2UXCQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcQ00
3T1YL 2E2JH 1WJJA 1N9WA 3UE1A 2NZOA 3BJUA 4C2MH 4YWKA 3F2CA 2UU9L 4JBKA 1XMQQ 1V1QA 1IBLL 4A3BH 2AMCB 1L0WA 2E8GA 2GVAA 4R4QA 5M5XH 4GN5A 3ICEA 1EQQA 3CPWA 1IBKL 4LWCA 4LUVA 4POGA 1P16A 2VQEQ 1PH6A 1E7ZA 2EQSA 2L15A 1IL2A 3JAMc 1I94L 3F2DA 4DNIA 1EUJA 4B3ML 4LF5L 3NELA 4DV4Q 3S1QH 5IE8A 2CWAA 1NE3A 5C0XI 5HGQA 4X6AH 1PA6A 2VY3A 2VL6A 5IT9c 5C4XH 5BR8L 4GLXA 1PH2A 1YZ6A 4R4TA 4HIMA 2I0QA 1E3PA 5K36G 2D0OA 1B70B 4C3IH 1WFQA 4OWWB 2LXJA 1CKMA 5C0XJ 3L2PA 4GNXB 1CKNA 3HOZG 2K5NA 5IY0A 1BVSA 2XTIA 1Q1BA 3VDYA 1VQIA 2ZTCA 4LFAQ 4DV2L 4BBRG 1K9MC 4EX5A 3PO2H 1Y14B 4GLAC 1VQJA 2AWNA 2Z6KC 5AJ3Q 2ASBA 2K14A 4L5RC 4JBWA 4BY1G 4X64Q 3PO3G 4DAYB 3CD6A 1I3QH 3NENA 1N33L 1YHBA 3I4NG 4A3DH 4GKJL 4GKKQ 4LF7Q 2C35B 2UXCL 3GTQH 1HR0Q 1K73C 3MEFA 4PZ8A 5ELNA 4A3MG 3A0JA 1Z47A 2JA6G 4IO9A 4HIKA 4DV6Q 4A3MH 2UUCQ 2JA6H 5FLMG 3GTOH 1OXSC 2R7FA 2IHFA 3BU2A 1CKOA 1G291 4JI1Q 3I4OA 3AEVA 3UDIA 3S24A 3CMEA 4JI4Q 3GTKH 4DAMA 4X65Q 1V43A 2LSSA 3MXNB 4OWTB 5IYBH 4JBJA 4A3JH 3BZKA 4OO1G 1PH4A 3HOYG 1WI5A 2KENA 2PQAA 4EQ5A 1UWVA 2Y0SG 2F3IA 1VQAA 4YCWA 1JJGA 5LMUL 2ZJRA 4LF6Q 5IP9H 4YY3L 3L7ZC 3ULPA 4C3JH 1PH3A 5IWAL 1OTCA 4OX9L 1VQ9A 4PZ7A 3J81c 1GM5A 1HR0W 2WB1E 2EXDA 1AE2A 2XGTA 5GAGC 4JYAQ 4DR5L 2UUCL 2IY5B 4JI0L 1N32Q 3EN2A 3HOZH 1VQCA 1HR0L 4JI8Q 1JJCB 5EAYA 1KD1C 1SROA 1EFWA 1PVOA 2PMZE 1AE3A 2I5MX 3M4QA 2B3GA 3NEMA 3I2ZA 4GNXC 3CQZH 1N33Q 4BY7G 2YYZA 3WWVA 4JI3Q 1MJEA 3CCUA 1YJWA 1XNRL 2D62A 1VQBA 4JC0A 1HZ9A 4DV1L 2WP8J 1TWGH 1XPOA 2A8VA 1Q7YC 2E2IH 4YY3Q 4XTCS 3PCOB 1SFOH 4UPAA 1YITA 3ULLA 3HOXG 2GVBA 3HOXH 1K83H 1SMXA 1XNQQ 4LUOA 1KQSA 4GN4B 2ZTDA 5BR8Q 1X55A 3RZOH 1FJGQ 3CMAA 2WFWA 1NBWA 1P8LA 3KF6B 3I4MH 2YU9H 4YHHQ 3PGZA 1VQ7A 1XTDA 2N8NA 2UUBQ 2YTYA 4MNOA 2MNAA 2HT1A 4DV7L 4DV5L 2ZM6L 3JAMi 1YIJA 4A3GG 3M4OH 2PI2E 2VQEL 1KHIA 3GTJH 4P71A 1X3EA 2ATWA 1T9HA 1WOCA 1TWAH 3CCJA 1KXLA 1I6HH 1WCMG 3KYHC 2Q2UA 1E22A 4LW1A 4JV5Q 2RCNA 4A3IG 1X9NA 1Q12A 5JEAJ 3S1NH 4GKJQ 4LFBQ 1QZHA 4IFDI 3PUYA 3PUZA 5HY6A 3HOUH 3I56A 1K0RA 4JI6Q 3HOUG 3EBEA 4AQYL 3CCMA 3S14H 2JA8G 5AJ3L 1OXTA 1J5EL 2ES2A 1E24A 2WB1G 1HNXQ 4WJ4A 1X65A 2EIFA 4L5QA 4A3FG 1Y1WG 1B8AA 2K5VA 4BXXH 1EOVA 2JEBI 1LYLA 4KI0A 4DR4L 4PG3A 1QVCA 2UUBL 4KHPQ 2KBNA 3G6EA 3M85A 1XNQL 1PFSA 1X54A 3CPFA 1VQLA 1VQNA 1PH9A 2AHOB 1VQFA 2KCMA 5M5WH 1JMCA 2FXQA 3G48A 3STBC 1S72A 1MIUA 2VQFL 4POFA 5M3FG 4DUYL 1ASYA 2F4VL 1GKHA 5JJKA 2OTJA 3J81i 2RF4A 3CCLA 1Q8KA 3CCEA 2R92G 1WYDA 2R92H 4DUZL 1PYSB 4GNXA 1YI2A 2UXDQ 1NJIC 2UXCQ 3M7NA 4P73A 2BA1A 1VQ5A 4GKKL 3K0XA 4DUZQ 1XMQL 2BH8A 4AYBG 4DR2L 3S17H 3KDFB 4DR6L 1CSQA 4PMWA 1LUZA 2VW9A 3E9HA 4H02A 4QL5A 3KJOA 1SR3A 2F4VQ 3CC2A 2VQFQ 2K4KA 2KHIA 3EIVA 4AYBE 4KLKA 3CP0A 4A3IH 4DV0Q 1EYGA 2NZHA 3L0OA 4LFCL 3CAMA 2OWOA 4OX9Q 4BBSG 4X66L 3ULJA 3H0GG 3PSIA 5JJIA 1ASZA 3GTMH 1X3GA 2KCTA 4DR7L 3CCQA 4LF9Q 4IPCA 1PHJA 1Z9FA 4X66Q 3HOVG 2UXBQ 1QZGA 3GD7A 3OTOQ 3HOVH 1H95A 4XIGS 3KF8B 3J7ZC 2AWOA 4DK6C 3I7FA 1HNXL 4BXXG 2IHEA 3DLLA 2Y0SE 4R4CA 1D8LA 3W5OA 3AQQA 1KC8C 4LF5Q 1IXRA 4HJ9A 2K5HA 2JA5H 4A3KH 5ELOA 4JBMA 2R7ZH 4IOAA 1X56A 4B3TQ 5JJLA 3U4ZA 1HZAA 5LMNW 4DV6L 1VQDA 4ME3A 3NBHB 1K8GA 4A3GH 2HHHQ 2R7DA 4BBRH 3D31A 2VUMG 3HOYH 1IBKQ 3GTGH 1KAWA 1YEZA 3AFQA 3FKIH 2OCEA 4LF7L 3OYYA 3CXCA 2QA4A 4O2DA 2YV5A 3T1HQ 3M3YH 1FVIA 1HZBA 1TWFH 1DGSA 1Q1EA 2H5XA 3BZCA 2Z6KA 3LGJA 3FP9A 3T1YQ 4LF8Q 1VQGA 2K75A 3KFUA 3KF6A 1L1OC 2V1CC 2I5LX 4R4OA 5C0XG 3G4SA 4GOPC 3S1RH 3M9BA 4IFDJ 1Y1VG 1OXXK 3TEHB 2WAQE 3KDFA 1K3RA 4HIDA 1JE5A 1GO3E 3I55A 4DR1L 1UE5A 2CQOA 3J80c 4HJ8A 4DR4Q 1YJNA 3F8TA 5GROA 3KJPA 1LM0A 2WAQG 2DUDA 3ERSX 3CCRA 1M90C 2D0PA 4JOIA 2JQOA 2JEAI 3UDXA 1YVCA 4B3RQ 2B63H 4JI3L 4LF8L 2B63G 5C4XG 2YTVA 1KRTA 4UY8C 3T1HL 4DR7Q 4RG1A 4LFBL 4P72A 1M1KC 2ALYB 2NVXH 1I5FA 1VQHA 4JV5L 5IYDH 3HKSA 2HQLA 2MQHA 4JI8L 4IJLA 1VQ4A 2E5LQ 2OQ0A 4A3KG 2JA5G 3AYHB 4IPDA 5GADC 1OXVA 1IBLQ 4BA2I 4A3CH 2ZTEA 3PUVA 2CKZB 2UU9Q 4DKAC 1GD7A 4DV5Q 3CC4A 4JYAL 2HIVA 4B3TL 2QEXA 4MZ9A 4AIMA 2PQAB 4A3LH 1A8VA 1UE7A 4YHHL 1G6PA 1QVGA 1I50H 4IPHA 4YCUA 1FJGL 3I4NH 4BY1H 4LUZA 1MKHA 4R4IA 1V9PA 1YNXA 3OTOL 5LMNL 5C4JH 2VNUD 1A63A 4R1JA 3PUWA 4BBSH 2I5HA 1PH5A 3F1ZA 4LF9L 1HJPA 4X65L 1HNZL 2JA8H 4B3SL 3B6YA 1PYBA 4DR3L 1SLJA 4APVA 3HOWH 2DGYA 1CSPA 3GO5A 4JI1L 2MO1A 4A76A 1A62A 5GAEC 4A3FH 1Y1WH 2IX1A 3HOWG 1Q82C 1Q86C 3HFZB 3H3VI 1RIPA 1J5EQ 4J15A 1XNRQ 1FGUA 1SE8A 2NVTH 2CFMA 3K7AH 4JI2Q 1IBML 2R7ZG 5IYBG 3D0FA 1VQMA 3U4VA 4A3EG 4A93G 3U58A 4IOCA 2PNHA 3RLNA 3K81C 3S2DH 3F2BA 1C0AA 1R9TH 5M3FH 4YCVA 