2UXCQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcQ00
4DR4Q 4DV3Q 5IYDH 5GAGC 4A3FG 1GVPA 2K75A 1YVCA 4DUZQ 3D31A 4A3IG 1GD7A 2IHFA 4GN5A 1EYGA 2Y0SG 1VQAA 1CKNA 1YHAA 4JI7Q 3I4MG 1JB7A 4OX9Q 4B3RQ 1XPRA 5IWAQ 1X9NA 2RHSB 4LF4L 3SGIA 4DR1Q 4YY3L 2R92G 1VQ6A 2VUMG 3CD6A 1VQCA 1VQNA 4BY7G 5C4XH 3S15H 2H5XA 4WJ3M 1L1OA 1PFSA 4LF9Q 4Y52H 4HIMA 5LMNW 3KJPA 3RN2A 5IP9H 4LUZA 4R4OA 2F52A 4UP9A 4DR5L 4LUVA 1Y1VH 1VQPA 4JYAQ 5BR8Q 3OTOL 4DV2Q 2UUCL 2NVTH 1SLJA 2E5LL 2UUBQ 1TWGH 3PO2G 3HFZB 1HNWL 5JJKA 1G51A 2ZTCA 4GLXA 2UXBL 1L0WA 2YTYA 4BY1G 2RF4A 4PZ6A 4YCUA 1SRUA 3TQYA 5ELNA 2KHIA 2MO1A 1TWAH 3CMEA 3PO3G 3TS2A 2DUDA 2LSSA 3M4QA 5IYDG 2BH8A 5JEAG 1IBKL 3M85A 2Z0SA 4L5TA 4LF6Q 3STBD 4DUYL 3K8AA 4A3DG 3GTOH 2JEBI 4BBSH 1MJEA 1XNQQ 5M5YH 2R7FA 1CSQA 1E3PA 4YHHL 2UU9Q 1V43A 3HOVH 3KDFA 2JA7H 4LFBL 4JBWA 4LFAQ 2Q2UA 1YBYA 2VQFL 3CW2C 1X55A 1OXVA 5HY6A 4JI2Q 1D7QA 3PCOB 4DV1Q 1NMFA 3J81c 2OTLA 4R4TA 1WYDA 5DLQE 5FLMG 5IP9G 4KI0A 5C4JH 1Y1VG 1DGSA 1SFOH 1E1OA 2JA9A 4LFCL 3NENA 1AH9A 1K0RA 1VQ8A 4DR2Q 3JAMi 5ELOA 4APVA 3RZDH 1JJGA 4R1JA 2B29A 4K0KL 1X56A 3A5ZB 4QIWE 2I5LX 3VDYA 1T9HA 4JBJA 1VQFA 5IP7H 3BZKA 3NBHB 4TVAB 4X66L 1VQIA 4JI0L 1I50H 1XNRL 4LF7Q 3I4OA 2UUAL 3WWVA 4JC0A 1FVIA 3CCRA 4BBSG 3CCEA 1C0AA 1UE5A 3S1MH 2OCEA 1PYSB 3MEFA 3GTLH 3UE1A 4A3CG 4HIKA 4AQYQ 3HOVG 4C2MH 1VQLA 2VQEL 4PG3A 4LUOA 3S24A 3CCUA 3M9BA 1PH2A 1IBMQ 2JA7G 1LYLA 1U0LA 1P16A 3HOYH 4YWKA 3HOWH 3W1BA 1GO3E 2RHQB 4IPDA 1OTCA 3GTGH 2K5NA 4A3LG 1Z47A 1U5KA 1CKOA 4JI8Q 3GTKH 2HIXA 3K0XA 1UEBA 4NPSA 3S17H 1TWCH 2VS1A 4AYBE 4X64L 4DV6Q 4JI3L 1HZ9A 3CC7A 3DLLA 2JA6H 1Z9FA 3RLFA 4DR3L 2AMCB 2HHHQ 4B3ML 2PI2A 4NXNQ 1XMQL 1YHBA 3G71A 4A3GH 3PUWA 5FLXc 2BH2A 1HZBA 4C3JH 2EQSA 4GS3A 3KF6B 1HNXL 1JJ2A 1KRSA 1VQGA 4JI5L 1K83H 4A3BH 1TXYA 1N9WA 4HIOA 3PF5A 1WJJA 1Q8KA 4B3SL 4HJAA 4B3TL 3K7AH 3G4SA 4A75A 4DAMA 4X65L 5C3EH 1MJCA 1KIXA 1KQSA 2KCMA 4GNXA 1YJ9A 2QGQA 3FKIG 3GD7A 3CPWA 1HR0Q 3GTPH 3ICEA 2PMZE 3STBC 4DAYB 1Y14B 3I7FA 4UP8A 3TS0A 5AJ3Q 3HOYG 3HOWG 4JV5L 1PVOA 2ZJPA 4LF4Q 2JA8G 4YY3Q 5GQOA 4BBRH 4YCWA 3S16H 4YWLA 1YZ6A 1YHQA 4DV0L 1B7YB 2I0QA 2YU9H 4JI1L 3RN5A 1VQ4A 2JA6G 2Y0SE 3JC66 4DV5L 4A3GG 2B63H 4DR5Q 2NZOA 3JAMc 3OTOQ 5IY0A 1HNWQ 2D62A 5C0XG 1KC8C 2ALYB 3T1HL 1VQHA 4TQUS 1N34Q 2R7ZH 5JJLA 1HJPA 4XIGS 1VQEA 3F2CA 4QGUA 4A3JH 1WFQA 3E9IA 2BA1A 3PIOA 4A3BG 4C3HH 2GN5A 3E0EA 1JMCA 2BA0A 1YNXA 3J7A5 2VY3A 4GKJL 5K36G 2JEAI 3NEMA 3HKZG 1I5FA 1EOVA 5C44H 3KLWA 1IBKQ 1ASYA 2DGYA 4DUYQ 1CKMA 4AIMA 1VQ9A 1YIJA 1V9PA 1A62A 1HR0W 2JE6I 4BBRG 1YJNA 2MQHA 4LFBQ 1XPOA 3K81C 4UY8C 1BKBA 1GKHA 1OXTA 3PUZA 4HJ5A 4JBMA 2D0PA 2B3GA 1XJVA 2IX0A 2B63G 2Q2TA 4P73A 2XGTA 3PGZA 3GTMH 4GKKQ 3AEVA 3ULJA 2GVBA 1L2FA 3H0GH 3AFPA 3PIPA 4LFCQ 3KFUA 2R7ZG 1I6HH 3ZJYC 1VQ5A 1JE5A 1A8VA 4MZ9A 5EAYA 5C0XI 5LMNL 2JJQA 1Y1WH 4KHPL 4A3JG 1HNZL 2I5MX 4K0KQ 1M1KC 5M3FH 4X66Q 4JI0Q 1PYBA 3T1YL 1XNRQ 2PQAB 5C44G 2ZJRA 1PA6A 2UUAQ 1H95A 3J81j 2UXCQ 4POGA 1Q46A 5LMUQ 3TEHB 2JA5H 2AKWB 3DM3A 2A1AA 3CP0A 5C4XG 4RMFA 2VQEQ 4PZ8A 3CMAA 1NJIC 4JI6L 2ASBA 2UXDL 1PH4A 4DV3L 3TREA 3I4NH 1RL2A 4A93H 4DUZL 1CSPA 5C0XJ 2CCZA 1FJGL 1KL9A 3OW2A 5IYBH 3I2ZA 3A0JA 2PI2E 2IT1A 4PMWA 2L15A 5GAEC 4DR1L 4R4CA 3H0GG 3IRBA 5J3BA 4DPGA 4X64Q 1S72A 4JI3Q 2IX1A 3FHWA 3NELA 4DR3Q 4B3MQ 3CCLA 1X6OA 1Y1WG 2K4KA 4LF9L 2Z6KC 1K9MC 3E9HA 5HGQA 5M3FG 1PH3A 3S1QH 4DV7Q 3BZCA 3OYYA 1HH2P 1S40A 5BR8L 4DV2L 4BXXH 4JI5Q 2UUBL 1J5EL 2IY5B 4P75A 1IBLL 2JA5G 2HT1A 4IOCA 1Q7YC 2OWOA 4B3SQ 4X6AH 1UWVA 1A63A 4P72A 5M5WH 4X65Q 1Q12A 4OWTB 3D0FA 3B6YA 5FJ8H 4IFDG 1J6QA 2A19A 5M3MH 1NY4A 1E22A 4ME3A 4A93G 2UXDQ 3KDFB 4JV5Q 1G291 4GLAC 2NVXH 4LF6L 4QQBX 2F4VL 4OWWB 5IYCH 1BBWA 1XNQL 4IJLA 1X65A 4JI4L 2NZHA 5GROA 4YWMA 4POFA 2UU9L 4JOIC 1W3SA 1ASZA 4DV0Q 4NXML 2K52A 1QUQB 1QVCA 1M90C 4DV5Q 4DR6L 4QY7A 4MTNA 3G6EA 5IP7G 2E2HH 4L5RC 4WJ4A 1PH9A 4A3MH 1NTGA 2WAQE 1XPUA 1KRTA 4OONA 1WCMH 4ALPA 3Q8DA 1E1TA 3T1HQ 1VQOA 2NVQH 4O2DA 2K14A 2Q2HA 1EQQA 2Q2IA 4AH6A 3U50C 4DV4L 4P74A 3U4ZA 1C9OA 2OQ0A 1HZCA 4GKJQ 1PH1A 1OXUA 5GADC 2YTVA 1IZ6A 4LF5L 2NVYH 3I55A 5M3MG 2KCTA 4IO9A 1QVGA 4IFDI 4OO1G 3UE0A 4LF7L 5M5XH 3H3VH 2VZAA 3CAMA 1B8AA 4X62L 3LGJA 2KENA 3ULLA 5IYCG 4JCVE 1EIFA 3J7ZC 3HKSA 2R93H 1V1QA 2QA4A 2AWNA 4UPAA 4KHZA 4A3FH 4HIDA 1UE1A 3HKZE 1IBML 1K3RA 1XTDA 2UUCQ 1OXSC 1Q1BA 2E5LQ 2QEXA 1N32L 1PH8A 1TWHH 4GOPC 1VS0A 2UXBQ 4A3MG 2VNUD 2R92H 1EQRA 3W1GA 2VUMH 2GVAA 1FGUA 3W5OA 5LMNQ 4LW1A 1N36L 1S3OA 3CPFA 1R9TH 3K80C 2E2JH 2ATWA 1MIUA 4IFDJ 3L7ZC 4KLKA 4FDBA 5C3EG 1EUJA 3F2BA 2OQKA 4NXNL 2N3SA 4IJHA 1UE7A 1Q82C 1TWFH 3T1YQ 4QL5A 3F2DA 1QVFA 2VL6A 4YHHQ 4R4IA 3I56A 2AWOA 4DK6C 1XMOL 3S14H 2D0OA 1VQDA 2ZM6L 5IE8A 1QZHA 4BY1H 3AYHB 1BBUA 2VQFQ 4GNXB 2WB1G 3UDIA 4OO1I 2K5HA 4P71A 2CQOA 2R93G 4JBKA 2ES2A 4JI6Q 2K5VA 2C35B 5JJIA 1K73C 1N33L 2HQLA 1SR3A 1FJGQ 4GOPB 2WFWA 3ERSX 1G6PA 4A3KH 1HR0L 4A3DH 2YV5A 4IPGA 4UP7A 1L1OC 1KXLA 1UE6A 5AJ3L 2MO0A 4PZ7A 1Q86C 1VQKA 3PUXA 1Q1EA 2YYZA 1I94L 4L5SA 1PH5A 4YCVA 3HOXH 1QZGA 4EX5A 3CC4A 1VQ7A 3KJOA 1X3EA 4QJFA 4LF8L 1JT8A 5FLMH 3PF4A 1KAWA 3J80i 1PHJA 1W2BA 4DR7L 1B70B 4GN4B 1EFWA 3A74A 4Y7NH 3S1NH 3K7UC 1J5EQ 1CKNB 1X3GA 4DK3C 5GAHC 1N34L 3FP9A 1IBLQ 5LMUL 2ZTEA 1E7ZA 3CCSA 1EWIA 1AE3A 4DR4L 3GO5A 4DNIA 2EXDA 2KBNA 4L5QA 3H3VI 3KF8B 1KHIA 2R7DA 2LXKA 1SROA 2CFMA 4JI7L 3CCVA 1YITA 4OX9L 1FL0A 3GTQH 1L1OB 4B3RL 4IPCA 5IWAL 3CF5A 2AHOB 3UDXA 3BU2A 4H02A 3CCJA 4A3KG 1IL2A 2F4VQ 4EQ5A 4JI4Q 3PSIA 3HOUH 1WOCA 4OWXB 3RLNA 4BA1I 1PH7A 2JQOA 2V1CC 3CCMA 2ID0A 3RNUA 1JJCB 4A3CH 1SN8A 1XMQQ 4NXMQ 5IT9c 2FXQA 2NN6G 4DR6Q 2ZJQA 3U4VA 3HOXG 3M4OH 4NB3A 4JYAL 3M4PA 3RLOA 1HNXQ 2R6GA 2ZTDA 4BA2I 3UDFA 1IYJB 3MXNB 3L0OA 1A0IA 4A3LH 1QUQA 2Z6KA 1E24A 1X3FA 3HOZH 3CQZH 4GN3B 1VQJA 4GKKL 4B3TQ 1D8LA 2YTXA 4RG1A 3KF6A 1AE2A 4DV4Q 3EN2A 1X54A 2LXJA 4HJ9A 3PUVA 2N49A 1YEZA 3UDGA 3I4NG 3ER0A 4J15A 4HJ7A 3A5UA 4LF5Q 2A8VA 4LNQA 5IYBG 3PV0A 2XTIA 1Q81C 3GTJH 4X62Q 2UXCL 3AQQA 3TRZA 1PV4A 2IHEA 3KOJA 3HOUG 4JI1Q 4LFAL 1SE8A 2RCNA 1I3QH 2N8NA 4MNOA 1LUZA 2VW9A 4HJ8A 2OTJA 4JI2L 1WI5A 4DV1L 3FKIH 2CKZB 4JOIA 4LWCA 4R4QA 1N32Q 4A3EH 2NN6I 1NBWA 1LM0A 3F8TA 2HIVA 3KYHC 1GM5A 3S1RH 2F3IA 2JA8H 4JG2A 3EBEA 4BXXG 3CC2A 1IXRA 2MNAA 3S2HH 3L2PA 3J80c 1MKHA 1N36Q 4DR2L 3HOZG 2PNHA 1VCIA 2I5HA 3AFQA 3RR5A 5JEAJ 5FJ8G 1SMXA 2N78A 5H1SE 2E8GA 3S2DH 1VQMA 1XMOQ 4DV7L 2KHJA 2WP8J 4DKAC 2ZM6Q 3CXCA 3M3YH 2JK8A 4GNXC 2CWAA 4AQYL 5E7NA 3GDEA 1PH6A 2EIFA 1OXXK 1VQBA 4AYBG 4A3IH 4C3IH 3F1ZA 1N33Q 3I4MH 1N8RC 1EIYB 1P8LA 4A76A 3H15A 1BVSA 2K50A 1WCMG 4A3EG 1RIPA 4GLVB 2WAQG 2MFIA 2WB1E 4JI8L 3J81i 4BY7H 4KHPQ 1CUKA 4XTCS 1KD1C 1HNZQ 4GOPA 1I94Q 3CCQA 3PUYA 4DV6L 3G48A 3M7NA 4O0AA 1NMGA 2HHHL 1YI2A 3BJUA 4A4IA 1LTLA 4OXPA 3PO2H 4LF8Q 3ULPA 4DR7Q 1C7YA 2E2IH 3EIVA 3RZOH 4IOAA 1K8AC 1NE3A 1K8GA 1YJWA 1HZAA 3U58A 2CWPA 1O7IA 2PQAA 3PO3H 4IPHA
chains in the Genus database with same CATH superfamily
4DR4Q 5IYDH 1GVPA 2K75A 1B50A 4GN5A 4LAAA 2FFKB 5CV9A 5EBCA 4X3UA 5IWAQ 1RHPA 2RHSB 4OELB 4PMCA 4MIUA 3CD6A 1I3QB 2DJFC 3S15H 3OWEB 1L1OA 2B39A 3RN2A 4JYAQ 4R4OA 3E3XA 3IFDA 3PO2G 1HNWL 2UUBQ 3S2HB 4Q5VA 1G51A 2YTYA 4BY1G 4CDCC 4PZ6A 1ONLA 1CT1D 1EY6A 2DUDA 2BH8A 3K0YA 1V1PB 5KYLA 4L5TA 2HDMA 4A3DG 3M3YB 2JEBI 1XNQQ 1IHZA 4YHHL 2KEDA 4A3BB 2F3WA 4A3IB 4C3IB 3I4MB 3VR4A 1SYBA 5HY6A 4JI2Q 1JWUD 5HGTA 2OTLA 2K5WA 4RKBA 1WYDA 5DLQE 1EY7A 5C4JH 1Y1VG 4UDUC 1KLGD 2PYKA 2NYZD 4LFCL 2KUMA 4OIKA 3S16B 2QF7A 3IAYA 1JJGA 4K0KL 1T9HA 3OIPA 1PLFA 5IP7H 4TVAB 4X66L 1UEAB 1X3PA 4LF7Q 3NBIA 1SJED 3WWVA 1FVIA 3EA6A 2JXMB 1D5MC 1UE5A 5KNDA 4XYOA 3J81L 3HP3A 4A3CG 2VQEL 4PG3A 2JA7G 1IBMQ 1O7ZA 2KVMA 2JYOA 1U0LA 3U9SA 4C1NI 3A54A 3S9WA 5C44B 1GUOA 1AZPA 3QG1A 2VB2X 1I4XA 5C4XB 4TSSA 1CKOA 4JI8Q 4B9XA 3K0XA 2L11A 3S17H 4AYBE 2JA6H 3DLLA 3Q22A 1Z9FA 3RLFA 4NXNQ 1IYUA 4K5XA 4PNYA 1TWGB 2EJGC 4C3JH 4GS3A 1EIHA 1KRSA 1VQGA 2K1BA 1TWAB 5HURA 1WJJA 2MPMA 4CJ1B 4DAMA 2TMPA 4X65L 5C3EH 1KIXA 2KCMA 4GNXA 3LWUA 4ZK9B 3GTOB 4BBSB 5M5YB 1DOLA 2IJ0A 2PMZE 3TS0A 1D1KA 2HQEA 3HOYG 1FNVA 4ABNA 2IPKD 1RDPD 4K6LA 4BBRH 1EIGA 4N8FA 1TR5A 2K5DA 4YWLA 5IIFA 4HSVA 4A3GG 4DR5Q 1SFOB 5IY0A 2D62A 3T1HL 2EYOA 3RZDB 3F2CA 1GXDC 2B8FA 2BA1A 2Z8LA 3T13A 4X3KA 1C4QA 1IBKQ 1K8OA 2DGYA 4DUYQ 4AIMA 1LO5D 1V8QA 1S4ZA 5FO9B 1YIJA 1GJXA 3I4LA 1O80A 1V1PA 4LFBQ 1EY5A 4HEDA 3JAML 1BKBA 1OXTA 3TBIB 3Q6SA 2D0PA 2B3GA 2JN4A 4CDDC 3SVMA 4ZLTF 1YNJD 3GTKB 4DA2A 3AEVA 1STYA 3ZJYC 5EAYA 1A8VA 5LMNL 5KNBA 4A3JG 2PQEA 2XNAC 2E2HB 4N9TA 1PYBA 1XNRQ 4DF7A 1PA6A 2UUAQ 1H95A 2UXCQ 1Q46A 1UUPA 5FOBB 3TEHB 1JR0D 3K7AB 1DXMA 3DM3A 2A1AA 4KY7A 2RQXA 3GTPB 1FGBD 1EEFD 3P1HA 4NP5A 1RTNA 1LTGD 4DV3L 1PH4A 2SNMA 3TREA 1GUWA 4DUZL 4OHJA 4CDFC 1HFNA 3OW2A 2WB1B 2F0NA 3R3OA 1PZJD 2L15A 2F0FA 4DR1L 3K5NA 4DPGA 1S72A 4JI3Q 4U673 2B63B 3FHWA 3NELA 1DOKA 2Z6KC 1LTID 3BG3A 4ZQ3A 5HGQA 1STAA 1HCZA 2R7ZB 4ZUIA 1SSOA 1B44D 4P75A 4C3HB 2JA5G 4XYQA 5JAVA 2HT1A 4RGMA 4B3SQ 1TKWB 1A63A 3SK6A 4ZUJA 5FJ8H 3BVZA 1J6QA 2A19A 1PTOF 3RMHA 3KDFB 1G291 4LF6L 1BBWA 3HZXA 1X65A 4JI4L 2NZHA 4C56C 1EWHA 4JK1C 4MTKA 1QUQB 4DV5Q 4QY7A 3DWQA 5IP7G 3GTMB 1PH9A 4A3MH 1WTPA 3P75A 2WAQE 3VYRA 1G91A 1KRTA 3H6MA 4O2DA 2A69C 5M9OA 3U50C 5M3FB 1BBXC 1C9OA 1EQTA 1XTCD 