2UXCI

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uxcI00
3J80Q 4LF9I 3WU4A 1N36I 1VISA 4JI2I 5LL6R 2HKJA 4XTJA 4LFCE 4DU8A 3OTOI 1XMOE 1EA6A 2ZBKB 4PRVA 2UUAE 2ZM6E 4DV2E 3D4JA 1NHJA 4LF4E 1N32I 4LF6E 3LNUA 1OJ4A 4NXNI 4KHPI 1H73A 4JI6I 4P7AA 4LF7E 3Q1QA 4DR2E 2E1RA 2UUBE 4YHHE 1BKNA 3WU6A 4R1FA 4B3SE 3GONA 4RPFA 4DPWA 4B3TE 1H7UA 4HXZA 3ZZTA 4DV0E 1D6TA 4LFCI 1ZXMA 4LF5I 4DV7E 3PYGA 4FWHA 1XMOI 4B3RE 2A2DA 4DPTA 2ZM6I 2EFGA 4DV2I 4LF4I 4LF6I 4ZVIA 3B78A 1Z5CA 4X65E 1I94E 5FLXC 2VQFE 4LF7I 1J5EE 2DEIA 1H7SA 4DR2I 4USMA 2UUBI 3F0NA 4DUYE 4YHHI 2V8PA 1ZM4A 4B3SI 4DUZE 4AQYE 4B3TI 4Z7YA 2NPFA 1K47A 1FNMA 3T1HE 4DV0I 3J7AG 4DR1E 4JV5E 2DEJA 4DV7I 1FWKA 4B3RI 3QT6A 1KVKA 3QT8A 5IT9C 4X65I 1I94I 1NHHA 1XNQE 3WU5A 2HFSA 5IT9Q 2HK3A 2LJPA 2VQFI 1J5EI 4DV1E 1N33E 1PKPA 3ZKBA 1RR9A 2VF3A 4MYTA 4DUYI 2HK2A 4FWDA 1ZM2A 4HACA 1Z0BA 4JI8I 4DPUA 4KQVA 2UU9I 2ZITA 3ZM7A 4DUZI 4DV5I 1PVGA 1Z0TA 1ZXNA 4M1KA 4AQYI 4DR6E 2F4VE 1HNZE 2R3VA 1KTVA 3T1HI 2VQEE 4DR1I 4DR5I 4B3ME 4JI4E 4HACB 4X66E 2J7KA 2V2VA 1MX0A 1HR0E 2BM0A 4DR4E 1XMQE 2V2ZA 1FWLA 3ZZUA 5LMUE 4MYUA 4X62I 4Z7CA 1EI1A 4DV1I 1N33I 1FKAE 4FWGA 4ED4A 5IWAE 1U2RA 3K17A 1KIJA 1IBKI 5BR8E 3T1YI 2UUCE 2V34A 4GKJE 4JG4A 1IBME 2HHHI 1QZRA 4YY3E 4DR6I 2R42A 4LFAE 1HNZI 1Z0WA 3H4LA 4JI5E 2VQEI 4JI4I 1S4EA 3CWVA 4HY1A 1Z0CA 2UUAI 1N0UA 1N0VC 2OI2A 1DARA 1HR0I 4EMDA 1XMQI 3B82A 1IBLE 4PU9A 5LMUI 4JI7E 1H74A 1B62A 4DU7A 3QT7A 5IWAI 1ELOA 5BR8I 1Z5AA 4P52A 1IBMI 3V5RA 4YY3I 4LFAI 4JI5I 1H72C 2E5LE 4WUDA 4UTGA 1Z0VA 2HKEA 2X7IA 2X36A 3LPSA 4JI1E 3QT5A 4URLA 1IBLI 1RREA 1Z0GA 2V2QA 4PRXA 4JI2E 4JI7I 4K0KE 2UXBE 4FW9A 4DR3E 3J81C 5A2QQ 4LF8E 3PYFA 2UXCE 4DPXA 1XNRE 3PYDA 3J81Q 4JI6E 1UEKA 1B63A 1ZM9A 1KKHA 4JV5I 3ZZ0A 2BM1A 1A6FA 4LFBE 4DR7E 2WW4A 4DV3E 3HULA 3J7AM 1XNQI 4OX9E 1HNXE 4USKA 4K0KI 3WU3A 4LF5E 3JAMC 2UXBI 1NHIA 4JI3E 4DR3I 4FN5A 4LF8I 1WUUA 2UXCI 3JAMQ 1XNRI 2F4VI 1Z5BA 4JI0E 3LTOA 4B3MI 1HNWE 1N34E 4X66I 4LFBI 4DR7I 3PYEA 4DR4I 4DV3I 4WUBA 4JYAE 4OX9I 1HNXI 3B8HA 5L3JA 1FJGE 4WUCA 2A2CA 4JI3I 3M6AA 2UUCI 4GKJI 3V2UC 4DV4E 3K1JA 1ZM3A 3ZKDA 5LMNE 4DV6E 4GKKE 5GMDA 4NXME 2UXDE 4JI0I 4UT4A 1HNWI 1S16A 4X64E 1N34I 1Z59A 4DXLA 5FLXQ 4HYMA 4JI8E 2XEXA 2UU9E 4JYAI 4DV5E 4LF9E 1MU5A 2GS8A 1N36E 4DPYA 2HFUA 5A2QC 4DR5E 2BV3A 4I3HA 3OTOE 1FJGI 2AJ4A 1N32E 4DV4I 1PIEA 1NZ0A 2Q2EB 4NXNE 4KHPE 5LMNI 4DV6I 2CZ9A 1FI4A 4GKKI 1MG7A 4NXMI 5GMEA 4X62E 2UXDI 2E5LI 4X64I 3J80C 1IBKE 1Z0EA 4JI1I 3T1YE 1XHKA 2HHHE
chains in the Genus database with same CATH superfamily
