1A 2V2ZA 5EL9A 4EMDA 2PNLA 3OTOI 4JI7E 2UXDI 3F0NA 2HKJA 2CGEA 4IZKB 4P52A 3Q1QA 3WU4A 3LTOA 4URLA 1J5EI 4BA1A 1HNWI 4KQVA 4LFBE 2Z5BA 3M7ND 4DR4I 2VQFE 2UU9E 4QNKA 5LMNI 1N32I 1FNMA 2IOQA 5JEAD 3HJCA 2ZBKB 2C38B 2O1TA 4IFDB 3P76A 1HNXI 1S16A 5DRQA 1Z0TA 2HK3A 3M85G 4JI5I 4X64E 1FJGE 1VI7A 2O3ZA 2DEJA 3U1YA 4DV2E 4IFDD 2VESA 3QT5A 2VF3A 4DV3I 2J65A 3UHMA 4LFAE 1N36E 4DV4I 3PYGA 3P3GA 1XMOE 4JI4I 4B3SE 4LF5E 1ZM4A 4DPUA 5BR8I 4U3DA 3J80Q 3OTOE 2UXDE 4BA1B 4ISAA 2Z5BB 3PS2A 1ZM2A 4WUBA 1N34I 2R42A 2CVEA 4LCHA 1Y4UA 4PRVA 4MDTA 1KKHA 4IFDF 1HNWE 4DR4E 4YY3I 2AJ4A 4N3OA 4JI2I 4IZJD 4DU7A 5LMNE 1N32E 2JEBA 2E5LI 3K85A 4X66I 5C0XC 4JYAI 3GCMA 5K36E 1MG7A 3Q6NA 2R3VA 2BR2A 2CZ9A 2PO0A 1VISA 2OI2A 4JI5E 2V2QA 1XMQI 2BM1A 4HACB 3PS3A 4DV7I 2V2VA 3DD6A 1WUUA 4LCFA 4OO1C 1H74A 4DV3E 4HYMA 3P3EA 1Z0CA 2E1RA 4DV4E 3K17A 1XNQI 3HULA 1Z0WA 3T1YI 1OJ4A 4USKA 2HFUA 1YH8A 1ELOA 2CG9A 5BR8E 1H73A 1FI4A 4K0KI 4OZEA 2BM0A 2GO4A 4AIDA 1N34E 2UXBE 4QNJA 1Y60A 2JEBB 2XEXA 5EKWA 2O1VA 3QT7A 2NN6C 2UXCI 1Y5YA 2BR2B 2IOPA 3KRNA 4FWDA 4UTGA 3PYEA 4YY3E 2PO0B 3PYFA 4DR7I 4JI2E 1OYRA 2E5LE 4X66E 2V8PA 4JYAE 4UT4A 4FW3A 1B62A 3PRYA 4MU3A 4IS9A 2WP8A 1RREA 4GKJI 1XMQE 1N0UA 4GQUA 4NXMI 4OO1A 1FWLA 4DV7E 5K36A 2BA1G 4MU0A 4MU1A 3B4TA 2Z5EA 5DRPA 5DRRA 2UUCE 2NPFA 1NHIA 1XNQE 2A2CA 2Z5CA 2F4VI 3T1YE 4LCGA 4LFCI 4FW7A 5DNXA 1XNRI 1Y6ZA 4K0KE 4FN5A 3WU3A 4AIMA 5GMDA 1N0VC 3GLLA 5FLXC 1EA6A 3U1KA 4USMA 4DV1I 2F1DA 2JE6A 4P7AA 2HKEA 2NN6A 2BA0G 4DR5I 2UXCE 4DPWA 4XTJA 2UUBI 2PO2A 2WP8B 4MQYA 3ZKBA 4DR7E 2PO1A 4B3TI 4LF8I 4OO1B 2BA1D 3LPSA 5K36B 4DV5I 2O1UA 4M1KA 4NXNI 1A6FA 3B82A 4MU4A 2WW4A 2UXBI 4GKJE 4NXME 5K36D 4YHHI 4KHPI 3L7ZA 5C0XE 3QT6A 4Z7CA 3CWVA 1DARA 2Z5CB 4GKKI 1NHJA 1UDNA 2AE8A 4RPFA 4DV0I 4DR3I 3M85D 1Z0VA 2V34A 5DNLA 5JEAC 5L3JA 2F4VE 4OO1E 5FWKA 1XXEA 4LFCE 1HK7A 1XNRE 4DR6I 2JE6B 2NN6B 3K1JA 4IFDC 1HNZI 4ZVIA 1OYPA 2PO2B 4LF4I 4FWGA 4PU9A 2BV3A 4DV1E 2PO1B 4MYTA 2UUCI 3V5RA 2JT2A 5K36F 4DR5E 3ZM7A 1UEKA 2O1WA 3NZKA 1Z0GA 5FLXQ 2UUBE 1Z59A 4JI1E 4DR1I 4B3TE 4HXZA 1KTVA 4LF8E 3L7ZB 3ZZ0A 2GQ0A 4DV5E 4JI0E 2NN6E 4NXNE 3V2UC 1FWKA 4DUZI 3H1CA 2HHHI 1Z5CA 4YHHE 4FW6A 1ZXNA 4KHPE 4OX9I 1R6LA 4GKKE 3D4JA 1IBKE 3J7AM 4AM3A 4DV0E 4DR3E 1KVKA 5JEAA 4DUYI 4FW9A 2EFGA 5C0XA 3QT8A 3JAMC 4DR2I 3J81C 5LMUI 1USUA 2HK2A 4DR6E 1MX0A 1Y4SA 3WU5A 1PVGA 1PKPA 1HNZE 2PNMA 1ZXMA 3P3CA 4X65I 4LF4E 2A2DA 1FKAE 1R6MA 2C37A 1H7SA 