2OQ0A 1B53A 1SNQA 4QCLA 1OXUA 4LF5L 3I55A 2FMCA 3J7AV 2A6HC 1B4OA 2VZAA 4XT3B 4JCVE 4A93B 4HIDA 1UE1A 3KLSX 4RH6A 1Q1BA 2QEXA 2XWBB 4C3JG 4GOPC 3VR5A 5DAUA 2R92H 1BCPD 3W1GA 3J80E 3K80C 1MIUA 4IFDJ 4RGNA 3W3AA 5C3EG 2KECA 1C8CA 2DY7A 3DEPA 4V190 1UE7A 1TS4A 5KYIA 4L6TB 4QL5A 3KLSA 5JVH3 4YHHQ 2EY1A 3HS0C 1GUGA 2D0OA 2RDHA 5I4DA 1SE3A 1DOMA 3AYHB 2CQOA 2R93G 2J7ZA 1YNNC 4JBKA 4YIJA 5M3MB 1N33L 3A8KE 1O7YA 4GOPB 1EYAA 3ERSX 1HR0L 1ILPA 4UP7A 1S5ED 1STBA 5EJWA 1X32A 3R8BA 4NKLA 2NN6H 2F0EA 4L5SA 1LABA 2EYJA 3CC4A 2DNEA 2RBMA 3Q24A 3KJOA 1WCMB 4QJFA 4A3EB 5FLMH 5IOCA 1PHJA 5I9PA 1EFWA 2L5TA 1J5EQ 1CKNB 1H9KA 2RCFA 1E7ZA 4DR4L 2KBNA 5LL6X 4LMQD 3BDCA 4IPCA 1JWSD 5IWAL 1SJHD 4H02A 5CBAE 1I4QA 4EQ5A 3HOUH 3PSIA 4A3FB 1AZQA 3RLNA 1PH7A 2V1CC 2IWHA 3CCMA 1CHQD 1JJCB 3X3NA 3HOXG 5ELDA 4NB3A 3X3MA 4JYAL 3TP8A 1I6VC 4IUUA 3C1FA 1BUVT 4N9PA 1BCPC 1QUQA 2Z6KA 5KEEA 3CQZH 4GN3B 2F0GA 4BWGB 1AE2A 1H9SA 4HJ9A 2N49A 3R2TA 5FO8B 3ER0A 5EKLA 2R61A 4HJ7A 4P2CB 1PFBA 3PV0A 3K6OA 5IT9L 4X62Q 1STHA 4M8AA 2RCNA 2N8NA 4MNOA 4JI2L 2QEJC 3TP6A 4A3KB 3J81E 3FKIH 1EY8A 4E6IA 5EPLA 2NN6I 1NBWA 1BCPB 3F8TA 4KY6A 3S1RH 3N6RA 3SXHA 2EPBA 1CQFA 1VCIA 2I5HA 5CC4A 2Q8RE 5FJ8G 3ND9A 1SYEA 3S2DH 4B08A 3A7AB 1L0XB 3CXCA 2AUJD 3T16A 1V1OA 1BO0A 1VQBA 3D8GA 4RKLA 3GTQB 5K36H 3E5SA 1QJOA 1WTVA 1N8RC 1PMRA 3H15A 1MBYA 1Q3LA 2GA4B 5EPKA 4JI8L 1CUKA 1KD1C 1U4PA 4GOPA 1TY0A 4KD4A 2E75C 3G48A 1KAAA 3BJUA 3D6WA 1GHKA 5A35A 2EXZA 2A6ED 3PO2H 4LF8Q 1STEA 3ULPA 3HOZB 4DR7Q 1C7YA 1KDBA 1F2ZA 2CH4A 1K8AC 1NE3A 5ISRA 4DV3Q 5GAGC 1YVCA 2IX3A 4DUZQ 1II3A 4A3IG 2IHFA 3OW7A 2Y0SG 1LT3D 1CKNA 4JI7Q 3I4MG 3EJIA 4FP5D 4DR1Q 2R92G 1ENFA 1VQ6A 1ILQA 1LTBD 3E0JA 3BVMA 1VQNA 4WJ3M 2CHBD 1PFSA 3L3OC 4HIMA 3KJPA 4LUZA 4DR5L 4LUVA 1Y1VH 5CV6A 2EVBA 2JA8B 2NVTH 3JAME 1SLJA 2E5LL 5EKKA 5JJKA 2VB3X 3J7YW 3K5LA 2RF4A 2JA6B 3TQYA 5F2DA 3M4QA 5JEAG 4ULLA 1JCKB 1IBKL 4XXEA 4LF6Q 3STBD 4DUYL 1A2UA 3VYTA 4RCNA 1CSQA 1V43A 1A3VA 2JA7H 4LFBL 4CDEC 1G2TA 1D1IA 2Q2UA 2FHTA 3HKZB 3V2TA 5IODA 4DV1Q 3OMGA 4DAVA 3F2UA 1G6ZA 3GV3A 5FLMG 4KI0A 1PDQA 4BY7B 2QCPX 1E1OA 3K5OA 2ENBA 4APVA 4DNRB 4R1JA 2B29A 1FD7D 1X56A 3A5ZB 4QIWE 5K5PA 2E2IB 3NBHB 5G3LD 1I50H 1XNRL 3I4OA 2UUAL 4MHEA 2Z9HA 4KMUC 3CCRA 4FF1A 4BBSG 2HCIA 3CCEA 3GP7A 3S1MH 1PYSB 1LT4D 3GTLH 2IW3A 4C2MH 5NUCA 1JC7A 3HOYH 3W1BA 2KEEA 4G7ZC 1GO3E 2Z4HA 3ERQA 4IPDA 4ZYSA 2HIXA 1TWCH 2VS1A 4JI3L 1HZ9A 2K04A 3URYA 2AMCB 2PZWA 4A3GH 2PI2A 1YHBA 3G71A 3PUWA 4I65A 3MC0B 5FLXc 2BH2A 3ITPA 2SNSA 5FKAC 4KD3A 2KA7A 1K83H 4DN4M 4C1NK 1TXYA 4UAIA 4CJ0B 3A7LA 4HIOA 1EFID 4B3SL 4RGOS 1CZWA 4A75A 3R93A 1S5DD 3FKIG 3CPWA 2F0OA 2XRSD 2Z1CA 1HR0Q 3J80L 3STBC 4UP8A 3SHLA 4BS9A 3HOVB 1PVOA 2N88A 2ZJPA 2WKCA 4YY3Q 5CGKA 5LL6S 1MSHA 1XYIA 1BDOA 2A73B 1HUMA 2I0QA 1VQ4A 2Y0SE 4DV5L 1RKNA 2NZOA 3OTOQ 4FF3A 3LNNA 5C0XG 4K8IA 1VQEA 4A3JH 3EROA 3E0EA 1JMCA 3J7A5 2X6GA 5K36G 5EBDA 2EZVA 1PRTF 2L4NA 2L1BA 3KLWA 3EQLC 1CKMA 1H9MA 3G7LA 2EYLA 3KF8A 1VQ9A 1V9PA 2Q8TA 2JE6I 1YJNA 1XPOA 5D14A 3K81C 3HOWB 1GKHA 1XJVA 3GTGB 2B63G 4O1NA 3WDNA 2AQ3B 1DD2A 5KIXA 1B9MA 1L2FA 1LLRD 3AFPA 3OMCA 1I6HH 2R7ZG 4LK1C 1H9RA 2JJQA 1DYQA 1HNZL 2CVRA 4DU9A 4KV6A 2HD3A 5A2QL 1SYDA 5I6WA 2JA5H 1EY9A 2AKWB 3NBHA 2F4IA 4RMFA 3CMAA 2ASBA 1HUNA 4ZKBB 1A6XA 4ZKCB 4WFN3 3DUZA 1CSPA 5IYBH 1A15A 1LT5D 3A0JA 4PMWA 1QNKA 3H0GG 5D65A 1R4PB 2PCFB 2K4KA 4LF9L 2J0TD 1K9MC 1F9RA 4EQPA 3KBGA 5M3FG 3S1QH 3Q0AA 1H9JA 3BZCA 1S40A 1DCZA 5BR8L 1J5EL 2HUGA 4HAEA 3TZUA 1K0SA 2CH4W 1ZKOA 5M5WH 1U4RA 3D0FA 4DAPA 3CHBD 3TMEA 4ME3A 4A93G 4H0LC 5CYUA 4JV5Q 2B2VC 4GLAC 4I7AA 4IJLA 1GOZA 3DHQA 4JOIC 1ASZA 1M4VA 3TDQA 5IT9E 4L5RC 5BN4A 1D5ZC 2A5HA 3QJYA 1XPUA 4OONA 4ALPA 1E1TA 1VQOA 2NVQH 1Y1WB 1EQQA 1AFPA 4AH6A 1IYVA 1B3AA 1K8MA 1KABA 3U4ZA 4GKJQ 1PH1A 3DM1A 4JVZA 4K8JA 2NVYH 5M3MG 2KCTA 4IO9A 4OO1G 1Q90A 3H3VH 3CAMA 1VMPA 1B8AA 4X62L 2R93H 3ULLA 1TS3A 1EY0A 3J7ZC 3MXGA 2F03A 1V1QA 4Q0FA 3MXPA 4RWSC 4XDXA 3I4NB 1U4MA 2NBFA 2WACA 3I8ZA 3IL8A 3SE0A 4CGYB 2E5LQ 2ICEC 2RKSA 1EWCA 2OF1A 1TWHH 3MXUA 1WTOA 1VS0A 1PH8A 1Y8OB 3NQIA 2VUMH 2KCCA 1FGUA 3HRZC 2XSCA 2ATWA 1AW7A 5E1FA 3L7ZC 4KLKA 5J1ZA 3F2BA 2OQKA 4IJHA 5I6YA 1Q82C 1TWFH 4WRDA 3F2DA 3I56A 3S14H 5IGBA 1BBUA 5ELFA 2B2YC 1EOTA 2K5HA 4P71A 2PZTA 2K33A 2K5VA 1K73C 4HN7A 2HQLA 1FJGQ 2NVXB 4KK7A 2EE1A 1W6JA 2YV5A 2A69D 1MD2D 5T1GA 1DZ1A 1BXTA 2MO0A 1RODA 4AYBB 3PUXA 1NAPA 4YCVA 3HOXH 3I90A 5IGFA 1X3EA 5FK9C 4LF8L 2A6HD 5DM63 1KAWA 1JB3A 4DR7L 2F0HA 2Z4IA 4GN4B 2C9OA 3A74A 4Y7NH 3S1NH 2O4XA 1X3GA 4K5VA 3CCSA 3K58A 3GQBA 1S5CD 4L5QA 2XIWA 2EYPA 3H3VI 1HPCA 2PMZB 3HGBA 5E4XA 4JI7L 2C5CA 3CU7A 5M5XB 1AN8A 3DMUA 4A3KG 2F0UA 2F4VQ 1PFNA 1WOCA 4BA1I 1TU2B 2B2WC 2JP1A 4NXMQ 3V05A 1XX8A 4DR6Q 3M4OH 1E2VA 4OIJA 3M4PA 2R6GA 4BA2I 3UDFA 1SYCA 3N52A 2N55A 4A3LH 4IUVA 4S3SA 4KKUA 1R9TB 1E24A 2E2JB 1VQJA 1YNND 4OL7A 4RG1A 5CORA 5CR3A 3UDGA 1WTXA 1NNXA 5IYBG 4BY1B 1RD9D 4JPBW 3QIAA 1PV4A 2B2VA 5E3FA 1I3QH 3D4DA 1LUZA 4HJ8A 4XT1B 4DV1L 4A3DB 3H91A 1TS2A 4JOIA 2BE5D 3EBEA 2B2UC 3S2HH 3L2PA 1WTWA 3HOZG 4HR7B 3L9AX 1CM9A 3BDLA 3QOLA 5JEAJ 3RUZA 5IGEA 5CV8A 2E8GA 3M7GA 2WP8J 1KNEA 5I2XA 3M3YH 3MWYW 5E7NA 3OWFA 5JPNC 4A3IH 1JE4A 1D6EC 1LTSD 4C3IH 2F0IA 3F1ZA 3I4MH 2DY8A 3DWAA 2ZXRA 3BDOA 1QG7A 4NDXA 3MTSA 1RIPA 3UI2A 1LTRD 2MFIA 5C3XA 1WD0A 3NQTA 4XTCS 1HNZQ 3TP7A 3CCQA 4KN7C 2AQ1B 2LY7A 1ICWA 3M4YA 5T1IA 1PTOC 3EIVA 1JOKA 2K01A 1B2TA 5C6AA 1WD1A 1HZAA 1OO9B 4DFAA 3U58A 5LMUQ 3K59A 1G2SA 4KJNA 5JJIA 5JEAH 5LHY1 2B2YA 1VQAA 1YHAA 5CMDA 3J7AF 4B3RQ 1XPRA 3GTJB 4CKEA 3SGIA 4YY3L 3ND8A 5DNFA 2VUMG 5EPJA 4BY7G 5C4XH 4LF9Q 4Y52H 5LMNW 1I4RA 2OT2A 5CV5A 1BQQT 4UP9A 1PTOB 2WAQB 1VQPA 5BR8Q 2BE5C 3OTOL 2KJXA 1EY4A 1UNSA 1TWGH 3HFZB 2ZTCA 1ZYRC 2UXBL 1L0WA 4YCUA 1Z7TA 1SRUA 5ELNA 2MO1A 3AB9A 1TWAH 1DONA 4CHTB 3MA2B 1BF4A 3M85A 2Z0SA 1XWEA 3K8AA 3GTOH 1SDFA 4BBSH 5M5YH 1Y8PB 5KNCA 1E3PA 1NR2A 5A2QE 1I4GA 1FNWA 2CW0C 3OOCA 3VA5A 3KDFA 5IGDA 1JOQA 4JBWA 4LFAQ 2QW7A 1YBYA 4RAUC 1MI2A 1TIID 3CW2C 1Z6HA 1F9PA 1OXVA 2SOBA 5ELBA 1D7QA 3PCOB 2B2WA 4R4TA 1T5XD 5IP9G 5DEHA 2KCNA 3A56A 1SFOH 2JA9A 1HA6A 1CQVA 4G57A 1K0RA 1VQ8A 1AH9A 4DR2Q 3RZDH 3FEWX 5L37A 3VDYA 4JBJA 1VQFA 1SNCA 3RZOB 3BZKA 1VQIA 2EJFC 3K57A 1O7LA 1L0YB 3D3RA 4JC0A 3PO3B 4QMGA 1C0AA 2OCEA 2HDLA 3MEFA 4AQYQ 3HOVG 4LUOA 5JOBA 3CCUA 2NZ1D 1LYLA 2O5IC 1P16A 3VR6A 3D4WA 3CKIB 1OTCA 3VA7A 2K5NA 5JPMC 4A3LG 1Z47A 2OXPA 3S15B 1U5KA 3GTKH 1HTPA 4NPSA 4PV1C 4F88A 4DV6Q 2B2UA 2QKIC 2HHHQ 1B3QA 1TQOA 1AP0A 3NSWA 1HZBA 5C0XH 2L0CA 2EQSA 1EYDA 3KF6B 1HNXL 1I6HB 1CFMA 1VDZA 1N9WA 1CA5A 1Q8KA 3D4RA 3K7AH 1ESRA 4FXDA 1MJCA 4EQNA 1KQSA 3GTPH 2QGQA 3GD7A 1JQYD 2K5QA 3HOWG 1Y14B 3I7FA 2NWGA 3BYTB 4JV5L 1B9NA 4LF4Q 1PYWD 4FXKC 3NWSA 5FLXL 5D3DA 1YZ6A 1YHQA 4OEMB 2YU9H 3RN5A 5C4JB 2B63H 3A8JE 4ZRZA 1STGA 1ICFB 3GV6A 1KC8C 4ILWA 2ALYB 2R7ZH 3IKJA 1NR4A 4LJZC 3E9IA 4RGTA 3PIOA 4A3BG 4C3HH 2GN5A 4C3IG 4QF4A 1EZ6A 4GKJL 2JEAI 5TSSA 2F0VA 1GUTA 1EOVA 2M2LA 2OEOA 5I9OA 1S5BD 4NW2A 4ID6A 4J8QA 3FVQA 3EFXD 1A62A 1BR9A 4R9WA 1HR0W 2Z6BA 1RF2D 2L12A 4FVMA 1EYCA 4JBMA 1JORA 2Q2TA 2K7VA 4P73A 2XGTA 4K2KA 5I2YA 3PGZA 3GTMH 3S17B 2EOTA 1QOHA 2GVBA 3H0GH 3I3CA 3ULJA 2H4OA 3PIPA 4X6AH 3NWTA 1JE5A 1SAPA 4MZ9A 5KRUA 3MEHA 5C0XI 1IL8A 3BYYB 4KHPL 5CV7A 1M1KC 1HHVA 4C3JB 5M3FH 4JI0Q 1K28A 2A74C 2PQAB 5C44G 1WTHA 3J81j 2NVQB 2M00A 2RVLA 4B9WA 3AMUA 1U9RA 3CP0A 5C3EB 5C4XG 1NJIC 2F0MA 1KLUD 3FDTA 5JVG3 4A93H 2CCZA 1FJGL 1O78A 1KL9A 1C48A 4BBRB 1PFMA 2E76C 1QB5D 3IFTA 3VR2A 2IT1A 5GAEC 5EKIA 4X64Q 1RCVD 2P5ZX 4ME5A 2PZUA 4B3MQ 4DR3Q 3CCLA 1Y1WG 4F8MA 3R2IA 3NE5B 2I46A 3OYYA 3H09A 4DV2L 1QILA 4JI5Q 2IY5B 1Q7YC 2OWOA 3EVQA 1Q12A 4KY5A 4OWTB 4IFDG 5M3MH 2UXDQ 4OO1H 4QQBX 4IUQA 2F4VL 2KHSA 5GROA 4YWMA 2UU9L 1W3SA 2F0WA 2XN9C 4DV0Q 4NXML 2K52A 4DXGA 1QVCA 1M90C 4DR6L 4MTNA 1CI3M 3G6EA 1HTLD 5G3LF 2AQ2B 1GUNA 1WCMH 1VF7A 2K14A 2DN8A 2Q2HA 2NTTA 2Q2IA 5E4WC 1D5XC 3DEOA 1HZCA 2YTVA 3A8IE 1TS5A 1K3BC 2WIIB 3MVVA 5IYCG 5DM73 3K5MA 1CZGA 1EIFA 4U68A 2QA4A 4A3FH 1R4QB 1AEXA 2G5DA 1K3RA 3D6CA 1XTDA 1OXSC 3FMCA 1BNZA 1HQMC 1F9SA 2UXBQ 1HXYD 1MHWC 1JICA 3CPFA 1I4PA 4QIWB 1KDAA 1FR3A 1SMYC 3ZYYX 3QOJA 4PQXA 3T1YQ 4XQQA 1QVFA 1BOSA 2B2TC 2TSSA 4R4IA 3W2DA 2AWOA 4DK6C 4F87A 1VQDA 1QZHA 4GNXB 2D2CC 2WB1G 3UDIA 4OO1I 2ES2A 4JI6Q 1F2LA 2C35B 2BOSA 4IURA 4RCOA 3OIQA 4G7HC 4A3KH 1NCVA 2MHVA 1KXLA 1UE6A 5AJ3L 5J39A 2LS01 2K03A 4IZ8A 4PZ7A 2F0JA 1VQKA 1Q1EA 1EZ8A 4C3HG 2A68D 1PH5A 3PQIA 1QZGA 4EX5A 4A3MB 2SDFA 1VQ7A 3SK8A 3Q23A 1WTRA 3NTHA 3PF4A 3J80i 1W2BA 4KN4C 1STNA 3K7UC 4XQNA 1N34L 1IBLQ 5LMUL 2AUKA 2ZTEA 1AE3A 3GO5A 2EXDA 2X69A 1ET9A 1KHIA 2R7DA 2LXKA 3VYUA 1SROA 2CFMA 2WINB 3CCVA 3NHHA 3GTQH 4B3RL 4FF4A 2AHOB 4RHRA 1IL2A 1EU3A 4OWXB 1U4LA 3RNUA 2Y0SB 3RD4A 2FXQA 4CBVA 4DGZA 2PW5A 5COYA 4HCEA 1S5FD 1HNXQ 2R92B 2ZTDA 1PRTC 1SEBD 3MXNB 1SBBB 3L0OA 3HOZH 4GKKL 2YTXA 4EGVA 4DV4Q 2WV6D 3EN2A 1ET6A 3I70A 3PUVA 3PMFA 1KDCA 4DXFA 4J15A 3A5UA 2XTIA 1Q81C 1E0BA 3AQQA 3TRZA 2IHEA 4LFAL 2OTJA 1SYGA 1MSGA 5J22A 2CKZB 1PRTB 4LWCA 3QB3A 4R4QA 1N32Q 1JOOA 4N8X1 1GM5A 1VMCA 3V96A 2JA8H 3CC2A 1CHPD 2LFNA 1J9OA 3J80c 1N36Q 4DR2L 2PNHA 2ZXOA 2A68C 3AFQA 4EQOA 1SMXA 2N78A 3BS1A 2XVSA 1VQMA 2J4XA 2QDBA 1XMOQ 3TP5A 4DV7L 2KHJA 3HEJA 2FINB 1MGSA 