2UXCI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcI00
4P52A 3B8HA 3T1HI 4LFAI 1FKAE 4B3SE 2HKEA 2V2ZA 3OTOI 2V2VA 3JAMQ 2X7IA 4USMA 1N32I 3F0NA 1HNXE 4K0KI 3LTOA 4DV7I 3K1JA 2HK3A 4JI2E 5FLXQ 4B3TE 4LF5I 2GS8A 1ZM2A 4JI8I 1H74A 3ZM7A 4DV5E 4JI6E 1IBLI 4LF6E 4B3SI 1HNXI 4UT4A 3ZKBA 3QT8A 2VQFE 1NHHA 2A2DA 1N34E 2LJPA 2ZM6E 4B3TI 1ZM4A 4DUYE 4UTGA 5IT9Q 1RREA 4LF7E 4DV5I 4JI6I 1XMOE 3HULA 4LF6I 2UUBE 2WW4A 3V5RA 3T1YE 4DR4E 4DV1E 3V2UC 1KTVA 1Z5BA 2VQFI 1N34I 3M6AA 1NZ0A 4FW9A 4FWHA 4DUYI 4JV5E 4LF7I 1S4EA 1I94E 4DR2E 1N36E 2ZBKB 1PVGA 3LPSA 1XMOI 4X65E 1FI4A 4Z7CA 2E5LE 2UUBI 3T1YI 4DR4I 4DV1I 4DR5E 1Z0VA 5LL6R 4DR3E 3QT5A 2DEJA 4DPUA 4KQVA 4JV5I 1I94I 1MG7A 4DR2I 4HY1A 3ZKDA 1N36I 2HHHE 4X65I 4JI4E 4DV2E 2E5LI 1Z0WA 2BV3A 3J7AG 4HACB 4NXME 1IBME 3WU6A 4DR5I 4DR3I 2EFGA 2OI2A 3JAMC 4HYMA 3J80Q 1S16A 2VQEE 4WUBA 2V34A 3K17A 1H72C 2HHHI 4DPTA 5A2QC 4JI4I 4EMDA 4DV2I 1J5EE 2A2CA 1VISA 4GKKE 4X64E 4LF9E 1FWKA 3PYEA 4NXMI 5L3JA 1IBMI 1EA6A 3B78A 4WUCA 3ZZUA 3J7AM 1H7UA 2V2QA 4B3ME 1DARA 2VQEI 4PU9A 3PYGA 4DXLA 3B82A 4DU8A 3Q1QA 1FWLA 5IT9C 1N33E 1J5EI 4GKKI 4X64I 4LF9I 2UUAE 2HK2A 1Z0BA 2BM0A 3H4LA 2UUCE 1B62A 4X62E 1UEKA 2DEIA 3CWVA 4DR1E 2Q2EB 4Z7YA 1HR0E 1PKPA 4B3MI 4DV4E 4HACA 2UXDE 4LF8E 3WU5A 2J7KA 1Z5AA 1N33I 4DU7A 4JI3E 2UUAI 1NHJA 2NPFA 4DUZE 1RR9A 1Z0EA 2UUCI 4X62I 4DR1I 4DPXA 3QT6A 4JI0E 1HR0I 1XHKA 4P7AA 4OX9E 2UXBE 2UXCE 4JI5E 4FWGA 1XNQE 2BM1A 4DV4I 4ED4A 2UXDI 3J81C 1BKNA 4LF8I 1K47A 3GONA 1H7SA 1D6TA 4DV6E 1NHIA 4JI3I 4DUZI 1QZRA 1ZM3A 1B63A 1ZM9A 4JI1E 4WUDA 2F4VI 4DV0I 4DR6E 4JI0I 4OX9I 2UXBI 2UXCI 4JI5I 4FN5A 3ZZ0A 1XNQI 4AQYE 2ZITA 4RPFA 1N0VC 5FLXC 1Z5CA 4X66E 3J80C 4MYUA 4DV6I 1ZXNA 1XNRE 1KVKA 5IWAE 4JI1I 4ZVIA 4FWDA 2HKJA 1H73A 4XTJA 5A2QQ 1MX0A 1Z0TA 4DR6I 4R1FA 1FJGE 4PRXA 4URLA 4AQYI 1ELOA 4DR7E 5GMEA 3LNUA 2AJ4A 5BR8E 4HXZA 4X66I 4JYAE 3ZZTA 5LMNE 1HNZE 5LMUE 1XNRI 4JI2I 5IWAI 1ZXMA 4LFBE 4I3HA 4MYTA 4LF4E 1FJGI 2CZ9A 1Z0CA 4KHPE 2R42A 4NXNE 5GMDA 4DR7I 5BR8I 4YY3E 1HNWE 4LFCE 4B3RE 4DV3E 4JYAI 5LMNI 1HNZI 5LMUI 4GKJE 1KIJA 4LFBI 2ZM6I 1N0UA 2UU9E 2VF3A 2V8PA 2F4VE 1XMQE 4DV0E 1MU5A 4LF4I 4JI7E 3WU4A 1EI1A 4YHHE 1U2RA 1IBKE 3PYDA 1OJ4A 1WUUA 4KHPI 1KKHA 1PIEA 1FNMA 2R3VA 4M1KA 4NXNI 4YY3I 4USKA 3T1HE 4LFAE 1HNWI 4LFCI 4B3RI 1Z0GA 4DV3I 1A6FA 3D4JA 3OTOE 2XEXA 4GKJI 1N32E 4K0KE 3J81Q 4DPWA 4DV7E 3QT7A 1Z59A 2UU9I 4LF5E 1XMQI 2HFSA 4JI7I 4PRVA 2X36A 4YHHI 2HFUA 1IBKI 2E1RA 4JI8E 4DPYA 3WU3A 4JG4A 3PYFA 1IBLE
chains in the Genus database with same CATH superfamily