2C39A 1USVA 4DXLA 1EI1A 4JV5I 1S4EA 1QZRA 1ZM9A 4HY1A 4X62I 1B63A 1I94I 4DR1E 4PRXA 4BA2A 2IERA 5IWAI 1Z5AA 1E3HA 1RHYA 1N33I 2VQEI 4DUZE 1BKNA 5JEAB 4OKGA 2J7KA 3PYDA 2HHHE 5C0XB 1E3PA 3B8HA 2ZM6E 4OX9E 2JEAA 5IT9C 4B3RI 4IZJA 1Z5BA 1KIJA 4DUYE 4AQYI 2ZITA 1U2RA 4JI1I 5C0XD 5A2QC 4DR2E 5LMUE 1HR0I 3GMEA 4JI0I 1D6TA 2WNRA 4JI8I 4LF7I 2C37B 2C39B 4JI3I 1P42A 3B78A 3JAMQ 5JEAE 3J81Q 4OO1D 2UUAI 1UDQA 4I3HA 1YHCA 4JI6I 4Z7YA 4HACA 4X65E 1IBKI 3Q6MA 1NZ0A 5LL6R 1PIEA 3T1HI 4BA2B 4MYUA 1IBLI 4JG4A 3H4LA 3WU6A 4IFDE 4JV5E 1NHHA 4DU8A 4X62E 4NBQA 3M6AA 2DEIA 4LOMA 5JEAF 1ZM3A 1I94E 4B3MI 1K47A 3M7NG 3CDIA 5C0XF 5GMEA 2JEAB 4DPTA 1UDSA 2PNZA 5IWAE 4LF9I 2BA0D 2HFSA 4IZJB 3ZZTA 1IBMI 4DV6I 1N33E 2VQEE 1J5EE 4J3DA 4LF6I 1H72C 4OO1F 2NN6D 3LNUA 4B3RE 2GO3A 4U3BA 2WNRB 5ELWA 4JI7I 4AQYE 3GONA 2X7IA 1HNXE 4LPFA 5IT9Q 1HR0E 4FW4A 4R1FA 3ZZUA 1XHKA 4JI8E 4LF7E 1H7UA 4JI3E 3ZKDA 5K36C 5A2QQ 4LFBI 4IZKA 2VQFI 2UU9I 2UUAE 2ZM6I 4WUDA 4JI6E 2LJPA 4FWHA 4JI4E
chains in the Genus database with same CATH topology
3T1HE 4WUCA 1IBLE 4DPYA 1MU5A 2GS8A 4ED4A 4DPXA 4X64I 1FJGI 4B3ME 1Z0BA 3J7AG 3P06A 4DV2I 1RR9A 1Z0EA 4LF9E 4LFAI 1IBME 4DV6E 1N36I 2X36A 1XMOI 3J80C 4LF6E 4B3SI 2Q2EB 4LF5I 2V2ZA 4EMDA 2PNLA 3OTOI 4JI7E 2UXDI 3F0NA 2HKJA 2CGEA 4IZKB 4P52A 3Q1QA 3WU4A 3LTOA 4URLA 1J5EI 1HNWI 4KQVA 4LFBE 2Z5BA 4DR4I 2VQFE 2UU9E 1N32I 5LMNI 1FNMA 2IOQA 3HJCA 2ZBKB 2O1TA 1HNXI 1S16A 1Z0TA 2HK3A 4JI5I 4X64E 1FJGE 2DEJA 4DV2E 3QT5A 2VF3A 4DV3I 4LFAE 1N36E 4DV4I 3PYGA 1XMOE 4JI4I 4B3SE 4LF5E 1ZM4A 4DPUA 5BR8I 3J80Q 3OTOE 2UXDE 2Z5BB 1ZM2A 4WUBA 1N34I 2R42A 1Y4UA 4PRVA 1KKHA 1HNWE 4DR4E 4YY3I 2AJ4A 4N3OA 4JI2I 4IZJD 4DU7A 5LMNE 1N32E 2E5LI 3K85A 4X66I 4JYAI 1MG7A 3Q6NA 2R3VA 2CZ9A 1VISA 2OI2A 4JI5E 2V2QA 1XMQI 2BM1A 4HACB 4DV7I 2V2VA 1WUUA 1H74A 4DV3E 4HYMA 1Z0CA 2E1RA 4DV4E 3K17A 1XNQI 3HULA 1Z0WA 3T1YI 1OJ4A 4USKA 2HFUA 1ELOA 2CG9A 5BR8E 1H73A 1FI4A 4K0KI 2BM0A 1N34E 2UXBE 2XEXA 2O1VA 3QT7A 2UXCI 2IOPA 4FWDA 4UTGA 4YY3E 3PYEA 3PYFA 4DR7I 4JI2E 2E5LE 4X66E 2V8PA 4JYAE 4UT4A 1B62A 3PRYA 1RREA 4GKJI 1XMQE 1N0UA 4NXMI 1FWLA 4DV7E 2Z5EA 2UUCE 2NPFA 1NHIA 1XNQE 2A2CA 2Z5CA 2F4VI 3T1YE 4LFCI 1XNRI 1Y6ZA 4K0KE 4FN5A 3WU3A 5GMDA 1N0VC 5FLXC 1EA6A 4USMA 4DV1I 4P7AA 2HKEA 4DR5I 2UXCE 4DPWA 4XTJA 2UUBI 3ZKBA 4DR7E 4B3TI 4LF8I 3LPSA 4DV5I 2O1UA 4M1KA 4NXNI 1A6FA 3B82A 2WW4A 2UXBI 4GKJE 4NXME 4YHHI 4KHPI 3QT6A 4Z7CA 3CWVA 1DARA 2Z5CB 