2MFIA 1CUKA 3J81j 3A5ZB 3UE0A 5FJ8H 3JC66 5FJ8G 4FDBA 2ZM6Q 4GN3B 3CC7A 4DR5Q 2Q2HA 1N34L 3S16H 2ID0A 2N78A 1CKNB 5IYDG 4DUYQ 2UXDL 5IWAQ 2NN6G 2QGQA 4JCVE 1EIYB 2JA7G 3HKZE 4K0KL 3STBD 2GN5A 1W2BA 3W1BA 4DV3Q 1QUQB 3G71A 1JT8A 4MTNA 3RZDH 1L1OA 4A3BG 4GLVB 3PV0A 4P75A 3J80i 4X62Q 3RLOA 4JI4L 1XPUA 2N49A 4HIOA 1AH9A 4JI5Q 1UEBA 4QGUA 1S40A 1JB7A 4L5TA 1PH1A 4DV1Q 5C44H 1N34Q 4OXPA 4LF4L 3ER0A 3RN5A 4AQYQ 4A4IA 1L1OB 1PH7A 4JI6L 1HNWQ 4P74A 1KL9A 2NVYH 4HJ5A 1QUQA 1YHQA 3S15H 3U50C 4Y7NH 2RHQB 3OW2A 4JOIC 3RR5A 3CF5A 1EQRA 4RMFA 4Y52H 1VQPA 4X64L 1BBWA 1IBMQ 4JI2L 3KLWA 3SGIA 1NY4A 3TREA 5M3MH 2UUAL 3I4MG 4B3RL 4JI0Q 1N32L 2A1AA 4OONA 3TQYA 1XJVA 3IRBA 4A75A 4DV7Q 4DK3C 1EWIA 1PV4A 4A3CG 3GDEA 4NB3A 5IYCH 2A19A 4JI5L 1K8AC 1GVPA 1TWHH 2F52A 1X6OA 1W3SA 1UE1A 2JA9A 4UP8A 4DR3Q 4X62L 1NTGA 5IP9G 4QIWE 4ALPA 3RN2A 4B3SQ 3PO2G 3PIPA 2OTLA 3CCVA 1WCMH 3RNUA 4QJFA 4OO1I 1Q81C 2OQKA 1X3FA 4C3HH 1YJ9A 5LMNQ 3PO3H 1E1TA 4WJ3M 1VS0A 3FHWA 1BKBA 3H0GH 3UDGA 1SN8A 4DV4L 2NN6I 4HJAA 3Q8DA 2CCZA 2R93G 1Y1VH 4AH6A 5M5YH 2R93H 1I94Q 5FLMH 2K50A 1J6QA 1MJCA 2JK8A 2Q2IA 3A5UA 2VZAA 2UUAQ 1O7IA 1YBYA 4GS3A 3CCSA 2IT1A 1D7QA 2E5LL 2RHSB 2HHHL 1HH2P 1U0LA 5C3EH 1KRSA 3GTLH 4GOPB 3TRZA 4A93H 4JG2A 1NMGA 1XPRA 3K80C 3TS0A 1HNWL 2VUMH 2HIXA 3M4PA 5JEAG 4L5SA 4OWXB 3E0EA 4YWLA 1VQKA 4LF4Q 1SRUA 3RLFA 3W1GA 5IP7H 3ZJYC 5IP7G 4DV2Q 1E1OA 4QY7A 2Z0SA 3PIOA 5E7NA 3AFPA 2UXBL 1TXYA 5LMUQ 2AKWB 4YWMA 1KIXA 4LF6L 1HNZQ 5DLQE 1VQOA 2PI2A 2CWPA 3E9IA 1HZCA 5J3BA 2JA7H 1VQ8A 2BH2A 4IPGA 4DV3L 1Q46A 2KHJA 3K8AA 1A0IA 2R6GA 4DV0L 1NMFA 1N36L 4JI7Q 2NVQH 4BY7H 4NXNQ 1IZ6A 4A3LG 4K0KQ 4NPSA 4B3MQ 2ZJPA 2JJQA 4GOPA 1JJ2A 1QVFA 1XMOL 1IYJB 4DPGA 2E2HH 5GQOA 3H3VH 4DR6Q 1C9OA 1S3OA 1UE6A 3PUXA 4DR2Q 3HKZG 1RL2A 3UDFA 5C44G 3S2HH 3K7UC 2ZJQA 1TWCH 1U5KA 1VQ6A 4KHZA 2JE6I 4UP7A 3PF5A 1N8RC 2Q2TA 1G51A 3TS2A 2LXKA 1VQEA 5H1SE 1XMOQ 1B7YB 4IJHA 4IFDG 5GAHC 4TVAB 1C7YA 1BBUA 4TQUS 3A74A 2N3SA 4NXNL 4LNQA 3DM3A 4A3EH 4O0AA 5C3EG 5M3MG 1N36Q 4JI7L 4NXMQ 4LFAL 2YTXA 5FLXc 3J7A5 3GTPH 2B29A 4A3JG 2MO0A 5IYCG 4KHPL 2VS1A 2K52A 3PF4A 4BA1I 1EIFA 4DR1Q 3FKIG 4UP9A 1LTLA 1PH8A 4LFCQ 3KOJA 3S1MH 1YHAA 4A3DG 4NXML 1OXUA 1FL0A 2IX0A 3H15A 4QQBX 4PZ6A 1VCIA 3CW2C 1L2FA 2BA0A 4HJ7A
chains in the Genus database with same CATH superfamily
3T1YL 4ME5A 3UE1A 2R93B 5M3FB 4C2MH 2F0HA 1SE2A 4A3BH 2AMCB 4B08A 1DJRD 1SYBA 1EQQA 3FVQA 4KTAA 1KDCA 1DM0B 1E7ZA 1CQFA 1KABA 2G5DA 1L0XB 3F2DA 3QOJA 5A2QE 4LF5L 3J7AF 1HFGA 2F3WA 5HGQA 1GUSA 1PH2A 4R4TA 2I0QA 5KYLA 2D0OA 1B70B 2DJFC 1WFQA 1CKMA 5C0XJ 3HOZG 1CZGA 2BE5D 1EZ6A 5IY0A 1BVSA 3VA5A 2WKDA 1VQIA 2NVTB 1K9MC 2Q8RE 4EX5A 3PO2H 1VQJA 2AWNA 2Z6KC 4RGMA 3TDQA 3NENA 2E2JB 1SYEA 2JA5B 1CM9A 1RF2D 2C35B 1CK1A 1KLUD 3DWPA 4A3MG 3A0JA 4IO9A 4A3MH 1TWGB 5FLMG 1OO9B 1STBA 1CKOA 3R3OA 2VB2X 3M3YB 1LT4D 4OWTB 2N88A 5IYBH 3IAYA 4QB4A 3R2TA 4DFAA 5I2XA 3BG3A 4ZLTF 3P20A 1OTCA 4OX9L 1RD9D 1HR0W 1H9MA 2EXDA 4K6DA 4DR5L 2UUCL 2IY5B 4JI0L 2ICEC 3EN2A 2NN6H 3TMEA 2OEOA 1QWYA 3NWSA 4JI8Q 1PVOA 1PFNA 2G9HD 1AE3A 2F0MA 2X6LA 3M4QA 2B3GA 3H6MA 2YYZA 1PRTB 4OIKA 1T5EA 5DNFA 1TS3A 2DN8A 3O13A 4JPBW 4JI3Q 1A3UA 3CCUA 4RH6A 2F0JA 2D62A 2O2LD 1TWGH 2A8VA 2SNSA 5C5LA 1Q7YC 1YITA 2GVBA 2L9HA 3NWTA 1PYWD 4DGZA 3I4NB 3CMAA 3EQLC 3I4MH 4DAVA 1U4MA 5M3MB 5E4WC 1XTDA 1B44D 3A8KE 4DV7L 2D2CC 4ZK9B 2BOSA 1FNUA 2VQEL 4C56C 1X3EA 1T9HA 1Q12A 1I3QB 1QZHA 1C4QA 2F0LA 5DEHA 2JA8G 1OXTA 1E24A 1SE3A 1HNXQ 1X65A 1Y1WG 1DD2A 1LTRD 1DYQA 4PG3A 3OIPA 1TQOA 1PZJD 1JR0D 1TIID 1V8QA 2KBNA 1STNA 3G6EA 3CPFA 2AHOB 4HCEA 4KMUC 3STBC 4POFA 5JJKA 1ASYA 1HPCA 1GKHA 4ULLA 3J81i 2R92G 1V1OA 1WYDA 2R92H 3V2TA 4GNXA 1YI2A 3FKIB 4KJOA 1NUCA 4P73A 1WCMB 1XMQL 2BH8A 2A6ED 3S17H 5ELFA 3S1QB 4PMWA 4H02A 4A3EB 5C3EB 1SR3A 3QIAA 3VYTA 2VQFQ 1QILA 1Q3LA 1CA6A 3EIVA 1QE6A 4KLKA 4A3IH 2OWOA 1F9QA 4A3BB 4RGOS 3J7AV 3PSIA 3GTMH 3S1MB 5KIXA 4LF9Q 4IPCA 5E3FA 1Z9FA 3HOVG 1M8AA 3GD7A 3HOVH 3Q0AA 1G91A 3NQTA 3J7ZC 5TSSA 5K5PA 3W5OA 3DWQA 1PZID 5EKIA 2R7ZH 1X56A 3DEPA 4OIJA 5LMNW 2HUGA 4ME3A 2ZXRA 2HHHQ 4F87A 1BUVT 2JA6B 3GTGH 1A6XA 2OCEA 2FFKB 2QA4A 2YV5A 3T1HQ 4DR7L 1VQGA 4QUFA 2V1CC 4CJ2C 1O78A 1H9RA 4XT1B 4R4OA 2RDHA 5G3LD 4GOPC 3S1RH 1OXXK 3TZDA 3J80E 3TEHB 1K3RA 1PTOH 3FDTA 1GO3E 3I55A 3MC0B 2AQ3B 2CQOA 3J80c 2WV6D 3GTMB 3F8TA 3KJPA 2AUKA 4OELB 2EPBA 2D0PA 4JOIA 5ELDA 2JEAI 3GP7A 1YVCA 3IKJA 1SNDA 4X3UA 1KRTA 1TS2A 3OMGA 2F0UA 2NVXH 4CJ0B 1LT3D 3I70A 2HQLA 4IJLA 2JA5G 2OQ0A 4A3KG 3AYHB 4IPDA 2XRQD 4CJ1B 2XRSD 1OXVA 1GD7A 4DV5Q 1TWCB 1NSNS 3VYRA 3VA7A 5IIFA 3PO2B 4KKUA 1JE4A 1UE7A 