4P52A 4OO1E 3B8HA 3T1HI 4LFAI 4BA2A 2O1UA 1FKAE 5JEAA 4B3SE 2HKEA 2V2ZA 3OTOI 2V2VA 3JAMQ 2X7IA 4U3DA 4USMA 1E3PA 3PS1A 4IZJA 1N32I 3F0NA 1HNXE 4K0KI 3LTOA 1R6MA 4DV7I 3K1JA 2HK3A 2C38B 4JI2E 2JE6B 5FLXQ 4B3TE 2JT2A 4LF5I 2BA1G 2GS8A 2O1VA 1ZM2A 2Z5EA 4AIMA 4JI8I 1H74A 2BA1D 3ZM7A 4DV5E 4JI6E 1IBLI 4LF6E 3Q6NA 4J3DA 4B3SI 2PNMA 2VESA 4IFDD 1HNXI 2GO3A 2C37A 4UT4A 3ZKBA 1OYPA 3QT8A 2VQFE 1NHHA 2BA0G 2A2DA 1N34E 2LJPA 2ZM6E 4B3TI 2PO0A 1ZM4A 1RHYA 2BA0D 4UTGA 4DUYE 4OO1D 5IT9Q 1RREA 1Y4UA 3PS3A 4LF7E 2PO2B 4DV5I 4AM3A 4JI6I 2Z5CB 1XMOE 3HULA 4OO1A 4LF6I 2GQ0A 4FW6A 2WW4A 4FW7A 2UUBE 1OYSA 3V5RA 3T1YE 3L7ZA 4MU3A 5EL9A 4DR4E 4DV1E 4IFDF 3V2UC 1KTVA 1YH8A 1Z5BA 2VQFI 3GLLA 1N34I 1UDQA 3P76A 2BR2B 4LCGA 3M6AA 1NZ0A 4FW9A 4FWHA 4DUYI 1XXEA 2PO1B 4JV5E 4LF7I 2GO4A 1S4EA 1I94E 4DR2E 1N36E 2ZBKB 1PVGA 3LPSA 1XMOI 2C38A 1FI4A 4X65E 2JE6A 4Z7CA 3M85D 2E5LE 2Z5BB 2JEAB 2UUBI 4LPFA 3T1YI 2CG9A 1UDOA 4DR4I 4DV1I 4DR5E 1Z0VA 5LL6R 3HKMA 4DR3E 3QT5A 2DEJA 1IBLE 4DPUA 2AE8A 4KQVA 4JV5I 1I94I 3U1KA 1MG7A 4DR2I 4HY1A 3ZKDA 1N36I 2PNZA 2NN6F 4X65I 2HHHE 5EKWA 4MU1A 4JI4E 4DV2E 2E5LI 1Z0WA 2BV3A 2JEBB 3J7AG 4HACB 4NXME 1IBME 4OKGA 3WU6A 2PO2A 4DR5I 4DR3I 4MU0A 2Z5CA 2EFGA 2CGEA 5C0XF 2OI2A 3JAMC 4HYMA 3UHMA 3J80Q 1S16A 2VQEE 4WUBA 5JEAF 2V34A 4IZKA 4U3BA 3K17A 3PS2A 4BA1A 1H72C 4LCFA 2HHHI 4DPTA 5A2QC 1UDSA 4JI4I 4EMDA 4DV2I 2BR2A 1J5EE 2A2CA 1VISA 4GKKE 4X64E 4LF9E 1FWKA 3PYEA 5K36C 2PO1A 4NXMI 2IOQA 5L3JA 1IBMI 1EA6A 3B78A 5K36B 4ISAA 4WUCA 3ZZUA 3J7AM 1H7UA 2V2QA 4B3ME 2JEAA 1DARA 3P3EA 1P42A 2VQEI 1Y5YA 4PU9A 3PYGA 4IS9A 4DXLA 3B82A 2O1TA 4DU8A 3Q1QA 1FWLA 5IT9C 1N33E 5ELWA 1J5EI 4GKKI 2WNRB 4X64I 4LF9I 2UUAE 2HK2A 1Z0BA 2BM0A 3H4LA 2UUCE 4BA2B 3B4TA 5DNLA 1B62A 1UEKA 4X62E 3P06A 5DNXA 2DEIA 3CWVA 4DR1E 2Q2EB 3GMEA 4Z7YA 4AIDA 1HR0E 1PKPA 3CDIA 4B3MI 3P3CA 4MDTA 4OO1F 2J65A 1Y4SA 1Y6ZA 4DV4E 4HACA 2UXDE 1USVA 4LF8E 3WU5A 2J7KA 1Z5AA 1N33I 3K85A 4DU7A 4JI3E 2PNLA 2IESA 2UUAI 1NHJA 2NPFA 4DUZE 1RR9A 1Z0EA 2UUCI 4X62I 4MU4A 4DR1I 4DPXA 3QT6A 4JI0E 3KRNA 1HR0I 3NZKA 2WP8B 1XHKA 4P7AA 4OX9E 2UXBE 2UXCE 4JI5E 4FWGA 1XNQE 2BM1A 4DV4I 4ED4A 4IFDC 2UXDI 4NBQA 3J81C 1BKNA 2O3ZA 4LF8I 1VI7A 1K47A 3GONA 2CVEA 4IFDB 5K36A 1H7SA 1D6TA 4FW3A 4DV6E 1NHIA 4JI3I 4DUZI 1QZRA 1ZM3A 1B63A 1ZM9A 4OO1B 4JI1E 4WUDA 2F4VI 3PRYA 4DV0I 4DR6E 4JI0I 2IERA 4OX9I 2UXBI 2UXCI 4JI5I 4FN5A 3ZZ0A 1XNQI 4AQYE 2ZITA 4RPFA 2F1DA 1N0VC 5FLXC 1Z5CA 4X66E 3J80C 4MYUA 4DV6I 3U1YA 1E3HA 1ZXNA 3Q6MA 1XNRE 1KVKA 4QNJA 5IWAE 4GQUA 4JI1I 4ZVIA 4FWDA 2HKJA 1H73A 4XTJA 4N3OA 5A2QQ 1MX0A 1Z0TA 4DR6I 2NN6C 4R1FA 1UDNA 1FJGE 4OZEA 3H1CA 4PRXA 4URLA 2NN6B 2Z5BA 4AQYI 1ELOA 4DR7E 5GMEA 3LNUA 2AJ4A 5BR8E 4HXZA 4X66I 5K36E 4JYAE 5C0XC 2WP8A 2C39B 3ZZTA 5LMNE 1HNZE 5LMUE 1XNRI 2NN6E 2IOPA 2PNZB 4JI2I 5JEAC 5IWAI 5C0XB 1ZXMA 4LFBE 4FW4A 4I3HA 4MYTA 5DRRA 5JEAB 4IFDA 4LF4E 1FJGI 4IZJB 5DRQA 2CZ9A 3DD6A 1Z0CA 4KHPE 2R42A 2JEBA 5C0XE 4NXNE 5GMDA 4DR7I 1R6LA 5BR8I 4YY3E 4QNKA 1HNWE 5JEAE 4LFCE 4B3RE 4DV3E 4JYAI 