4GKKI 1NHJA 4RPFA 4DV0I 4DR3I 1Z0VA 2V34A 5L3JA 2F4VE 5FWKA 4LFCE 1HK7A 1XNRE 4DR6I 3K1JA 1HNZI 4ZVIA 4LF4I 4FWGA 4PU9A 2BV3A 4DV1E 4MYTA 2UUCI 3V5RA 4DR5E 3ZM7A 1UEKA 2O1WA 1Z0GA 5FLXQ 2UUBE 1Z59A 4JI1E 4DR1I 4B3TE 4HXZA 1KTVA 4LF8E 3ZZ0A 2GQ0A 4DV5E 4JI0E 4NXNE 3V2UC 1FWKA 4DUZI 2HHHI 1Z5CA 4YHHE 1ZXNA 4KHPE 4OX9I 4GKKE 3D4JA 1IBKE 3J7AM 4DV0E 4DR3E 1KVKA 4DUYI 4FW9A 2EFGA 3QT8A 3JAMC 4DR2I 3J81C 5LMUI 1USUA 2HK2A 4DR6E 1MX0A 1Y4SA 3WU5A 1PVGA 1PKPA 1HNZE 2PNMA 1ZXMA 4X65I 4LF4E 2A2DA 1FKAE 1H7SA 1USVA 4DXLA 1EI1A 4JV5I 1S4EA 1QZRA 1ZM9A 4HY1A 4X62I 1B63A 1I94I 4DR1E 4PRXA 5IWAI 1Z5AA 1N33I 2VQEI 4DUZE 1BKNA 2J7KA 3PYDA 2HHHE 3B8HA 2ZM6E 4OX9E 5IT9C 4B3RI 4IZJA 1Z5BA 1KIJA 4DUYE 4AQYI 2ZITA 1U2RA 4JI1I 5A2QC 4DR2E 5LMUE 1HR0I 4JI0I 1D6TA 4JI8I 4LF7I 4JI3I 3B78A 3JAMQ 3J81Q 2UUAI 4I3HA 4JI6I 4Z7YA 4HACA 4X65E 1IBKI 3Q6MA 1NZ0A 5LL6R 3T1HI 1PIEA 4MYUA 1IBLI 4JG4A 3H4LA 3WU6A 4JV5E 1NHHA 4DU8A 4X62E 3M6AA 2DEIA 1I94E 1ZM3A 4B3MI 1K47A 5GMEA 4DPTA 5IWAE 4LF9I 2HFSA 4IZJB 3ZZTA 1IBMI 4DV6I 1N33E 2VQEE 1J5EE 4LF6I 1H72C 3LNUA 4B3RE 4JI7I 4AQYE 3GONA 2X7IA 1HNXE 5IT9Q 1HR0E 4R1FA 3ZZUA 1XHKA 4JI8E 4LF7E 1H7UA 4JI3E 3ZKDA 5A2QQ 4LFBI 4IZKA 2VQFI 2UU9I 2UUAE 2ZM6I 4WUDA 4JI6E 2LJPA 4FWHA 4JI4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H E;  4WUC A;  1IBL E;  4DPY A;  1MU5 A;  2GS8 A;  4ED4 A;  4DPX A;  4X64 I;  1FJG I;  4B3M E;  1Z0B A;  3J7A G;  4DV2 I;  1RR9 A;  1Z0E A;  4LF9 E;  4LFA I;  1IBM E;  4DV6 E;  1N36 I;  2X36 A;  1XMO I;  3J80 C;  4LF6 E;  4B3S I;  2Q2E B;  4LF5 I;  2V2Z A;  4EMD A;  3OTO I;  4JI7 E;  2UXD I;  3F0N A;  2HKJ A;  4P52 A;  3Q1Q A;  3WU4 A;  3LTO A;  4URL A;  1J5E I;  1HNW I;  4KQV A;  4LFB E;  4DR4 I;  2VQF E;  2UU9 E;  1N32 I;  5LMN I;  1FNM A;  2ZBK B;  1HNX I;  1S16 A;  1Z0T A;  2HK3 A;  4JI5 I;  4X64 E;  1FJG E;  2DEJ A;  4DV2 E;  3QT5 A;  2VF3 A;  4DV3 I;  4LFA E;  1N36 E;  4DV4 I;  3PYG A;  1XMO E;  4JI4 I;  4B3S E;  4LF5 E;  1ZM4 A;  4DPU A;  5BR8 I;  3J80 Q;  3OTO E;  2UXD E;  1ZM2 A;  4WUB A;  1N34 I;  2R42 A;  4PRV A;  1KKH A;  1HNW E;  4DR4 E;  4YY3 I;  2AJ4 A;  4JI2 I;  4DU7 A;  5LMN E;  1N32 E;  2E5L I;  4X66 I;  4JYA I;  1MG7 A;  2R3V A;  2CZ9 A;  1VIS A;  2OI2 A;  4JI5 E;  2V2Q A;  1XMQ I;  2BM1 A;  4HAC B;  4DV7 I;  2V2V A;  1WUU A;  1H74 A;  4DV3 E;  4HYM A;  1Z0C A;  2E1R A;  4DV4 E;  3K17 A;  1XNQ I;  3HUL A;  1Z0W A;  3T1Y I;  1OJ4 A;  4USK