3PRYA 3J80Q 4LF9I 3WU4A 2O1WA 5C0XD 1N36I 2JT2A 1VISA 4JI2I 5LL6R 1YH8A 2HKJA 4XTJA 4LFCE 1OYSA 4DU8A 3OTOI 1XMOE 1EA6A 2ZBKB 4PRVA 2UUAE 3CDIA 2ZM6E 4DV2E 4NBQA 3D4JA 1NHJA 4LF4E 1N32I 4LF6E 3LNUA 5C0XE 1OJ4A 5DNXA 4IS9A 4NXNI 4U3DA 4KHPI 1H73A 4IFDF 4JI6I 4P7AA 4LF7E 4IZJA 2PO0A 3Q1QA 5K36D 4DR2E 2E1RA 2UUBE 3B4TA 4YHHE 1BKNA 3WU6A 2NN6F 4R1FA 4B3SE 3GONA 4RPFA 4DPWA 4B3TE 2Z5BB 5K36E 1H7UA 4HXZA 4IZJB 2PO0B 1P42A 3ZZTA 4DV0E 1D6TA 4LFCI 2NN6B 1ZXMA 1RHYA 4LF5I 4DV7E 3PYGA 2BR2B 4FWHA 3U1KA 1XMOI 1HK7A 4B3RE 3P3EA 2A2DA 2WNRA 4DPTA 2ZM6I 2EFGA 4DV2I 2JEBA 4LOMA 1UDNA 4LF4I 4LF6I 4ZVIA 1Y5YA 3B78A 1Z5CA 4BA1B 4X65E 1I94E 1Y60A 4MU4A 4LCFA 5FLXC 2VQFE 4MU1A 4LF7I 1J5EE 2DEIA 1H7SA 5DNLA 4DR2I 4USMA 2NN6D 2UUBI 3F0NA 2WNRB 2IOQA 4DUYE 2JEBB 4YHHI 3K85A 2V8PA 1ZM4A 4MDTA 2PNMA 4B3SI 4DUZE 2BA0G 3M7ND 4AQYE 4B3TI 4Z7YA 2NPFA 1UDOA 1K47A 1FNMA 5C0XA 2J65A 2WP8A 2NN6E 4DV0I 3T1HE 2C38A 3J7AG 4DR1E 4FW6A 5JEAF 4JV5E 2DEJA 4DV7I 1FWKA 4B3RI 3QT6A 1KVKA 3GMEA 3QT8A 5IT9C 4QNKA 5ELWA 4X65I 1I94I 1Y4SA 2F1DA 1NHHA 1XNQE 3WU5A 5C0XB 2HFSA 2WP8B 5EL9A 2IOPA 5IT9Q 2HK3A 2LJPA 4LCHA 2C38B 2VQFI 1J5EI 3PS2A 4FW4A 4DV1E 1N33E 2JEAA 1PKPA 3ZKBA 5K36A 1RR9A 2AE8A 2VF3A 4MYTA 4DUYI 2HK2A 4FWDA 1ZM2A 4HACA 1Y4UA 1Z0BA 4JI8I 4DPUA 4KQVA 2UU9I 2Z5CA 2ZITA 3ZM7A 4OZEA 4DUZI 4DV5I 1PVGA 1Z0TA 1ZXNA 4M1KA 4AQYI 4DR6E 2F4VE 1HNZE 3DD6A 2R3VA 2JEAB 1KTVA 3T1HI 2VQEE 5K36B 4DR1I 4DR5I 4FW5A 4B3ME 4JI4E 4HACB 4U3BA 4X66E 2J7KA 2V2VA 2Z5CB 4OO1A 1MX0A 1HR0E 1OYPA 2BM0A 3HKMA 4DR4E 1XMQE 2V2ZA 4OO1F 4BA2A 4IFDA 1FWLA 2O1UA 3P3GA 2Z5BA 4FW7A 3ZZUA 5LMUE 4MYUA 4X62I 4Z7CA 1EI1A 4DV1I 1N33I 1FKAE 5FWKA 4FWGA 2C39B 4ED4A 5IWAE 1U2RA 2NN6A 3K17A 4OO1B 1KIJA 1IBKI 2BR2A 5BR8E 3T1YI 2UUCE 2V34A 4N3OA 4GKJE 4JG4A 1IBME 4BA2B 2HHHI 4IFDB 3P06A 1QZRA 4YY3E 4BA1A 1YHCA 2CG9A 4DR6I 2R42A 4LFAE 1HNZI 1Z0WA 3H4LA 4JI5E 2VQEI 2IERA 3M7NG 4JI4I 1S4EA 3CWVA 1UDSA 1Z0CA 4HY1A 1N0UA 2UUAI 3L7ZA 1N0VC 5C0XC 3P3CA 4OO1D 2OI2A 1DARA 1HR0I 4EMDA 1XMQI 3B82A 4IFDD 1IBLE 2PNLA 2BA1D 4PU9A 5LMUI 2C37A 4JI7E 1H74A 3HJCA 4OO1E 1B62A 3L7ZB 3QT7A 4DU7A 1ELOA 5IWAI 5BR8I 1Z5AA 4P52A 4IFDE 1E3HA 1IBMI 5K36C 3V5RA 4YY3I 2C37B 4LFAI 4AIDA 4JI5I 1H72C 2GO4A 4MU0A 5JEAA 2E5LE 4WUDA 4UTGA 1USVA 1Z0VA 5DRRA 2HKEA 4AIMA 2X7IA 2X36A 4J3DA 3LPSA 4JI1E 3QT5A 4URLA 1IBLI 1RREA 5JEAB 1Z0GA 2V2QA 4OO1C 4PRXA 4JI2E 4JI7I 4K0KE 3M85G 4IFDC 2UXBE 4MQYA 4FW9A 4DR3E 3J81C 5A2QQ 4LF8E 3PS3A 3PYFA 2UXCE 4DPXA 3Q6MA 1R6MA 1XNRE 3PYDA 2NN6C 5JEAD 3J81Q 4JI6E 1UEKA 1B63A 1ZM9A 1KKHA 4JV5I 3ZZ0A 2C39A 4GQUA 2BM1A 1A6FA 4LFBE 4LCGA 4DR7E 2WW4A 4DV3E 4MU3A 3HULA 5JEAE 3J7AM 1XNQI 3M85D 4OX9E 1HNXE 4USKA 3Q6NA 4AM3A 4IZKA 4K0KI 5DRQA 2O3ZA 3WU3A 4LF5E 3JAMC 2UXBI 2BA1G 1UDQA 1XXEA 2PO1A 1NHIA 4JI3E 4DR3I 4FN5A 3GLLA 4LF8I 1WUUA 2JE6A 2UXCI 3JAMQ 4LPFA 1XNRI 2F4VI 4IZKB 1Z5BA 2IESA 4JI0E 3LTOA 2PO2A 4B3MI 1HNWE 2PO1B 1N34E 3NZKA 4X66I 2GQ0A 5DROA 5JEAC 4LFBI 2JE6B 4DR7I 3PYEA 4DR4I 4DV3I 4WUBA 4JYAE 4OX9I 1HNXI 2VESA 3B8HA 