5BN3A 2EVBA 1I50H 4IPHA 4YCUA 3OSOA 3RZOB 2E76C 1A63A 1PRTF 3OTOL 5LMNL 1J8IA 4B9WA 1DOLA 2A5HA 1PH5A 4LF9L 1HJPA 4X65L 4L63B 2JA8H 4B3SL 5D3IB 4J6HA 5M5YB 3GO5A 2UXDQ 4RKBA 4A3FH 3C2PA 1Q82C 2HDMA 3TP6A 1SE4A 2EY5A 1GUOA 2A68C 1AW7A 1HUMA 4JI2Q 3BS1A 2R7ZG 1RDPD 4MHEA 1G2TA 3FPUB 3U4VA 4A93G 3U58A 3RLNA 2VUMB 1C0AA 4C2MB 1R9TH 1CUKA 4C3JB 3J81j 4FDBA 2ZM6Q 1EWCA 5IGBA 1CKNB 1ENCA 2UXDL 5IWAQ 2NN6G 3HKZE 4ODGA 3STBD 3BYYB 1ZYRD 4DV3Q 1RTOA 3G71A 1JT8A 1BCPD 4GLVB 3PV0A 5IT9L 4JI4L 1TVXA 5I9PA 3K58A 4JI5Q 1UEBA 4QGUA 1WTWA 1SSOA 4A3FB 3T13A 2ENBA 3PIP3 5KYIA 1WTRA 3U50C 5FK9C 4JOIC 2ZXPA 3CF5A 1B9MA 1EQRA 4H44C 1VQPA 1JWSD 1IBMQ 3KLWA 2ZXOA 1QOHA 3TREA 3ZYYX 1N32L 3TQYA 4DK3C 4A3CG 1XWEA 3S16B 2F0PA 4JI5L 2UUBL 2M00A 3X3MA 1I6HH 1D5XC 3CCVA 3NUCA 1WCMH 4QJFA 1A3VA 3ND8A 5HGTA 4WRDA 1YJ9A 2IWHA 4EQPA 1VS0A 3MFYA 4HJAA 2CW0D 4H0LC 2F0TA 1MJCA 1F9PA 3QR8A 2UUAQ 1O7IA 1GHJA 2E5LL 3U9OA 2RHSB 1NCVA 1U0LA 3HGBA 4OO1H 2A69C 1HNWL 3VR4A 4PMBA 5FO7B 4L5SA 4PMCA 4LF4Q 4YWLA 1Y8NB 5IP7H 4HSVA 2F0VA 5IP7G 3GTPB 4DV2Q 1I4GA 1IW7C 5E7NA 2UXBL 1TXYA 5J1ZA 1ZEQX 2B2WA 4NMZA 1KIXA 5DLQE 1CHPD 3I73A 3KLSA 1VQ8A 3K8AA 4K6LA 1A0IA 2A68D 1K83B 3MXGA 3D4WA 4EVOA 1HXYD 1NMFA 4DV0L 4JI7Q 1IZ6A 5C4HA 4NPSA 3D4RA 4GOPA 1JJ2A 1QVFA 1XMOL 4DPGA 2HDLA 2A6EC 3A7LA 1PTOF 1GHKA 4E6IA 1C9OA 3J81E 1Y8PB 1QG7A 5C44G 3S2HH 1MGSA 3K5LA 2P5ZX 4ABNA 2Q2TA 5IODA 1G51A 2SDFA 1ET9A 4UAIA 4A93B 1B7YB 4IJHA 4IFDG 1PRTC 1XTCD 3A8IE 5J39A 4IFDH 4BY1B 1C7YA 2EYMA 3A74A 1Y69U 1QJOA 4CKEA 4HR7B 4O0AA 4JI7L 2F0SA 4ZRZA 3J7A5 4IUNA 1BO0A 2VS1A 4Z9CB 3K57A 1KNAA 4DR1Q 1T5XD 4H13C 1PH8A 1LTLA 4LFCQ 1YHAA 4NXML 2NYZD 1OXUA 1VCIA 2PW5A 3WOFA 1STGA 4QUCA 1EEFD 4YWKA 1B53A 4JBKA 1XMQQ 2E8GA 3GTQB 3NP8A 1K3BC 2F0KA 3ICEA 1XYIA 3CPWA 4O1NA 4POGA 2PZWA 4ZUIA 2EQSA 2L15A 1IL2A 3JAMc 3EFXD 5NUCA 4DNIA 1EYDA 1QNKA 4B3ML 5IE8A 4WFN3 1NE3A 3M7GA 1S5ED 5C0XI 4X6AH 2BE5C 5IT9c 5C4XH 4G57A 2JA8B 1BDOA 1DCZA 4K8IA 5EJWA 5DM63 4OEMB 3E5SA 3L2PA 4GNXB 1PFBA 2K5NA 4IQZA 5EQ0A 1WTPA 5CGKA 1NAPA 4KJNA 1RJTA 2ZTCA 4BBRG 3H94A 4GLAC 4X3TA 5AJ3Q 1EY4A 4CDCC 1JOQA 3TP8A 4JBWA 4DAYB 2CHBD 1I3QH 4KD4A 1YHBA 4A3KB 4A3DH 5E4XA 3M4YA 2R7ZB 4LF7Q 1Z7TA 4F88A 3GTQH 1K73C 4FP5D 3MEFA 4PZ8A 4HIKA 2JA6H 3GTOH 3I91A 3ONAB 3GTGB 1OXSC 2JP1A 1AZQA 5IGDA 1G291 3J81L 3AEVA 3S24A 1KDBA 4FVMA 3GTKH 2LSSA 3FMCA 4JBJA 5CMDA 1B9NA 3BZKA 3WOEA 4DN4M 3BYTB 1WI5A 2KENA 2PQAA 3HOYG 2H4OA 4OO1G 2Y0SG 1JJGA 3VYUA 5KNBA 4YY3L 4C3JH 2B8FA 2NZ1D 1VQ9A 2K5DA 1UNSA 3TP5A 4JYAQ 2TSSA 3W2DA 1N32Q 5EKLA 1CI3M 1VQCA 1HR0L 1JJCB 5EAYA 1EFWA 3PO3B 3I2ZA 4BY7G 1JICA 3G6JB 5I2YA 1B2TA 2EJFC 4BBRB 1YJWA 1XNRL 1ZYRC 4XYOA 1VQBA 2WP8J 2CVRA 1VMPA 2E2IH 4FNFA 1H9JA 1TWFB 3A54A 1SFOH 5C3WA 2F3VA 3HOXG 3K6OA 3HOXH 5BN5A 4RHSA 1SMXA 4GN4B 2EY2A 1FJGQ 1GXDC 4H7BA 2YU9H 2RVLA 3PGZA 1VQ7A 3DUZA 4MNOA 4DV5L 2ZM6L 1YIJA 2NB0A 4N9PA 2PI2E 5J22A 3HOWB 4XT3B 4P71A 2ATWA 1WOCA 1WCMG 2Q2UA 4GKJQ 5JEAJ 3S1NH 5DM73 1I4QA 4IFDI 1ZKOA 4QIWB 3UI2A 3CCMA 1QNUA 4G7ZC 2NVXB 3E6ZX 5AJ3L 5FLXL 1J5EL 2WB1G 4WJ4A 4L5QA 4KV6A 1EFID 2K5VA 4BXXH 1B1ZA 1QVCA 2F0NA 1PFSA 3TSSA 1VQLA 1PH9A 5M5WH 1JMCA 1GJXA 1MIUA 2VQFL 2EYJA 5M3FG 4HAEA 4DUYL 2RF4A 3CCLA 1Q8KA 3CRKC 1F9RA 2BA1A 1WTHA 3K0XA 4G7OC 4DXGA 1CSQA 4KY5A 5KRUA 2VW9A 4B9XA 4PNYA 4QL5A 2F4VQ 2NVQB 1CHQD 4A3JB 5A2QL 4LFCL 1LTTD 2EJGC 3ULJA 2B2YC 3FEWX 1IKLA 3H0GG 1ASZA 1PTOD 4HSPA 3GV3A 1X3GA 3PIO3 1I6HB 2KVMA 1PHJA 1TWHB 1QZGA 4N8FA 5K36H 2EYOA 3I7FA 4BXXG 1FNWA 2Y0SE 1KC8C 3JAME 4LF5Q 1IXRA 2XWBB 3U9SA 2K5HA 1B4OA 3U4ZA 5I6WA 3IFTA 1HZAA 2DJGC 1VQDA 2M9VA 3NBHB 2R7DA 4ID6A 1IBKQ 2B39A 1VMCA 4A3MB 4LF7L 5D65A 3FPPA 4CKBA 1DXMA 5CC4A 4O2DA 5ELEA 1FVIA 3LGJA 1HZBA 1LTAD 3SDZA 3GTLB 1L1OC 4MN3A 5C4XB 4DAYA 3QJYA 1S5CD 3G4SA 4IFDJ 1I4HA 1Y1VG 2KCNA 3ERQA 2WAQE 3KDFA 1O7LA 3T16A 1D1KA 4J8QA 5CBAE 4EGVA 1HTPA 1YJNA 2HD3A 3K0YA 1YNNC 5GROA 3NTKA 4IALA 1M90C 1PFMA 2A73B 4B3RQ 1SBBB 1SYCA 2B63G 2B2VA 1ESFA 4UY8C 2L55A 3H0GB 1ET6A 3KUPA 1HRJA 3L9AX 3P75A 4LFBL 4DNRB 3OMCA 4RHRA 1F2ZA 1VQ4A 2E5LQ 2JYOA 3ND9A 3H91A 3CHBD 5GADC 1IBLQ 2CKZB 3CC4A 4B3TL 4U68A 2PQAB 1A8VA 1HQRD 4IZ8A 3DEOA 3TZUA 1QVGA 1FJGL 4BY1H 2VNUD 3PMFA 1HA5A 4LMQD 4C3IB 3HOWH 4JI1L 3BDCA 2ICIA 2MO1A 1A62A 2IW3A 4CGYB 5CV8A 3H3VI 4JK1C 1XNRQ 1SE8A 4HN7A 1U4PA 2CFMA 1I6VC 2WACA 1LT6D 4IOCA 3S2DH 4OL7A 5M3FH 3D6CA 3A5ZB 5ELBA 3K5MA 1IYVA 1N34L 4GN3B 4DR5Q 1JOOA 2QF7A 1EYAA 5LL6X 5IGFA 2O5IC 2QGQA 4JCVE 4J1MA 2EOTA 2JA7G 4K0KL 4F7XA 2OT2A 1K28A 2GN5A 3OIQA 1W2BA 4RWSC 1QUQB 2XIWA 5L37A 3RZDH 1L1OA 1PTOB 4A3BG 1XPUA 1D5ZC 2FJ2A 4EQOA 