5FWKA 4IZKB 4BA1B 5LMNI 5DROA 1HNZI 5LMUI 4GKJE 1KIJA 1HK7A 4LFBI 2ZM6I 1N0UA 1OYRA 3GCMA 2UU9E 1YHCA 2O1WA 2VF3A 2V8PA 2F4VE 1XMQE 4DV0E 1MU5A 4LF4I 4JI7E 3WU4A 1EI1A 4YHHE 5K36D 1U2RA 2C37B 1IBKE 3PYDA 3M85G 1OJ4A 1WUUA 4KHPI 1KKHA 1PIEA 3M7NG 1FNMA 2R3VA 4M1KA 2NN6D 4NXNI 2PO0B 4YY3I 4USKA 3T1HE 4LFAE 3M7ND 1HNWI 4LFCI 4B3RI 1Z0GA 4DV3I 1A6FA 3D4JA 3OTOE 3CDJA 2XEXA 1USUA 4GKJI 1N32E 4OO1C 4K0KE 3J81Q 2NN6A 4DPWA 4DV7E 4MQYA 3QT7A 3P3GA 1Z59A 4FW5A 2UU9I 5C0XD 5DRPA 1Y60A 4LCHA 1XMQI 4LF5E 3L7ZB 4IFDE 2HFSA 4JI7I 4PRVA 5K36F 2X36A 5JEAD 2HFUA 4YHHI 1IBKI 2E1RA 2C39A 4JI8E 3HJCA 4DPYA 3WU3A 4IZJD 4LOMA 2WNRA 4JG4A 3PYFA 5C0XA
chains in the Genus database with same CATH topology
4P52A 3B8HA 3T1HI 4LFAI 2O1UA 1FKAE 4B3SE 2HKEA 2V2ZA 3OTOI 2V2VA 3JAMQ 2X7IA 4USMA 4IZJA 1N32I 3F0NA 1HNXE 4K0KI 3LTOA 4DV7I 3K1JA 2HK3A 4JI2E 5FLXQ 4B3TE 4LF5I 2GS8A 2O1VA 1ZM2A 2Z5EA 4JI8I 1H74A 3ZM7A 4DV5E 4JI6E 1IBLI 4LF6E 3Q6NA 4B3SI 2PNMA 1HNXI 4UT4A 3ZKBA 3QT8A 2VQFE 1NHHA 2A2DA 1N34E 2LJPA 2ZM6E 4B3TI 1ZM4A 4DUYE 4UTGA 5IT9Q 1RREA 1Y4UA 4LF7E 4DV5I 4JI6I 2Z5CB 1XMOE 3HULA 4LF6I 2GQ0A 2UUBE 2WW4A 3V5RA 3T1YE 4DR4E 4DV1E 3V2UC 1KTVA 1Z5BA 2VQFI 1N34I 3M6AA 1NZ0A 4FW9A 4FWHA 4DUYI 4JV5E 4LF7I 1S4EA 1I94E 4DR2E 1N36E 2ZBKB 1PVGA 3LPSA 1XMOI 4X65E 1FI4A 4Z7CA 2E5LE 2Z5BB 2UUBI 3T1YI 2CG9A 4DR4I 4DV1I 4DR5E 1Z0VA 5LL6R 4DR3E 3QT5A 2DEJA 4DPUA 4KQVA 4JV5I 1I94I 1MG7A 4DR2I 4HY1A 3ZKDA 1N36I 2HHHE 4X65I 4JI4E 4DV2E 2E5LI 1Z0WA 2BV3A 3J7AG 4HACB 4NXME 1IBME 3WU6A 4DR5I 4DR3I 2Z5CA 2EFGA 2CGEA 2OI2A 3JAMC 4HYMA 3J80Q 1S16A 2VQEE 4WUBA 2V34A 4IZKA 3K17A 1H72C 2HHHI 4DPTA 5A2QC 4JI4I 4EMDA 4DV2I 1J5EE 2A2CA 1VISA 4GKKE 4X64E 4LF9E 1FWKA 3PYEA 4NXMI 2IOQA 5L3JA 1IBMI 1EA6A 3B78A 4WUCA 3ZZUA 3J7AM 1H7UA 2V2QA 4B3ME 1DARA 2VQEI 4PU9A 3PYGA 4DXLA 3B82A 2O1TA 4DU8A 3Q1QA 1FWLA 5IT9C 1N33E 1J5EI 4GKKI 4X64I 4LF9I 2UUAE 2HK2A 1Z0BA 2BM0A 3H4LA 2UUCE 1B62A 4X62E 1UEKA 3P06A 2DEIA 3CWVA 4DR1E 2Q2EB 4Z7YA 1HR0E 1PKPA 4B3MI 1Y4SA 1Y6ZA 4DV4E 4HACA 2UXDE 1USVA 4LF8E 3WU5A 2J7KA 1Z5AA 1N33I 3K85A 4DU7A 4JI3E 2PNLA 2UUAI 1NHJA 2NPFA 4DUZE 1RR9A 1Z0EA 2UUCI 4X62I 4DR1I 4DPXA 3QT6A 4JI0E 1HR0I 1XHKA 4P7AA 4OX9E 2UXBE 2UXCE 4JI5E 4FWGA 1XNQE 2BM1A 4DV4I 4ED4A 2UXDI 3J81C 1BKNA 4LF8I 1K47A 3GONA 1H7SA 1D6TA 4DV6E 1NHIA 4JI3I 4DUZI 1QZRA 1ZM3A 1B63A 1ZM9A 4JI1E 4WUDA 2F4VI 3PRYA 4DV0I 4DR6E 4JI0I 4OX9I 2UXBI 2UXCI 4JI5I 4FN5A 3ZZ0A 1XNQI 4AQYE 2ZITA 4RPFA 1N0VC 5FLXC 1Z5CA 4X66E 3J80C 4MYUA 4DV6I 1ZXNA 3Q6MA 1XNRE 1KVKA 5IWAE 4JI1I 4ZVIA 4FWDA 2HKJA 1H73A 4XTJA 4N3OA 5A2QQ 1MX0A 1Z0TA 4DR6I 4R1FA 1FJGE 4PRXA 4URLA 2Z5BA 4AQYI 1ELOA 4DR7E 5GMEA 3LNUA 2AJ4A 5BR8E 4HXZA 4X66I 4JYAE 3ZZTA 5LMNE 1HNZE 5LMUE 1XNRI 2IOPA 4JI2I 5IWAI 1ZXMA 4LFBE 4I3HA 4MYTA 4LF4E 1FJGI 