2PO2B 3KRNA 5L3JA 1Y6ZA 3P76A 3UHMA 1FJGE 4WUCA 2A2CA 4JI3I 3M6AA 2UUCI 4GKJI 3V2UC 2O1VA 4DV4E 3K1JA 5EKWA 1ZM3A 3ZKDA 5LMNE 4DV6E 4GKKE 2GO3A 4IZJD 5GMDA 4NXME 2UXDE 4JI0I 2CGEA 4ISAA 4UT4A 1HNWI 1S16A 4X64E 1N34I 1Z59A 4DXLA 5DRPA 5FLXQ 2PNZA 4HYMA 4JI8E 2XEXA 2UU9E 1OYRA 3H1CA 4FW3A 4DV5E 4LF9E 4JYAI 1MU5A 2GS8A 1N36E 4DPYA 2O1TA 2HFUA 1VI7A 5A2QC 5C0XF 4DR5E 2BV3A 4I3HA 3OTOE 2PNZB 3PS1A 3U1YA 1FJGI 1R6LA 1E3PA 2AJ4A 1N32E 3GCMA 4DV4I 1PIEA 1NZ0A 2Q2EB 4QNJA 4NXNE 4KHPE 5LMNI 4DV6I 2CZ9A 1FI4A 4GKKI 1MG7A 4NXMI 2CVEA 5GMEA 2Z5EA 4X62E 2UXDI 2E5LI 3CDJA 4X64I 3J80C 1IBKE 1Z0EA 2BA0D 4OKGA 5K36F 4JI1I 1USUA 3T1YE 1XHKA 2HHHE
chains in the Genus database with same CATH topology
3PRYA 3J80Q 4LF9I 3WU4A 2O1WA 1N36I 1VISA 4JI2I 5LL6R 2HKJA 4XTJA 4LFCE 4DU8A 3OTOI 1XMOE 1EA6A 2ZBKB 4PRVA 2UUAE 2ZM6E 4DV2E 3D4JA 1NHJA 4LF4E 1N32I 4LF6E 3LNUA 1OJ4A 4NXNI 4KHPI 1H73A 4JI6I 4P7AA 4LF7E 4IZJA 3Q1QA 4DR2E 2E1RA 2UUBE 4YHHE 1BKNA 3WU6A 4R1FA 4B3SE 3GONA 4RPFA 4DPWA 4B3TE 2Z5BB 1H7UA 4HXZA 4IZJB 3ZZTA 4DV0E 1D6TA 4LFCI 1ZXMA 4LF5I 4DV7E 3PYGA 4FWHA 1XMOI 1HK7A 4B3RE 2A2DA 4DPTA 2ZM6I 2EFGA 4DV2I 4LF4I 4LF6I 4ZVIA 3B78A 1Z5CA 4X65E 1I94E 5FLXC 2VQFE 4LF7I 1J5EE 2DEIA 1H7SA 4DR2I 4USMA 2UUBI 3F0NA 2IOQA 4DUYE 4YHHI 3K85A 2V8PA 1ZM4A 2PNMA 4B3SI 4DUZE 4AQYE 4B3TI 4Z7YA 2NPFA 1K47A 1FNMA 3T1HE 4DV0I 3J7AG 4DR1E 4JV5E 2DEJA 4DV7I 1FWKA 4B3RI 3QT6A 1KVKA 3QT8A 5IT9C 4X65I 1I94I 1Y4SA 1NHHA 1XNQE 3WU5A 2HFSA 2IOPA 5IT9Q 2HK3A 2LJPA 2VQFI 1J5EI 4DV1E 1N33E 1PKPA 3ZKBA 1RR9A 2VF3A 4MYTA 4DUYI 2HK2A 4FWDA 1ZM2A 4HACA 1Y4UA 1Z0BA 4JI8I 4DPUA 4KQVA 2UU9I 2Z5CA 2ZITA 3ZM7A 4DUZI 4DV5I 1PVGA 1Z0TA 1ZXNA 4M1KA 4AQYI 4DR6E 2F4VE 1HNZE 2R3VA 1KTVA 3T1HI 2VQEE 4DR1I 4DR5I 4B3ME 4JI4E 4HACB 4X66E 2J7KA 2V2VA 2Z5CB 1MX0A 1HR0E 2BM0A 4DR4E 1XMQE 2V2ZA 1FWLA 2O1UA 2Z5BA 3ZZUA 5LMUE 4MYUA 4X62I 4Z7CA 1EI1A 4DV1I 1N33I 1FKAE 5FWKA 4FWGA 4ED4A 5IWAE 1U2RA 3K17A 1KIJA 1IBKI 5BR8E 3T1YI 2UUCE 2V34A 4N3OA 4GKJE 4JG4A 1IBME 2HHHI 3P06A 1QZRA 4YY3E 2CG9A 4DR6I 2R42A 4LFAE 1HNZI 1Z0WA 3H4LA 4JI5E 2VQEI 4JI4I 1S4EA 3CWVA 4HY1A 1Z0CA 2UUAI 1N0UA 1N0VC 2OI2A 1DARA 1HR0I 4EMDA 1XMQI 3B82A 1IBLE 2PNLA 4PU9A 5LMUI 4JI7E 1H74A 3HJCA 1B62A 4DU7A 3QT7A 5IWAI 1ELOA 5BR8I 1Z5AA 4P52A 1IBMI 3V5RA 4YY3I 4LFAI 4JI5I 1H72C 2E5LE 4WUDA 4UTGA 1USVA 1Z0VA 2HKEA 2X7IA 2X36A 3LPSA 4JI1E 3QT5A 4URLA 1IBLI 1RREA 1Z0GA 2V2QA 4PRXA 4JI2E 4JI7I 4K0KE 2UXBE 4FW9A 4DR3E 3J81C 5A2QQ 4LF8E 3PYFA 2UXCE 4DPXA 3Q6MA 1XNRE 3PYDA 3J81Q 4JI6E 1UEKA 1B63A 1ZM9A 1KKHA 4JV5I 3ZZ0A 2BM1A 1A6FA 4LFBE 4DR7E 2WW4A 4DV3E 3HULA 3J7AM 1XNQI 4OX9E 1HNXE 4USKA 3Q6NA 4IZKA 4K0KI 3WU3A 4LF5E 3JAMC 2UXBI 1NHIA 4JI3E 4DR3I 4FN5A 4LF8I 1WUUA 2UXCI 3JAMQ 1XNRI 2F4VI 4IZKB 1Z5BA 4JI0E 3LTOA 4B3MI 1HNWE 