2HCCA 2JK8A 2LMCB 3T51B 2ZM6Q 2O2LD 4WJWA 1TY2A 4AQYL 1I4HA 2KOLA 3I72A 2K05A 1EIYB 1P8LA 4A76A 3LX0A 3HOUB 1WCMG 2VXWA 3ONAB 3FPUB 4A3EG 3NUCA 2WAQG 1HA5A 2WB1E 4HTHA 3J81i 4BY7H 4KHPQ 1I94Q 4DV6L 4HCSA 4IUPA 4NMZA 2HHHL 4A4IA 1LTLA 4OXPA 1CK1A 4RA8A 5FLXE 2MP1A 1CTMA 3CQZB 2E2IH 1W6KA 4IOAA 5JJZA 1YJWA 2CWPA 1O7IA 3T4AC 1WTQA 2B2TA 3CC7A 5EQ0A 4A3FG 3D31A 1GD7A 1EYGA 1JB7A 4OX9Q 1NUCA 2MUYA 1F77A 3H94A 4DK0A 1X9NA 4LF4L 3T56B 1VQCA 1M8AA 2H5XA 3OHXC 4KTAA 3FKIB 2F0TA 5IP9H 1JWMD 2F52A 3S1RB 4DV2Q 2UUCL 5C4ZA 3DWPA 4QUCA 4GLXA 1EU4A 4I7ZC 1QCBD 2IL8A 4X3SA 2KHIA 3TS2A 3CMEA 3PO3G 2V4DA 3MXNA 2LSSA 5IYDG 1F2MA 2PPBC 3S2DB 4ODGA 4ZAIA 4H44C 2RSOA 1MJEA 2WKDA 2R7FA 2UU9Q 3HOVH 3C1EA 1FYCA 2VQFL 2ZXPA 1X55A 1NMFA 3J81c 2B8GA 2FJ2A 4TKOB 4CJ2C 1PTOD 1DGSA 4KHVA 4J6HA 1XXGA 3VYSA 4QB4A 2F0SA 3NENA 4FYDA 3E6ZX 3JAMi 5ELOA 2BDOA 5BN5A 2YU9B 3PO2B 2I5LX 4KJOA 1GUSA 4JI0L 2X6LA 3TZDA 3WOEA 2NUCA 2KQ3A 4IUTA 3UE1A 4HIKA 3VR3A 1VQLA 1PH2A 3S24A 3M9BA 4YWKA 3HOWH 2K28A 2RHQB 3GTGH 1ZYRD 4QUFA 3I91A 1ENCA 1UEBA 2QDLA 4X64L 2EY5A 1HRJA 1NSNS 2CQAA 4B3ML 4DR3L 1Y1VB 1XMQL 2E74C 2NVTB 1HFGA 2F1MA 4HMJA 3C46A 1A2TA 2QILA 1QWYA 2F0KA 2SEBD 4UHVA 1YNJC 1JJ2A 2D9UA 3H0GB 2EYFA 2CW0D 4JI5L 1H9SB 4FF2A 3HG9A 4A3BH 3PF5A 4B3TL 4HJAA 3G4SA 2RA4A 4RFBA 1SXTA 5C5LA 3NK9A 2ZT9C 1YJ9A 3ICEA 2RDGA 4DAYB 2UXDL 2MJ8A 3NPPA 5AJ3Q 2JA8G 2JA7B 3SK5A 5GQOA 2DNCA 2M9VA 1Y69U 4YCWA 4H7BA 3S16H 2O5JC 5BN3A 2PW7A 4DV0L 1B7YB 4JI1L 2JA6G 3JC66 3JAMc 1HNWQ 2H1EA 2LKVA 1QE6A 1VQHA 4JW0A 4TQUS 1N34Q 5JJLA 1D2BA 1HJPA 1HQRD 3CRKC 1EEID 1KTKA 4XIGS 4QGUA 3QO2A 1WFQA 1VF5C 4O42A 2L55A 1J8IA 2BA0A 1YNXA 2G9DA 3KLRA 4WORA 2VY3A 1I50B 3NEMA 3HKZG 1I5FA 5C44H 1ASYA 1SNPA 2RSNA 1BCPF 3S1MB 3GTLB 4C2MB 1LT6D 4BBRG 1A3TA 2MQHA 2D5DA 5ELCA 3LWEA 4UY8C 3HOYB 3PUZA 2RDFA 3G6JB 4HJ5A 4IQZA 3CRLC 2IX0A 4HMIA 4KKTA 4GKKQ 4MN3A 1TWCB 5KGUA 4LFCQ 3KFUA 3P7JA 4M1UB 4FXGC 1VQ5A 4A3GB 1Y1WH 2I5MX 4K0KQ 2F0QA 4X66Q 3T1YL 1K83B 1PZID 2ZJRA 3SR1A 4POGA 2Q8IB 3C3LA 2VQEQ 4PZ8A 1T5EA 4JI6L 4IFDH 1ENAA 1IW7D 3I4NH 1RL2A 2R3ZA 5C0XJ 4K2LA 1SNOA 2EJMA 4IALA 3I2ZA 2PI2E 4R4CA 3IRBA 5J3BA 4F7XA 2G9HD 3FRPB 2IX1A 3NTIA 1X6OA 4Z9CB 1RJTA 3E9HA 1PH3A 5ELEA 4DV7Q 2K6AA 1HH2P 2NTSA 4BXXH 4A3JB 1LTTD 2FMMA 3NTKA 2UUBL 5AFWA 1IBLL 1G8ZD 4IOCA 3KUPA 1UWVA 2BCOA 3I73A 4P72A 3MAQA 4X65Q 1ESFA 2XWJB 3B6YA 2EY6A 1NY4A 1E22A 2NVXH 4OWWB 5IYCH 1XNQL 2E2DC 5FO7B 1CA6A 4POFA 4DAYA 2PNRC 3SK4A 1B1ZA 5CV4A 2E2HH 4WJ4A 2F0PA 1NTGA 4DK1A 4V0BA 5C3WA 3T1HQ 3Q8DA 2EYMA 4DV4L 4P74A 4ZCKA 3U9OA 5GADC 1IZ6A 2JA5B 1QVGA 4IFDI 1DJRD 1PZKD 3UE0A 4LF7L 5M5XH 3LGJA 2KENA 4TRDA 3HKSA 1ZEQX 1SE2A 2AWNA 4UPAA 4KHZA 1IW7C 3HKZE 1IBML 4J1MA 4G4KA 1PXUA 2UUCQ 1IKMA 1N32L 1E2WA 2VNUD 4A3MG 1LTAD 1EQVA 1EQRA 4KKSA 3SDZA 2GVAA 3W5OA 5LMNQ 4LW1A 1N36L 1S3OA 1R9TH 2E2JH 3MFGA 1TVXA 2EYHA 4FDBA 3S1QB 1EUJA 3KBXA 2I07B 4NXNL 2N3SA 1TT2A 2VL6A 3MFYA 4DNTB 2EDGA 1XMOL 2ZM6L 5IE8A 3C2PA 4BY1H 5M5WB 2VQFQ 1Q8IA 4IUNA 2JSOA 3O13A 1SR3A 2WFWA 1G6PA 4A3DH 4RHSA 4IPGA 4CKCA 4IN3A 1L1OC 3H3VC 1Q86C 2MGSA 2YYZA 1I94L 5EGTA 3QWNA 3OPOA 1JT8A 1EL0A 5C4HA 5C5MA 5IGGA 1B70B 1SYFA 4K14A 4DK3C 5GAHC 3FP9A 4FO2A 4CKBA 1EWIA 1IKLA 3OSOA 4DNIA 4L8JA 5D3IB 1E2ZA 1SE4A 1ZXTA 2NVYB 3KF8B 1YITA 4OX9L 1FL0A 1L1OB 1GHJA 4R8NA 3CF5A 2R93B 3UDXA 3CCJA 3BU2A 3NXWA 1UAPA 4JI4Q 2XRQD 4A3CH 2JQOA 2ID0A 1SN8A 1XMQQ 1SMYD 5IT9c 1FNUA 1ML0D 2NN6G 4PMBA 2ZJQA 3U4VA 1F9QA 1TWHB 3RLOA 4GZYC 1LV9A 1IYJB 2VUMB 3KK7A 1A0IA 1X3FA 2K32A 5CBEE 4B3TQ 4R8IA 1D8LA 2F0LA 3KF6A 3TN2A 1X54A 2LXJA 1Y8NB 1YEZA 1TWFB 2L9HA 2PO4A 3PIO3 3I4NG 3WOFA 2EY2A 2A6EC 4LF5Q 2A8VA 3S14B 4LNQA 2DJGC 3T53B 2NB0A 1SNDA 1SNMA 3SEBA 3GTJH 3MZ5A 2UXCL 4K5WA 3KOJA 3HOUG 4JI1Q 1SE8A 2VW9A 2F3VA 1WI5A 1A3UA 4HSPA 4A3EH 3KYHC 1LM0A 2HIVA 1PTOH 2F3IA 4JG2A 4BXXG 4EVOA 1IXRA 2MNAA 3HOXB 4G7OC 1MKHA 3PIP3 3RR5A 4K6DA 4OGQC 5H1SE 4Y7NB 3S1NB 4L63B 2BDNA 3DXJC 3P20A 1RTOA 4DKAC 5IGCA 1QNUA 4GNXC 2CWAA 3GDEA 1PH6A 2EIFA 1OXXK 1DM0B 4AYBG 4X3TA 4FNFA 1WVLA 1N33Q 3QR8A 3AU7A 1PRTD 2F0DA 1BVSA 1X3QA 3NP8A 3FPPA 2K50A 1F2YA 4H13C 4GLVB 3TSSA 3BVGA 1KNAA 1LACA 3PUYA 3M4OB 3BZDB 3M7NA 4O0AA 1NMGA 1YI2A 2ICIA 3RZOH 3A55A 3MHBA 1K8GA 4XQJA 2PQAA 3PO3H 4IPHA
chains in the Genus database with same CATH topology
4DR4Q 4DV3Q 5IYDH 5GAGC 4A3FG 1GVPA 2K75A 1YVCA 4DUZQ 3D31A 4A3IG 1GD7A 2IHFA 4GN5A 1EYGA 2Y0SG 1VQAA 1CKNA 1YHAA 4JI7Q 3I4MG 1JB7A 4OX9Q 4B3RQ 1XPRA 5IWAQ 1X9NA 2RHSB 4LF4L 3SGIA 4DR1Q 4YY3L 2R92G 1VQ6A 2VUMG 3CD6A 1VQCA 1VQNA 4BY7G 5C4XH 3S15H 2H5XA 4WJ3M 1L1OA 1PFSA 4LF9Q 4Y52H 4HIMA 5LMNW 3KJPA 3RN2A 5IP9H 4LUZA 4R4OA 2F52A 4UP9A 4DR5L 4LUVA 1Y1VH 1VQPA 4JYAQ 5BR8Q 3OTOL 4DV2Q 2UUCL 2NVTH 1SLJA 2E5LL 2UUBQ 1TWGH 3PO2G 3HFZB 1HNWL 5JJKA 1G51A 2ZTCA 4GLXA 2UXBL 1L0WA 2YTYA 4BY1G 2RF4A 4PZ6A 4YCUA 1SRUA 3TQYA 5ELNA 2KHIA 2MO1A 1TWAH 3CMEA 3PO3G 3TS2A 2DUDA 2LSSA 3M4QA 5IYDG 2BH8A 5JEAG 1IBKL 3M85A 2Z0SA 4L5TA 4LF6Q 3STBD 4DUYL 3K8AA 4A3DG 3GTOH 2JEBI 4BBSH 1MJEA 1XNQQ 5M5YH 2R7FA 1CSQA 1E3PA 4YHHL 2UU9Q 1V43A 3HOVH 3KDFA 2JA7H 4LFBL 4JBWA 4LFAQ 2Q2UA 1YBYA 2VQFL 3CW2C 1X55A 1OXVA 5HY6A 4JI2Q 1D7QA 3PCOB 4DV1Q 1NMFA 3J81c 2OTLA 4R4TA 1WYDA 5DLQE 5FLMG 5IP9G 4KI0A 5C4JH 1Y1VG 1DGSA 1SFOH 1E1OA 2JA9A 4LFCL 3NENA 1AH9A 1K0RA 1VQ8A 4DR2Q 3JAMi 5ELOA 4APVA 3RZDH 1JJGA 4R1JA 2B29A 4K0KL 1X56A 3A5ZB 4QIWE 2I5LX 3VDYA 1T9HA 4JBJA 1VQFA 5IP7H 3BZKA 3NBHB 4TVAB 4X66L 1VQIA 4JI0L 1I50H 1XNRL 4LF7Q 3I4OA 2UUAL 3WWVA 4JC0A 1FVIA 3CCRA 4BBSG 3CCEA 1C0AA 1UE5A 3S1MH 2OCEA 1PYSB 3MEFA 3GTLH 3UE1A 4A3CG 4HIKA 4AQYQ 3HOVG 4C2MH 1VQLA 2VQEL 4PG3A 4LUOA 3S24A 3CCUA 3M9BA 1PH2A 1IBMQ 2JA7G 1LYLA 1U0LA 1P16A 3HOYH 4YWKA 3HOWH 3W1BA 1GO3E 2RHQB 4IPDA 1OTCA 3GTGH 2K5NA 4A3LG 1Z47A 1U5KA 1CKOA 4JI8Q 3GTKH 2HIXA 3K0XA 1UEBA 4NPSA 3S17H 1TWCH 2VS1A 4AYBE 4X64L 4DV6Q 4JI3L 1HZ9A 3CC7A 3DLLA 2JA6H 1Z9FA 3RLFA 4DR3L 2AMCB 2HHHQ 4B3ML 2PI2A 4NXNQ 1XMQL 1YHBA 3G71A 4A3GH 3PUWA 5FLXc 2BH2A 1HZBA 4C3JH 2EQSA 4GS3A 3KF6B 1HNXL 1JJ2A 1KRSA 1VQGA 4JI5L 1K83H 4A3BH 1TXYA 1N9WA 4HIOA 3PF5A 1WJJA 1Q8KA 4B3SL 4HJAA 4B3TL 3K7AH 3G4SA 4A75A 4DAMA 4X65L 5C3EH 1MJCA 1KIXA 1KQSA 2KCMA 4GNXA 1YJ9A 2QGQA 3FKIG 3GD7A 3CPWA 1HR0Q 3GTPH 3ICEA 2PMZE 3STBC 4DAYB 1Y14B 3I7FA 4UP8A 3TS0A 5AJ3Q 3HOYG 3HOWG 4JV5L 1PVOA 2ZJPA 4LF4Q 2JA8G 4YY3Q 5GQOA 4BBRH 4YCWA 3S16H 4YWLA 1YZ6A 1YHQA 4DV0L 1B7YB 2I0QA 2YU9H 4JI1L 3RN5A 1VQ4A 2JA6G 2Y0SE 3JC66 4DV5L 4A3GG 2B63H 4DR5Q 2NZOA 3JAMc 3OTOQ 5IY0A 1HNWQ 2D62A 5C0XG 1KC8C 2ALYB 3T1HL 1VQHA 4TQUS 1N34Q 2R7ZH 5JJLA 1HJPA 4XIGS 1VQEA 3F2CA 4QGUA 4A3JH 1WFQA 3E9IA 2BA1A 3PIOA 4A3BG 4C3HH 2GN5A 3E0EA 1JMCA 2BA0A 1YNXA 3J7A5 2VY3A 4GKJL 5K36G 2JEAI 3NEMA 3HKZG 1I5FA 1EOVA 5C44H 3KLWA 1IBKQ 1ASYA 2DGYA 4DUYQ 1CKMA 4AIMA 1VQ9A 1YIJA 1V9PA 1A62A 1HR0W 2JE6I 4BBRG 1YJNA 2MQHA 4LFBQ 1XPOA 3K81C 4UY8C 1BKBA 1GKHA 1OXTA 3PUZA 4HJ5A 4JBMA 2D0PA 2B3GA 1XJVA 2IX0A 2B63G 2Q2TA 4P73A 2XGTA 3PGZA 3GTMH 4GKKQ 3AEVA 3ULJA 2GVBA 1L2FA 3H0GH 3AFPA 3PIPA 4LFCQ 3KFUA 2R7ZG 1I6HH 3ZJYC 1VQ5A 1JE5A 1A8VA 4MZ9A 5EAYA 5C0XI 5LMNL 2JJQA 1Y1WH 4KHPL 4A3JG 1HNZL 2I5MX 4K0KQ 1M1KC 5M3FH 4X66Q 4JI0Q 1PYBA 3T1YL 1XNRQ 2PQAB 5C44G 2ZJRA 1PA6A 2UUAQ 1H95A 3J81j 2UXCQ 4POGA 1Q46A 5LMUQ 3TEHB 2JA5H 2AKWB 3DM3A 2A1AA 3CP0A 5C4XG 4RMFA 2VQEQ 4PZ8A 3CMAA 1NJIC 4JI6L 2ASBA 2UXDL 1PH4A 4DV3L 3TREA 3I4NH 1RL2A 4A93H 4DUZL 1CSPA 5C0XJ 2CCZA 1FJGL 1KL9A 3OW2A 5IYBH 3I2ZA 3A0JA 2PI2E 2IT1A 4PMWA 2L15A 5GAEC 4DR1L 4R4CA 3H0GG 3IRBA 5J3BA 4DPGA 4X64Q 1S72A 4JI3Q 2IX1A 3FHWA 3NELA 4DR3Q 4B3MQ 3CCLA 1X6OA 1Y1WG 2K4KA 4LF9L 2Z6KC 1K9MC 3E9HA 5HGQA 5M3FG 1PH3A 3S1QH 4DV7Q 3BZCA 3OYYA 1HH2P 1S40A 5BR8L 4DV2L 4BXXH 4JI5Q 2UUBL 1J5EL 2IY5B 4P75A 1IBLL 2JA5G 2HT1A 4IOCA 1Q7YC 2OWOA 4B3SQ 4X6AH 1UWVA 1A63A 4P72A 5M5WH 4X65Q 1Q12A 4OWTB 3D0FA 3B6YA 5FJ8H 4IFDG 1J6QA 2A19A 5M3MH 1NY4A 1E22A 4ME3A 4A93G 2UXDQ 3KDFB 4JV5Q 1G291 4GLAC 2NVXH 4LF6L 4QQBX 2F4VL 4OWWB 5IYCH 1BBWA 1XNQL 4IJLA 1X65A 4JI4L 2NZHA 5GROA 4YWMA 4POFA 2UU9L 4JOIC 1W3SA 1ASZA 4DV0Q 4NXML 2K52A 1QUQB 1QVCA 1M90C 4DV5Q 4DR6L 4QY7A 4MTNA 3G6EA 5IP7G 2E2HH 4L5RC 4WJ4A 1PH9A 4A3MH 1NTGA 2WAQE 1XPUA 1KRTA 4OONA 1WCMH 4ALPA 3Q8DA 1E1TA 3T1HQ 1VQOA 2NVQH 4O2DA 2K14A 2Q2HA 1EQQA 2Q2IA 4AH6A 3U50C 4DV4L 4P74A 3U4ZA 1C9OA 2OQ0A 1HZCA 4GKJQ 1PH1A 1OXUA 5GADC 2YTVA 1IZ6A 4LF5L 2NVYH 3I55A 5M3MG 2KCTA 4IO9A 1QVGA 4IFDI 4OO1G 3UE0A 4LF7L 5M5XH 3H3VH 2VZAA 3CAMA 1B8AA 4X62L 3LGJA 2KENA 3ULLA 5IYCG 4JCVE 1EIFA 3J7ZC 3HKSA 2R93H 1V1QA 2QA4A 2AWNA 4UPAA 4KHZA 4A3FH 4HIDA 1UE1A 3HKZE 1IBML 1K3RA 1XTDA 2UUCQ 1OXSC 1Q1BA 2E5LQ 2QEXA 1N32L 1PH8A 1TWHH 4GOPC 1VS0A 2UXBQ 4A3MG 2VNUD 2R92H 1EQRA 3W1GA 2VUMH 2GVAA 1FGUA 3W5OA 5LMNQ 4LW1A 1N36L 1S3OA 3CPFA 1R9TH 3K80C 2E2JH 2ATWA 1MIUA 4IFDJ 3L7ZC 4KLKA 4FDBA 5C3EG 1EUJA 3F2BA 2OQKA 4NXNL 2N3SA 4IJHA 1UE7A 1Q82C 1TWFH 3T1YQ 4QL5A 3F2DA 1QVFA 2VL6A 4YHHQ 4R4IA 3I56A 2AWOA 4DK6C 1XMOL 3S14H 2D0OA 1VQDA 2ZM6L 5IE8A 1QZHA 4BY1H 3AYHB 1BBUA 2VQFQ 4GNXB 2WB1G 3UDIA 4OO1I 2K5HA 4P71A 2CQOA 2R93G 4JBKA 2ES2A 4JI6Q 2K5VA 2C35B 5JJIA 1K73C 1N33L 2HQLA 1SR3A 1FJGQ 4GOPB 2WFWA 3ERSX 1G6PA 4A3KH 1HR0L 4A3DH 2YV5A 4IPGA 4UP7A 1L1OC 1KXLA 1UE6A 5AJ3L 2MO0A 4PZ7A 1Q86C 1VQKA 3PUXA 1Q1EA 2YYZA 1I94L 4L5SA 1PH5A 4YCVA 3HOXH 1QZGA 4EX5A 3CC4A 1VQ7A 3KJOA 1X3EA 4QJFA 4LF8L 1JT8A 5FLMH 3PF4A 1KAWA 3J80i 1PHJA 1W2BA 4DR7L 1B70B 4GN4B 1EFWA 3A74A 4Y7NH 3S1NH 3K7UC 1J5EQ 1CKNB 1X3GA 4DK3C 5GAHC 1N34L 3FP9A 1IBLQ 5LMUL 2ZTEA 1E7ZA 3CCSA 1EWIA 1AE3A 4DR4L 3GO5A 4DNIA 2EXDA 2KBNA 4L5QA 3H3VI 3KF8B 1KHIA 2R7DA 2LXKA 1SROA 2CFMA 4JI7L 3CCVA 1YITA 4OX9L 1FL0A 3GTQH 1L1OB 4B3RL 4IPCA 5IWAL 3CF5A 2AHOB 3UDXA 3BU2A 4H02A 3CCJA 4A3KG 1IL2A 2F4VQ 4EQ5A 4JI4Q 3PSIA 3HOUH 1WOCA 4OWXB 3RLNA 4BA1I 1PH7A 2JQOA 2V1CC 3CCMA 2ID0A 3RNUA 1JJCB 4A3CH 1SN8A 1XMQQ 4NXMQ 5IT9c 2FXQA 2NN6G 4DR6Q 2ZJQA 3U4VA 3HOXG 3M4OH 4NB3A 4JYAL 3M4PA 3RLOA 1HNXQ 2R6GA 2ZTDA 4BA2I 3UDFA 1IYJB 3MXNB 3L0OA 1A0IA 4A3LH 1QUQA 2Z6KA 1E24A 1X3FA 3HOZH 3CQZH 4GN3B 1VQJA 4GKKL 4B3TQ 1D8LA 2YTXA 4RG1A 3KF6A 1AE2A 4DV4Q 3EN2A 1X54A 2LXJA 4HJ9A 3PUVA 2N49A 1YEZA 3UDGA 3I4NG 3ER0A 4J15A 4HJ7A 3A5UA 4LF5Q 2A8VA 4LNQA 5IYBG 3PV0A 2XTIA 1Q81C 3GTJH 4X62Q 2UXCL 3AQQA 3TRZA 1PV4A 2IHEA 3KOJA 3HOUG 4JI1Q 4LFAL 1SE8A 2RCNA 1I3QH 2N8NA 4MNOA 1LUZA 2VW9A 4HJ8A 2OTJA 4JI2L 1WI5A 4DV1L 3FKIH 2CKZB 4JOIA 4LWCA 4R4QA 1N32Q 4A3EH 2NN6I 1NBWA 1LM0A 3F8TA 2HIVA 3KYHC 1GM5A 3S1RH 2F3IA 2JA8H 4JG2A 3EBEA 4BXXG 3CC2A 1IXRA 2MNAA 3S2HH 3L2PA 3J80c 1MKHA 1N36Q 4DR2L 3HOZG 2PNHA 1VCIA 2I5HA 3AFQA 3RR5A 5JEAJ 5FJ8G 1SMXA 2N78A 5H1SE 2E8GA 3S2DH 1VQMA 1XMOQ 4DV7L 2KHJA 2WP8J 4DKAC 2ZM6Q 3CXCA 3M3YH 2JK8A 4GNXC 2CWAA 4AQYL 5E7NA 3GDEA 1PH6A 2EIFA 1OXXK 1VQBA 4AYBG 4A3IH 4C3IH 3F1ZA 1N33Q 3I4MH 1N8RC 1EIYB 1P8LA 4A76A 3H15A 1BVSA 2K50A 1WCMG 4A3EG 1RIPA 4GLVB 2WAQG 2MFIA 2WB1E 4JI8L 3J81i 4BY7H 4KHPQ 1CUKA 4XTCS 1KD1C 1HNZQ 4GOPA 1I94Q 3CCQA 3PUYA 4DV6L 3G48A 3M7NA 4O0AA 1NMGA 2HHHL 1YI2A 3BJUA 4A4IA 1LTLA 4OXPA 3PO2H 4LF8Q 3ULPA 4DR7Q 1C7YA 2E2IH 3EIVA 3RZOH 4IOAA 1K8AC 1NE3A 1K8GA 1YJWA 1HZAA 3U58A 2CWPA 1O7IA 2PQAA 3PO3H 4IPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 Q;  4DV3 Q;  5IYD H;  5GAG C;  4A3F G;  1GVP A;  2K75 A;  1YVC A;  4DUZ Q;  3D31 A;  4A3I G;  1GD7 A;  2IHF A;  4GN5 A;  1EYG A;  2Y0S G;  1VQA A;  1CKN A;  1YHA A;  4JI7 Q;  3I4M G;  1JB7 A;  4OX9 Q;  4B3R Q;  1XPR A;  5IWA Q;  1X9N A;  2RHS B;  4LF4 L;  3SGI A;  4DR1 Q;  4YY3 L;  2R92 G;  1VQ6 A;  2VUM G;  3CD6 A;  1VQC A;  1VQN A;  4BY7 G;  5C4X H;  3S15 H;  2H5X A;  4WJ3 M;  1L1O A;  1PFS A;  4LF9 Q;  4Y52 H;  4HIM A;  5LMN W;  3KJP A;  3RN2 A;  5IP9 H;  4LUZ A;  4R4O A;  2F52 A;  4UP9 A;  4DR5 L;  4LUV A;  1Y1V H;  1VQP A;  4JYA Q;  5BR8 Q;  3OTO L;  4DV2 Q;  2UUC L;  2NVT H;  1SLJ A;  2E5L L;  2UUB Q;  1TWG H;  3PO2 G;  3HFZ B;  1HNW L;  5JJK A;  1G51 A;  2ZTC A;  4GLX A;  2UXB L;  1L0W A;  2YTY A;  4BY1 G;  2RF4 A;  4PZ6 A;  4YCU A;  1SRU A;  3TQY A;  5ELN A;  2KHI A;  2MO1 A;  1TWA H;  3CME A;  3PO3 G;  3TS2 A;  2DUD A;  2LSS A;  3M4Q A;  5IYD G;  2BH8 A;  5JEA G;  1IBK L;  3M85 A;  2Z0S A;  4L5T A;  4LF6 Q;  3STB D;  4DUY L;  3K8A A;  4A3D G;  3GTO H;  2JEB I;  4BBS H;  1MJE A;  1XNQ Q;  5M5Y H;  2R7F A;  1CSQ A;  1E3P A;  4YHH L;  2UU9 Q;  1V43 A;  3HOV H;  3KDF A;  2JA7 H;  4LFB L;  4JBW A;  4LFA Q;  2Q2U A;  1YBY A;  2VQF L;  3CW2 C;  1X55 A;  1OXV A;  5HY6 A;  4JI2 Q;  1D7Q A;  3PCO B;  4DV1 Q;  1NMF A;  3J81 c;  2OTL A;  4R4T A;  1WYD A;  5DLQ E;  5FLM G;  5IP9 G;  4KI0 A;  5C4J H;  1Y1V G;  1DGS A;  1SFO H;  1E1O A;  2JA9 A;  4LFC L;  3NEN A;  1AH9 A;  1K0R A;  1VQ8 A;  4DR2 Q;  3JAM i;  5ELO A;  4APV A;  3RZD H;  1JJG A;  4R1J A;  2B29 A;  4K0K L;  1X56 A;  3A5Z B;  4QIW E;  2I5L X;  3VDY A;  1T9H A;  4JBJ A;  1VQF A;  5IP7 H;  3BZK A;  3NBH B;  4TVA B;  4X66 L;  1VQI A;  4JI0 L;  1I50 H;  1XNR L;  4LF7 Q;  3I4O A;  2UUA L;  3WWV A;  4JC0 A;  1FVI A;  3CCR A;  4BBS G;  3CCE A;  1C0A A;  1UE5 A;  3S1M H;  2OCE A;  1PYS B;  3MEF A;  3GTL H;  3UE1 A;  4A3C G;  4HIK A;  4AQY Q;  3HOV G;  4C2M H;  1VQL A;  2VQE L;  4PG3 A;  4LUO A;  3S24 A;  3CCU A;  3M9B A;  1PH2 A;  1IBM Q;  2JA7 G;  1LYL A;  1U0L A;  1P16 A;  3HOY H;  4YWK A;  3HOW H;  3W1B A;  1GO3 E;  2RHQ B;  4IPD A;  1OTC A;  3GTG H;  2K5N A;  4A3L G;  1Z47 A;  1U5K A;  1CKO A;  4JI8 Q;  3GTK H;  2HIX A;  3K0X A;  1UEB A;  4NPS A;  3S17 H;  1TWC H;  2VS1 A;  4AYB E;  4X64 L;  4DV6 Q;  4JI3 L;  1HZ9 A;  3CC7 A;  3DLL A;  2JA6 H;  1Z9F A;  3RLF A;  4DR3 L;  2AMC B;  2HHH Q;  4B3M L;  2PI2 A;  4NXN Q;  1XMQ L;  1YHB A;  3G71 A;  4A3G H;  3PUW A;  5FLX c;  2BH2 A;  1HZB A;  4C3J H;  2EQS A;  4GS3 A;  3KF6 B;  1HNX L;  1JJ2 A;  1KRS A;  1VQG A;  4JI5 L;  1K83 H;  4A3B H;  1TXY A;  1N9W A;  4HIO A;  3PF5 A;  1WJJ A;  1Q8K A;  4B3S L;  4HJA A;  4B3T L;  3K7A H;  3G4S A;  4A75 A;  4DAM A;  4X65 L;  5C3E H;  1MJC A;  1KIX A;  1KQS A;  2KCM A;  4GNX A;  1YJ9 A;  2QGQ A;  3FKI G;  3GD7 A;  3CPW A;  1HR0 Q;  3GTP H;  3ICE A;  2PMZ E;  3STB C;  4DAY B;  1Y14 B;  3I7F A;  4UP8 A;  3TS0 A;  5AJ3 Q;  3HOY G;  3HOW G;  4JV5 L;  1PVO A;  2ZJP A;  4LF4 Q;  2JA8 G;  4YY3 Q;  5GQO A;  4BBR H;  4YCW A;  3S16 H;  4YWL A;  1YZ6 A;  1YHQ A;  4DV0 L;  1B7Y B;  2I0Q A;  2YU9 H;  4JI1 L;  3RN5 A;  1VQ4 A;  2JA6 G;  2Y0S E;  3JC6 6;  4DV5 L;  4A3G G;  2B63 H;  4DR5 Q;  2NZO A;  3JAM c;  3OTO Q;  5IY0 A;  1HNW Q;  2D62 A;  5C0X G;  1KC8 C;  2ALY B;  3T1H L;  1VQH A;  4TQU S;  1N34 Q;  2R7Z H;  5JJL A;  1HJP A;  4XIG S;  1VQE A;  3F2C A;  4QGU A;  4A3J H;  1WFQ A;  3E9I A;  2BA1 A;  3PIO A;  4A3B G;  4C3H H;  2GN5 A;  3E0E A;  1JMC A;  2BA0 A;  1YNX A;  3J7A 5;  2VY3 A;  4GKJ L;  5K36 G;  2JEA I;  3NEM A;  3HKZ G;  1I5F A;  1EOV A;  5C44 H;  3KLW A;  1IBK Q;  1ASY A;  2DGY A;  4DUY Q;  1CKM A;  4AIM A;  1VQ9 A;  1YIJ A;  1V9P A;  1A62 A;  1HR0 W;  2JE6 I;  4BBR G;  1YJN A;  2MQH A;  4LFB Q;  1XPO A;  3K81 C;  4UY8 C;  1BKB A;  1GKH A;  1OXT A;  3PUZ A;  4HJ5 A;  4JBM A;  2D0P A;  2B3G A;  1XJV A;  2IX0 A;  2B63 G;  2Q2T A;  4P73 A;  2XGT A;  3PGZ A;  3GTM H;  4GKK Q;  3AEV A;  3ULJ A;  2GVB A;  1L2F A;  3H0G H;  3AFP A;  3PIP A;  4LFC Q;  3KFU A;  2R7Z G;  1I6H H;  3ZJY C;  1VQ5 A;  1JE5 A;  1A8V A;  4MZ9 A;  5EAY A;  5C0X I;  5LMN L;  2JJQ A;  1Y1W H;  4KHP L;  4A3J G;  1HNZ L;  2I5M X;  4K0K Q;  1M1K C;  5M3F H;  4X66 Q;  4JI0 Q;  1PYB A;  3T1Y L;  1XNR Q;  2PQA B;  5C44 G;  2ZJR A;  1PA6 A;  2UUA Q;  1H95 A;  3J81 j;  2UXC Q;  4POG A;  1Q46 A;  5LMU Q;  3TEH B;  2JA5 H;  2AKW B;  3DM3 A;  2A1A A;  3CP0 A;  5C4X G;  4RMF A;  2VQE Q;  4PZ8 A;  3CMA A;  1NJI C;  4JI6 L;  2ASB A;  2UXD L;  1PH4 A;  4DV3 L;  3TRE A;  3I4N H;  1RL2 A;  4A93 H;  4DUZ L;  1CSP A;  5C0X J;  2CCZ A;  1FJG L;  1KL9 A;  3OW2 A;  5IYB H;  3I2Z A;  3A0J A;  2PI2 E;  2IT1 A;  4PMW A;  2L15 A;  5GAE C;  4DR1 L;  4R4C A;  3H0G G;  3IRB A;  5J3B A;  4DPG A;  4X64 Q;  1S72 A;  4JI3 Q;  2IX1 A;  3FHW A;  3NEL A;  4DR3 Q;  4B3M Q;  3CCL A;  1X6O A;  1Y1W G;  2K4K A;  4LF9 L;  2Z6K C;  1K9M C;  3E9H A;  5HGQ A;  5M3F G;  1PH3 A;  3S1Q H;  4DV7 Q;  3BZC A;  3OYY A;  1HH2 P;  1S40 A;  5BR8 L;  4DV2 L;  4BXX H;  4JI5 Q;  2UUB L;  1J5E L;  2IY5 B;  4P75 A;  1IBL L;  2JA5 G;  2HT1 A;  4IOC A;  1Q7Y C;  2OWO A;  4B3S Q;  4X6A H;  1UWV A;  1A63 A;  4P72 A;  5M5W H;  4X65 Q;  1Q12 A;  4OWT B;  3D0F A;  3B6Y A;  5FJ8 H;  4IFD G;  1J6Q A;  2A19 A;  5M3M H;  1NY4 A;  1E22 A;  4ME3 A;  4A93 G;  2UXD Q;  3KDF B;  4JV5 Q;  1G29 1;  4GLA C;  2NVX H;  4LF6 L;  4QQB X;  2F4V L;  4OWW B;  5IYC H;  1BBW A;  1XNQ L;  4IJL A;  1X65 A;  4JI4 L;  2NZH A;  5GRO A;  4YWM A;  4POF A;  2UU9 L;  4JOI C;  1W3S A;  1ASZ A;  4DV0 Q;  4NXM L;  2K52 A;  1QUQ B;  1QVC A;  1M90 C;  4DV5 Q;  4DR6 L;  4QY7 A;  4MTN A;  3G6E A;  5IP7 G;  2E2H H;  4L5R C;  4WJ4 A;  1PH9 A;  4A3M H;  1NTG A;  2WAQ E;  1XPU A;  1KRT A;  4OON A;  1WCM H;  4ALP A;  3Q8D A;  1E1T A;  3T1H Q;  1VQO A;  2NVQ H;  4O2D A;  2K14 A;  2Q2H A;  1EQQ A;  2Q2I A;  4AH6 A;  3U50 C;  4DV4 L;  4P74 A;  3U4Z A;  1C9O A;  2OQ0 A;  1HZC A;  4GKJ Q;  1PH1 A;  1OXU A;  5GAD C;  2YTV A;  1IZ6 A;  4LF5 L;  2NVY H;  3I55 A;  5M3M G;  2KCT A;  4IO9 A;  1QVG A;  4IFD I;  4OO1 G;  3UE0 A;  4LF7 L;  5M5X H;  3H3V H;  2VZA A;  3CAM A;  1B8A A;  4X62 L;  3LGJ A;  2KEN A;  3ULL A;  5IYC G;  4JCV E;  1EIF A;  3J7Z C;  3HKS A;  2R93 H;  1V1Q A;  2QA4 A;  2AWN A;  4UPA A;  4KHZ A;  4A3F H;  4HID A;  1UE1 A;  3HKZ E;  1IBM L;  1K3R A;  1XTD A;  2UUC Q;  1OXS C;  1Q1B A;  2E5L Q;  2QEX A;  1N32 L;  1PH8 A;  1TWH H;  4GOP C;  1VS0 A;  2UXB Q;  4A3M G;  2VNU D;  2R92 H;  1EQR A;  3W1G A;  2VUM H;  2GVA A;  1FGU A;  3W5O A;  5LMN Q;  4LW1 A;  1N36 L;  1S3O A;  3CPF A;  1R9T H;  3K80 C;  2E2J H;  2ATW A;  1MIU A;  4IFD J;  3L7Z C;  4KLK A;  4FDB A;  5C3E G;  1EUJ A;  3F2B A;  2OQK A;  4NXN L;  2N3S A;  4IJH A;  1UE7 A;  1Q82 C;  1TWF H;  3T1Y Q;  4QL5 A;  3F2D A;  1QVF A;  2VL6 A;  4YHH Q;  4R4I A;  3I56 A;  2AWO A;  4DK6 C;  1XMO L;  3S14 H;  2D0O A;  1VQD A;  2ZM6 L;  5IE8 A;  1QZH A;  4BY1 H;  3AYH B;  1BBU A;  2VQF Q;  4GNX B;  2WB1 G;  3UDI A;  4OO1 I;  2K5H A;  4P71 A;  2CQO A;  2R93 G;  4JBK A;  2ES2 A;  4JI6 Q;  2K5V A;  2C35 B;  5JJI A;  1K73 C;  1N33 L;  2HQL A;  1SR3 A;  1FJG Q;  4GOP B;  2WFW A;  3ERS X;  1G6P A;  4A3K H;  1HR0 L;  4A3D H;  2YV5 A;  4IPG A;  4UP7 A;  1L1O C;  1KXL A;  1UE6 A;  5AJ3 L;  