A;  2HFU A;  1ELO A;  5BR8 E;  1H73 A;  1FI4 A;  4K0K I;  2BM0 A;  1N34 E;  2UXB E;  2XEX A;  3QT7 A;  2UXC I;  4FWD A;  4UTG A;  4YY3 E;  3PYE A;  3PYF A;  4DR7 I;  4JI2 E;  2E5L E;  4X66 E;  2V8P A;  4JYA E;  4UT4 A;  1B62 A;  1RRE A;  4GKJ I;  1XMQ E;  1N0U A;  4NXM I;  1FWL A;  4DV7 E;  2UUC E;  2NPF A;  1NHI A;  1XNQ E;  2A2C A;  2F4V I;  3T1Y E;  4LFC I;  1XNR I;  4K0K E;  4FN5 A;  3WU3 A;  5GMD A;  1N0V C;  5FLX C;  1EA6 A;  4USM A;  4DV1 I;  4P7A A;  2HKE A;  4DR5 I;  2UXC E;  4DPW A;  4XTJ A;  2UUB I;  3ZKB A;  4DR7 E;  4B3T I;  4LF8 I;  3LPS A;  4DV5 I;  4M1K A;  4NXN I;  1A6F A;  3B82 A;  2WW4 A;  2UXB I;  4GKJ E;  4NXM E;  4YHH I;  4KHP I;  3QT6 A;  4Z7C A;  3CWV A;  1DAR A;  4GKK I;  1NHJ A;  4RPF A;  4DV0 I;  4DR3 I;  1Z0V A;  2V34 A;  5L3J A;  2F4V E;  4LFC E;  1XNR E;  4DR6 I;  3K1J A;  1HNZ I;  4ZVI A;  4LF4 I;  4FWG A;  4PU9 A;  2BV3 A;  4DV1 E;  4MYT A;  2UUC I;  3V5R A;  4DR5 E;  3ZM7 A;  1UEK A;  1Z0G A;  5FLX Q;  2UUB E;  1Z59 A;  4JI1 E;  4DR1 I;  4B3T E;  4HXZ A;  1KTV A;  4LF8 E;  3ZZ0 A;  4DV5 E;  4JI0 E;  4NXN E;  3V2U C;  1FWK A;  4DUZ I;  2HHH I;  1Z5C A;  4YHH E;  1ZXN A;  4KHP E;  4OX9 I;  4GKK E;  3D4J A;  1IBK E;  3J7A M;  4DV0 E;  4DR3 E;  1KVK A;  4DUY I;  4FW9 A;  2EFG A;  3QT8 A;  3JAM C;  4DR2 I;  3J81 C;  5LMU I;  2HK2 A;  4DR6 E;  1MX0 A;  3WU5 A;  1PVG A;  1PKP A;  1HNZ E;  1ZXM A;  4X65 I;  4LF4 E;  2A2D A;  1FKA E;  1H7S A;  4DXL A;  1EI1 A;  4JV5 I;  1S4E A;  1QZR A;  1ZM9 A;  4HY1 A;  4X62 I;  1B63 A;  1I94 I;  4DR1 E;  4PRX A;  5IWA I;  1Z5A A;  1N33 I;  2VQE I;  4DUZ E;  1BKN A;  2J7K A;  3PYD A;  2HHH E;  3B8H A;  2ZM6 E;  4OX9 E;  5IT9 C;  4B3R I;  1Z5B A;  1KIJ A;  4DUY E;  4AQY I;  2ZIT A;  1U2R A;  4JI1 I;  5A2Q C;  4DR2 E;  5LMU E;  1HR0 I;  4JI0 I;  1D6T A;  4JI8 I;  4LF7 I;  4JI3 I;  3B78 A;  3JAM Q;  3J81 Q;  2UUA I;  4I3H A;  4JI6 I;  4Z7Y A;  4HAC A;  4X65 E;  1IBK I;  1NZ0 A;  1PIE A;  3T1H I;  5LL6 R;  4MYU A;  1IBL I;  4JG4 A;  3H4L A;  3WU6 A;  4JV5 E;  1NHH A;  4DU8 A;  4X62 E;  3M6A A;  2DEI A;  1I94 E;  1ZM3 A;  4B3M I;  1K47 A;  5GME A;  4DPT A;  5IWA E;  4LF9 I;  2HFS A;  3ZZT A;  1IBM I;  4DV6 I;  1N33 E;  2VQE E;  1J5E E;  4LF6 I;  1H72 C;  3LNU A;  4B3R E;  4JI7 I;  4AQY E;  3GON A;  2X7I A;  1HNX E;  5IT9 Q;  1HR0 E;  4R1F A;  3ZZU A;  1XHK A;  4JI8 E;  4LF7 E;  1H7U A;  4JI3 E;  3ZKD A;  5A2Q Q;  4LFB I;  2VQF I;  2UU9 I;  2UUA E;  2ZM6 I;  4WUD A;  4JI6 E;  2LJP A;  4FWH A;  4JI4 E; 