1N34E 4X66I 2GQ0A 4LFBI 4DR7I 3PYEA 4DR4I 4DV3I 4WUBA 4JYAE 4OX9I 1HNXI 3B8HA 5L3JA 1Y6ZA 1FJGE 4WUCA 2A2CA 4JI3I 3M6AA 2UUCI 4GKJI 3V2UC 2O1VA 4DV4E 3K1JA 1ZM3A 3ZKDA 5LMNE 4DV6E 4GKKE 4IZJD 5GMDA 4NXME 2UXDE 4JI0I 2CGEA 4UT4A 1HNWI 1S16A 4X64E 1N34I 1Z59A 4DXLA 5FLXQ 4HYMA 4JI8E 2XEXA 2UU9E 4JYAI 4DV5E 4LF9E 1MU5A 2GS8A 1N36E 4DPYA 2O1TA 2HFUA 5A2QC 4DR5E 2BV3A 4I3HA 3OTOE 1FJGI 2AJ4A 1N32E 4DV4I 1PIEA 1NZ0A 2Q2EB 4NXNE 4KHPE 5LMNI 4DV6I 2CZ9A 1FI4A 4GKKI 1MG7A 4NXMI 5GMEA 2Z5EA 4X62E 2UXDI 2E5LI 4X64I 3J80C 1IBKE 1Z0EA 4JI1I 1USUA 3T1YE 1XHKA 2HHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 Q;  4LF9 I;  3WU4 A;  1N36 I;  1VIS A;  4JI2 I;  5LL6 R;  2HKJ A;  4XTJ A;  4LFC E;  4DU8 A;  3OTO I;  1XMO E;  1EA6 A;  2ZBK B;  4PRV A;  2UUA E;  2ZM6 E;  4DV2 E;  3D4J A;  1NHJ A;  4LF4 E;  1N32 I;  4LF6 E;  3LNU A;  1OJ4 A;  4NXN I;  4KHP I;  1H73 A;  4JI6 I;  4P7A A;  4LF7 E;  3Q1Q A;  4DR2 E;  2E1R A;  2UUB E;  4YHH E;  1BKN A;  3WU6 A;  4R1F A;  4B3S E;  3GON A;  4RPF A;  4DPW A;  4B3T E;  1H7U A;  4HXZ A;  3ZZT A;  4DV0 E;  1D6T A;  4LFC I;  1ZXM A;  4LF5 I;  4DV7 E;  3PYG A;  4FWH A;  1XMO I;  4B3R E;  2A2D A;  4DPT A;  2ZM6 I;  2EFG A;  4DV2 I;  4LF4 I;  4LF6 I;  4ZVI A;  3B78 A;  1Z5C A;  4X65 E;  1I94 E;  5FLX C;  2VQF E;  4LF7 I;  1J5E E;  2DEI A;  1H7S A;  4DR2 I;  4USM A;  2UUB I;  3F0N A;  4DUY E;  4YHH I;  2V8P A;  1ZM4 A;  4B3S I;  4DUZ E;  4AQY E;  4B3T I;  4Z7Y A;  2NPF A;  1K47 A;  1FNM A;  3T1H E;  4DV0 I;  3J7A G;  4DR1 E;  4JV5 E;  2DEJ A;  4DV7 I;  1FWK A;  4B3R I;  3QT6 A;  1KVK A;  3QT8 A;  5IT9 C;  4X65 I;  1I94 I;  1NHH A;  1XNQ E;  3WU5 A;  2HFS A;  5IT9 Q;  2HK3 A;  2LJP A;  2VQF I;  1J5E I;  4DV1 E;  1N33 E;  1PKP A;  3ZKB A;  1RR9 A;  2VF3 A;  4MYT A;  4DUY I;  2HK2 A;  4FWD A;  1ZM2 A;  4HAC A;  1Z0B A;  4JI8 I;  4DPU A;  4KQV A;  2UU9 I;  2ZIT A;  3ZM7 A;  4DUZ I;  4DV5 I;  1PVG A;  1Z0T A;  1ZXN A;  4M1K A;  4AQY I;  4DR6 E;  2F4V E;  1HNZ E;  2R3V A;  1KTV A;  3T1H I;  2VQE E;  4DR1 I;  4DR5 I;  4B3M E;  4JI4 E;  4HAC B;  4X66 E;  2J7K A;  2V2V A;  1MX0 A;  1HR0 E;  2BM0 A;  4DR4 E;  1XMQ E;  2V2Z A;  1FWL A;  3ZZU A;  5LMU E;  4MYU A;  4X62 I;  4Z7C A;  1EI1 A;  4DV1 I;  1N33 I;  1FKA E;  4FWG A;  4ED4 A;  5IWA E;  1U2R A;  3K17 A;  1KIJ A;  1IBK I;  5BR8 E;  3T1Y I;  2UUC E;  2V34 A;  4GKJ E;  4JG4 A;  1IBM E;  2HHH I;  1QZR A;  4YY3 E;  4DR6 I;  2R42 A;  4LFA E;  1HNZ I;  1Z0W A;  3H4L A;  4JI5 E;  2VQE I;  4JI4 I;  1S4E A;  3CWV A;  4HY1 A;  1Z0C A;  2UUA I;  1N0U A;  1N0V C;  2OI2 A;  1DAR A;  1HR0 I;  4EMD A;  1XMQ I;  3B82 A;  1IBL E;  4PU9 A;  5LMU I;  4JI7 E;  1H74 A;  1B62 A;  4DU7 A;  3QT7 A;  5IWA I;  1ELO A;  5BR8 I;  1Z5A A;  4P52 A;  1IBM I;  3V5R A;  4YY3 I;  4LFA I;  