3R93A 1JB7A 1PH1A 1G6ZA 3A7AB 4DV1Q 5C44H 3RN5A 2QDBA 2SOBA 4AQYQ 1PRTD 5JPMC 1PH7A 5JVG3 1Z6HA 4R8IA 1YHQA 4HJ5A 1EWHA 2F4IA 4Y7NH 2X6GA 2K05A 2WKCA 3OW2A 2K32A 3I8ZA 3RR5A 3H09A 2IX3A 4Y52H 1BBWA 4A3IB 3SGIA 1U9RA 4PQXA 1MBYA 1U4RA 4OONA 3IRBA 4DV7Q 1EWIA 1PV4A 5IYCH 5KNCA 1TWHH 4UP8A 4OWWB 3GTJB 3PO2G 2KHSA 3L3OC 5KNDA 4B3SQ 3HOVB 1AFPA 2X69A 4L8JA 4DU9A 3RNUA 4JVZA 2AUJD 1H9SB 1HTLD 1ICFB 3MWYW 4BBSB 2C9OA 4KHVA 3MZ5A 4LAAA 3RZDB 4WJ3M 3FHWA 2MPMA 1FYCA 2QDLA 2CCZA 2KUMA 1Y1VH 4AH6A 3KBGA 2K50A 1JORA 4RFBA 5E1FA 1YBYA 4GS3A 2J4XA 3CCSA 1YNND 1EY7A 2PNRC 1B50A 5FO9B 4GOPB 3TRZA 4JG2A 1AP0A 3K80C 3TS0A 3LWEA 2VUMH 2HIXA 2NUCA 3M4PA 5JEAG 2AQ2B 1HQMC 2E2DC 4DK0A 1SRUA 2PO4A 4HMIA 1LACA 1E1OA 1STYA 4QY7A 3AFPA 4RGTA 1CA5A 4LF6L 2KCCA 4YWMA 1HNZQ 2PI2A 1WTOA 5J3BA 1SFOB 1E0BA 4K8JA 1N36L 3EVQA 2ZJPA 2JJQA 4RAUC 4X3SA 2YU9B 1LTSD 5GQOA 4OHJA 3SR1A 3H3VH 3PUXA 4DR2Q 4BWGB 3HKZG 1RL2A 3NXWA 1RCVD 2F0GA 3PF5A 3S15B 4CKCA 5H1SE 1XMOQ 1PDQA 3S1NB 5GAHC 4TQUS 4LNQA 2IJ0A 4NXNL 3DM3A 1N36Q 5FLXc 3C46A 3KLRA 1JWUD 2K52A 3BZDB 4RA8A 4BA1I 1EIFA 4FXDA 2E2IB 2L5TA 4LJZC 1SYFA 2K6AA 1W6JA 3KOJA 4XQJA 1K0SA 1X32A 2JSOA 3QWNA 1UUPA 3H15A 4PZ6A 2CH4A 2VXWA 1D2BA 2BA0A 4HJ7A 2SEBD 5JOBA 2E2JH 2I46A 1N9WA 1RTNA 3F2CA 4KN7C 1V1QA 5T1GA 4R4QA 1KLGD 4GN5A 2A74C 1IBKL 4LWCA 2VQEQ 3I4LA 3SVMA 1I94L 1F2MA 1GUGA 3P1HA 1LABA 1X3PA 3HP3A 1L0YB 5F2DA 1NR2A 4DV4Q 1EU3A 4N9TA 1PA6A 3MTSA 1II3A 2VL6A 1BOSA 3I3CA 5BR8L 4GLXA 5K36G 1YZ6A 1E3PA 1SXTA 4C3IH 2J7ZA 2HQEA 1CKNA 5C44B 2LKVA 2K5WA 1Q1BA 3CRLC 3D3RA 3IL8A 5LL6S 2K14A 4BY1G 1JQYD 3CD6A 5C4JB 3T4AC 1HFNA 1E2WA 4GKKQ 3S9WA 1HR0Q 5ELNA 4O42A 5G3LF 2UUCQ 3LNNA 2R7FA 1SEBD 3SK6A 2Z8LA 3I4OA 2EYLA 3SK8A 4C3HB 2PW7A 3MXNB 2RDFA 4IURA 4A3JH 1GUWA 4EQ5A 1R9TB 1ILPA 1VQAA 4LF6Q 5JEAH 3KK7A 3L7ZC 1FNVA 3BDLA 2WB1E 5GAGC 3F2UA 3C1FA 3HOZH 5EPKA 1I50B 1KD1C 1EOTA 1SROA 2E74C 1N33Q 3A56A 2BCOA 2F0DA 3QG1A 4HCSA 3WWVA 1VDZA 1MJEA 2EYPA 2Z4IA 1LTGD 1XPOA 1HZ9A 1AN8A 2K01A 1HUNA 2O5JC 1NNXA 4YY3Q 4XTCS 1S5BD 1PXUA 3ULLA 1K83H 2DY7A 2NVYB 4LUOA 2RDGA 3Q6SA 1KQSA 1E2ZA 1V1PB 5BN4A 5BR8Q 1X55A 3RZOH 2WFWA 3MXPA 2EYFA 4YHHQ 2F1MA 4IUUA 5CV5A 2MNAA 2HT1A 5IOCA 4A3GG 5T1IA 4DAPA 1KHIA 5FOBB 1TWAH 1AZPA 4LW1A 4JV5Q 4A3IG 1X9NA 3VR3A 4LFBQ 3PUZA 5HY6A 3HOUH 4JI6Q 1WD1A 3HOUG 3EBEA 1BNZA 2ES2A 1QB5D 3FRPB 4IUPA 4A3FG 4FXKC 2KA7A 2JEBI 1LYLA 2NTSA 4I7ZC 4KI0A 5JAVA 1C8CA 3VR2A 1XNQL 1VQNA 1VQFA 2KCMA 2SNMA 1EU4A 1I4PA 2CQAA 2WINB 4F8MA 1EQTA 3CCEA 1PYSB 3TBIB 3MVVA 1NJIC 2UXCQ 3M7NA 1O7YA 1EY8A 4K5WA 4X3KA 2K7VA 4AYBG 3KDFB 4DR6L 3KJOA 2OXPA 3ITPA 2B2TA 3CP0A 4FF3A 4DV0Q 1EYGA 2K03A 1TS4A 4OX9Q 4BBSG 3HG9A 1ENAA 4FXGC 1IYUA 2KCTA 2QW7A 5IT9E 3HOXB 1H95A 1NR4A 4XIGS 2JA7B 2AWOA 1HNXL 2IHEA 3E3XA 1IKMA 4R4CA 2JA5H 1IL8A 4A3KH 2Z4HA 4JBMA 4IOAA 5JJLA 4QF4A 5C3XA 4DV6L 2XN9C 4A3GH 4BBRH 2VUMG 3D31A 2VB3X 4U673 1SYDA 3AFQA 3FKIH 3X3NA 1WTXA 4MIUA 3HZXA 3M3YH 4FF4A 2H5XA 1TWFH 1Q1EA 1I4RA 2Z6KA 3BZCA 3WDNA 3T1YQ 3KFUA 1PMRA 1IHZA 2D9UA 3CKIB 4CDFC 3NSWA 1JOKA 1F2LA 3A55A 2F0WA 2MJ8A 3M9BA 2HCIA 4HIDA 4DR1L 1STAA 5FO8B 4DR4Q 3V05A 3DHQA 3I90A 1KAAA 1LM0A 2WAQG 3ERSX 3CCRA 3D4DA 2JQOA 1WTVA 4ZKCB 1KTKA 3H3VC 3DWAA 1F9SA 2YTVA 1CZWA 4Y7NB 2KEEA 2KQ3A 4P72A 4ZKBB 1M1KC 2ALYB 1UEAB 1I5FA 2KEDA 3T56B 2B2VC 2MQHA 5IYDH 5EGTA 3MAQA 2L12A 2EXZA 3NK9A 2QILA 3PUVA 2UU9Q 1BR9A 1Q90A 4JYAL 4C1NK 3K59A 4MZ9A 1BCPC 4A3LH 1DOKA 1A2TA 2Q8TA 1JC7A 4LUZA 4R4IA 1V9PA 1YNXA 5C4JH 3PUWA 4BBSH 2I5HA 3F1ZA 2N55A 1HNZL 5M5XB 1PYBA 2B2TC 1BCPF 1CSPA 4KKSA 4A76A 3BVMA 2L0CA 3HRZC 1Y1WH 1BF4A 1GUNA 1Q86C 4J15A 1EY6A 1TY2A 3MXUA 4DK1A 3GTKB 5JVH3 3K7AH 1IBML 5IYBG 2FMCA 3D0FA 1VQMA 2IPKD 4HMJA 1A3TA 3K81C 3F2BA 4YCVA 2MFIA 1I4XA 2TMPA 3RD4A 4ILWA 3JC66 5CBEE 3S16H 3D8GA 2ID0A 4C3HG 2N78A 4C3IG 5IYDG 1AEXA 5M9OA 1EZ8A 2H1EA 1MD2D 3LWUA 1JB3A 4CBVA 4QCLA 3D6WA 5M5WB 2EDGA 3T53B 4MTNA 2OF1A 2R61A 2MUYA 4Q0FA 2EE1A 3J80i 2N49A 4HIOA 4BS9A 1ONLA 1Y1WB 2F0FA 4FYDA 4L6TB 4OXPA 4RKLA 4LF4L 1KNEA 4XQNA 3S17B 4JI6L 1HNWQ 4P74A 1O7ZA 1SNPA 3S15H 1QUQA 4HTHA 4DXFA 4C1NI 5LHY1 4X64L 4JI2L 2PMZB 3KBXA 1TS5A 1NY4A 1EL0A 1STEA 2PZUA 3T51B 1XJVA 2EYHA 1WD0A 3K5OA 3QOLA 1DZ1A 4NB3A 2A19A 1K8AC 2F52A 1UE1A 2JA9A 4DR3Q 2F0IA 1NTGA 4X62L 4QIWE 4ALPA 3RN2A 3NTHA 4RCOA 2E75C 4TSSA 4OO1I 3J80L 1MSHA 1X3FA 4C3HH 3PO3H 1XXGA 1EIGA 1WTQA 2GA4B 4UHVA 2F0QA 1BKBA 3H0GH 1CFMA 2RCFA 4DV4L 3UDGA 2F03A 2M2LA 2NN6I 3Q8DA 2R93G 5CV6A 2R93H 1CTMA 4WORA 4P2CB 1O80A 1J6QA 4ZUJA 2JK8A 1CQVA 4GZYC 3A5UA 2VZAA 5COYA 3RUZA 2IT1A 1WVLA 1TT2A 2DY8A 3DMUA 5C3EH 1KRSA 