2MO0 A;  4PZ7 A;  1Q86 C;  1VQK A;  3PUX A;  1Q1E A;  2YYZ A;  1I94 L;  4L5S A;  1PH5 A;  4YCV A;  3HOX H;  1QZG A;  4EX5 A;  3CC4 A;  1VQ7 A;  3KJO A;  1X3E A;  4QJF A;  4LF8 L;  1JT8 A;  5FLM H;  3PF4 A;  1KAW A;  3J80 i;  1PHJ A;  1W2B A;  4DR7 L;  1B70 B;  4GN4 B;  1EFW A;  3A74 A;  4Y7N H;  3S1N H;  3K7U C;  1J5E Q;  1CKN B;  1X3G A;  4DK3 C;  5GAH C;  1N34 L;  3FP9 A;  1IBL Q;  5LMU L;  2ZTE A;  1E7Z A;  3CCS A;  1EWI A;  1AE3 A;  4DR4 L;  3GO5 A;  4DNI A;  2EXD A;  2KBN A;  4L5Q A;  3H3V I;  3KF8 B;  1KHI A;  2R7D A;  2LXK A;  1SRO A;  2CFM A;  4JI7 L;  3CCV A;  1YIT A;  4OX9 L;  1FL0 A;  3GTQ H;  1L1O B;  4B3R L;  4IPC A;  5IWA L;  3CF5 A;  2AHO B;  3UDX A;  3BU2 A;  4H02 A;  3CCJ A;  4A3K G;  1IL2 A;  2F4V Q;  4EQ5 A;  4JI4 Q;  3PSI A;  3HOU H;  1WOC A;  4OWX B;  3RLN A;  4BA1 I;  1PH7 A;  2JQO A;  2V1C C;  3CCM A;  2ID0 A;  3RNU A;  1JJC B;  4A3C H;  1SN8 A;  1XMQ Q;  4NXM Q;  5IT9 c;  2FXQ A;  2NN6 G;  4DR6 Q;  2ZJQ A;  3U4V A;  3HOX G;  3M4O H;  4NB3 A;  4JYA L;  3M4P A;  3RLO A;  1HNX Q;  2R6G A;  2ZTD A;  4BA2 I;  3UDF A;  1IYJ B;  3MXN B;  3L0O A;  1A0I A;  4A3L H;  1QUQ A;  2Z6K A;  1E24 A;  1X3F A;  3HOZ H;  3CQZ H;  4GN3 B;  1VQJ A;  4GKK L;  4B3T Q;  1D8L A;  2YTX A;  4RG1 A;  3KF6 A;  1AE2 A;  4DV4 Q;  3EN2 A;  1X54 A;  2LXJ A;  4HJ9 A;  3PUV A;  2N49 A;  1YEZ A;  3UDG A;  3I4N G;  3ER0 A;  4J15 A;  4HJ7 A;  3A5U A;  4LF5 Q;  2A8V A;  4LNQ A;  5IYB G;  3PV0 A;  2XTI A;  1Q81 C;  3GTJ H;  4X62 Q;  2UXC L;  3AQQ A;  3TRZ A;  1PV4 A;  2IHE A;  3KOJ A;  3HOU G;  4JI1 Q;  4LFA L;  1SE8 A;  2RCN A;  1I3Q H;  2N8N A;  4MNO A;  1LUZ A;  2VW9 A;  4HJ8 A;  2OTJ A;  4JI2 L;  1WI5 A;  4DV1 L;  3FKI H;  2CKZ B;  4JOI A;  4LWC A;  4R4Q A;  1N32 Q;  4A3E H;  2NN6 I;  1NBW A;  1LM0 A;  3F8T A;  2HIV A;  3KYH C;  1GM5 A;  3S1R H;  2F3I A;  2JA8 H;  4JG2 A;  3EBE A;  4BXX G;  3CC2 A;  1IXR A;  2MNA A;  3S2H H;  3L2P A;  3J80 c;  1MKH A;  1N36 Q;  4DR2 L;  3HOZ G;  2PNH A;  1VCI A;  2I5H A;  3AFQ A;  3RR5 A;  5JEA J;  5FJ8 G;  1SMX A;  2N78 A;  5H1S E;  2E8G A;  3S2D H;  1VQM A;  1XMO Q;  4DV7 L;  2KHJ A;  2WP8 J;  4DKA C;  2ZM6 Q;  3CXC A;  3M3Y H;  2JK8 A;  4GNX C;  2CWA A;  4AQY L;  5E7N A;  3GDE A;  1PH6 A;  2EIF A;  1OXX K;  1VQB A;  4AYB G;  4A3I H;  4C3I H;  3F1Z A;  1N33 Q;  3I4M H;  1N8R C;  1EIY B;  1P8L A;  4A76 A;  3H15 A;  1BVS A;  2K50 A;  1WCM G;  4A3E G;  1RIP A;  4GLV B;  2WAQ G;  2MFI A;  2WB1 E;  4JI8 L;  3J81 i;  4BY7 H;  4KHP Q;  1CUK A;  4XTC S;  1KD1 C;  1HNZ Q;  4GOP A;  1I94 Q;  3CCQ A;  3PUY A;  4DV6 L;  3G48 A;  3M7N A;  4O0A A;  1NMG A;  2HHH L;  1YI2 A;  3BJU A;  4A4I A;  1LTL A;  4OXP A;  3PO2 H;  4LF8 Q;  3ULP A;  4DR7 Q;  1C7Y A;  2E2I H;  3EIV A;  3RZO H;  4IOA A;  1K8A C;  1NE3 A;  1K8G A;  1YJW A;  1HZA A;  3U58 A;  2CWP A;  1O7I A;  2PQA A;  3PO3 H;  4IPH A; 
#chains in the Genus database with same CATH topology
 4DR4 Q;  5IYD H;  1GVP A;  2K75 A;  1B50 A;  4GN5 A;  4LAA A;  2FFK B;  5CV9 A;  5EBC A;  4X3U A;  5IWA Q;  1RHP A;  2RHS B;  4OEL B;  4PMC A;  4MIU A;  3CD6 A;  1I3Q B;  2DJF C;  3S15 H;  3OWE B;  1L1O A;  2B39 A;  3RN2 A;  4JYA Q;  4R4O A;  3E3X A;  3IFD A;  3PO2 G;  1HNW L;  2UUB Q;  3S2H B;  4Q5V A;  1G51 A;  2YTY A;  4BY1 G;  4CDC C;  4PZ6 A;  1ONL A;  1CT1 D;  1EY6 A;  2DUD A;  2BH8 A;  3K0Y A;  1V1P B;  5KYL A;  4L5T A;  2HDM A;  4A3D G;  3M3Y B;  2JEB I;  1XNQ Q;  1IHZ A;  4YHH L;  2KED A;  4A3B B;  2F3W A;  4A3I B;  4C3I B;  3I4M B;  3VR4 A;  1SYB A;  5HY6 A;  4JI2 Q;  1JWU D;  5HGT A;  2OTL A;  2K5W A;  4RKB A;  1WYD A;  5DLQ E;  1EY7 A;  5C4J H;  1Y1V G;  4UDU C;  1KLG D;  2PYK A;  2NYZ D;  4LFC L;  2KUM A;  4OIK A;  3S16 B;  2QF7 A;  3IAY A;  1JJG A;  4K0K L;  1T9H A;  3OIP A;  1PLF A;  5IP7 H;  4TVA B;  4X66 L;  1UEA B;  1X3P A;  4LF7 Q;  3NBI A;  1SJE D;  3WWV A;  1FVI A;  3EA6 A;  2JXM B;  1D5M C;  1UE5 A;  5KND A;  4XYO A;  3J81 L;  3HP3 A;  4A3C G;  2VQE L;  4PG3 A;  2JA7 G;  1IBM Q;  1O7Z A;  2KVM A;  2JYO A;  1U0L A;  3U9S A;  4C1N I;  3A54 A;  3S9W A;  5C44 B;  1GUO A;  1AZP A;  3QG1 A;  2VB2 X;  1I4X A;  5C4X B;  4TSS A;  1CKO A;  4JI8 Q;  4B9X A;  3K0X A;  2L11 A;  3S17 H;  4AYB E;  2JA6 H;  3DLL A;  3Q22 A;  1Z9F A;  3RLF A;  4NXN Q;  1IYU A;  4K5X A;  4PNY A;  1TWG B;  2EJG C;  4C3J H;  4GS3 A;  1EIH A;  1KRS A;  1VQG A;  2K1B A;  1TWA B;  5HUR A;  1WJJ A;  2MPM A;  4CJ1 B;  4DAM A;  2TMP A;  4X65 L;  5C3E H;  1KIX A;  2KCM A;  4GNX A;  3LWU A;  4ZK9 B;  3GTO B;  4BBS B;  5M5Y B;  1DOL A;  2IJ0 A;  2PMZ E;  3TS0 A;  1D1K A;  2HQE A;  3HOY G;  1FNV A;  4ABN A;  2IPK D;  1RDP D;  4K6L A;  4BBR H;  1EIG A;  4N8F A;  1TR5 A;  2K5D A;  4YWL A;  5IIF A;  4HSV A;  4A3G G;  4DR5 Q;  1SFO B;  5IY0 A;  2D62 A;  3T1H L;  2EYO A;  3RZD B;  3F2C A;  1GXD C;  2B8F A;  2BA1 A;  2Z8L A;  3T13 A;  4X3K A;  1C4Q A;  1IBK Q;  1K8O A;  2DGY A;  4DUY Q;  4AIM A;  1LO5 D;  1V8Q A;  1S4Z A;  5FO9 B;  1YIJ A;  1GJX A;  3I4L A;  1O80 A;  1V1P A;  4LFB Q;  1EY5 A;  4HED A;  3JAM L;  1BKB A;  1OXT A;  3TBI B;  3Q6S A;  2D0P A;  2B3G A;  2JN4 A;  4CDD C;  3SVM A;  4ZLT F;  1YNJ D;  3GTK B;  4DA2 A;  3AEV A;  1STY A;  3ZJY C;  5EAY A;  1A8V A;  5LMN L;  5KNB A;  4A3J G;  2PQE A;  2XNA C;  2E2H B;  4N9T A;  1PYB A;  1XNR Q;  4DF7 A;  1PA6 A;  2UUA Q;  1H95 A;  2UXC Q;  1Q46 A;  1UUP A;  5FOB B;  3TEH B;  1JR0 D;  3K7A B;  1DXM A;  3DM3 A;  2A1A A;  4KY7 A;  2RQX A;  3GTP B;  1FGB D;  1EEF D;  3P1H A;  4NP5 A;  1RTN A;  1LTG D;  4DV3 L;  1PH4 A;  2SNM A;  3TRE A;  1GUW A;  4DUZ L;  4OHJ A;  4CDF C;  1HFN A;  3OW2 A;  2WB1 B;  2F0N A;  3R3O A;  1PZJ D;  2L15 A;  2F0F A;  4DR1 L;  3K5N A;  4DPG A;  1S72 A;  4JI3 Q;  4U67 3;  2B63 B;  3FHW A;  3NEL A;  1DOK A;  2Z6K C;  1LTI D;  3BG3 A;  4ZQ3 A;  5HGQ A;  1STA A;  1HCZ A;  2R7Z B;  4ZUI A;  1SSO A;  1B44 D;  4P75 A;  4C3H B;  2JA5 G;  4XYQ A;  5JAV A;  2HT1 A;  4RGM A;  4B3S Q;  1TKW B;  1A63 A;  3SK6 A;  4ZUJ A;  5FJ8 H;  3BVZ A;  1J6Q A;  2A19 A;  1PTO F;  3RMH A;  3KDF B;  1G29 1;  4LF6 L;  1BBW A;  3HZX A;  1X65 A;  4JI4 L;  2NZH A;  4C56 C;  1EWH A;  4JK1 C;  4MTK A;  1QUQ B;  4DV5 Q;  4QY7 A;  3DWQ A;  5IP7 G;  3GTM B;  1PH9 A;  4A3M H;  1WTP A;  3P75 A;  2WAQ E;  3VYR A;  1G91 A;  1KRT A;  3H6M A;  4O2D A;  2A69 C;  5M9O A;  3U50 C;  5M3F B;  1BBX C;  1C9O A;  1EQT A;  1XTC D;  2OQ0 A;  1B53 A;  1SNQ A;  4QCL A;  1OXU A;  4LF5 L;  3I55 A;  2FMC A;  3J7A V;  2A6H C;  1B4O A;  2VZA A;  4XT3 B;  4JCV E;  4A93 B;  4HID A;  1UE1 A;  3KLS X;  4RH6 A;  1Q1B A;  2QEX A;  2XWB B;  4C3J G;  4GOP C;  3VR5 A;  5DAU A;  2R92 H;  1BCP D;  3W1G A;  3J80 E;  3K80 C;  1MIU A;  4IFD J;  4RGN A;  3W3A A;  5C3E G;  2KEC A;  1C8C A;  2DY7 A;  3DEP A;  4V19 0;  1UE7 A;  1TS4 A;  5KYI A;  4L6T B;  4QL5 A;  3KLS A;  5JVH 3;  4YHH Q;  2EY1 A;  3HS0 C;  1GUG A;  2D0O A;  2RDH A;  5I4D A;  1SE3 A;  1DOM A;  3AYH B;  2CQO A;  2R93 G;  2J7Z A;  1YNN C;  4JBK A;  4YIJ A;  5M3M B;  1N33 L;  3A8K E;  1O7Y A;  4GOP B;  1EYA A;  3ERS X;  1HR0 L;  1ILP A;  4UP7 A;  1S5E D;  1STB A;  5EJW A;  1X32 A;  3R8B A;  4NKL A;  2NN6 H;  2F0E A;  4L5S A;  1LAB A;  2EYJ A;  3CC4 A;  2DNE A;  2RBM A;  3Q24 A;  3KJO A;  1WCM B;  4QJF A;  4A3E B;  5FLM H;  5IOC A;  1PHJ A;  5I9P A;  1EFW A;  2L5T A;  1J5E Q;  1CKN B;  1H9K A;  2RCF A;  1E7Z A;  4DR4 L;  2KBN A;  5LL6 X;  4LMQ D;  3BDC A;  4IPC A;  1JWS D;  5IWA L;  1SJH D;  4H02 A;  5CBA E;  1I4Q A;  4EQ5 A;  3HOU H;  3PSI A;  4A3F B;  1AZQ A;  3RLN A;  1PH7 A;  2V1C C;  2IWH A;  3CCM A;  1CHQ D;  1JJC B;  3X3N A;  3HOX G;  5ELD A;  4NB3 A;  3X3M A;  4JYA L;  3TP8 A;  1I6V C;  4IUU A;  3C1F A;  1BUV T;  4N9P A;  1BCP C;  1QUQ A;  2Z6K A;  5KEE A;  3CQZ H;  4GN3 B;  2F0G A;  4BWG B;  1AE2 A;  1H9S A;  4HJ9 A;  2N49 A;  3R2T A;  5FO8 B;  3ER0 A;  5EKL A;  2R61 A;  4HJ7 A;  4P2C B;  1PFB A;  3PV0 A;  3K6O A;  5IT9 L;  4X62 Q;  1STH A;  4M8A A;  2RCN A;  2N8N A;  4MNO A;  4JI2 L;  2QEJ C;  3TP6 A;  4A3K B;  3J81 E;  3FKI H;  1EY8 A;  4E6I A;  5EPL A;  2NN6 I;  1NBW A;  1BCP B;  3F8T A;  4KY6 A;  3S1R H;  3N6R A;  3SXH A;  2EPB A;  1CQF A;  1VCI A;  2I5H A;  5CC4 A;  2Q8R E;  5FJ8 G;  3ND9 A;  1SYE A;  3S2D H;  4B08 A;  3A7A B;  1L0X B;  3CXC A;  2AUJ D;  3T16 A;  1V1O A;  1BO0 A;  1VQB A;  3D8G A;  4RKL A;  3GTQ B;  5K36 H;  3E5S A;  1QJO A;  1WTV A;  1N8R C;  1PMR A;  3H15 A;  1MBY A;  1Q3L A;  2GA4 B;  5EPK A;  4JI8 L;  1CUK A;  1KD1 C;  1U4P A;  4GOP A;  1TY0 A;  4KD4 A;  2E75 C;  3G48 A;  1KAA A;  3BJU A;  3D6W A;  1GHK A;  5A35 A;  2EXZ A;  2A6E D;  3PO2 H;  4LF8 Q;  1STE A;  3ULP A;  3HOZ B;  4DR7 Q;  1C7Y A;  1KDB A;  1F2Z A;  2CH4 A;  1K8A C;  1NE3 A;  5ISR A;  4DV3 Q;  5GAG C;  1YVC A;  2IX3 A;  4DUZ Q;  1II3 A;  4A3I G;  2IHF A;  3OW7 A;  2Y0S G;  1LT3 D;  1CKN A;  4JI7 Q;  3I4M G;  3EJI A;  4FP5 D;  4DR1 Q;  2R92 G;  1ENF A;  1VQ6 A;  1ILQ A;  1LTB D;  3E0J A;  3BVM A;  1VQN A;  4WJ3 M;  2CHB D;  1PFS A;  3L3O C;  4HIM A;  3KJP A;  4LUZ A;  4DR5 L;  4LUV A;  1Y1V H;  5CV6 A;  2EVB A;  2JA8 B;  2NVT H;  3JAM E;  1SLJ A;  2E5L L;  5EKK A;  5JJK A;  2VB3 X;  3J7Y W;  3K5L A;  2RF4 A;  2JA6 B;  3TQY A;  5F2D A;  3M4Q