4JI5 I;  1H72 C;  2E5L E;  4WUD A;  4UTG A;  1Z0V A;  2HKE A;  2X7I A;  2X36 A;  3LPS A;  4JI1 E;  3QT5 A;  4URL A;  1IBL I;  1RRE A;  1Z0G A;  2V2Q A;  4PRX A;  4JI2 E;  4JI7 I;  4K0K E;  2UXB E;  4FW9 A;  4DR3 E;  3J81 C;  5A2Q Q;  4LF8 E;  3PYF A;  2UXC E;  4DPX A;  1XNR E;  3PYD A;  3J81 Q;  4JI6 E;  1UEK A;  1B63 A;  1ZM9 A;  1KKH A;  4JV5 I;  3ZZ0 A;  2BM1 A;  1A6F A;  4LFB E;  4DR7 E;  2WW4 A;  4DV3 E;  3HUL A;  3J7A M;  1XNQ I;  4OX9 E;  1HNX E;  4USK A;  4K0K I;  3WU3 A;  4LF5 E;  3JAM C;  2UXB I;  1NHI A;  4JI3 E;  4DR3 I;  4FN5 A;  4LF8 I;  1WUU A;  2UXC I;  3JAM Q;  1XNR I;  2F4V I;  1Z5B A;  4JI0 E;  3LTO A;  4B3M I;  1HNW E;  1N34 E;  4X66 I;  4LFB I;  4DR7 I;  3PYE A;  4DR4 I;  4DV3 I;  4WUB A;  4JYA E;  4OX9 I;  1HNX I;  3B8H A;  5L3J A;  1FJG E;  4WUC A;  2A2C A;  4JI3 I;  3M6A A;  2UUC I;  4GKJ I;  3V2U C;  4DV4 E;  3K1J A;  1ZM3 A;  3ZKD A;  5LMN E;  4DV6 E;  4GKK E;  5GMD A;  4NXM E;  2UXD E;  4JI0 I;  4UT4 A;  1HNW I;  1S16 A;  4X64 E;  1N34 I;  1Z59 A;  4DXL A;  5FLX Q;  4HYM A;  4JI8 E;  2XEX A;  2UU9 E;  4JYA I;  4DV5 E;  4LF9 E;  1MU5 A;  2GS8 A;  1N36 E;  4DPY A;  2HFU A;  5A2Q C;  4DR5 E;  2BV3 A;  4I3H A;  3OTO E;  1FJG I;  2AJ4 A;  1N32 E;  4DV4 I;  1PIE A;  1NZ0 A;  2Q2E B;  4NXN E;  4KHP E;  5LMN I;  4DV6 I;  2CZ9 A;  1FI4 A;  4GKK I;  1MG7 A;  4NXM I;  5GME A;  4X62 E;  2UXD I;  2E5L I;  4X64 I;  3J80 C;  1IBK E;  1Z0E A;  4JI1 I;  3T1Y E;  1XHK A;  2HHH E; 
#chains in the Genus database with same CATH topology
 3PRY A;  3J80 Q;  4LF9 I;  3WU4 A;  2O1W A;  5C0X D;  1N36 I;  2JT2 A;  1VIS A;  4JI2 I;  5LL6 R;  1YH8 A;  2HKJ A;  4XTJ A;  4LFC E;  1OYS A;  4DU8 A;  3OTO I;  1XMO E;  1EA6 A;  2ZBK B;  4PRV A;  2UUA E;  3CDI A;  2ZM6 E;  4DV2 E;  4NBQ A;  3D4J A;  1NHJ A;  4LF4 E;  1N32 I;  4LF6 E;  3LNU A;  5C0X E;  1OJ4 A;  5DNX A;  4IS9 A;  4NXN I;  4U3D A;  4KHP I;  1H73 A;  4IFD F;  4JI6 I;  4P7A A;  4LF7 E;  4IZJ A;  2PO0 A;  3Q1Q A;  5K36 D;  4DR2 E;  2E1R A;  2UUB E;  3B4T A;  4YHH E;  1BKN A;  3WU6 A;  2NN6 F;  4R1F A;  4B3S E;  3GON A;  4RPF A;  4DPW A;  4B3T E;  2Z5B B;  5K36 E;  1H7U A;  4HXZ A;  4IZJ B;  2PO0 B;  1P42 A;  3ZZT A;  4DV0 E;  1D6T A;  4LFC I;  2NN6 B;  1ZXM A;  1RHY A;  4LF5 I;  4DV7 E;  3PYG A;  2BR2 B;  4FWH A;  3U1K A;  1XMO I;  1HK7 A;  4B3R E;  3P3E A;  2A2D A;  2WNR A;  4DPT A;  2ZM6 I;  2EFG A;  4DV2 I;  2JEB A;  4LOM A;  1UDN A;  4LF4 I;  4LF6 I;  4ZVI A;  1Y5Y A;  3B78 A;  1Z5C A;  4BA1 B;  4X65 E;  1I94 E;  1Y60 A;  4MU4 A;  4LCF A;  5FLX C;  2VQF E;  4MU1 A;  4LF7 I;  1J5E E;  2DEI A;  1H7S A;  5DNL A;  4DR2 I;  4USM A;  2NN6 D;  2UUB I;  3F0N A;  2WNR B;  2IOQ A;  4DUY E;  2JEB B;  4YHH I;  3K85 A;  2V8P A;  1ZM4 A;  4MDT A;  2PNM A;  4B3S I;  4DUZ E;  2BA0 G;  3M7N D;  4AQY E;  4B3T I;  4Z7Y A;  2NPF A;  1UDO A;  1K47 A;  1FNM A;  5C0X A;  2J65 A;  2WP8 A;  2NN6 E;  4DV0 I;  3T1H E;  2C38 A;  3J7A G;  4DR1 E;  4FW6 A;  5JEA F;  4JV5 E;  2DEJ A;  4DV7 I;  1FWK A;  4B3R I;  3QT6 A;  1KVK A;  3GME A;  3QT8 A;  5IT9 C;  4QNK A;  5ELW A;  4X65 I;  1I94 I;  1Y4S A;  2F1D A;  1NHH A;  1XNQ E;  3WU5 A;  5C0X B;  2HFS A;  2WP8 B;  5EL9 A;  2IOP A;  5IT9 Q;  2HK3 A;  2LJP A;  4LCH A;  2C38 B;  2VQF I;  1J5E I;  3PS2 A;  4FW4 A;  4DV1 E;  1N33 E;  2JEA A;  1PKP A;  3ZKB A;  5K36 A;  1RR9 A;  2AE8 A;  2VF3 A;  4MYT A;  4DUY I;  2HK2 A;  4FWD A;  1ZM2 A;  4HAC A;  1Y4U A;  1Z0B A;  4JI8 I;  4DPU A;  4KQV A;  2UU9 I;  2Z5C A;  2ZIT A;  3ZM7 A;  4OZE A;  4DUZ I;  4DV5 I;  1PVG A;  1Z0T A;  1ZXN A;  4M1K A;  4AQY I;  4DR6 E;  2F4V E;  1HNZ E;  3DD6 A;  2R3V A;  2JEA B;  1KTV A;  3T1H I;  2VQE E;  5K36 B;  4DR1 I;  4DR5 I;  4FW5 A;  4B3M E;  4JI4 E;  4HAC B;  4U3B A;  4X66 E;  2J7K A;  2V2V A;  2Z5C B;  4OO1 A;  1MX0 A;  1HR0 E;  1OYP A;  2BM0 A;  3HKM A;  4DR4 E;  1XMQ E;  2V2Z A;  4OO1 F;  4BA2 A;  4IFD A;  1FWL A;  2O1U A;  3P3G A;  2Z5B A;  4FW7 A;  3ZZU A;  5LMU E;  4MYU A;  4X62 I;  4Z7C A;  1EI1 A;  4DV1 I;  1N33 I;  1FKA E;  5FWK A;  4FWG A;  2C39 B;  4ED4 A;  5IWA E;  1U2R A;  2NN6 A;  3K17 A;  4OO1 B;  1KIJ A;  1IBK I;  2BR2 A;  5BR8 E;  3T1Y I;  2UUC E;  2V34 A;  4N3O A;  4GKJ E;  4JG4 A;  1IBM E;  4BA2 B;  2HHH I;  4IFD B;  3P06 A;  1QZR A;  4YY3 E;  4BA1 A;  1YHC A;  2CG9 A;  4DR6 I;  2R42 A;  4LFA E;  1HNZ I;  1Z0W A;  3H4L A;  4JI5 E;  2VQE I;  2IER A;  3M7N G;  4JI4 I;  1S4E A;  3CWV A;  1UDS A;  1Z0C A;  4HY1 A;  1N0U A;  2UUA I;  3L7Z A;  1N0V C;  5C0X C;  3P3C A;  4OO1 D;  2OI2 A;  1DAR A;  1HR0 I;  4EMD A;  1XMQ I;  3B82 A;  4IFD D;  1IBL E;  2PNL A;  2BA1 D;  4PU9 A;  5LMU I;  2C37 A;  4JI7 E;  1H74 A;  3HJC A;  4OO1 E;  1B62 A;  3L7Z B;  3QT7 A;  4DU7 A;  1ELO A;  5IWA I;  5BR8 I;  1Z5A A;  4P52 A;  4IFD E;  1E3H A;  1IBM I;  5K36 C;  3V5R A;  4YY3 I;  2C37 B;  4LFA I;  4AID A;  4JI5 I;  1H72 C;  2GO4 A;  4MU0 A;  5JEA A;  2E5L E;  4WUD A;  4UTG A;  1USV A;  1Z0V A;  5DRR A;  2HKE A;  4AIM A;  2X7I A;  2X36 A;  4J3D A;  3LPS A;  4JI1 E;  3QT5 A;  4URL A;  1IBL I;  1RRE A;  5JEA B;  1Z0G A;  2V2Q A;  4OO1 C;  4PRX A;  4JI2 E;  4JI7 I;  4K0K E;  3M85 G;  4IFD C;  2UXB E;  4MQY A;  4FW9 A;  4DR3 E;  3J81 C;  5A2Q Q;  4LF8 E;  3PS3 A;  3PYF A;  2UXC E;  4DPX A;  3Q6M A;  1R6M A;  1XNR E;  3PYD A;  2NN6 C;  5JEA D;  3J81 Q;  4JI6 E;  1UEK A;  1B63 A;  1ZM9 A;  1KKH A;  4JV5 I;  3ZZ0 A;  2C39 A;  4GQU A;  2BM1 A;  1A6F A;  4LFB E;  4LCG A;  4DR7 E;  2WW4 A;  4DV3 E;  4MU3 A;  3HUL A;  5JEA E;  3J7A M;  1XNQ I;  3M85 D;  4OX9 E;  1HNX E;  4USK A;  3Q6N A;  