4IZJB 2CZ9A 1Z0CA 4KHPE 2R42A 4NXNE 5GMDA 4DR7I 5BR8I 4YY3E 1HNWE 4LFCE 4B3RE 4DV3E 4JYAI 5FWKA 4IZKB 5LMNI 1HNZI 5LMUI 4GKJE 1KIJA 1HK7A 4LFBI 2ZM6I 1N0UA 2UU9E 2O1WA 2VF3A 2V8PA 2F4VE 1XMQE 4DV0E 1MU5A 4LF4I 4JI7E 3WU4A 1EI1A 4YHHE 1U2RA 1IBKE 3PYDA 1OJ4A 1WUUA 4KHPI 1KKHA 1PIEA 1FNMA 2R3VA 4M1KA 4NXNI 4YY3I 4USKA 3T1HE 4LFAE 1HNWI 4LFCI 4B3RI 1Z0GA 4DV3I 1A6FA 3D4JA 3OTOE 2XEXA 1USUA 4GKJI 1N32E 4K0KE 3J81Q 4DPWA 4DV7E 3QT7A 1Z59A 2UU9I 4LF5E 1XMQI 2HFSA 4JI7I 4PRVA 2X36A 4YHHI 2HFUA 1IBKI 2E1RA 4JI8E 3HJCA 4DPYA 3WU3A 4IZJD 4JG4A 3PYFA 1IBLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P52 A;  3B8H A;  3T1H I;  4LFA I;  1FKA E;  4B3S E;  2HKE A;  2V2Z A;  3OTO I;  2V2V A;  3JAM Q;  2X7I A;  4USM A;  1N32 I;  3F0N A;  1HNX E;  4K0K I;  3LTO A;  4DV7 I;  3K1J A;  2HK3 A;  4JI2 E;  5FLX Q;  4B3T E;  4LF5 I;  2GS8 A;  1ZM2 A;  4JI8 I;  1H74 A;  3ZM7 A;  4DV5 E;  4JI6 E;  1IBL I;  4LF6 E;  4B3S I;  1HNX I;  4UT4 A;  3ZKB A;  3QT8 A;  2VQF E;  1NHH A;  2A2D A;  1N34 E;  2LJP A;  2ZM6 E;  4B3T I;  1ZM4 A;  4DUY E;  4UTG A;  5IT9 Q;  1RRE A;  4LF7 E;  4DV5 I;  4JI6 I;  1XMO E;  3HUL A;  4LF6 I;  2UUB E;  2WW4 A;  3V5R A;  3T1Y E;  4DR4 E;  4DV1 E;  3V2U C;  1KTV A;  1Z5B A;  2VQF I;  1N34 I;  3M6A A;  1NZ0 A;  4FW9 A;  4FWH A;  4DUY I;  4JV5 E;  4LF7 I;  1S4E A;  1I94 E;  4DR2 E;  1N36 E;  2ZBK B;  1PVG A;  3LPS A;  1XMO I;  4X65 E;  1FI4 A;  4Z7C A;  2E5L E;  2UUB I;  3T1Y I;  4DR4 I;  4DV1 I;  4DR5 E;  1Z0V A;  5LL6 R;  4DR3 E;  3QT5 A;  2DEJ A;  4DPU A;  4KQV A;  4JV5 I;  1I94 I;  1MG7 A;  4DR2 I;  4HY1 A;  3ZKD A;  1N36 I;  2HHH E;  4X65 I;  4JI4 E;  4DV2 E;  2E5L I;  1Z0W A;  2BV3 A;  3J7A G;  4HAC B;  4NXM E;  1IBM E;  3WU6 A;  4DR5 I;  4DR3 I;  2EFG A;  2OI2 A;  3JAM C;  4HYM A;  3J80 Q;  1S16 A;  2VQE E;  4WUB A;  2V34 A;  3K17 A;  1H72 C;  2HHH I;  4DPT A;  5A2Q C;  4JI4 I;  4EMD A;  4DV2 I;  1J5E E;  2A2C A;  1VIS A;  4GKK E;  4X64 E;  4LF9 E;  1FWK A;  3PYE A;  4NXM I;  5L3J A;  1IBM I;  1EA6 A;  3B78 A;  4WUC A;  3ZZU A;  3J7A M;  1H7U A;  2V2Q A;  4B3M E;  1DAR A;  2VQE I;  4PU9 A;  3PYG A;  4DXL A;  3B82 A;  4DU8 A;  3Q1Q A;  1FWL A;  5IT9 C;  1N33 E;  1J5E I;  4GKK I;  4X64 I;  4LF9 I;  2UUA E;  2HK2 A;  1Z0B A;  2BM0 A;  3H4L A;  2UUC E;  1B62 A;  4X62 E;  1UEK A;  2DEI A;  3CWV A;  4DR1 E;  2Q2E B;  4Z7Y A;  1HR0 E;  1PKP A;  4B3M I;  4DV4 E;  4HAC A;  2UXD E;  4LF8 E;  3WU5 A;  2J7K A;  1Z5A A;  1N33 I;  4DU7 A;  4JI3 E;  2UUA I;  1NHJ A;  2NPF A;  4DUZ E;  1RR9 A;  1Z0E A;  2UUC I;  4X62 I;  4DR1 I;  4DPX A;  3QT6 A;  4JI0 E;  1HR0 I;  1XHK A;  4P7A A;  4OX9 E;  2UXB E;  2UXC E;  4JI5 E;  4FWG A;  1XNQ E;  2BM1 A;  4DV4 I;  4ED4 A;  2UXD I;  3J81 C;  1BKN A;  4LF8 I;  1K47 A;  3GON A;  1H7S A;  