A;  5JEA G;  4ULL A;  1JCK B;  1IBK L;  4XXE A;  4LF6 Q;  3STB D;  4DUY L;  1A2U A;  3VYT A;  4RCN A;  1CSQ A;  1V43 A;  1A3V A;  2JA7 H;  4LFB L;  4CDE C;  1G2T A;  1D1I A;  2Q2U A;  2FHT A;  3HKZ B;  3V2T A;  5IOD A;  4DV1 Q;  3OMG A;  4DAV A;  3F2U A;  1G6Z A;  3GV3 A;  5FLM G;  4KI0 A;  1PDQ A;  4BY7 B;  2QCP X;  1E1O A;  3K5O A;  2ENB A;  4APV A;  4DNR B;  4R1J A;  2B29 A;  1FD7 D;  1X56 A;  3A5Z B;  4QIW E;  5K5P A;  2E2I B;  3NBH B;  5G3L D;  1I50 H;  1XNR L;  3I4O A;  2UUA L;  4MHE A;  2Z9H A;  4KMU C;  3CCR A;  4FF1 A;  4BBS G;  2HCI A;  3CCE A;  3GP7 A;  3S1M H;  1PYS B;  1LT4 D;  3GTL H;  2IW3 A;  4C2M H;  5NUC A;  1JC7 A;  3HOY H;  3W1B A;  2KEE A;  4G7Z C;  1GO3 E;  2Z4H A;  3ERQ A;  4IPD A;  4ZYS A;  2HIX A;  1TWC H;  2VS1 A;  4JI3 L;  1HZ9 A;  2K04 A;  3URY A;  2AMC B;  2PZW A;  4A3G H;  2PI2 A;  1YHB A;  3G71 A;  3PUW A;  4I65 A;  3MC0 B;  5FLX c;  2BH2 A;  3ITP A;  2SNS A;  5FKA C;  4KD3 A;  2KA7 A;  1K83 H;  4DN4 M;  4C1N K;  1TXY A;  4UAI A;  4CJ0 B;  3A7L A;  4HIO A;  1EFI D;  4B3S L;  4RGO S;  1CZW A;  4A75 A;  3R93 A;  1S5D D;  3FKI G;  3CPW A;  2F0O A;  2XRS D;  2Z1C A;  1HR0 Q;  3J80 L;  3STB C;  4UP8 A;  3SHL A;  4BS9 A;  3HOV B;  1PVO A;  2N88 A;  2ZJP A;  2WKC A;  4YY3 Q;  5CGK A;  5LL6 S;  1MSH A;  1XYI A;  1BDO A;  2A73 B;  1HUM A;  2I0Q A;  1VQ4 A;  2Y0S E;  4DV5 L;  1RKN A;  2NZO A;  3OTO Q;  4FF3 A;  3LNN A;  5C0X G;  4K8I A;  1VQE A;  4A3J H;  3ERO A;  3E0E A;  1JMC A;  3J7A 5;  2X6G A;  5K36 G;  5EBD A;  2EZV A;  1PRT F;  2L4N A;  2L1B A;  3KLW A;  3EQL C;  1CKM A;  1H9M A;  3G7L A;  2EYL A;  3KF8 A;  1VQ9 A;  1V9P A;  2Q8T A;  2JE6 I;  1YJN A;  1XPO A;  5D14 A;  3K81 C;  3HOW B;  1GKH A;  1XJV A;  3GTG B;  2B63 G;  4O1N A;  3WDN A;  2AQ3 B;  1DD2 A;  5KIX A;  1B9M A;  1L2F A;  1LLR D;  3AFP A;  3OMC A;  1I6H H;  2R7Z G;  4LK1 C;  1H9R A;  2JJQ A;  1DYQ A;  1HNZ L;  2CVR A;  4DU9 A;  4KV6 A;  2HD3 A;  5A2Q L;  1SYD A;  5I6W A;  2JA5 H;  1EY9 A;  2AKW B;  3NBH A;  2F4I A;  4RMF A;  3CMA A;  2ASB A;  1HUN A;  4ZKB B;  1A6X A;  4ZKC B;  4WFN 3;  3DUZ A;  1CSP A;  5IYB H;  1A15 A;  1LT5 D;  3A0J A;  4PMW A;  1QNK A;  3H0G G;  5D65 A;  1R4P B;  2PCF B;  2K4K A;  4LF9 L;  2J0T D;  1K9M C;  1F9R A;  4EQP A;  3KBG A;  5M3F G;  3S1Q H;  3Q0A A;  1H9J A;  3BZC A;  1S40 A;  1DCZ A;  5BR8 L;  1J5E L;  2HUG A;  4HAE A;  3TZU A;  1K0S A;  2CH4 W;  1ZKO A;  5M5W H;  1U4R A;  3D0F A;  4DAP A;  3CHB D;  3TME A;  4ME3 A;  4A93 G;  4H0L C;  5CYU A;  4JV5 Q;  2B2V C;  4GLA C;  4I7A A;  4IJL A;  1GOZ A;  3DHQ A;  4JOI C;  1ASZ A;  1M4V A;  3TDQ A;  5IT9 E;  4L5R C;  5BN4 A;  1D5Z C;  2A5H A;  3QJY A;  1XPU A;  4OON A;  4ALP A;  1E1T A;  1VQO A;  2NVQ H;  1Y1W B;  1EQQ A;  1AFP A;  4AH6 A;  1IYV A;  1B3A A;  1K8M A;  1KAB A;  3U4Z A;  4GKJ Q;  1PH1 A;  3DM1 A;  4JVZ A;  4K8J A;  2NVY H;  5M3M G;  2KCT A;  4IO9 A;  4OO1 G;  1Q90 A;  3H3V H;  3CAM A;  1VMP A;  1B8A A;  4X62 L;  2R93 H;  3ULL A;  1TS3 A;  1EY0 A;  3J7Z C;  3MXG A;  2F03 A;  1V1Q A;  4Q0F A;  3MXP A;  4RWS C;  4XDX A;  3I4N B;  1U4M A;  2NBF A;  2WAC A;  3I8Z A;  3IL8 A;  3SE0 A;  4CGY B;  2E5L Q;  2ICE C;  2RKS A;  1EWC A;  2OF1 A;  1TWH H;  3MXU A;  1WTO A;  1VS0 A;  1PH8 A;  1Y8O B;  3NQI A;  2VUM H;  2KCC A;  1FGU A;  3HRZ C;  2XSC A;  2ATW A;  1AW7 A;  5E1F A;  3L7Z C;  4KLK A;  5J1Z A;  3F2B A;  2OQK A;  4IJH A;  5I6Y A;  1Q82 C;  1TWF H;  4WRD A;  3F2D A;  3I56 A;  3S14 H;  5IGB A;  1BBU A;  5ELF A;  2B2Y C;  1EOT A;  2K5H A;  4P71 A;  2PZT A;  2K33 A;  2K5V A;  1K73 C;  4HN7 A;  2HQL A;  1FJG Q;  2NVX B;  4KK7 A;  2EE1 A;  1W6J A;  2YV5 A;  2A69 D;  1MD2 D;  5T1G A;  1DZ1 A;  1BXT A;  2MO0 A;  1ROD A;  4AYB B;  3PUX A;  1NAP A;  4YCV A;  3HOX H;  3I90 A;  5IGF A;  1X3E A;  5FK9 C;  4LF8 L;  2A6H D;  5DM6 3;  1KAW A;  1JB3 A;  4DR7 L;  2F0H A;  2Z4I A;  4GN4 B;  2C9O A;  3A74 A;  4Y7N H;  3S1N H;  2O4X A;  1X3G A;  4K5V A;  3CCS A;  3K58 A;  3GQB A;  1S5C D;  4L5Q A;  2XIW A;  2EYP A;  3H3V I;  1HPC A;  2PMZ B;  3HGB A;  5E4X A;  4JI7 L;  2C5C A;  3CU7 A;  5M5X B;  1AN8 A;  3DMU A;  4A3K G;  2F0U A;  2F4V Q;  1PFN A;  1WOC A;  4BA1 I;  1TU2 B;  2B2W C;  2JP1 A;  4NXM Q;  3V05 A;  1XX8 A;  4DR6 Q;  3M4O H;  1E2V A;  4OIJ A;  3M4P A;  2R6G A;  4BA2 I;  3UDF A;  1SYC A;  3N52 A;  2N55 A;  4A3L H;  4IUV A;  4S3S A;  4KKU A;  1R9T B;  1E24 A;  2E2J B;  1VQJ A;  1YNN D;  4OL7 A;  4RG1 A;  5COR A;  5CR3 A;  3UDG A;  1WTX A;  1NNX A;  5IYB G;  4BY1 B;  1RD9 D;  4JPB W;  3QIA A;  1PV4 A;  2B2V A;  5E3F A;  1I3Q H;  3D4D A;  1LUZ A;  4HJ8 A;  4XT1 B;  4DV1 L;  4A3D B;  3H91 A;  1TS2 A;  4JOI A;  2BE5 D;  3EBE A;  2B2U C;  3S2H H;  3L2P A;  1WTW A;  3HOZ G;  4HR7 B;  3L9A X;  1CM9 A;  3BDL A;  3QOL A;  5JEA J;  3RUZ A;  5IGE A;  5CV8 A;  2E8G A;  3M7G A;  2WP8 J;  1KNE A;  5I2X A;  3M3Y H;  3MWY W;  5E7N A;  3OWF A;  5JPN C;  4A3I H;  1JE4 A;  1D6E C;  1LTS D;  4C3I H;  2F0I A;  3F1Z A;  3I4M H;  2DY8 A;  3DWA A;  2ZXR A;  3BDO A;  1QG7 A;  4NDX A;  3MTS A;  1RIP A;  3UI2 A;  1LTR D;  2MFI A;  5C3X A;  1WD0 A;  3NQT A;  4XTC S;  1HNZ Q;  3TP7 A;  3CCQ A;  4KN7 C;  2AQ1 B;  2LY7 A;  1ICW A;  3M4Y A;  5T1I A;  1PTO C;  3EIV A;  1JOK A;  2K01 A;  1B2T A;  5C6A A;  1WD1 A;  1HZA A;  1OO9 B;  4DFA A;  3U58 A;  5LMU Q;  3K59 A;  1G2S A;  4KJN A;  5JJI A;  5JEA H;  5LHY 1;  2B2Y A;  1VQA A;  1YHA A;  5CMD A;  3J7A F;  4B3R Q;  1XPR A;  3GTJ B;  4CKE A;  3SGI A;  4YY3 L;  3ND8 A;  5DNF A;  2VUM G;  5EPJ A;  4BY7 G;  5C4X H;  4LF9 Q;  4Y52 H;  5LMN W;  1I4R A;  2OT2 A;  5CV5 A;  1BQQ T;  4UP9 A;  1PTO B;  2WAQ B;  1VQP A;  5BR8 Q;  2BE5 C;  3OTO L;  2KJX A;  1EY4 A;  1UNS A;  1TWG H;  3HFZ B;  2ZTC A;  1ZYR C;  2UXB L;  1L0W A;  4YCU A;  1Z7T A;  1SRU A;  5ELN A;  2MO1 A;  3AB9 A;  1TWA H;  1DON A;  4CHT B;  3MA2 B;  1BF4 A;  3M85 A;  2Z0S A;  1XWE A;  3K8A A;  3GTO H;  1SDF A;  4BBS H;  5M5Y H;  1Y8P B;  5KNC A;  1E3P A;  1NR2 A;  5A2Q E;  1I4G A;  1FNW A;  2CW0 C;  3OOC A;  3VA5 A;  3KDF A;  5IGD A;  1JOQ A;  4JBW A;  4LFA Q;  2QW7 A;  1YBY A;  4RAU C;  1MI2 A;  1TII D;  3CW2 C;  1Z6H A;  1F9P A;  1OXV A;  2SOB A;  5ELB A;  1D7Q A;  3PCO B;  2B2W A;  4R4T A;  1T5X D;  5IP9 G;  5DEH A;  2KCN A;  3A56 A;  1SFO H;  2JA9 A;  1HA6 A;  1CQV A;  4G57 A;  1K0R A;  1VQ8 A;  1AH9 A;  4DR2 Q;  3RZD H;  3FEW X;  5L37 A;  3VDY A;  4JBJ A;  1VQF A;  1SNC A;  3RZO B;  3BZK A;  1VQI A;  2EJF C;  3K57 A;  1O7L A;  1L0Y B;  3D3R A;  4JC0 A;  3PO3 B;  4QMG A;  1C0A A;  2OCE A;  2HDL A;  3MEF A;  4AQY Q;  3HOV G;  4LUO A;  5JOB A;  3CCU A;  2NZ1 D;  1LYL A;  2O5I C;  1P16 A;  3VR6 A;  3D4W A;  3CKI B;  1OTC A;  3VA7 A;  2K5N A;  5JPM C;  4A3L G;  1Z47 A;  2OXP A;  3S15 B;  1U5K A;  3GTK H;  1HTP A;  4NPS A;  4PV1 C;  4F88 A;  4DV6 Q;  2B2U A;  2QKI C;  2HHH Q;  1B3Q A;  1TQO A;  1AP0 A;  3NSW A;  1HZB A;  5C0X H;  2L0C A;  2EQS A;  1EYD A;  3KF6 B;  1HNX L;  1I6H B;  1CFM A;  1VDZ A;  1N9W A;  1CA5 A;  1Q8K A;  3D4R A;  3K7A H;  1ESR A;  4FXD A;  1MJC A;  4EQN A;  1KQS A;  3GTP H;  2QGQ A;  3GD7 A;  1JQY D;  2K5Q A;  3HOW G;  1Y14 B;  3I7F A;  2NWG A;  3BYT B;  4JV5 L;  1B9N A;  4LF4 Q;  1PYW D;  4FXK C;  3NWS A;  5FLX L;  5D3D A;  1YZ6 A;  1YHQ A;  4OEM B;  2YU9 H;  3RN5 A;  5C4J B;  2B63 H;  3A8J E;  4ZRZ A;  1STG A;  1ICF B;  3GV6 A;  1KC8 C;  4ILW A;  2ALY B;  2R7Z H;  3IKJ A;  1NR4 A;  4LJZ C;  3E9I A;  4RGT A;  3PIO A;  4A3B G;  4C3H H;  2GN5 A;  4C3I G;  4QF4 A;  1EZ6 A;  4GKJ L;  2JEA I;  5TSS A;  2F0V A;  1GUT A;  1EOV A;  2M2L A;  2OEO A;  5I9O A;  1S5B D;  4NW2 A;  4ID6 A;  4J8Q A;  3FVQ A;  3EFX D;  1A62 A;  1BR9 A;  4R9W A;  1HR0 W;  2Z6B A;  1RF2 D;  2L12 A;  4FVM A;  1EYC A;  4JBM A;  1JOR A;  2Q2T A;  2K7V A;  4P73 A;  2XGT A;  4K2K A;  5I2Y A;  3PGZ A;  3GTM H;  3S17 B;  2EOT A;  1QOH A;  2GVB A;  3H0G H;  3I3C A;  3ULJ A;  2H4O A;  3PIP A;  4X6A H;  3NWT A;  1JE5 A;  1SAP A;  4MZ9 A;  5KRU A;  3MEH A;  5C0X I;  1IL8 A;  3BYY B;  4KHP L;  5CV7 A;  1M1K C;  1HHV A;  4C3J B;  5M3F H;  4JI0 Q;  1K28 A;  2A74 C;  2PQA B;  5C44 G;  1WTH A;  3J81 j;  2NVQ B;  2M00 A;  2RVL A;  4B9W A;  3AMU A;  1U9R A;  3CP0 A;  5C3E B;  5C4X G;  1NJI C;  2F0M A;  1KLU D;  3FDT A;  5JVG 3;  4A93 H;  2CCZ A;  1FJG L;  1O78 A;  1KL9 A;  1C48 A;  4BBR B;  1PFM A;  2E76 C;  1QB5 D;  3IFT A;  3VR2 A;  2IT1 A;  5GAE C;  5EKI A;  4X64 Q;  1RCV D;  2P5Z X;  4ME5 A;  2PZU A;  4B3M Q;  4DR3 Q;  3CCL A;  1Y1W G;  4F8M A;  3R2I A;  3NE5 B;  2I46 A;  3OYY A;  3H09 A;  4DV2 L;  1QIL A;  4JI5 Q;  2IY5 B;  1Q7Y C;  2OWO A;  3EVQ A;  1Q12 A;  4KY5 A;  4OWT B;  4IFD G;  5M3M H;  2UXD Q;  4OO1 H;  4QQB X;  4IUQ A;  2F4V L;  2KHS A;  5GRO A;  4YWM A;  2UU9 L;  1W3S A;  2F0W A;  2XN9 C;  4DV0 Q;  4NXM L;  2K52 A;  4DXG A;  1QVC A;  1M90 C;  4DR6 L;  4MTN A;  1CI3 M;  3G6E A;  1HTL D;  5G3L F;  2AQ2 B;  1GUN A;  1WCM H;  1VF7 A;  2K14 A;  2DN8 A;  2Q2H A;  2NTT A;  2Q2I A;  5E4W C;  1D5X C;  3DEO A;  1HZC A;  2YTV A;  3A8I E;  1TS5 A;  1K3B C;  2WII B;  3MVV A;  5IYC G;  5DM7 3;  3K5M A;  1CZG A;  1EIF A;  4U68 A;  2QA4 A;  4A3F H;  1R4Q B;  1AEX A;  2G5D A;  1K3R A;  3D6C A;  1XTD A;  1OXS