4AM3 A;  4IZK A;  4K0K I;  5DRQ A;  2O3Z A;  3WU3 A;  4LF5 E;  3JAM C;  2UXB I;  2BA1 G;  1UDQ A;  1XXE A;  2PO1 A;  1NHI A;  4JI3 E;  4DR3 I;  4FN5 A;  3GLL A;  4LF8 I;  1WUU A;  2JE6 A;  2UXC I;  3JAM Q;  4LPF A;  1XNR I;  2F4V I;  4IZK B;  1Z5B A;  2IES A;  4JI0 E;  3LTO A;  2PO2 A;  4B3M I;  1HNW E;  2PO1 B;  1N34 E;  3NZK A;  4X66 I;  2GQ0 A;  5DRO A;  5JEA C;  4LFB I;  2JE6 B;  4DR7 I;  3PYE A;  4DR4 I;  4DV3 I;  4WUB A;  4JYA E;  4OX9 I;  1HNX I;  2VES A;  3B8H A;  2PO2 B;  3KRN A;  5L3J A;  1Y6Z A;  3P76 A;  3UHM A;  1FJG E;  4WUC A;  2A2C A;  4JI3 I;  3M6A A;  2UUC I;  4GKJ I;  3V2U C;  2O1V A;  4DV4 E;  3K1J A;  5EKW A;  1ZM3 A;  3ZKD A;  5LMN E;  4DV6 E;  4GKK E;  2GO3 A;  4IZJ D;  5GMD A;  4NXM E;  2UXD E;  4JI0 I;  2CGE A;  4ISA A;  4UT4 A;  1HNW I;  1S16 A;  4X64 E;  1N34 I;  1Z59 A;  4DXL A;  5DRP A;  5FLX Q;  2PNZ A;  4HYM A;  4JI8 E;  2XEX A;  2UU9 E;  1OYR A;  3H1C A;  4FW3 A;  4DV5 E;  4LF9 E;  4JYA I;  1MU5 A;  2GS8 A;  1N36 E;  4DPY A;  2O1T A;  2HFU A;  1VI7 A;  5A2Q C;  5C0X F;  4DR5 E;  2BV3 A;  4I3H A;  3OTO E;  2PNZ B;  3PS1 A;  3U1Y A;  1FJG I;  1R6L A;  1E3P A;  2AJ4 A;  1N32 E;  3GCM A;  4DV4 I;  1PIE A;  1NZ0 A;  2Q2E B;  4QNJ A;  4NXN E;  4KHP E;  5LMN I;  4DV6 I;  2CZ9 A;  1FI4 A;  4GKK I;  1MG7 A;  4NXM I;  2CVE A;  5GME A;  2Z5E A;  4X62 E;  2UXD I;  2E5L I;  3CDJ A;  4X64 I;  3J80 C;  1IBK E;  1Z0E A;  2BA0 D;  4OKG A;  5K36 F;  4JI1 I;  1USU A;  3T1Y E;  1XHK A;  2HHH E; 
#chains in the Genus database with same CATH homology
 3PRY A;  3J80 Q;  4LF9 I;  3WU4 A;  2O1W A;  1N36 I;  1VIS A;  4JI2 I;  5LL6 R;  2HKJ A;  4XTJ A;  4LFC E;  4DU8 A;  3OTO I;  1XMO E;  1EA6 A;  2ZBK B;  4PRV A;  2UUA E;  2ZM6 E;  4DV2 E;  3D4J A;  1NHJ A;  4LF4 E;  1N32 I;  4LF6 E;  3LNU A;  1OJ4 A;  4NXN I;  4KHP I;  1H73 A;  4JI6 I;  4P7A A;  4LF7 E;  4IZJ A;  3Q1Q A;  4DR2 E;  2E1R A;  2UUB E;  4YHH E;  1BKN A;  3WU6 A;  4R1F A;  4B3S E;  3GON A;  4RPF A;  4DPW A;  4B3T E;  2Z5B B;  1H7U A;  4HXZ A;  4IZJ B;  3ZZT A;  4DV0 E;  1D6T A;  4LFC I;  1ZXM A;  4LF5 I;  4DV7 E;  3PYG A;  4FWH A;  1XMO I;  1HK7 A;  4B3R E;  2A2D A;  4DPT A;  2ZM6 I;  2EFG A;  4DV2 I;  4LF4 I;  4LF6 I;  4ZVI A;  3B78 A;  1Z5C A;  4X65 E;  1I94 E;  5FLX C;  2VQF E;  4LF7 I;  1J5E E;  2DEI A;  1H7S A;  4DR2 I;  4USM A;  2UUB I;  3F0N A;  2IOQ A;  4DUY E;  4YHH I;  3K85 A;  2V8P A;  1ZM4 A;  2PNM A;  4B3S I;  4DUZ E;  4AQY E;  4B3T I;  4Z7Y A;  2NPF A;  1K47 A;  1FNM A;  3T1H E;  4DV0 I;  3J7A G;  4DR1 E;  4JV5 E;  2DEJ A;  4DV7 I;  1FWK A;  4B3R I;  3QT6 A;  1KVK A;  3QT8 A;  5IT9 C;  4X65 I;  1I94 I;  1Y4S A;  1NHH A;  1XNQ E;  3WU5 A;  2HFS A;  2IOP A;  5IT9 Q;  2HK3 A;  2LJP A;  2VQF I;  1J5E I;  4DV1 E;  1N33 E;  1PKP A;  3ZKB A;  