1D6T A;  4DV6 E;  1NHI A;  4JI3 I;  4DUZ I;  1QZR A;  1ZM3 A;  1B63 A;  1ZM9 A;  4JI1 E;  4WUD A;  2F4V I;  4DV0 I;  4DR6 E;  4JI0 I;  4OX9 I;  2UXB I;  2UXC I;  4JI5 I;  4FN5 A;  3ZZ0 A;  1XNQ I;  4AQY E;  2ZIT A;  4RPF A;  1N0V C;  5FLX C;  1Z5C A;  4X66 E;  3J80 C;  4MYU A;  4DV6 I;  1ZXN A;  1XNR E;  1KVK A;  5IWA E;  4JI1 I;  4ZVI A;  4FWD A;  2HKJ A;  1H73 A;  4XTJ A;  5A2Q Q;  1MX0 A;  1Z0T A;  4DR6 I;  4R1F A;  1FJG E;  4PRX A;  4URL A;  4AQY I;  1ELO A;  4DR7 E;  5GME A;  3LNU A;  2AJ4 A;  5BR8 E;  4HXZ A;  4X66 I;  4JYA E;  3ZZT A;  5LMN E;  1HNZ E;  5LMU E;  1XNR I;  4JI2 I;  5IWA I;  1ZXM A;  4LFB E;  4I3H A;  4MYT A;  4LF4 E;  1FJG I;  2CZ9 A;  1Z0C A;  4KHP E;  2R42 A;  4NXN E;  5GMD A;  4DR7 I;  5BR8 I;  4YY3 E;  1HNW E;  4LFC E;  4B3R E;  4DV3 E;  4JYA I;  5LMN I;  1HNZ I;  5LMU I;  4GKJ E;  1KIJ A;  4LFB I;  2ZM6 I;  1N0U A;  2UU9 E;  2VF3 A;  2V8P A;  2F4V E;  1XMQ E;  4DV0 E;  1MU5 A;  4LF4 I;  4JI7 E;  3WU4 A;  1EI1 A;  4YHH E;  1U2R A;  1IBK E;  3PYD A;  1OJ4 A;  1WUU A;  4KHP I;  1KKH A;  1PIE A;  1FNM A;  2R3V A;  4M1K A;  4NXN I;  4YY3 I;  4USK A;  3T1H E;  4LFA E;  1HNW I;  4LFC I;  4B3R I;  1Z0G A;  4DV3 I;  1A6F A;  3D4J A;  3OTO E;  2XEX A;  4GKJ I;  1N32 E;  4K0K E;  3J81 Q;  4DPW A;  4DV7 E;  3QT7 A;  1Z59 A;  2UU9 I;  4LF5 E;  1XMQ I;  2HFS A;  4JI7 I;  4PRV A;  2X36 A;  4YHH I;  2HFU A;  1IBK I;  2E1R A;  4JI8 E;  4DPY A;  3WU3 A;  4JG4 A;  3PYF A;  1IBL E; 
#chains in the Genus database with same CATH topology
 4P52 A;  4OO1 E;  3B8H A;  3T1H I;  4LFA I;  4BA2 A;  2O1U A;  1FKA E;  5JEA A;  4B3S E;  2HKE A;  2V2Z A;  3OTO I;  2V2V A;  3JAM Q;  2X7I A;  4U3D A;  4USM A;  1E3P A;  3PS1 A;  4IZJ A;  1N32 I;  3F0N A;  1HNX E;  4K0K I;  3LTO A;  1R6M A;  4DV7 I;  3K1J A;  2HK3 A;  2C38 B;  4JI2 E;  2JE6 B;  5FLX Q;  4B3T E;  2JT2 A;  4LF5 I;  2BA1 G;  2GS8 A;  2O1V A;  1ZM2 A;  2Z5E A;  4AIM A;  4JI8 I;  1H74 A;  2BA1 D;  3ZM7 A;  4DV5 E;  4JI6 E;  1IBL I;  4LF6 E;  3Q6N A;  4J3D A;  4B3S I;  2PNM A;  2VES A;  4IFD D;  1HNX I;  2GO3 A;  2C37 A;  4UT4 A;  3ZKB A;  1OYP A;  3QT8 A;  2VQF E;  1NHH A;  2BA0 G;  2A2D A;  1N34 E;  2LJP A;  2ZM6 E;  4B3T I;  2PO0 A;  1ZM4 A;  1RHY A;  2BA0 D;  4UTG A;  4DUY E;  4OO1 D;  5IT9 Q;  1RRE A;  1Y4U A;  3PS3 A;  4LF7 E;  2PO2 B;  4DV5 I;  4AM3 A;  4JI6 I;  2Z5C B;  1XMO E;  3HUL A;  4OO1 A;  4LF6 I;  2GQ0 A;  4FW6 A;  2WW4 A;  4FW7 A;  2UUB E;  1OYS A;  3V5R A;  3T1Y E;  3L7Z A;  4MU3 A;  5EL9 A;  4DR4 E;  4DV1 E;  4IFD F;  3V2U C;  1KTV A;  1YH8 A;  1Z5B A;  2VQF I;  3GLL A;  1N34 I;  1UDQ A;  3P76 A;  2BR2 B;  4LCG A;  3M6A A;  1NZ0 A;  4FW9 A;  4FWH A;  4DUY I;  1XXE A;  2PO1 B;  4JV5 E;  4LF7 I;  2GO4 A;  1S4E A;  1I94 E;  4DR2 E;  1N36 E;  2ZBK