3GTLH 4A93H 1XPRA 4K14A 5A35A 4OWXB 1XX8A 2BDNA 3E0EA 4C3JG 3W1GA 1SNQA 3ZJYC 3BDOA 3EA6A 4V0BA 2Z0SA 3PIOA 2ZT9C 3HS0C 5KGUA 5LMUQ 2AKWB 1VQOA 2CWPA 2JA7H 2K04A 4MTKA 2BH2A 4IPGA 2KHJA 4IN3A 2HCCA 2FMMA 2NWGA 4PV1C 2NVQH 2EZVA 5CV9A 4BY7H 4DA2A 4K0KQ 4A3LG 3R8BA 2DNEA 2Z1CA 1YNJD 1B3AA 1IYJB 3OWFA 4DR6Q 4XQQA 1S5FD 3UDFA 5C4ZA 1M4VA 1TWCH 3HEJA 2B8GA 4KHZA 2JE6I 4UP7A 3TS2A 1VQEA 1LLRD 1SDFA 3AB9A 3MFGA 4QMGA 2XNAC 4KD3A 2LS01 4RGNA 2LFNA 5C3EG 5M3MG 4LFAL 4KY7A 3GTPH 2CH4W 3BVZA 2MO0A 1Y8OB 4UP9A 3SK4A 3NBHA 4IUTA 4A3DG 4CDEC 2WAQB 3CW2C 1L2FA 4KY6A 4XDXA 4JW0A 1WJJA 3TP7A 2NZOA 3BJUA 2F0EA 2UU9L 1HCZA 1IBLL 4ZYSA 1L0WA 3G7LA 2GVAA 3IFDA 5M5XH 2B2YA 1FD7D 3BVGA 4HEDA 1U4LA 4LUVA 1P16A 3RMHA 1PH6A 1BQQT 3OOCA 1EUJA 2A69D 3NELA 3S1QH 2CWAA 3HOUB 2VY3A 2C5CA 4CDDC 2PPBC 4HIMA 2LXJA 2PYKA 3JAML 1G8ZD 2B2UA 2KECA 2XTIA 3VDYA 4LFAQ 5C6AA 4DV2L 3VYSA 1R4PB 1Y14B 5DAUA 1C48A 2ASBA 1SYGA 4L5RC 4X64Q 3PO3G 3I4NG 1N33L 4GKJL 2NTTA 5CYUA 1LT5D 1ZXTA 2UXCL 2NBFA 5CR3A 1B3QA 2JA6G 2MHVA 1SAPA 1Z47A 4DV6Q 3CU7A 3A8JE 2IHFA 3OW7A 3BU2A 4JI1Q 1DOMA 3UDIA 3CMEA 4JI4Q 1E2VA 4DAMA 3K7AB 4X65Q 1V43A 1KDAA 2KJXA 5FLXE 2CW0C 3W3AA 1PH4A 2RBMA 5I6YA 1UWVA 1Y1VB 2F3IA 4YCWA 5LMUL 2ZJRA 5IP9H 1G2SA 3ULPA 1PH3A 5IWAL 1D1IA 4PZ7A 3J81c 1GM5A 1AE2A 1BCPB 2XGTA 4Q5VA 1SNOA 3NTIA 2A6HC 2XVSA 3I72A 3PQIA 2PMZE 1PZKD 2I5MX 3NEMA 4GNXC 3CQZH 2B63B 4FF2A 3SE0A 3HKZB 3S14B 5EBCA 3URYA 4DV1L 4JC0A 2XWJB 3DM1A 1ICWA 3PCOB 4UPAA 1SNMA 1XNQQ 2K28A 4FF1A 1MSGA 2ZTDA 2EJMA 4LK1C 2V4DA 1NBWA 1P8LA 3DXJC 2R3ZA 3KF6B 3SHLA 4CHTB 2E2HB 1EY0A 2UUBQ 2N8NA 1TR5A 2YTYA 3NHHA 3JAMi 1PLFA 3GV6A 3M4OH 3GTJH 2WB1B 3C1EA 3CCJA 1KXLA 3KYHC 1E22A 2RCNA 1EY9A 5CORA 3MXNA 4G4KA 3PUYA 3I56A 1K0RA 4AQYL 3KF8A 3S14H 3S2DB 3S1RB 2LY7A 4I7AA 2EIFA 1B8AA 1HA6A 4S3SA 1EOVA 4DR4L 4M8AA 1VF7A 5JJZA 2A6HD 2Z9HA 4KHPQ 4K2KA 3M85A 3N52A 4FO2A 1X54A 3OWEB 1V1PA 1LO5D 2FXQA 1A2UA 3G48A 4NP5A 3E0JA 1S72A 2F4VL 1K8MA 4YIJA 2OTJA 1RHPA 3S2HB 3HOYB 4DUZL 5EBDA 1RODA 3Q23A 3HOZB 1EYCA 1VQ5A 4ZAIA 4GKKL 2G9DA 4DUZQ 4DR2L 5I9OA 5C0XH 1LUZA 3E9HA 4ZCKA 3CC2A 5IGGA 2QKIC 3MEHA 2K4KA 2KHIA 4K5VA 4AYBE 1SJED 5EKKA 2NZHA 3L0OA 3CAMA 4X66L 5ELCA 5JJIA 3SEBA 2MP1A 3CCQA 3AU7A 2UXBQ 4X66Q 3OTOQ 2FHTA 3KF8B 4DK6C 3DLLA 1D8LA 1K8OA 3AQQA 4HJ9A 4TRDA 5ELOA 4B3TQ 4V190 4NW2A 1K8GA 5KEEA 3HOYH 3Q22A 1KAWA 1YEZA 3OYYA 1SMYD 3CXCA 4G7HC 4K5XA 1DGSA 3FP9A 4LF8Q 1D5MC 2K75A 1EQVA 1LTBD 3KF6A 2I5LX 3C3LA 3OPOA 3Q24A 5C0XG 2JN4A 4IUVA 2EY1A 1JE5A 5D3DA 1UE5A 1LV9A 4HJ8A 3GQBA 2QCPX 1S4ZA 2DUDA 3UDXA 3MA2B 2PCFB 4ZQ3A 5EPJA 3CQZB 2B63H 4UDUC 4JI3L 4LF8L 4BY7B 5C4XG 3T1HL 1TU2B 4DR7Q 4RG1A 2AQ1B 3LX0A 1VQHA 4JV5L 3HKSA 4JI8L 3R2IA 4BA2I 4A3CH 2ZTEA 1EIHA 2L1BA 1IW7D 4DKAC 2HIVA 2QEXA 4OGQC 4AIMA 2K33A 1UAPA 4YHHL 4KKTA 1G6PA 1VF5C 3EJIA 2MGSA 3I4NH 1MKHA 4A3DB 4R1JA 2KOLA 1QCBD 3B6YA 4DR3L 1EEID 1SLJA 1Q8IA 4APVA 3M4OB 2DGYA 2R92B 3HOWG 5GAEC 2O4XA 2IX1A 1DONA 3HFZB 4KK7A 1RIPA 1J5EQ 3AMUA 1FGUA 2NVTH 4A3EG 1GOZA 2EY6A 2PNHA 3OHXC 4K2LA 3K5NA 3UE0A 5FJ8H 1SMYC 5FJ8G 3CC7A 2Q2HA 2K5QA 4DUYQ 1EIYB 4XXEA 3KLSX 1ENFA 3TN2A 1CT1D 3W1BA 4M1UB 2PZTA 1YNJC 5FKAC 1HHVA 2RQXA 5ISRA 1X3QA 3NE5B 4P75A 3V96A 2J0TD 4X62Q 3RLOA 2IL8A 1AH9A 4A3GB 1S40A 4NKLA 4L5TA 1TKWB 4N8X1 3P7JA 3QO2A 5D14A 1N34Q 4R9WA 3ER0A 4A4IA 1L1OB 2QEJC 4AYBB 1KL9A 1JWMD 2NVYH 1R4QB 2I07B 2RHQB 4RMFA 1LTID 3EROA 1A15A 5M3MH 4KN4C 2UUAL 3I4MG 4B3RL 4JI0Q 2A1AA 3MHBA 3VR6A 4A75A 1SJHD 3GDEA 1GVPA 1X6OA 1W3SA 1FGBD 5IP9G 4XYQA 1J9OA 1W6KA 3PIPA 1JCKB 2OTLA 1Q81C 2OQKA 1STHA 5LMNQ 1BBXC 4TKOB 1E1TA 1H9SA 1ML0D 1ILQA 4DNTB 1SN8A 1F77A 2WIIB 4RCNA 5M5YH 1I94Q 5FLMH 3NBIA 2Q2IA 2XSCA 5HURA 4EQNA 1D7QA 2RSOA 4NDXA 2PQEA 2HHHL 1HH2P 2F0OA 1NMGA 4IUQA 4I65A 1MHWC 1VQKA 2RKSA 3RLFA 2B2WC 5I4DA 5AFWA 5CV7A 2L11A 1SNCA 1TWAB 3SXHA 3E9IA 1HZCA 1FR3A 2FINB 2K1BA 1GUTA 4DV3L 1Q46A 1H9KA 2R6GA 1D6EC 2DNCA 4NXNQ 2LMCB 2B2UC 4B3MQ 1F2YA 1EY5A 5EPLA 2BDOA 2E2HH 3I4MB 1UE6A 1S3OA 2L4NA 3N6RA 2JXMB 3K7UC 1ESRA 2ZJQA 1U5KA 3NPPA 1VQ6A 1N8RC 3GTOB 2RA4A 5JPNC 2D5DA 2LXKA 3QB3A 5CV4A 3VR5A 4TVAB 1PTOC 1BBUA 1S5DD 1RKNA 2N3SA 4A3EH 4NXMQ 2YTXA 5IGCA 2Q8IB 2B29A 4A3JG 1TY0A 5IYCG 2Y0SB 4KHPL 2RSNA 4R8NA 3PF4A 3FKIG 4DF7A 2Z6BA 3S1MH 1BXTA 4WJWA 5IGEA 1FL0A 2IX0A 3NQIA 4QQBX 3SK5A 5C5MA 3J7YW 1MI2A
chains in the Genus database with same CATH topology