1RR9 A;  2VF3 A;  4MYT A;  4DUY I;  2HK2 A;  4FWD A;  1ZM2 A;  4HAC A;  1Y4U A;  1Z0B A;  4JI8 I;  4DPU A;  4KQV A;  2UU9 I;  2Z5C A;  2ZIT A;  3ZM7 A;  4DUZ I;  4DV5 I;  1PVG A;  1Z0T A;  1ZXN A;  4M1K A;  4AQY I;  4DR6 E;  2F4V E;  1HNZ E;  2R3V A;  1KTV A;  3T1H I;  2VQE E;  4DR1 I;  4DR5 I;  4B3M E;  4JI4 E;  4HAC B;  4X66 E;  2J7K A;  2V2V A;  2Z5C B;  1MX0 A;  1HR0 E;  2BM0 A;  4DR4 E;  1XMQ E;  2V2Z A;  1FWL A;  2O1U A;  2Z5B A;  3ZZU A;  5LMU E;  4MYU A;  4X62 I;  4Z7C A;  1EI1 A;  4DV1 I;  1N33 I;  1FKA E;  5FWK A;  4FWG A;  4ED4 A;  5IWA E;  1U2R A;  3K17 A;  1KIJ A;  1IBK I;  5BR8 E;  3T1Y I;  2UUC E;  2V34 A;  4N3O A;  4GKJ E;  4JG4 A;  1IBM E;  2HHH I;  3P06 A;  1QZR A;  4YY3 E;  2CG9 A;  4DR6 I;  2R42 A;  4LFA E;  1HNZ I;  1Z0W A;  3H4L A;  4JI5 E;  2VQE I;  4JI4 I;  1S4E A;  3CWV A;  4HY1 A;  1Z0C A;  2UUA I;  1N0U A;  1N0V C;  2OI2 A;  1DAR A;  1HR0 I;  4EMD A;  1XMQ I;  3B82 A;  1IBL E;  2PNL A;  4PU9 A;  5LMU I;  4JI7 E;  1H74 A;  3HJC A;  1B62 A;  4DU7 A;  3QT7 A;  5IWA I;  1ELO A;  5BR8 I;  1Z5A A;  4P52 A;  1IBM I;  3V5R A;  4YY3 I;  4LFA I;  4JI5 I;  1H72 C;  2E5L E;  4WUD A;  4UTG A;  1USV A;  1Z0V A;  2HKE A;  2X7I A;  2X36 A;  3LPS A;  4JI1 E;  3QT5 A;  4URL A;  1IBL I;  1RRE A;  1Z0G A;  2V2Q A;  4PRX A;  4JI2 E;  4JI7 I;  4K0K E;  2UXB E;  4FW9 A;  4DR3 E;  3J81 C;  5A2Q Q;  4LF8 E;  3PYF A;  2UXC E;  4DPX A;  3Q6M A;  1XNR E;  3PYD A;  3J81 Q;  4JI6 E;  1UEK A;  1B63 A;  1ZM9 A;  1KKH A;  4JV5 I;  3ZZ0 A;  2BM1 A;  1A6F A;  4LFB E;  4DR7 E;  2WW4 A;  4DV3 E;  3HUL A;  3J7A M;  1XNQ I;  4OX9 E;  1HNX E;  4USK A;  3Q6N A;  4IZK A;  4K0K I;  3WU3 A;  4LF5 E;  3JAM C;  2UXB I;  1NHI A;  4JI3 E;  4DR3 I;  4FN5 A;  4LF8 I;  1WUU A;  2UXC I;  3JAM Q;  1XNR I;  2F4V I;  4IZK B;  1Z5B A;  4JI0 E;  3LTO A;  4B3M I;  1HNW E;  1N34 E;  4X66 I;  2GQ0 A;  4LFB I;  4DR7 I;  3PYE A;  4DR4 I;  4DV3 I;  4WUB A;  4JYA E;  4OX9 I;  1HNX I;  3B8H A;  5L3J A;  1Y6Z A;  1FJG E;  4WUC A;  2A2C A;  4JI3 I;  3M6A A;  2UUC I;  4GKJ I;  3V2U C;  2O1V A;  4DV4 E;  3K1J A;  1ZM3 A;  3ZKD A;  5LMN E;  4DV6 E;  4GKK E;  4IZJ D;  5GMD A;  4NXM E;  2UXD E;  4JI0 I;  2CGE A;  4UT4 A;  1HNW I;  1S16 A;  4X64 E;  1N34 I;  1Z59 A;  4DXL A;  5FLX Q;  4HYM A;  4JI8 E;  2XEX A;  2UU9 E;  4JYA I;  4DV5 E;  4LF9 E;  1MU5 A;  2GS8 A;  1N36 E;  4DPY A;  2O1T A;  2HFU A;  5A2Q C;  4DR5 E;  2BV3 A;  4I3H A;  3OTO E;  1FJG I;  2AJ4 A;  1N32 E;  4DV4 I;  1PIE A;  1NZ0 A;  2Q2E B;  4NXN E;  4KHP E;  5LMN I;  4DV6 I;  2CZ9 A;  1FI4 A;  4GKK I;  1MG7 A;  4NXM I;  5GME A;  2Z5E A;  4X62 E;  2UXD I;  2E5L I;  4X64 I;  3J80 C;  1IBK E;  1Z0E A;  4JI1 I;  1USU A;  3T1Y E;  1XHK A;  2HHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...