#chains in the Genus database with same CATH topology
 3T1H E;  4WUC A;  1IBL E;  4DPY A;  1MU5 A;  2NN6 F;  2PNZ B;  3CDJ A;  2IES A;  2GS8 A;  4ED4 A;  4DPX A;  4FW5 A;  4X64 I;  1FJG I;  4B3M E;  1Z0B A;  3J7A G;  3P06 A;  5DRO A;  4DV2 I;  2C38 A;  1RR9 A;  4IFD A;  1Z0E A;  4LF9 E;  4LFA I;  1IBM E;  4DV6 E;  1N36 I;  1OYS A;  2X36 A;  3HKM A;  1XMO I;  3J80 C;  4LF6 E;  1UDO A;  4B3S I;  2Q2E B;  4LF5 I;  3PS1 A;  2V2Z A;  5EL9 A;  4EMD A;  2PNL A;  3OTO I;  4JI7 E;  2UXD I;  3F0N A;  2HKJ A;  2CGE A;  4IZK B;  4P52 A;  3Q1Q A;  3WU4 A;  3LTO A;  4URL A;  1J5E I;  4BA1 A;  1HNW I;  4KQV A;  4LFB E;  2Z5B A;  3M7N D;  4DR4 I;  2VQF E;  2UU9 E;  4QNK A;  5LMN I;  1N32 I;  1FNM A;  2IOQ A;  5JEA D;  3HJC A;  2ZBK B;  2C38 B;  2O1T A;  4IFD B;  3P76 A;  1HNX I;  1S16 A;  5DRQ A;  1Z0T A;  2HK3 A;  3M85 G;  4JI5 I;  4X64 E;  1FJG E;  1VI7 A;  2O3Z A;  2DEJ A;  3U1Y A;  4DV2 E;  4IFD D;  2VES A;  3QT5 A;  2VF3 A;  4DV3 I;  2J65 A;  3UHM A;  4LFA E;  1N36 E;  4DV4 I;  3PYG A;  3P3G A;  1XMO E;  4JI4 I;  4B3S E;  4LF5 E;  1ZM4 A;  4DPU A;  5BR8 I;  4U3D A;  3J80 Q;  3OTO E;  2UXD E;  4BA1 B;  4ISA A;  2Z5B B;  3PS2 A;  1ZM2 A;  4WUB A;  1N34 I;  2R42 A;  2CVE A;  4LCH A;  1Y4U A;  4PRV A;  4MDT A;  1KKH A;  4IFD F;  1HNW E;  4DR4 E;  4YY3 I;  2AJ4 A;  4N3O A;  4JI2 I;  4IZJ D;  4DU7 A;  5LMN E;  1N32 E;  2JEB A;  2E5L I;  3K85 A;  4X66 I;  5C0X C;  4JYA I;  3GCM A;  5K36 E;  1MG7 A;  3Q6N A;  2R3V A;  2BR2 A;  2CZ9 A;  2PO0 A;  1VIS A;  2OI2 A;  4JI5 E;  2V2Q A;  1XMQ I;  2BM1 A;  4HAC B;  3PS3 A;  4DV7 I;  2V2V A;  3DD6 A;  1WUU A;  4LCF A;  4OO1 C;  1H74 A;  4DV3 E;  4HYM A;  3P3E A;  1Z0C A;  2E1R A;  4DV4 E;  3K17 A;  1XNQ I;  3HUL A;  1Z0W A;  3T1Y I;  1OJ4 A;  4USK A;  2HFU A;  1YH8 A;  1ELO A;  2CG9 A;  5BR8 E;  1H73 A;  1FI4 A;  4K0K I;  4OZE A;  2BM0 A;  2GO4 A;  4AID A;  1N34 E;  2UXB E;  4QNJ A;  1Y60 A;  2JEB B;  2XEX A;  5EKW A;  2O1V A;  3QT7 A;  2NN6 C;  2UXC I;  1Y5Y A;  2BR2 B;  2IOP A;  3KRN A;  4FWD A;  4UTG A;  3PYE A;  4YY3 E;  2PO0 B;  3PYF A;  4DR7 I;  4JI2 E;  1OYR A;  2E5L E;  4X66 E;  2V8P A;  4JYA E;  4UT4 A;  4FW3 A;  1B62 A;  3PRY A;  4MU3 A;  4IS9 A;  2WP8 A;  1RRE A;  4GKJ I;  1XMQ E;  1N0U A;  4GQU A;  4NXM I;  4OO1 A;  1FWL A;  4DV7 E;  5K36 A;  2BA1 G;  4MU0 A;  4MU1 A;  3B4T A;  