B;  1PVG A;  3LPS A;  1XMO I;  2C38 A;  1FI4 A;  4X65 E;  2JE6 A;  4Z7C A;  3M85 D;  2E5L E;  2Z5B B;  2JEA B;  2UUB I;  4LPF A;  3T1Y I;  2CG9 A;  1UDO A;  4DR4 I;  4DV1 I;  4DR5 E;  1Z0V A;  5LL6 R;  3HKM A;  4DR3 E;  3QT5 A;  2DEJ A;  1IBL E;  4DPU A;  2AE8 A;  4KQV A;  4JV5 I;  1I94 I;  3U1K A;  1MG7 A;  4DR2 I;  4HY1 A;  3ZKD A;  1N36 I;  2PNZ A;  2NN6 F;  4X65 I;  2HHH E;  5EKW A;  4MU1 A;  4JI4 E;  4DV2 E;  2E5L I;  1Z0W A;  2BV3 A;  2JEB B;  3J7A G;  4HAC B;  4NXM E;  1IBM E;  4OKG A;  3WU6 A;  2PO2 A;  4DR5 I;  4DR3 I;  4MU0 A;  2Z5C A;  2EFG A;  2CGE A;  5C0X F;  2OI2 A;  3JAM C;  4HYM A;  3UHM A;  3J80 Q;  1S16 A;  2VQE E;  4WUB A;  5JEA F;  2V34 A;  4IZK A;  4U3B A;  3K17 A;  3PS2 A;  4BA1 A;  1H72 C;  4LCF A;  2HHH I;  4DPT A;  5A2Q C;  1UDS A;  4JI4 I;  4EMD A;  4DV2 I;  2BR2 A;  1J5E E;  2A2C A;  1VIS A;  4GKK E;  4X64 E;  4LF9 E;  1FWK A;  3PYE A;  5K36 C;  2PO1 A;  4NXM I;  2IOQ A;  5L3J A;  1IBM I;  1EA6 A;  3B78 A;  5K36 B;  4ISA A;  4WUC A;  3ZZU A;  3J7A M;  1H7U A;  2V2Q A;  4B3M E;  2JEA A;  1DAR A;  3P3E A;  1P42 A;  2VQE I;  1Y5Y A;  4PU9 A;  3PYG A;  4IS9 A;  4DXL A;  3B82 A;  2O1T A;  4DU8 A;  3Q1Q A;  1FWL A;  5IT9 C;  1N33 E;  5ELW A;  1J5E I;  4GKK I;  2WNR B;  4X64 I;  4LF9 I;  2UUA E;  2HK2 A;  1Z0B A;  2BM0 A;  3H4L A;  2UUC E;  4BA2 B;  3B4T A;  5DNL A;  1B62 A;  1UEK A;  4X62 E;  3P06 A;  5DNX A;  2DEI A;  3CWV A;  4DR1 E;  2Q2E B;  3GME A;  4Z7Y A;  4AID A;  1HR0 E;  1PKP A;  3CDI A;  4B3M I;  3P3C A;  4MDT A;  4OO1 F;  2J65 A;  1Y4S A;  1Y6Z A;  4DV4 E;  4HAC A;  2UXD E;  1USV A;  4LF8 E;  3WU5 A;  2J7K A;  1Z5A A;  1N33 I;  3K85 A;  4DU7 A;  4JI3 E;  2PNL A;  2IES A;  2UUA I;  1NHJ A;  2NPF A;  4DUZ E;  1RR9 A;  1Z0E A;  2UUC I;  4X62 I;  4MU4 A;  4DR1 I;  4DPX A;  3QT6 A;  4JI0 E;  3KRN A;  1HR0 I;  3NZK A;  2WP8 B;  1XHK A;  4P7A A;  4OX9 E;  2UXB E;  2UXC E;  4JI5 E;  4FWG A;  1XNQ E;  2BM1 A;  4DV4 I;  4ED4 A;  4IFD C;  2UXD I;  4NBQ A;  3J81 C;  1BKN A;  2O3Z A;  4LF8 I;  1VI7 A;  1K47 A;  3GON A;  2CVE A;  4IFD B;  5K36 A;  1H7S A;  1D6T A;  4FW3 A;  4DV6 E;  1NHI A;  4JI3 I;  4DUZ I;  1QZR A;  1ZM3 A;  1B63 A;  1ZM9 A;  4OO1 B;  4JI1 E;  4WUD A;  2F4V I;  3PRY A;  4DV0 I;  4DR6 E;  4JI0 I;  2IER A;  4OX9 I;  2UXB I;  2UXC I;  4JI5 I;  4FN5 A;  3ZZ0 A;  1XNQ I;  4AQY E;  2ZIT A;  4RPF A;  2F1D A;  1N0V C;  5FLX C;  1Z5C A;  4X66 E;  3J80 C;  4MYU A;  4DV6 I;  3U1Y A;  1E3H A;  1ZXN A;  3Q6M A;  1XNR E;  1KVK A;  4QNJ A;  5IWA E;  4GQU A;  4JI1 I;  4ZVI A;  4FWD A;  2HKJ A;  1H73 A;  4XTJ A;  4N3O A;  5A2Q Q;  1MX0 A;  1Z0T A;  4DR6 I;  2NN6 C;  4R1F A;  1UDN A;  1FJG E;  4OZE A;  3H1C A;  4PRX A;  4URL A;  2NN6 B;  2Z5B A;  4AQY I;  1ELO A;  4DR7 E;  5GME A;  3LNU A;  2AJ4 