3T1YL 2E2JH 1WJJA 1N9WA 3UE1A 2NZOA 3BJUA 4C2MH 4YWKA 3F2CA 2UU9L 4JBKA 1XMQQ 1V1QA 1IBLL 4A3BH 2AMCB 1L0WA 2E8GA 2GVAA 4R4QA 5M5XH 4GN5A 3ICEA 1EQQA 3CPWA 1IBKL 4LWCA 4LUVA 4POGA 1P16A 2VQEQ 1PH6A 1E7ZA 2EQSA 2L15A 1IL2A 3JAMc 1I94L 3F2DA 4DNIA 1EUJA 4B3ML 4LF5L 3NELA 4DV4Q 3S1QH 5IE8A 2CWAA 1NE3A 5C0XI 5HGQA 4X6AH 1PA6A 2VY3A 2VL6A 5IT9c 5C4XH 5BR8L 4GLXA 1PH2A 1YZ6A 4R4TA 4HIMA 2I0QA 1E3PA 5K36G 2D0OA 1B70B 4C3IH 1WFQA 4OWWB 2LXJA 1CKMA 5C0XJ 3L2PA 4GNXB 1CKNA 3HOZG 2K5NA 5IY0A 1BVSA 2XTIA 1Q1BA 3VDYA 1VQIA 2ZTCA 4LFAQ 4DV2L 4BBRG 1K9MC 4EX5A 3PO2H 1Y14B 4GLAC 1VQJA 2AWNA 2Z6KC 5AJ3Q 2ASBA 2K14A 4L5RC 4JBWA 4BY1G 4X64Q 3PO3G 4DAYB 3CD6A 1I3QH 3NENA 1N33L 1YHBA 3I4NG 4A3DH 4GKJL 4GKKQ 4LF7Q 2C35B 2UXCL 3GTQH 1HR0Q 1K73C 3MEFA 4PZ8A 5ELNA 4A3MG 3A0JA 1Z47A 2JA6G 4IO9A 4HIKA 4DV6Q 4A3MH 2UUCQ 2JA6H 5FLMG 3GTOH 1OXSC 2R7FA 2IHFA 3BU2A 1CKOA 1G291 4JI1Q 3I4OA 3AEVA 3UDIA 3S24A 3CMEA 4JI4Q 3GTKH 4DAMA 4X65Q 1V43A 2LSSA 3MXNB 4OWTB 5IYBH 4JBJA 4A3JH 3BZKA 4OO1G 1PH4A 3HOYG 1WI5A 2KENA 2PQAA 4EQ5A 1UWVA 2Y0SG 2F3IA 1VQAA 4YCWA 1JJGA 5LMUL 2ZJRA 4LF6Q 5IP9H 4YY3L 3L7ZC 3ULPA 4C3JH 1PH3A 5IWAL 1OTCA 4OX9L 1VQ9A 4PZ7A 3J81c 1GM5A 1HR0W 2WB1E 2EXDA 1AE2A 2XGTA 5GAGC 4JYAQ 4DR5L 2UUCL 2IY5B 4JI0L 1N32Q 3EN2A 3HOZH 1VQCA 1HR0L 4JI8Q 1JJCB 5EAYA 1KD1C 1SROA 1EFWA 1PVOA 2PMZE 1AE3A 2I5MX 3M4QA 2B3GA 3NEMA 3I2ZA 4GNXC 3CQZH 1N33Q 4BY7G 2YYZA 3WWVA 4JI3Q 1MJEA 3CCUA 1YJWA 1XNRL 2D62A 1VQBA 4JC0A 1HZ9A 4DV1L 2WP8J 1TWGH 1XPOA 2A8VA 1Q7YC 2E2IH 4YY3Q 4XTCS 3PCOB 1SFOH 4UPAA 1YITA 3ULLA 3HOXG 2GVBA 3HOXH 1K83H 1SMXA 1XNQQ 4LUOA 1KQSA 4GN4B 2ZTDA 5BR8Q 1X55A 3RZOH 1FJGQ 3CMAA 2WFWA 1NBWA 1P8LA 3KF6B 3I4MH 2YU9H 4YHHQ 3PGZA 1VQ7A 1XTDA 2N8NA 2UUBQ 2YTYA 4MNOA 2MNAA 2HT1A 4DV7L 4DV5L 2ZM6L 3JAMi 1YIJA 4A3GG 3M4OH 2PI2E 2VQEL 1KHIA 3GTJH 4P71A 1X3EA 2ATWA 1T9HA 1WOCA 1TWAH 3CCJA 1KXLA 1I6HH 1WCMG 3KYHC 2Q2UA 1E22A 4LW1A 4JV5Q 2RCNA 4A3IG 1X9NA 1Q12A 5JEAJ 3S1NH 4GKJQ 4LFBQ 1QZHA 4IFDI 3PUYA 3PUZA 5HY6A 3HOUH 3I56A 1K0RA 4JI6Q 3HOUG 3EBEA 4AQYL 3CCMA 3S14H 2JA8G 5AJ3L 1OXTA 1J5EL 2ES2A 1E24A 2WB1G 1HNXQ 4WJ4A 1X65A 2EIFA 4L5QA 4A3FG 1Y1WG 1B8AA 2K5VA 4BXXH 1EOVA 2JEBI 1LYLA 4KI0A 4DR4L 4PG3A 1QVCA 2UUBL 4KHPQ 2KBNA 3G6EA 3M85A 1XNQL 1PFSA 1X54A 3CPFA 1VQLA 1VQNA 1PH9A 2AHOB 1VQFA 2KCMA 5M5WH 1JMCA 2FXQA 3G48A 3STBC 1S72A 1MIUA 2VQFL 4POFA 5M3FG 4DUYL 1ASYA 2F4VL 1GKHA 5JJKA 2OTJA 3J81i 2RF4A 3CCLA 1Q8KA 3CCEA 2R92G 1WYDA 2R92H 4DUZL 1PYSB 4GNXA 1YI2A 2UXDQ 1NJIC 2UXCQ 3M7NA 4P73A 2BA1A 1VQ5A 4GKKL 3K0XA 4DUZQ 1XMQL 2BH8A 4AYBG 4DR2L 3S17H 3KDFB 4DR6L 1CSQA 4PMWA 1LUZA 2VW9A 3E9HA 4H02A 4QL5A 3KJOA 1SR3A 2F4VQ 3CC2A 2VQFQ 2K4KA 2KHIA 3EIVA 4AYBE 4KLKA 3CP0A 4A3IH 4DV0Q 1EYGA 2NZHA 3L0OA 4LFCL 3CAMA 2OWOA 4OX9Q 4BBSG 4X66L 3ULJA 3H0GG 3PSIA 5JJIA 1ASZA 3GTMH 1X3GA 2KCTA 4DR7L 3CCQA 4LF9Q 4IPCA 1PHJA 1Z9FA 4X66Q 3HOVG 2UXBQ 1QZGA 3GD7A 3OTOQ 3HOVH 1H95A 4XIGS 3KF8B 3J7ZC 2AWOA 4DK6C 3I7FA 1HNXL 4BXXG 2IHEA 3DLLA 2Y0SE 4R4CA 1D8LA 3W5OA 3AQQA 1KC8C 4LF5Q 1IXRA 4HJ9A 2K5HA 2JA5H 4A3KH 5ELOA 4JBMA 2R7ZH 4IOAA 1X56A 4B3TQ 5JJLA 3U4ZA 1HZAA 5LMNW 4DV6L 1VQDA 4ME3A 3NBHB 1K8GA 4A3GH 2HHHQ 2R7DA 4BBRH 3D31A 2VUMG 3HOYH 1IBKQ 3GTGH 1KAWA 1YEZA 3AFQA 3FKIH 2OCEA 4LF7L 3OYYA 3CXCA 2QA4A 4O2DA 2YV5A 3T1HQ 3M3YH 1FVIA 1HZBA 1TWFH 1DGSA 1Q1EA 2H5XA 3BZCA 2Z6KA 3LGJA 3FP9A 3T1YQ 4LF8Q 1VQGA 2K75A 3KFUA 3KF6A 1L1OC 2V1CC 2I5LX 4R4OA 5C0XG 3G4SA 4GOPC 3S1RH 3M9BA 4IFDJ 1Y1VG 1OXXK 3TEHB 2WAQE 3KDFA 1K3RA 4HIDA 1JE5A 1GO3E 3I55A 4DR1L 1UE5A 2CQOA 3J80c 4HJ8A 4DR4Q 1YJNA 3F8TA 5GROA 3KJPA 1LM0A 2WAQG 2DUDA 3ERSX 3CCRA 1M90C 2D0PA 4JOIA 2JQOA 2JEAI 3UDXA 1YVCA 4B3RQ 2B63H 4JI3L 4LF8L 2B63G 5C4XG 2YTVA 1KRTA 4UY8C 3T1HL 4DR7Q 4RG1A 4LFBL 4P72A 1M1KC 2ALYB 2NVXH 1I5FA 1VQHA 4JV5L 5IYDH 3HKSA 2HQLA 2MQHA 4JI8L 4IJLA 1VQ4A 2E5LQ 2OQ0A 4A3KG 2JA5G 3AYHB 4IPDA 5GADC 1OXVA 1IBLQ 4BA2I 4A3CH 2ZTEA 3PUVA 2CKZB 2UU9Q 4DKAC 1GD7A 4DV5Q 3CC4A 4JYAL 2HIVA 4B3TL 2QEXA 4MZ9A 4AIMA 2PQAB 4A3LH 1A8VA 1UE7A 4YHHL 1G6PA 1QVGA 1I50H 4IPHA 4YCUA 1FJGL 3I4NH 4BY1H 4LUZA 1MKHA 4R4IA 1V9PA 1YNXA 3OTOL 5LMNL 5C4JH 2VNUD 1A63A 4R1JA 3PUWA 4BBSH 2I5HA 1PH5A 3F1ZA 4LF9L 1HJPA 4X65L 1HNZL 2JA8H 4B3SL 3B6YA 1PYBA 4DR3L 1SLJA 4APVA 3HOWH 2DGYA 1CSPA 3GO5A 4JI1L 2MO1A 4A76A 1A62A 5GAEC 4A3FH 1Y1WH 2IX1A 3HOWG 1Q82C 1Q86C 3HFZB 3H3VI 1RIPA 1J5EQ 4J15A 1XNRQ 1FGUA 1SE8A 2NVTH 2CFMA 3K7AH 4JI2Q 1IBML 2R7ZG 5IYBG 3D0FA 1VQMA 3U4VA 4A3EG 4A93G 3U58A 4IOCA 2PNHA 3RLNA 3K81C 3S2DH 3F2BA 1C0AA 1R9TH 5M3FH 4YCVA 2MFIA 1CUKA 3J81j 3A5ZB 3UE0A 5FJ8H 3JC66 5FJ8G 4FDBA 2ZM6Q 4GN3B 3CC7A 4DR5Q 2Q2HA 1N34L 3S16H 2ID0A 2N78A 1CKNB 5IYDG 4DUYQ 2UXDL 5IWAQ 2NN6G 2QGQA 4JCVE 1EIYB 2JA7G 3HKZE 4K0KL 3STBD 2GN5A 1W2BA 3W1BA 4DV3Q 1QUQB 3G71A 1JT8A 4MTNA 3RZDH 1L1OA 4A3BG 4GLVB 3PV0A 4P75A 