C;  3FMC A;  1BNZ A;  1HQM C;  1F9S A;  2UXB Q;  1HXY D;  1MHW C;  1JIC A;  3CPF A;  1I4P A;  4QIW B;  1KDA A;  1FR3 A;  1SMY C;  3ZYY X;  3QOJ A;  4PQX A;  3T1Y Q;  4XQQ A;  1QVF A;  1BOS A;  2B2T C;  2TSS A;  4R4I A;  3W2D A;  2AWO A;  4DK6 C;  4F87 A;  1VQD A;  1QZH A;  4GNX B;  2D2C C;  2WB1 G;  3UDI A;  4OO1 I;  2ES2 A;  4JI6 Q;  1F2L A;  2C35 B;  2BOS A;  4IUR A;  4RCO A;  3OIQ A;  4G7H C;  4A3K H;  1NCV A;  2MHV A;  1KXL A;  1UE6 A;  5AJ3 L;  5J39 A;  2LS0 1;  2K03 A;  4IZ8 A;  4PZ7 A;  2F0J A;  1VQK A;  1Q1E A;  1EZ8 A;  4C3H G;  2A68 D;  1PH5 A;  3PQI A;  1QZG A;  4EX5 A;  4A3M B;  2SDF A;  1VQ7 A;  3SK8 A;  3Q23 A;  1WTR A;  3NTH A;  3PF4 A;  3J80 i;  1W2B A;  4KN4 C;  1STN A;  3K7U C;  4XQN A;  1N34 L;  1IBL Q;  5LMU L;  2AUK A;  2ZTE A;  1AE3 A;  3GO5 A;  2EXD A;  2X69 A;  1ET9 A;  1KHI A;  2R7D A;  2LXK A;  3VYU A;  1SRO A;  2CFM A;  2WIN B;  3CCV A;  3NHH A;  3GTQ H;  4B3R L;  4FF4 A;  2AHO B;  4RHR A;  1IL2 A;  1EU3 A;  4OWX B;  1U4L A;  3RNU A;  2Y0S B;  3RD4 A;  2FXQ A;  4CBV A;  4DGZ A;  2PW5 A;  5COY A;  4HCE A;  1S5F D;  1HNX Q;  2R92 B;  2ZTD A;  1PRT C;  1SEB D;  3MXN B;  1SBB B;  3L0O A;  3HOZ H;  4GKK L;  2YTX A;  4EGV A;  4DV4 Q;  2WV6 D;  3EN2 A;  1ET6 A;  3I70 A;  3PUV A;  3PMF A;  1KDC A;  4DXF A;  4J15 A;  3A5U A;  2XTI A;  1Q81 C;  1E0B A;  3AQQ A;  3TRZ A;  2IHE A;  4LFA L;  2OTJ A;  1SYG A;  1MSG A;  5J22 A;  2CKZ B;  1PRT B;  4LWC A;  3QB3 A;  4R4Q A;  1N32 Q;  1JOO A;  4N8X 1;  1GM5 A;  1VMC A;  3V96 A;  2JA8 H;  3CC2 A;  1CHP D;  2LFN A;  1J9O A;  3J80 c;  1N36 Q;  4DR2 L;  2PNH A;  2ZXO A;  2A68 C;  3AFQ A;  4EQO A;  1SMX A;  2N78 A;  3BS1 A;  2XVS A;  1VQM A;  2J4X A;  2QDB A;  1XMO Q;  3TP5 A;  4DV7 L;  2KHJ A;  3HEJ A;  2FIN B;  1MGS A;  2HCC A;  2JK8 A;  2LMC B;  3T51 B;  2ZM6 Q;  2O2L D;  4WJW A;  1TY2 A;  4AQY L;  1I4H A;  2KOL A;  3I72 A;  2K05 A;  1EIY B;  1P8L A;  4A76 A;  3LX0 A;  3HOU B;  1WCM G;  2VXW A;  3ONA B;  3FPU B;  4A3E G;  3NUC A;  2WAQ G;  1HA5 A;  2WB1 E;  4HTH A;  3J81 i;  4BY7 H;  4KHP Q;  1I94 Q;  4DV6 L;  4HCS A;  4IUP A;  4NMZ A;  2HHH L;  4A4I A;  1LTL A;  4OXP A;  1CK1 A;  4RA8 A;  5FLX E;  2MP1 A;  1CTM A;  3CQZ B;  2E2I H;  1W6K A;  4IOA A;  5JJZ A;  1YJW A;  2CWP A;  1O7I A;  3T4A C;  1WTQ A;  2B2T A;  3CC7 A;  5EQ0 A;  4A3F G;  3D31 A;  1GD7 A;  1EYG A;  1JB7 A;  4OX9 Q;  1NUC A;  2MUY A;  1F77 A;  3H94 A;  4DK0 A;  1X9N A;  4LF4 L;  3T56 B;  1VQC A;  1M8A A;  2H5X A;  3OHX C;  4KTA A;  3FKI B;  2F0T A;  5IP9 H;  1JWM D;  2F52 A;  3S1R B;  4DV2 Q;  2UUC L;  5C4Z A;  3DWP A;  4QUC A;  4GLX A;  1EU4 A;  4I7Z C;  1QCB D;  2IL8 A;  4X3S A;  2KHI A;  3TS2 A;  3CME A;  3PO3 G;  2V4D A;  3MXN A;  2LSS A;  5IYD G;  1F2M A;  2PPB C;  3S2D B;  4ODG A;  4ZAI A;  4H44 C;  2RSO A;  1MJE A;  2WKD A;  2R7F A;  2UU9 Q;  3HOV H;  3C1E A;  1FYC A;  2VQF L;  2ZXP A;  1X55 A;  1NMF A;  3J81 c;  2B8G A;  2FJ2 A;  4TKO B;  4CJ2 C;  1PTO D;  1DGS A;  4KHV A;  4J6H A;  1XXG A;  3VYS A;  4QB4 A;  2F0S A;  3NEN A;  4FYD A;  3E6Z X;  3JAM i;  5ELO A;  2BDO A;  5BN5 A;  2YU9 B;  3PO2 B;  2I5L X;  4KJO A;  1GUS A;  4JI0 L;  2X6L A;  3TZD A;  3WOE A;  2NUC A;  2KQ3 A;  4IUT A;  3UE1 A;  4HIK A;  3VR3 A;  1VQL A;  1PH2 A;  3S24 A;  3M9B A;  4YWK A;  3HOW H;  2K28 A;  2RHQ B;  3GTG H;  1ZYR D;  4QUF A;  3I91 A;  1ENC A;  1UEB A;  2QDL A;  4X64 L;  2EY5 A;  1HRJ A;  1NSN S;  2CQA A;  4B3M L;  4DR3 L;  1Y1V B;  1XMQ L;  2E74 C;  2NVT B;  1HFG A;  2F1M A;  4HMJ A;  3C46 A;  1A2T A;  2QIL A;  1QWY A;  2F0K A;  2SEB D;  4UHV A;  1YNJ C;  1JJ2 A;  2D9U A;  3H0G B;  2EYF A;  2CW0 D;  4JI5 L;  1H9S B;  4FF2 A;  3HG9 A;  4A3B H;  3PF5 A;  4B3T L;  4HJA A;  3G4S A;  2RA4 A;  4RFB A;  1SXT A;  5C5L A;  3NK9 A;  2ZT9 C;  1YJ9 A;  3ICE A;  2RDG A;  4DAY B;  2UXD L;  2MJ8 A;  3NPP A;  5AJ3 Q;  2JA8 G;  2JA7 B;  3SK5 A;  5GQO A;  2DNC A;  2M9V A;  1Y69 U;  4YCW A;  4H7B A;  3S16 H;  2O5J C;  5BN3 A;  2PW7 A;  4DV0 L;  1B7Y B;  4JI1 L;  2JA6 G;  3JC6 6;  3JAM c;  1HNW Q;  2H1E A;  2LKV A;  1QE6 A;  1VQH A;  4JW0 A;  4TQU S;  1N34 Q;  5JJL A;  1D2B A;  1HJP A;  1HQR D;  3CRK C;  1EEI D;  1KTK A;  4XIG S;  4QGU A;  3QO2 A;  1WFQ A;  1VF5 C;  4O42 A;  2L55 A;  1J8I A;  2BA0 A;  1YNX A;  2G9D A;  3KLR A;  4WOR A;  2VY3 A;  1I50 B;  3NEM A;  3HKZ G;  1I5F A;  5C44 H;  1ASY A;  1SNP A;  2RSN A;  1BCP F;  3S1M B;  3GTL B;  4C2M B;  1LT6 D;  4BBR G;  1A3T A;  2MQH A;  2D5D A;  5ELC A;  3LWE A;  4UY8 C;  3HOY B;  3PUZ A;  2RDF A;  3G6J B;  4HJ5 A;  4IQZ A;  3CRL C;  2IX0 A;  4HMI A;  4KKT A;  4GKK Q;  4MN3 A;  1TWC B;  5KGU A;  4LFC Q;  3KFU A;  3P7J A;  4M1U B;  4FXG C;  1VQ5 A;  4A3G B;  1Y1W H;  2I5M X;  4K0K Q;  2F0Q A;  4X66 Q;  3T1Y L;  1K83 B;  1PZI D;  2ZJR A;  3SR1 A;  4POG A;  2Q8I B;  3C3L A;  2VQE Q;  4PZ8 A;  1T5E A;  4JI6 L;  4IFD H;  1ENA A;  1IW7 D;  3I4N H;  1RL2 A;  2R3Z A;  5C0X J;  4K2L A;  1SNO A;  2EJM A;  4IAL A;  3I2Z A;  2PI2 E;  4R4C A;  3IRB A;  5J3B A;  4F7X A;  2G9H D;  3FRP B;  2IX1 A;  3NTI A;  1X6O A;  4Z9C B;  1RJT A;  3E9H A;  1PH3 A;  5ELE A;  4DV7 Q;  2K6A A;  1HH2 P;  2NTS A;  4BXX H;  4A3J B;  1LTT D;  2FMM A;  3NTK A;  2UUB L;  5AFW A;  1IBL L;  1G8Z D;  4IOC A;  3KUP A;  1UWV A;  2BCO A;  3I73 A;  4P72 A;  3MAQ A;  4X65 Q;  1ESF A;  2XWJ B;  3B6Y A;  2EY6 A;  1NY4 A;  1E22 A;  2NVX H;  4OWW B;  5IYC H;  1XNQ L;  2E2D C;  5FO7 B;  1CA6 A;  4POF A;  4DAY A;  2PNR C;  3SK4 A;  1B1Z A;  5CV4 A;  2E2H H;  4WJ4 A;  2F0P A;  1NTG A;  4DK1 A;  4V0B A;  5C3W A;  3T1H Q;  3Q8D A;  2EYM A;  4DV4 L;  4P74 A;  4ZCK A;  3U9O A;  5GAD C;  1IZ6 A;  2JA5 B;  1QVG A;  4IFD I;  1DJR D;  1PZK D;  3UE0 A;  4LF7 L;  5M5X H;  3LGJ A;  2KEN A;  4TRD A;  3HKS A;  1ZEQ X;  1SE2 A;  2AWN A;  4UPA A;  4KHZ A;  1IW7 C;  3HKZ E;  1IBM L;  4J1M A;  4G4K A;  1PXU A;  2UUC Q;  1IKM A;  1N32 L;  1E2W A;  2VNU D;  4A3M G;  1LTA D;  1EQV A;  1EQR A;  4KKS A;  3SDZ A;  2GVA A;  3W5O A;  5LMN Q;  4LW1 A;  1N36 L;  1S3O A;  1R9T H;  2E2J H;  3MFG A;  1TVX A;  2EYH A;  4FDB A;  3S1Q B;  1EUJ A;  3KBX A;  2I07 B;  4NXN L;  2N3S A;  1TT2 A;  2VL6 A;  3MFY A;  4DNT B;  2EDG A;  1XMO L;  2ZM6 L;  5IE8 A;  3C2P A;  4BY1 H;  5M5W B;  2VQF Q;  1Q8I A;  4IUN A;  2JSO A;  3O13 A;  1SR3 A;  2WFW A;  1G6P A;  4A3D H;  4RHS A;  4IPG A;  4CKC A;  4IN3 A;  1L1O C;  3H3V C;  1Q86 C;  2MGS A;  2YYZ A;  1I94 L;  5EGT A;  3QWN A;  3OPO A;  1JT8 A;  1EL0 A;  5C4H A;  5C5M A;  5IGG A;  1B70 B;  1SYF A;  4K14 A;  4DK3 C;  5GAH C;  3FP9 A;  4FO2 A;  4CKB A;  1EWI A;  1IKL A;  3OSO A;  4DNI A;  4L8J A;  5D3I B;  1E2Z A;  1SE4 A;  1ZXT A;  2NVY B;  3KF8 B;  1YIT A;  4OX9 L;  1FL0 A;  1L1O B;  1GHJ A;  4R8N A;  3CF5 A;  2R93 B;  3UDX A;  3CCJ A;  3BU2 A;  3NXW A;  1UAP A;  4JI4 Q;  2XRQ D;  4A3C H;  2JQO A;  2ID0 A;  1SN8 A;  1XMQ Q;  1SMY D;  5IT9 c;  1FNU A;  1ML0 D;  2NN6 G;  4PMB A;  2ZJQ A;  3U4V A;  1F9Q A;  1TWH B;  3RLO A;  4GZY C;  1LV9 A;  1IYJ B;  2VUM B;  3KK7 A;  1A0I A;  1X3F A;  2K32 A;  5CBE E;  4B3T Q;  4R8I A;  1D8L A;  2F0L A;  3KF6 A;  3TN2 A;  1X54 A;  2LXJ A;  1Y8N B;  1YEZ A;  1TWF B;  2L9H A;  2PO4 A;  3PIO 3;  3I4N G;  3WOF A;  2EY2 A;  2A6E C;  4LF5 Q;  2A8V A;  3S14 B;  4LNQ A;  2DJG C;  3T53 B;  2NB0 A;  1SND A;  1SNM A;  3SEB A;  3GTJ H;  3MZ5 A;  2UXC L;  4K5W A;  3KOJ A;  3HOU G;  4JI1 Q;  1SE8 A;  2VW9 A;  2F3V A;  1WI5 A;  1A3U A;  4HSP A;  4A3E H;  3KYH C;  1LM0 A;  2HIV A;  1PTO H;  2F3I A;  4JG2 A;  4BXX G;  4EVO A;  1IXR A;  2MNA A;  3HOX B;  4G7O C;  1MKH A;  3PIP 3;  3RR5 A;  4K6D A;  4OGQ C;  5H1S E;  4Y7N B;  3S1N B;  4L63 B;  2BDN A;  3DXJ C;  3P20 A;  1RTO A;  4DKA C;  5IGC A;  1QNU A;  4GNX C;  2CWA A;  3GDE A;  1PH6 A;  2EIF A;  1OXX K;  1DM0 B;  4AYB G;  4X3T A;  4FNF A;  1WVL A;  1N33 Q;  3QR8 A;  3AU7 A;  1PRT D;  2F0D A;  1BVS A;  1X3Q A;  3NP8 A;  3FPP A;  2K50 A;  1F2Y A;  4H13 C;  4GLV B;  3TSS A;  3BVG A;  1KNA A;  1LAC A;  3PUY A;  3M4O B;  3BZD B;  3M7N A;  4O0A A;  1NMG A;  1YI2 A;  2ICI A;  3RZO H;  3A55 A;  3MHB A;  1K8G A;  4XQJ A;  2PQA A;  3PO3 H;  4IPH A; 
#chains in the Genus database with same CATH homology