A;  5BR8 E;  4HXZ A;  4X66 I;  5K36 E;  4JYA E;  5C0X C;  2WP8 A;  2C39 B;  3ZZT A;  5LMN E;  1HNZ E;  5LMU E;  1XNR I;  2NN6 E;  2IOP A;  2PNZ B;  4JI2 I;  5JEA C;  5IWA I;  5C0X B;  1ZXM A;  4LFB E;  4FW4 A;  4I3H A;  4MYT A;  5DRR A;  5JEA B;  4IFD A;  4LF4 E;  1FJG I;  4IZJ B;  5DRQ A;  2CZ9 A;  3DD6 A;  1Z0C A;  4KHP E;  2R42 A;  2JEB A;  5C0X E;  4NXN E;  5GMD A;  4DR7 I;  1R6L A;  5BR8 I;  4YY3 E;  4QNK A;  1HNW E;  5JEA E;  4LFC E;  4B3R E;  4DV3 E;  4JYA I;  5FWK A;  4IZK B;  4BA1 B;  5LMN I;  5DRO A;  1HNZ I;  5LMU I;  4GKJ E;  1KIJ A;  1HK7 A;  4LFB I;  2ZM6 I;  1N0U A;  1OYR A;  3GCM A;  2UU9 E;  1YHC A;  2O1W A;  2VF3 A;  2V8P A;  2F4V E;  1XMQ E;  4DV0 E;  1MU5 A;  4LF4 I;  4JI7 E;  3WU4 A;  1EI1 A;  4YHH E;  5K36 D;  1U2R A;  2C37 B;  1IBK E;  3PYD A;  3M85 G;  1OJ4 A;  1WUU A;  4KHP I;  1KKH A;  1PIE A;  3M7N G;  1FNM A;  2R3V A;  4M1K A;  2NN6 D;  4NXN I;  2PO0 B;  4YY3 I;  4USK A;  3T1H E;  4LFA E;  3M7N D;  1HNW I;  4LFC I;  4B3R I;  1Z0G A;  4DV3 I;  1A6F A;  3D4J A;  3OTO E;  3CDJ A;  2XEX A;  1USU A;  4GKJ I;  1N32 E;  4OO1 C;  4K0K E;  3J81 Q;  2NN6 A;  4DPW A;  4DV7 E;  4MQY A;  3QT7 A;  3P3G A;  1Z59 A;  4FW5 A;  2UU9 I;  5C0X D;  5DRP A;  1Y60 A;  4LCH A;  1XMQ I;  4LF5 E;  3L7Z B;  4IFD E;  2HFS A;  4JI7 I;  4PRV A;  5K36 F;  2X36 A;  5JEA D;  2HFU A;  4YHH I;  1IBK I;  2E1R A;  2C39 A;  4JI8 E;  3HJC A;  4DPY A;  3WU3 A;  4IZJ D;  4LOM A;  2WNR A;  4JG4 A;  3PYF A;  5C0X A; 
#chains in the Genus database with same CATH homology
 4P52 A;  3B8H A;  3T1H I;  4LFA I;  2O1U A;  1FKA E;  4B3S E;  2HKE A;  2V2Z A;  3OTO I;  2V2V A;  3JAM Q;  2X7I A;  4USM A;  4IZJ A;  1N32 I;  3F0N A;  1HNX E;  4K0K I;  3LTO A;  4DV7 I;  3K1J A;  2HK3 A;  4JI2 E;  5FLX Q;  4B3T E;  4LF5 I;  2GS8 A;  2O1V A;  1ZM2 A;  2Z5E A;  4JI8 I;  1H74 A;  3ZM7 A;  4DV5 E;  4JI6 E;  1IBL I;  4LF6 E;  3Q6N A;  4B3S I;  2PNM A;  1HNX I;  4UT4 A;  3ZKB A;  3QT8 A;  2VQF E;  1NHH A;  2A2D A;  1N34 E;  2LJP A;  2ZM6 E;  4B3T I;  1ZM4 A;  4DUY E;  4UTG A;  5IT9 Q;  1RRE A;  1Y4U A;  4LF7 E;  4DV5 I;  4JI6 I;  2Z5C B;  1XMO E;  3HUL A;  4LF6 I;  2GQ0 A;  2UUB E;  2WW4 A;  3V5R A;  3T1Y E;  4DR4 E;  4DV1 E;  3V2U C;  1KTV A;  1Z5B A;  2VQF I;  1N34 I;  3M6A A;  1NZ0 A;  4FW9 A;  4FWH A;  4DUY I;  4JV5 E;  4LF7 I;  1S4E A;  1I94 E;  4DR2 E;  1N36 E;  2ZBK B;  1PVG A;  3LPS A;  1XMO I;  4X65 E;  1FI4 A;  4Z7C A;  2E5L E;  2Z5B B;  2UUB I;  3T1Y I;  2CG9 A;  4DR4 I;  4DV1 I;  4DR5 E;  1Z0V A;  5LL6 R;  4DR3 E;  3QT5 A;  2DEJ A;  4DPU A;  4KQV A;  4JV5 I;  1I94 I;  1MG7 A;  4DR2 I;  4HY1 A;  3ZKD A;  1N36 I;  2HHH E;  4X65 I;  4JI4 E;  4DV2 E;  2E5L I;  1Z0W A;  2BV3 A;  3J7A G;  4HAC B;  4NXM E;  1IBM E;  3WU6 A;  4DR5 I;  4DR3 I;  