2Z5E A;  5DRP A;  5DRR A;  2UUC E;  2NPF A;  1NHI A;  1XNQ E;  2A2C A;  2Z5C A;  2F4V I;  3T1Y E;  4LCG A;  4LFC I;  4FW7 A;  5DNX A;  1XNR I;  1Y6Z A;  4K0K E;  4FN5 A;  3WU3 A;  4AIM A;  5GMD A;  1N0V C;  3GLL A;  5FLX C;  1EA6 A;  3U1K A;  4USM A;  4DV1 I;  2F1D A;  2JE6 A;  4P7A A;  2HKE A;  2NN6 A;  2BA0 G;  4DR5 I;  2UXC E;  4DPW A;  4XTJ A;  2UUB I;  2PO2 A;  2WP8 B;  4MQY A;  3ZKB A;  4DR7 E;  2PO1 A;  4B3T I;  4LF8 I;  4OO1 B;  2BA1 D;  3LPS A;  5K36 B;  4DV5 I;  2O1U A;  4M1K A;  4NXN I;  1A6F A;  3B82 A;  4MU4 A;  2WW4 A;  2UXB I;  4GKJ E;  4NXM E;  5K36 D;  4YHH I;  4KHP I;  3L7Z A;  5C0X E;  3QT6 A;  4Z7C A;  3CWV A;  1DAR A;  2Z5C B;  4GKK I;  1NHJ A;  1UDN A;  2AE8 A;  4RPF A;  4DV0 I;  4DR3 I;  3M85 D;  1Z0V A;  2V34 A;  5DNL A;  5JEA C;  5L3J A;  2F4V E;  4OO1 E;  5FWK A;  1XXE A;  4LFC E;  1HK7 A;  1XNR E;  4DR6 I;  2JE6 B;  2NN6 B;  3K1J A;  4IFD C;  1HNZ I;  4ZVI A;  1OYP A;  2PO2 B;  4LF4 I;  4FWG A;  4PU9 A;  2BV3 A;  4DV1 E;  2PO1 B;  4MYT A;  2UUC I;  3V5R A;  2JT2 A;  5K36 F;  4DR5 E;  3ZM7 A;  1UEK A;  2O1W A;  3NZK A;  1Z0G A;  5FLX Q;  2UUB E;  1Z59 A;  4JI1 E;  4DR1 I;  4B3T E;  4HXZ A;  1KTV A;  4LF8 E;  3L7Z B;  3ZZ0 A;  2GQ0 A;  4DV5 E;  4JI0 E;  2NN6 E;  4NXN E;  3V2U C;  1FWK A;  4DUZ I;  3H1C A;  2HHH I;  1Z5C A;  4YHH E;  4FW6 A;  1ZXN A;  4KHP E;  4OX9 I;  1R6L A;  4GKK E;  3D4J A;  1IBK E;  3J7A M;  4AM3 A;  4DV0 E;  4DR3 E;  1KVK A;  5JEA A;  4DUY I;  4FW9 A;  2EFG A;  5C0X A;  3QT8 A;  3JAM C;  4DR2 I;  3J81 C;  5LMU I;  1USU A;  2HK2 A;  4DR6 E;  1MX0 A;  1Y4S A;  3WU5 A;  1PVG A;  1PKP A;  1HNZ E;  2PNM A;  1ZXM A;  3P3C A;  4X65 I;  4LF4 E;  2A2D A;  1FKA E;  1R6M A;  2C37 A;  1H7S A;  2C39 A;  1USV A;  4DXL A;  1EI1 A;  4JV5 I;  1S4E A;  1QZR A;  1ZM9 A;  4HY1 A;  4X62 I;  1B63 A;  1I94 I;  4DR1 E;  4PRX A;  4BA2 A;  2IER A;  5IWA I;  1Z5A A;  1E3H A;  1RHY A;  1N33 I;  2VQE I;  4DUZ E;  1BKN A;  5JEA B;  4OKG A;  2J7K A;  3PYD A;  2HHH E;  5C0X B;  1E3P A;  3B8H A;  2ZM6 E;  4OX9 E;  2JEA A;  5IT9 C;  4B3R I;  4IZJ A;  1Z5B A;  1KIJ A;  4DUY E;  4AQY I;  2ZIT A;  1U2R A;  4JI1 I;  5C0X D;  5A2Q C;  4DR2 E;  5LMU E;  1HR0 I;  3GME A;  4JI0 I;  1D6T A;  2WNR A;  4JI8 I;  4LF7 I;  2C37 B;  2C39 B;  4JI3 I;  1P42 A;  3B78 A;  3JAM Q;  5JEA E;  3J81 Q;  4OO1 D;  2UUA I;  1UDQ A;  4I3H A;  1YHC A;  4JI6 I;  4Z7Y A;  4HAC A;  4X65 E;  1IBK I;  3Q6M