3J80i 4X62Q 3RLOA 4JI4L 1XPUA 2N49A 4HIOA 1AH9A 4JI5Q 1UEBA 4QGUA 1S40A 1JB7A 4L5TA 1PH1A 4DV1Q 5C44H 1N34Q 4OXPA 4LF4L 3ER0A 3RN5A 4AQYQ 4A4IA 1L1OB 1PH7A 4JI6L 1HNWQ 4P74A 1KL9A 2NVYH 4HJ5A 1QUQA 1YHQA 3S15H 3U50C 4Y7NH 2RHQB 3OW2A 4JOIC 3RR5A 3CF5A 1EQRA 4RMFA 4Y52H 1VQPA 4X64L 1BBWA 1IBMQ 4JI2L 3KLWA 3SGIA 1NY4A 3TREA 5M3MH 2UUAL 3I4MG 4B3RL 4JI0Q 1N32L 2A1AA 4OONA 3TQYA 1XJVA 3IRBA 4A75A 4DV7Q 4DK3C 1EWIA 1PV4A 4A3CG 3GDEA 4NB3A 5IYCH 2A19A 4JI5L 1K8AC 1GVPA 1TWHH 2F52A 1X6OA 1W3SA 1UE1A 2JA9A 4UP8A 4DR3Q 4X62L 1NTGA 5IP9G 4QIWE 4ALPA 3RN2A 4B3SQ 3PO2G 3PIPA 2OTLA 3CCVA 1WCMH 3RNUA 4QJFA 4OO1I 1Q81C 2OQKA 1X3FA 4C3HH 1YJ9A 5LMNQ 3PO3H 1E1TA 4WJ3M 1VS0A 3FHWA 1BKBA 3H0GH 3UDGA 1SN8A 4DV4L 2NN6I 4HJAA 3Q8DA 2CCZA 2R93G 1Y1VH 4AH6A 5M5YH 2R93H 1I94Q 5FLMH 2K50A 1J6QA 1MJCA 2JK8A 2Q2IA 3A5UA 2VZAA 2UUAQ 1O7IA 1YBYA 4GS3A 3CCSA 2IT1A 1D7QA 2E5LL 2RHSB 2HHHL 1HH2P 1U0LA 5C3EH 1KRSA 3GTLH 4GOPB 3TRZA 4A93H 4JG2A 1NMGA 1XPRA 3K80C 3TS0A 1HNWL 2VUMH 2HIXA 3M4PA 5JEAG 4L5SA 4OWXB 3E0EA 4YWLA 1VQKA 4LF4Q 1SRUA 3RLFA 3W1GA 5IP7H 3ZJYC 5IP7G 4DV2Q 1E1OA 4QY7A 2Z0SA 3PIOA 5E7NA 3AFPA 2UXBL 1TXYA 5LMUQ 2AKWB 4YWMA 1KIXA 4LF6L 1HNZQ 5DLQE 1VQOA 2PI2A 2CWPA 3E9IA 1HZCA 5J3BA 2JA7H 1VQ8A 2BH2A 4IPGA 4DV3L 1Q46A 2KHJA 3K8AA 1A0IA 2R6GA 4DV0L 1NMFA 1N36L 4JI7Q 2NVQH 4BY7H 4NXNQ 1IZ6A 4A3LG 4K0KQ 4NPSA 4B3MQ 2ZJPA 2JJQA 4GOPA 1JJ2A 1QVFA 1XMOL 1IYJB 4DPGA 2E2HH 5GQOA 3H3VH 4DR6Q 1C9OA 1S3OA 1UE6A 3PUXA 4DR2Q 3HKZG 1RL2A 3UDFA 5C44G 3S2HH 3K7UC 2ZJQA 1TWCH 1U5KA 1VQ6A 4KHZA 2JE6I 4UP7A 3PF5A 1N8RC 2Q2TA 1G51A 3TS2A 2LXKA 1VQEA 5H1SE 1XMOQ 1B7YB 4IJHA 4IFDG 5GAHC 4TVAB 1C7YA 1BBUA 4TQUS 3A74A 2N3SA 4NXNL 4LNQA 3DM3A 4A3EH 4O0AA 5C3EG 5M3MG 1N36Q 4JI7L 4NXMQ 4LFAL 2YTXA 5FLXc 3J7A5 3GTPH 2B29A 4A3JG 2MO0A 5IYCG 4KHPL 2VS1A 2K52A 3PF4A 4BA1I 1EIFA 4DR1Q 3FKIG 4UP9A 1LTLA 1PH8A 4LFCQ 3KOJA 3S1MH 1YHAA 4A3DG 4NXML 1OXUA 1FL0A 2IX0A 3H15A 4QQBX 4PZ6A 1VCIA 3CW2C 1L2FA 2BA0A 4HJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y L;  2E2J H;  1WJJ A;  1N9W A;  3UE1 A;  2NZO A;  3BJU A;  4C2M H;  4YWK A;  3F2C A;  2UU9 L;  4JBK A;  1XMQ Q;  1V1Q A;  1IBL L;  4A3B H;  2AMC B;  1L0W A;  2E8G A;  2GVA A;  4R4Q A;  5M5X H;  4GN5 A;  3ICE A;  1EQQ A;  3CPW A;  1IBK L;  4LWC A;  4LUV A;  4POG A;  1P16 A;  2VQE Q;  1PH6 A;  1E7Z A;  2EQS A;  2L15 A;  1IL2 A;  3JAM c;  1I94 L;  3F2D A;  4DNI A;  1EUJ A;  4B3M L;  4LF5 L;  3NEL A;  4DV4 Q;  3S1Q H;  5IE8 A;  2CWA A;  1NE3 A;  5C0X I;  5HGQ A;  4X6A H;  1PA6 A;  2VY3 A;  2VL6 A;  5IT9 c;  5C4X H;  5BR8 L;  4GLX A;  1PH2 A;  1YZ6 A;  4R4T A;  4HIM A;  2I0Q A;  1E3P A;  5K36 G;  2D0O A;  1B70 B;  4C3I H;  1WFQ A;  4OWW B;  2LXJ A;  1CKM A;  5C0X J;  3L2P A;  4GNX B;  1CKN A;  3HOZ G;  2K5N A;  5IY0 A;  1BVS A;  2XTI A;  1Q1B A;  3VDY A;  1VQI A;  2ZTC A;  4LFA Q;  4DV2 L;  4BBR G;  1K9M C;  4EX5 A;  3PO2 H;  1Y14 B;  4GLA C;  1VQJ A;  2AWN A;  2Z6K C;  5AJ3 Q;  2ASB A;  2K14 A;  4L5R C;  4JBW A;  4BY1 G;  4X64 Q;  3PO3 G;  4DAY B;  3CD6 A;  1I3Q H;  3NEN A;  1N33 L;  1YHB A;  3I4N G;  4A3D H;  4GKJ L;  4GKK Q;  4LF7 Q;  2C35 B;  2UXC L;  3GTQ H;  1HR0 Q;  1K73 C;  3MEF A;  4PZ8 A;  5ELN A;  4A3M G;  3A0J A;  1Z47 A;  2JA6 G;  4IO9 A;  4HIK A;  4DV6 Q;  4A3M H;  2UUC Q;  2JA6 H;  5FLM G;  3GTO H;  1OXS C;  2R7F A;  2IHF A;  3BU2 A;  1CKO A;  1G29 1;  4JI1 Q;  3I4O A;  3AEV A;  3UDI A;  3S24 A;  3CME A;  4JI4 Q;  3GTK H;  4DAM A;  4X65 Q;  1V43 A;  2LSS A;  3MXN B;  4OWT B;  5IYB H;  4JBJ A;  4A3J H;  3BZK A;  4OO1 G;  1PH4 A;  3HOY G;  1WI5 A;  2KEN A;  2PQA A;  4EQ5 A;  1UWV A;  2Y0S G;  2F3I A;  1VQA A;  4YCW A;  1JJG A;  5LMU L;  2ZJR A;  4LF6 Q;  5IP9 H;  4YY3 L;  3L7Z C;  3ULP A;  4C3J H;  1PH3 A;  5IWA L;  1OTC A;  4OX9 L;  1VQ9 A;  4PZ7 A;  3J81 c;  1GM5 A;  1HR0 W;  2WB1 E;  2EXD A;  1AE2 A;  2XGT A;  5GAG C;  4JYA Q;  4DR5 L;  2UUC L;  2IY5 B;  4JI0 L;  1N32 Q;  3EN2 A;  3HOZ H;  1VQC A;  1HR0 L;  4JI8 Q;  1JJC B;  5EAY A;  1KD1 C;  1SRO A;  1EFW A;  1PVO A;  2PMZ E;  1AE3 A;  2I5M X;  3M4Q A;  2B3G A;  3NEM A;  3I2Z A;  4GNX C;  3CQZ H;  1N33 Q;  4BY7 G;  2YYZ A;  3WWV A;  4JI3 Q;  1MJE A;  3CCU A;  1YJW A;  1XNR L;  2D62 A;  1VQB A;  4JC0 A;  1HZ9 A;  4DV1 L;  2WP8 J;  1TWG H;  1XPO A;  2A8V A;  1Q7Y C;  2E2I H;  4YY3 Q;  4XTC S;  3PCO B;  1SFO H;  4UPA A;  1YIT A;  3ULL A;  3HOX G;  2GVB A;  3HOX H;  1K83 H;  1SMX A;  1XNQ Q;  4LUO A;  1KQS A;  4GN4 B;  2ZTD A;  5BR8 Q;  1X55 A;  3RZO H;  1FJG Q;  3CMA A;  2WFW A;  1NBW A;  1P8L A;  3KF6 B;  3I4M H;  2YU9 H;  4YHH