2Z5C A;  2EFG A;  2CGE A;  2OI2 A;  3JAM C;  4HYM A;  3J80 Q;  1S16 A;  2VQE E;  4WUB A;  2V34 A;  4IZK A;  3K17 A;  1H72 C;  2HHH I;  4DPT A;  5A2Q C;  4JI4 I;  4EMD A;  4DV2 I;  1J5E E;  2A2C A;  1VIS A;  4GKK E;  4X64 E;  4LF9 E;  1FWK A;  3PYE A;  4NXM I;  2IOQ A;  5L3J A;  1IBM I;  1EA6 A;  3B78 A;  4WUC A;  3ZZU A;  3J7A M;  1H7U A;  2V2Q A;  4B3M E;  1DAR A;  2VQE I;  4PU9 A;  3PYG A;  4DXL A;  3B82 A;  2O1T A;  4DU8 A;  3Q1Q A;  1FWL A;  5IT9 C;  1N33 E;  1J5E I;  4GKK I;  4X64 I;  4LF9 I;  2UUA E;  2HK2 A;  1Z0B A;  2BM0 A;  3H4L A;  2UUC E;  1B62 A;  4X62 E;  1UEK A;  3P06 A;  2DEI A;  3CWV A;  4DR1 E;  2Q2E B;  4Z7Y A;  1HR0 E;  1PKP A;  4B3M I;  1Y4S A;  1Y6Z A;  4DV4 E;  4HAC A;  2UXD E;  1USV A;  4LF8 E;  3WU5 A;  2J7K A;  1Z5A A;  1N33 I;  3K85 A;  4DU7 A;  4JI3 E;  2PNL A;  2UUA I;  1NHJ A;  2NPF A;  4DUZ E;  1RR9 A;  1Z0E A;  2UUC I;  4X62 I;  4DR1 I;  4DPX A;  3QT6 A;  4JI0 E;  1HR0 I;  1XHK A;  4P7A A;  4OX9 E;  2UXB E;  2UXC E;  4JI5 E;  4FWG A;  1XNQ E;  2BM1 A;  4DV4 I;  4ED4 A;  2UXD I;  3J81 C;  1BKN A;  4LF8 I;  1K47 A;  3GON A;  1H7S A;  1D6T A;  4DV6 E;  1NHI A;  4JI3 I;  4DUZ I;  1QZR A;  1ZM3 A;  1B63 A;  1ZM9 A;  4JI1 E;  4WUD A;  2F4V I;  3PRY A;  4DV0 I;  4DR6 E;  4JI0 I;  4OX9 I;  2UXB I;  2UXC I;  4JI5 I;  4FN5 A;  3ZZ0 A;  1XNQ I;  4AQY E;  2ZIT A;  4RPF A;  1N0V C;  5FLX C;  1Z5C A;  4X66 E;  3J80 C;  4MYU A;  4DV6 I;  1ZXN A;  3Q6M A;  1XNR E;  1KVK A;  5IWA E;  4JI1 I;  4ZVI A;  4FWD A;  2HKJ A;  1H73 A;  4XTJ A;  4N3O A;  5A2Q Q;  1MX0 A;  1Z0T A;  4DR6 I;  4R1F A;  1FJG E;  4PRX A;  4URL A;  2Z5B A;  4AQY I;  1ELO A;  4DR7 E;  5GME A;  3LNU A;  2AJ4 A;  5BR8 E;  4HXZ A;  4X66 I;  4JYA E;  3ZZT A;  5LMN E;  1HNZ E;  5LMU E;  1XNR I;  2IOP A;  4JI2 I;  5IWA I;  1ZXM A;  4LFB E;  4I3H A;  4MYT A;  4LF4 E;  1FJG I;  4IZJ B;  2CZ9 A;  1Z0C A;  4KHP E;  2R42 A;  4NXN E;  5GMD A;  4DR7 I;  5BR8 I;  4YY3 E;  1HNW E;  4LFC E;  4B3R E;  4DV3 E;  4JYA I;  5FWK A;  4IZK B;  5LMN I;  1HNZ I;  5LMU I;  4GKJ E;  1KIJ A;  1HK7 A;  4LFB I;  2ZM6 I;  1N0U A;  2UU9 E;  2O1W A;  2VF3 A;  2V8P A;  2F4V E;  1XMQ E;  4DV0 E;  1MU5 A;  4LF4 I;  4JI7 E;  3WU4 A;  1EI1 A;  4YHH E;  1U2R A;  1IBK E;  3PYD A;  1OJ4 A;  1WUU A;  4KHP I;  1KKH A;  1PIE A;  1FNM A;  2R3V A;  4M1K A;  4NXN I;  4YY3 I;  4USK A;  3T1H E;  4LFA E;  1HNW I;  4LFC I;  4B3R I;  1Z0G A;  4DV3 I;  1A6F A;  3D4J A;  3OTO E;  2XEX A;  1USU A;  4GKJ I;  1N32 E;  4K0K E;  3J81 Q;  4DPW A;  4DV7 E;  3QT7 A;  1Z59 A;  2UU9 I;  4LF5 E;  1XMQ I;  2HFS A;  4JI7 I;  4PRV A;  2X36 A;  4YHH I;  2HFU A;  1IBK I;  2E1R A;  4JI8 E;  3HJC A;  4DPY A;  3WU3 A;  4IZJ D;  4JG4 A;  3PYF A;  1IBL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...