A;  1NZ0 A;  5LL6 R;  1PIE A;  3T1H I;  4BA2 B;  4MYU A;  1IBL I;  4JG4 A;  3H4L A;  3WU6 A;  4IFD E;  4JV5 E;  1NHH A;  4DU8 A;  4X62 E;  4NBQ A;  3M6A A;  2DEI A;  4LOM A;  5JEA F;  1ZM3 A;  1I94 E;  4B3M I;  1K47 A;  3M7N G;  3CDI A;  5C0X F;  5GME A;  2JEA B;  4DPT A;  1UDS A;  2PNZ A;  5IWA E;  4LF9 I;  2BA0 D;  2HFS A;  4IZJ B;  3ZZT A;  1IBM I;  4DV6 I;  1N33 E;  2VQE E;  1J5E E;  4J3D A;  4LF6 I;  1H72 C;  4OO1 F;  2NN6 D;  3LNU A;  4B3R E;  2GO3 A;  4U3B A;  2WNR B;  5ELW A;  4JI7 I;  4AQY E;  3GON A;  2X7I A;  1HNX E;  4LPF A;  5IT9 Q;  1HR0 E;  4FW4 A;  4R1F A;  3ZZU A;  1XHK A;  4JI8 E;  4LF7 E;  1H7U A;  4JI3 E;  3ZKD A;  5K36 C;  5A2Q Q;  4LFB I;  4IZK A;  2VQF I;  2UU9 I;  2UUA E;  2ZM6 I;  4WUD A;  4JI6 E;  2LJP A;  4FWH A;  4JI4 E; 
#chains in the Genus database with same CATH homology
 3T1H E;  4WUC A;  1IBL E;  4DPY A;  1MU5 A;  2GS8 A;  4ED4 A;  4DPX A;  4X64 I;  1FJG I;  4B3M E;  1Z0B A;  3J7A G;  3P06 A;  4DV2 I;  1RR9 A;  1Z0E A;  4LF9 E;  4LFA I;  1IBM E;  4DV6 E;  1N36 I;  2X36 A;  1XMO I;  3J80 C;  4LF6 E;  4B3S I;  2Q2E B;  4LF5 I;  2V2Z A;  4EMD A;  2PNL A;  3OTO I;  4JI7 E;  2UXD I;  3F0N A;  2HKJ A;  2CGE A;  4IZK B;  4P52 A;  3Q1Q A;  3WU4 A;  3LTO A;  4URL A;  1J5E I;  1HNW I;  4KQV A;  4LFB E;  2Z5B A;  4DR4 I;  2VQF E;  2UU9 E;  1N32 I;  5LMN I;  1FNM A;  2IOQ A;  3HJC A;  2ZBK B;  2O1T A;  1HNX I;  1S16 A;  1Z0T A;  2HK3 A;  4JI5 I;  4X64 E;  1FJG E;  2DEJ A;  4DV2 E;  3QT5 A;  2VF3 A;  4DV3 I;  4LFA E;  1N36 E;  4DV4 I;  3PYG A;  1XMO E;  4JI4 I;  4B3S E;  4LF5 E;  1ZM4 A;  4DPU A;  5BR8 I;  3J80 Q;  3OTO E;  2UXD E;  2Z5B B;  1ZM2 A;  4WUB A;  1N34 I;  2R42 A;  1Y4U A;  4PRV A;  1KKH A;  1HNW E;  4DR4 E;  4YY3 I;  2AJ4 A;  4N3O A;  4JI2 I;  4IZJ D;  4DU7 A;  5LMN E;  1N32 E;  2E5L I;  3K85 A;  4X66 I;  4JYA I;  1MG7 A;  3Q6N A;  2R3V A;  2CZ9 A;  1VIS A;  2OI2 A;  4JI5 E;  2V2Q A;  1XMQ I;  2BM1 A;  4HAC B;  4DV7 I;  2V2V A;  1WUU A;  1H74 A;  4DV3 E;  4HYM A;  1Z0C A;  2E1R A;  4DV4 E;  3K17 A;  1XNQ I;  3HUL A;  1Z0W A;  3T1Y I;  1OJ4 A;  4USK A;  2HFU A;  1ELO A;  2CG9 A;  5BR8 E;  1H73 A;  1FI4 A;  4K0K I;  2BM0 A;  1N34 E;  2UXB E;  2XEX A;  2O1V A;  3QT7 A;  2UXC I;  2IOP A;  4FWD A;  4UTG A;  4YY3 E;  3PYE A;  3PYF A;  4DR7 I;  4JI2 E;  2E5L E;  4X66 E;  2V8P A;  4JYA E;  4UT4 A;  1B62 A;  3PRY A;  1RRE A;  4GKJ I;  1XMQ E;  1N0U A;  4NXM I;  