 4DR4 Q;  4DV3 Q;  5IYD H;  5GAG C;  4A3F G;  1GVP A;  2K75 A;  1YVC A;  4DUZ Q;  3D31 A;  4A3I G;  1GD7 A;  2IHF A;  4GN5 A;  1EYG A;  2Y0S G;  1VQA A;  1CKN A;  1YHA A;  4JI7 Q;  3I4M G;  1JB7 A;  4OX9 Q;  4B3R Q;  1XPR A;  5IWA Q;  1X9N A;  2RHS B;  4LF4 L;  3SGI A;  4DR1 Q;  4YY3 L;  2R92 G;  1VQ6 A;  2VUM G;  3CD6 A;  1VQC A;  1VQN A;  4BY7 G;  5C4X H;  3S15 H;  2H5X A;  4WJ3 M;  1L1O A;  1PFS A;  4LF9 Q;  4Y52 H;  4HIM A;  5LMN W;  3KJP A;  3RN2 A;  5IP9 H;  4LUZ A;  4R4O A;  2F52 A;  4UP9 A;  4DR5 L;  4LUV A;  1Y1V H;  1VQP A;  4JYA Q;  5BR8 Q;  3OTO L;  4DV2 Q;  2UUC L;  2NVT H;  1SLJ A;  2E5L L;  2UUB Q;  1TWG H;  3PO2 G;  3HFZ B;  1HNW L;  5JJK A;  1G51 A;  2ZTC A;  4GLX A;  2UXB L;  1L0W A;  2YTY A;  4BY1 G;  2RF4 A;  4PZ6 A;  4YCU A;  1SRU A;  3TQY A;  5ELN A;  2KHI A;  2MO1 A;  1TWA H;  3CME A;  3PO3 G;  3TS2 A;  2DUD A;  2LSS A;  3M4Q A;  5IYD G;  2BH8 A;  5JEA G;  1IBK L;  3M85 A;  2Z0S A;  4L5T A;  4LF6 Q;  3STB D;  4DUY L;  3K8A A;  4A3D G;  3GTO H;  2JEB I;  4BBS H;  1MJE A;  1XNQ Q;  5M5Y H;  2R7F A;  1CSQ A;  1E3P A;  4YHH L;  2UU9 Q;  1V43 A;  3HOV H;  3KDF A;  2JA7 H;  4LFB L;  4JBW A;  4LFA Q;  2Q2U A;  1YBY A;  2VQF L;  3CW2 C;  1X55 A;  1OXV A;  5HY6 A;  4JI2 Q;  1D7Q A;  3PCO B;  4DV1 Q;  1NMF A;  3J81 c;  2OTL A;  4R4T A;  1WYD A;  5DLQ E;  5FLM G;  5IP9 G;  4KI0 A;  5C4J H;  1Y1V G;  1DGS A;  1SFO H;  1E1O A;  2JA9 A;  4LFC L;  3NEN A;  1AH9 A;  1K0R A;  1VQ8 A;  4DR2 Q;  3JAM i;  5ELO A;  4APV A;  3RZD H;  1JJG A;  4R1J A;  2B29 A;  4K0K L;  1X56 A;  3A5Z B;  4QIW E;  2I5L X;  3VDY A;  1T9H A;  4JBJ A;  1VQF A;  5IP7 H;  3BZK A;  3NBH B;  4TVA B;  4X66 L;  1VQI A;  4JI0 L;  1I50 H;  1XNR L;  4LF7 Q;  3I4O A;  2UUA L;  3WWV A;  4JC0 A;  1FVI A;  3CCR A;  4BBS G;  3CCE A;  1C0A A;  1UE5 A;  3S1M H;  2OCE A;  1PYS B;  3MEF A;  3GTL H;  3UE1 A;  4A3C G;  4HIK A;  4AQY Q;  3HOV G;  4C2M H;  1VQL A;  2VQE L;  4PG3 A;  4LUO A;  3S24 A;  3CCU A;  3M9B A;  1PH2 A;  1IBM Q;  2JA7 G;  1LYL A;  1U0L A;  1P16 A;  3HOY H;  4YWK A;  3HOW H;  3W1B A;  1GO3 E;  2RHQ B;  4IPD A;  1OTC A;  3GTG H;  2K5N A;  4A3L G;  1Z47 A;  1U5K A;  1CKO A;  4JI8 Q;  3GTK H;  2HIX A;  3K0X A;  1UEB A;  4NPS A;  3S17 H;  1TWC H;  2VS1 A;  4AYB E;  4X64 L;  4DV6 Q;  4JI3 L;  1HZ9 A;  3CC7 A;  3DLL A;  2JA6 H;  1Z9F A;  3RLF A;  4DR3 L;  2AMC B;  2HHH Q;  4B3M L;  2PI2 A;  4NXN Q;  1XMQ L;  1YHB A;  3G71 A;  4A3G H;  3PUW A;  5FLX c;  2BH2 A;  1HZB A;  4C3J H;  2EQS A;  4GS3 A;  3KF6 B;  1HNX L;  1JJ2 A;  1KRS A;  1VQG A;  4JI5 L;  1K83 H;  4A3B H;  1TXY A;  1N9W A;  4HIO A;  3PF5 A;  1WJJ A;  1Q8K A;  4B3S L;  4HJA A;  4B3T L;  3K7A H;  3G4S A;  4A75 A;  4DAM A;  4X65 L;  5C3E H;  1MJC A;  1KIX A;  1KQS A;  2KCM A;  4GNX A;  1YJ9 A;  2QGQ A;  3FKI G;  3GD7 A;  3CPW A;  1HR0 Q;  3GTP H;  3ICE A;  2PMZ E;  3STB C;  4DAY B;  1Y14 B;  3I7F A;  4UP8 A;  3TS0 A;  5AJ3 Q;  3HOY G;  3HOW G;  4JV5 L;  1PVO A;  2ZJP A;  4LF4 Q;  2JA8 G;  4YY3 Q;  5GQO A;  4BBR H;  4YCW A;  3S16 H;  4YWL A;  1YZ6 A;  1YHQ A;  4DV0 L;  1B7Y B;  2I0Q A;  2YU9 H;  4JI1 L;  3RN5 A;  1VQ4 A;  2JA6 G;  2Y0S E;  3JC6 6;  4DV5 L;  4A3G G;  2B63 H;  4DR5 Q;  2NZO A;  3JAM c;  3OTO Q;  5IY0 A;  1HNW Q;  2D62 A;  5C0X G;  1KC8 C;  2ALY B;  3T1H L;  1VQH A;  4TQU S;  1N34 Q;  2R7Z H;  5JJL A;  1HJP A;  4XIG S;  1VQE A;  3F2C A;  4QGU A;  4A3J H;  1WFQ A;  3E9I A;  2BA1 A;  3PIO A;  4A3B G;  4C3H H;  2GN5 A;  3E0E A;  1JMC A;  2BA0 A;  1YNX A;  3J7A 5;  2VY3 A;  4GKJ L;  5K36 G;  2JEA I;  3NEM A;  3HKZ G;  1I5F A;  1EOV A;  5C44 H;  3KLW A;  1IBK Q;  1ASY A;  2DGY A;  4DUY Q;  1CKM A;  4AIM A;  1VQ9 A;  1YIJ A;  1V9P A;  1A62 A;  1HR0 W;  2JE6 I;  4BBR G;  1YJN A;  2MQH A;  4LFB Q;  1XPO A;  3K81 C;  4UY8 C;  1BKB A;  1GKH A;  1OXT A;  3PUZ A;  4HJ5 A;  4JBM A;  2D0P A;  2B3G A;  1XJV A;  2IX0 A;  2B63 G;  2Q2T A;  4P73 A;  2XGT A;  3PGZ A;  3GTM H;  4GKK Q;  3AEV A;  3ULJ A;  2GVB A;  1L2F A;  3H0G H;  3AFP A;  3PIP A;  4LFC Q;  3KFU A;  2R7Z G;  1I6H H;  3ZJY C;  1VQ5 A;  1JE5 A;  1A8V A;  4MZ9 A;  5EAY A;  5C0X I;  5LMN L;  2JJQ A;  1Y1W H;  4KHP L;  4A3J G;  1HNZ L;  2I5M X;  4K0K Q;  1M1K C;  5M3F H;  4X66 Q;  4JI0 Q;  1PYB A;  3T1Y L;  1XNR Q;  2PQA B;  5C44 G;  2ZJR A;  1PA6 A;  2UUA Q;  1H95 A;  3J81 j;  2UXC Q;  4POG A;  1Q46 A;  5LMU Q;  3TEH B;  2JA5 H;  2AKW B;  3DM3 A;  2A1A A;  3CP0 A;  5C4X G;  4RMF A;  2VQE Q;  4PZ8 A;  3CMA A;  1NJI C;  4JI6 L;  2ASB A;  2UXD L;  1PH4 A;  4DV3 L;  3TRE A;  3I4N H;  1RL2 A;  4A93 H;  4DUZ L;  1CSP A;  5C0X J;  2CCZ A;  1FJG L;  1KL9 A;  3OW2 A;  5IYB H;  3I2Z A;  3A0J A;  2PI2 E;  2IT1 A;  4PMW A;  2L15 A;  5GAE C;  4DR1 L;  4R4C A;  3H0G G;  3IRB A;  5J3B A;  4DPG A;  4X64 Q;  1S72 A;  4JI3 Q;  2IX1 A;  3FHW A;  3NEL A;  4DR3 Q;  4B3M Q;  3CCL A;  1X6O A;  1Y1W G;  2K4K A;  4LF9 L;  2Z6K C;  1K9M C;  3E9H A;  5HGQ A;  5M3F G;  1PH3 A;  3S1Q H;  4DV7 Q;  3BZC A;  3OYY A;  1HH2 P;  1S40 A;  5BR8 L;  4DV2 L;  4BXX H;  4JI5 Q;  2UUB L;  1J5E L;  2IY5 B;  4P75 A;  1IBL L;  2JA5 G;  2HT1 A;  4IOC A;  1Q7Y C;  2OWO A;  4B3S Q;  4X6A H;  1UWV A;  1A63 A;  4P72 A;  5M5W H;  4X65 Q;  1Q12 A;  4OWT B;  3D0F A;  3B6Y A;  5FJ8 H;  4IFD G;  1J6Q A;  2A19 A;  5M3M H;  1NY4 A;  1E22 A;  4ME3 A;  4A93 G;  2UXD Q;  3KDF B;  4JV5 Q;  1G29 1;  4GLA C;  2NVX H;  4LF6 L;  4QQB X;  2F4V L;  4OWW B;  5IYC H;  1BBW A;  1XNQ L;  4IJL A;  1X65 A;  4JI4 L;  2NZH A;  5GRO A;  4YWM A;  4POF A;  2UU9 L;  4JOI C;  1W3S A;  1ASZ A;  4DV0 Q;  4NXM L;  2K52 A;  1QUQ B;  1QVC A;  1M90 C;  4DV5 Q;  4DR6 L;  4QY7 A;  4MTN A;  3G6E A;  5IP7 G;  2E2H H;  4L5R C;  4WJ4 A;  1PH9 A;  4A3M H;  1NTG A;  2WAQ E;  1XPU A;  1KRT A;  4OON A;  1WCM H;  4ALP A;  3Q8D A;  1E1T A;  3T1H Q;  1VQO A;  2NVQ H;  4O2D A;  2K14 A;  2Q2H A;  1EQQ A;  2Q2I A;  4AH6 A;  3U50 C;  4DV4 L;  4P74 A;  3U4Z A;  1C9O A;  2OQ0 A;  1HZC A;  4GKJ Q;  1PH1 A;  1OXU A;  5GAD C;  2YTV A;  1IZ6 A;  4LF5 L;  2NVY H;  3I55 A;  5M3M G;  2KCT A;  4IO9 A;  1QVG A;  4IFD I;  4OO1 G;  3UE0 A;  4LF7 L;  5M5X H;  3H3V H;  2VZA A;  3CAM A;  1B8A A;  4X62 L;  3LGJ A;  2KEN A;  3ULL A;  5IYC G;  4JCV E;  1EIF A;  3J7Z C;  3HKS A;  2R93 H;  1V1Q A;  2QA4 A;  2AWN A;  4UPA A;  4KHZ A;  4A3F H;  4HID A;  1UE1 A;  3HKZ E;  1IBM L;  1K3R A;  1XTD A;  2UUC Q;  1OXS C;  1Q1B A;  2E5L Q;  2QEX A;  1N32 L;  1PH8 A;  1TWH H;  4GOP C;  1VS0 A;  2UXB Q;  4A3M G;  2VNU D;  2R92 H;  1EQR A;  3W1G A;  2VUM H;  2GVA A;  1FGU A;  3W5O A;  5LMN Q;  4LW1 A;  1N36 L;  1S3O A;  3CPF A;  1R9T H;  3K80 C;  2E2J H;  2ATW A;  1MIU A;  4IFD J;  3L7Z C;  4KLK A;  4FDB A;  5C3E G;  1EUJ A;  3F2B A;  2OQK A;  4NXN L;  2N3S A;  4IJH A;  1UE7 A;  1Q82 C;  1TWF H;  3T1Y Q;  4QL5 A;  3F2D A;  1QVF A;  2VL6 A;  4YHH Q;  4R4I A;  3I56 A;  2AWO A;  4DK6 C;  1XMO L;  3S14 H;  2D0O A;  1VQD A;  2ZM6 L;  5IE8 A;  1QZH A;  4BY1 H;  3AYH B;  1BBU A;  2VQF Q;  4GNX B;  2WB1 G;  3UDI A;  4OO1 I;  2K5H A;  4P71 A;  2CQO A;  2R93 G;  4JBK A;  2ES2 A;  4JI6 Q;  2K5V A;  2C35 B;  5JJI A;  1K73 C;  1N33 L;  2HQL A;  1SR3 A;  1FJG Q;  4GOP B;  2WFW A;  3ERS X;  1G6P A;  4A3K H;  1HR0 L;  4A3D H;  2YV5 A;  4IPG A;  4UP7 A;  1L1O C;  1KXL A;  1UE6 A;  5AJ3 L;  2MO0 A;  4PZ7 A;  1Q86 C;  1VQK A;  3PUX A;  1Q1E A;  2YYZ A;  1I94 L;  4L5S A;  1PH5 A;  4YCV A;  3HOX H;  1QZG A;  4EX5 A;  3CC4 A;  1VQ7 A;  3KJO A;  1X3E A;  4QJF A;  4LF8 L;  1JT8 A;  5FLM H;  3PF4 A;  1KAW A;  3J80 i;  1PHJ A;  1W2B A;  4DR7 L;  1B70 B;  4GN4 B;  1EFW A;  3A74 A;  4Y7N H;  3S1N H;  3K7U C;  1J5E Q;  1CKN B;  1X3G A;  4DK3 C;  5GAH C;  1N34 L;  3FP9 A;  1IBL Q;  5LMU L;  2ZTE A;  1E7Z A;  3CCS A;  1EWI A;  1AE3 A;  4DR4 L;  3GO5 A;  4DNI A;  2EXD A;  2KBN A;  4L5Q A;  3H3V I;  3KF8 B;  1KHI A;  2R7D A;  2LXK A;  1SRO A;  2CFM A;  4JI7 L;  3CCV A;  1YIT A;  4OX9 L;  1FL0 A;  3GTQ H;  1L1O B;  4B3R L;  4IPC A;  5IWA L;  3CF5 A;  2AHO B;  3UDX A;  3BU2 A;  4H02 A;  3CCJ A;  4A3K G;  1IL2 A;  2F4V Q;  4EQ5 A;  4JI4 Q;  3PSI A;  3HOU H;  1WOC A;  4OWX B;  3RLN A;  4BA1 I;  1PH7 A;  2JQO A;  2V1C C;  3CCM A;  2ID0 A;  3RNU A;  1JJC B;  4A3C H;  1SN8 A;  1XMQ Q;  4NXM Q;  5IT9 c;  2FXQ A;  2NN6 G;  4DR6 Q;  2ZJQ A;  3U4V A;  3HOX G;  3M4O H;  4NB3 A;  4JYA L;  3M4P A;  3RLO A;  1HNX Q;  2R6G A;  2ZTD A;  4BA2 I;  3UDF A;  1IYJ B;  3MXN B;  3L0O A;  1A0I A;  4A3L H;  1QUQ A;  2Z6K A;  1E24 A;  1X3F A;  3HOZ H;  3CQZ H;  4GN3 B;  1VQJ A;  4GKK L;  4B3T Q;  1D8L A;  2YTX A;  4RG1 A;  3KF6 A;  1AE2 A;  4DV4 Q;  3EN2 A;  1X54 A;  2LXJ A;  4HJ9 A;  3PUV A;  2N49 A;  1YEZ A;  3UDG A;  3I4N G;  3ER0 A;  4J15 A;  4HJ7 A;  3A5U A;  4LF5 Q;  2A8V A;  4LNQ A;  5IYB G;  3PV0 A;  2XTI A;  1Q81 C;  3GTJ H;  4X62 Q;  2UXC L;  3AQQ A;  3TRZ A;  1PV4 A;  2IHE A;  3KOJ A;  3HOU G;  4JI1 Q;  4LFA L;  1SE8 A;  2RCN A;  1I3Q H;  2N8N A;  4MNO A;  1LUZ A;  2VW9 A;  4HJ8 A;  2OTJ A;  4JI2 L;  1WI5 A;  4DV1 L;  3FKI H;  2CKZ B;  4JOI A;  4LWC A;  4R4Q A;  1N32 Q;  4A3E H;  2NN6 I;  1NBW A;  1LM0 A;  3F8T A;  2HIV A;  3KYH C;  1GM5 A;  3S1R H;  2F3I A;  2JA8 H;  4JG2 A;  3EBE A;  4BXX G;  3CC2 A;  1IXR A;  2MNA A;  3S2H H;  3L2P A;  3J80 c;  1MKH A;  1N36 Q;  4DR2 L;  3HOZ G;  2PNH A;  1VCI A;  2I5H A;  3AFQ A;  3RR5 A;  5JEA J;  5FJ8 G;  1SMX A;  2N78 A;  5H1S E;  2E8G A;  3S2D H;  1VQM A;  1XMO Q;  4DV7 L;  2KHJ A;  2WP8 J;  4DKA C;  2ZM6 Q;  3CXC A;  3M3Y H;  2JK8 A;  4GNX C;  2CWA A;  4AQY L;  5E7N A;  3GDE A;  1PH6 A;  2EIF A;  1OXX K;  1VQB A;  4AYB G;  4A3I H;  4C3I H;  3F1Z A;  1N33 Q;  3I4M H;  1N8R C;  1EIY B;  1P8L A;  4A76 A;  3H15 A;  1BVS A;  2K50 A;  1WCM G;  4A3E G;  1RIP A;  4GLV B;  2WAQ G;  2MFI A;  2WB1 E;  4JI8 L;  3J81 i;  4BY7 H;  4KHP Q;  1CUK A;  4XTC S;  1KD1 C;  1HNZ Q;  4GOP A;  1I94 Q;  3CCQ A;  3PUY A;  4DV6 L;  3G48 A;  3M7N A;  4O0A A;  1NMG A;  2HHH L;  1YI2 A;  3BJU A;  4A4I A;  1LTL A;  4OXP A;  3PO2 H;  4LF8 Q;  3ULP A;  4DR7 Q;  1C7Y A;  2E2I H;  3EIV A;  3RZO H;  4IOA A;  1K8A C;  1NE3 A;  1K8G A;  1YJW A;  1HZA A;  3U58 A;  2CWP A;  1O7I A;  2PQA A;  3PO3 H;  4IPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...