1FWL A;  4DV7 E;  2Z5E A;  2UUC E;  2NPF A;  1NHI A;  1XNQ E;  2A2C A;  2Z5C A;  2F4V I;  3T1Y E;  4LFC I;  1XNR I;  1Y6Z A;  4K0K E;  4FN5 A;  3WU3 A;  5GMD A;  1N0V C;  5FLX C;  1EA6 A;  4USM A;  4DV1 I;  4P7A A;  2HKE A;  4DR5 I;  2UXC E;  4DPW A;  4XTJ A;  2UUB I;  3ZKB A;  4DR7 E;  4B3T I;  4LF8 I;  3LPS A;  4DV5 I;  2O1U A;  4M1K A;  4NXN I;  1A6F A;  3B82 A;  2WW4 A;  2UXB I;  4GKJ E;  4NXM E;  4YHH I;  4KHP I;  3QT6 A;  4Z7C A;  3CWV A;  1DAR A;  2Z5C B;  4GKK I;  1NHJ A;  4RPF A;  4DV0 I;  4DR3 I;  1Z0V A;  2V34 A;  5L3J A;  2F4V E;  5FWK A;  4LFC E;  1HK7 A;  1XNR E;  4DR6 I;  3K1J A;  1HNZ I;  4ZVI A;  4LF4 I;  4FWG A;  4PU9 A;  2BV3 A;  4DV1 E;  4MYT A;  2UUC I;  3V5R A;  4DR5 E;  3ZM7 A;  1UEK A;  2O1W A;  1Z0G A;  5FLX Q;  2UUB E;  1Z59 A;  4JI1 E;  4DR1 I;  4B3T E;  4HXZ A;  1KTV A;  4LF8 E;  3ZZ0 A;  2GQ0 A;  4DV5 E;  4JI0 E;  4NXN E;  3V2U C;  1FWK A;  4DUZ I;  2HHH I;  1Z5C A;  4YHH E;  1ZXN A;  4KHP E;  4OX9 I;  4GKK E;  3D4J A;  1IBK E;  3J7A M;  4DV0 E;  4DR3 E;  1KVK A;  4DUY I;  4FW9 A;  2EFG A;  3QT8 A;  3JAM C;  4DR2 I;  3J81 C;  5LMU I;  1USU A;  2HK2 A;  4DR6 E;  1MX0 A;  1Y4S A;  3WU5 A;  1PVG A;  1PKP A;  1HNZ E;  2PNM A;  1ZXM A;  4X65 I;  4LF4 E;  2A2D A;  1FKA E;  1H7S A;  1USV A;  4DXL A;  1EI1 A;  4JV5 I;  1S4E A;  1QZR A;  1ZM9 A;  4HY1 A;  4X62 I;  1B63 A;  1I94 I;  4DR1 E;  4PRX A;  5IWA I;  1Z5A A;  1N33 I;  2VQE I;  4DUZ E;  1BKN A;  2J7K A;  3PYD A;  2HHH E;  3B8H A;  2ZM6 E;  4OX9 E;  5IT9 C;  4B3R I;  4IZJ A;  1Z5B A;  1KIJ A;  4DUY E;  4AQY I;  2ZIT A;  1U2R A;  4JI1 I;  5A2Q C;  4DR2 E;  5LMU E;  1HR0 I;  4JI0 I;  1D6T A;  4JI8 I;  4LF7 I;  4JI3 I;  3B78 A;  3JAM Q;  3J81 Q;  2UUA I;  4I3H A;  4JI6 I;  4Z7Y A;  4HAC A;  4X65 E;  1IBK I;  3Q6M A;  1NZ0 A;  5LL6 R;  3T1H I;  1PIE A;  4MYU A;  1IBL I;  4JG4 A;  3H4L A;  3WU6 A;  4JV5 E;  1NHH A;  4DU8 A;  4X62 E;  3M6A A;  2DEI A;  1I94 E;  1ZM3 A;  4B3M I;  1K47 A;  5GME A;  4DPT A;  5IWA E;  4LF9 I;  2HFS A;  4IZJ B;  3ZZT A;  1IBM I;  4DV6 I;  1N33 E;  2VQE E;  1J5E E;  4LF6 I;  1H72 C;  3LNU A;  4B3R E;  4JI7 I;  4AQY E;  3GON A;  2X7I A;  1HNX E;  5IT9 Q;  1HR0 E;  4R1F A;  3ZZU A;  1XHK A;  4JI8 E;  4LF7 E;  1H7U A;  4JI3 E;  3ZKD A;  5A2Q Q;  4LFB I;  4IZK A;  2VQF I;  2UU9 I;  2UUA E;  2ZM6 I;  4WUD A;  4JI6 E;  2LJP A;  4FWH A;  4JI4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...