Q;  3PGZ A;  1VQ7 A;  1XTD A;  2N8N A;  2UUB Q;  2YTY A;  4MNO A;  2MNA A;  2HT1 A;  4DV7 L;  4DV5 L;  2ZM6 L;  3JAM i;  1YIJ A;  4A3G G;  3M4O H;  2PI2 E;  2VQE L;  1KHI A;  3GTJ H;  4P71 A;  1X3E A;  2ATW A;  1T9H A;  1WOC A;  1TWA H;  3CCJ A;  1KXL A;  1I6H H;  1WCM G;  3KYH C;  2Q2U A;  1E22 A;  4LW1 A;  4JV5 Q;  2RCN A;  4A3I G;  1X9N A;  1Q12 A;  5JEA J;  3S1N H;  4GKJ Q;  4LFB Q;  1QZH A;  4IFD I;  3PUY A;  3PUZ A;  5HY6 A;  3HOU H;  3I56 A;  1K0R A;  4JI6 Q;  3HOU G;  3EBE A;  4AQY L;  3CCM A;  3S14 H;  2JA8 G;  5AJ3 L;  1OXT A;  1J5E L;  2ES2 A;  1E24 A;  2WB1 G;  1HNX Q;  4WJ4 A;  1X65 A;  2EIF A;  4L5Q A;  4A3F G;  1Y1W G;  1B8A A;  2K5V A;  4BXX H;  1EOV A;  2JEB I;  1LYL A;  4KI0 A;  4DR4 L;  4PG3 A;  1QVC A;  2UUB L;  4KHP Q;  2KBN A;  3G6E A;  3M85 A;  1XNQ L;  1PFS A;  1X54 A;  3CPF A;  1VQL A;  1VQN A;  1PH9 A;  2AHO B;  1VQF A;  2KCM A;  5M5W H;  1JMC A;  2FXQ A;  3G48 A;  3STB C;  1S72 A;  1MIU A;  2VQF L;  4POF A;  5M3F G;  4DUY L;  1ASY A;  2F4V L;  1GKH A;  5JJK A;  2OTJ A;  3J81 i;  2RF4 A;  3CCL A;  1Q8K A;  3CCE A;  2R92 G;  1WYD A;  2R92 H;  4DUZ L;  1PYS B;  4GNX A;  1YI2 A;  2UXD Q;  1NJI C;  2UXC Q;  3M7N A;  4P73 A;  2BA1 A;  1VQ5 A;  4GKK L;  3K0X A;  4DUZ Q;  1XMQ L;  2BH8 A;  4AYB G;  4DR2 L;  3S17 H;  3KDF B;  4DR6 L;  1CSQ A;  4PMW A;  1LUZ A;  2VW9 A;  3E9H A;  4H02 A;  4QL5 A;  3KJO A;  1SR3 A;  2F4V Q;  3CC2 A;  2VQF Q;  2K4K A;  2KHI A;  3EIV A;  4AYB E;  4KLK A;  3CP0 A;  4A3I H;  4DV0 Q;  1EYG A;  2NZH A;  3L0O A;  4LFC L;  3CAM A;  2OWO A;  4OX9 Q;  4BBS G;  4X66 L;  3ULJ A;  3H0G G;  3PSI A;  5JJI A;  1ASZ A;  3GTM H;  1X3G A;  2KCT A;  4DR7 L;  3CCQ A;  4LF9 Q;  4IPC A;  1PHJ A;  1Z9F A;  4X66 Q;  3HOV G;  2UXB Q;  1QZG A;  3GD7 A;  3OTO Q;  3HOV H;  1H95 A;  4XIG S;  3KF8 B;  3J7Z C;  2AWO A;  4DK6 C;  3I7F A;  1HNX L;  4BXX G;  2IHE A;  3DLL A;  2Y0S E;  4R4C A;  1D8L A;  3W5O A;  3AQQ A;  1KC8 C;  4LF5 Q;  1IXR A;  4HJ9 A;  2K5H A;  2JA5 H;  4A3K H;  5ELO A;  4JBM A;  2R7Z H;  4IOA A;  1X56 A;  4B3T Q;  5JJL A;  3U4Z A;  1HZA A;  5LMN W;  4DV6 L;  1VQD A;  4ME3 A;  3NBH B;  1K8G A;  4A3G H;  2HHH Q;  2R7D A;  4BBR H;  3D31 A;  2VUM G;  3HOY H;  1IBK Q;  3GTG H;  1KAW A;  1YEZ A;  3AFQ A;  3FKI H;  2OCE A;  4LF7 L;  3OYY A;  3CXC A;  2QA4 A;  4O2D A;  2YV5 A;  3T1H Q;  3M3Y H;  1FVI A;  1HZB A;  1TWF H;  1DGS A;  1Q1E A;  2H5X A;  3BZC A;  2Z6K A;  3LGJ A;  3FP9 A;  3T1Y Q;  4LF8 Q;  1VQG A;  2K75 A;  3KFU A;  3KF6 A;  1L1O C;  2V1C C;  2I5L X;  4R4O A;  5C0X G;  3G4S A;  4GOP C;  3S1R H;  3M9B A;  4IFD J;  1Y1V G;  1OXX K;  3TEH B;  2WAQ E;  3KDF A;  1K3R A;  4HID A;  1JE5 A;  1GO3 E;  3I55 A;  4DR1 L;  1UE5 A;  2CQO A;  3J80 c;  4HJ8 A;  4DR4 Q;  1YJN A;  3F8T A;  5GRO A;  3KJP A;  1LM0 A;  2WAQ G;  2DUD A;  3ERS X;  3CCR A;  1M90 C;  2D0P A;  4JOI A;  2JQO A;  2JEA I;  3UDX A;  1YVC A;  4B3R Q;  2B63 H;  4JI3 L;  4LF8 L;  2B63 G;  5C4X G;  2YTV A;  1KRT A;  4UY8 C;  3T1H L;  4DR7 Q;  4RG1 A;  4LFB L;  4P72 A;  1M1K C;  2ALY B;  2NVX H;  1I5F A;  1VQH A;  4JV5 L;  5IYD H;  3HKS A;  2HQL A;  2MQH A;  4JI8 L;  4IJL A;  1VQ4 A;  2E5L Q;  2OQ0 A;  4A3K G;  2JA5 G;  3AYH B;  4IPD A;  5GAD C;  1OXV A;  1IBL Q;  4BA2 I;  4A3C H;  2ZTE A;  3PUV A;  2CKZ B;  2UU9 Q;  4DKA C;  1GD7 A;  4DV5 Q;  3CC4 A;  4JYA L;  2HIV A;  4B3T L;  2QEX A;  4MZ9 A;  4AIM A;  2PQA B;  4A3L H;  1A8V A;  1UE7 A;  4YHH L;  1G6P A;  1QVG A;  1I50 H;  4IPH A;  4YCU A;  1FJG L;  3I4N H;  4BY1 H;  4LUZ A;  1MKH A;  4R4I A;  1V9P A;  1YNX A;  3OTO L;  5LMN L;  5C4J H;  2VNU D;  1A63 A;  4R1J A;  3PUW A;  4BBS H;  2I5H A;  1PH5 A;  3F1Z A;  4LF9 L;  1HJP A;  4X65 L;  1HNZ L;  2JA8 H;  4B3S L;  3B6Y A;  1PYB A;  4DR3 L;  1SLJ A;  4APV A;  3HOW H;  2DGY A;  1CSP A;  3GO5 A;  4JI1 L;  2MO1 A;  4A76 A;  1A62 A;  5GAE C;  4A3F H;  1Y1W H;  2IX1 A;  3HOW G;  1Q82 C;  1Q86 C;  3HFZ B;  3H3V I;  1RIP A;  1J5E Q;  4J15 A;  1XNR Q;  1FGU A;  1SE8 A;  2NVT H;  2CFM A;  3K7A H;  4JI2 Q;  1IBM L;  2R7Z G;  5IYB G;  3D0F A;  1VQM A;  3U4V A;  4A3E G;  4A93 G;  3U58 A;  4IOC A;  2PNH A;  3RLN A;  3K81 C;  3S2D H;  3F2B A;  1C0A A;  1R9T H;  5M3F H;  4YCV A;  2MFI A;  1CUK A;  3J81 j;  3A5Z B;  3UE0 A;  5FJ8 H;  3JC6 6;  5FJ8 G;  4FDB A;  2ZM6 Q;  4GN3 B;  3CC7 A;  4DR5 Q;  2Q2H A;  1N34 L;  3S16 H;  2ID0 A;  2N78 A;  1CKN B;  5IYD G;  4DUY Q;  2UXD L;  5IWA Q;  2NN6 G;  2QGQ A;  4JCV E;  1EIY B;  2JA7 G;  3HKZ E;  4K0K L;  3STB D;  2GN5 A;  1W2B A;  3W1B A;  4DV3 Q;  1QUQ B;  3G71 A;  1JT8 A;  4MTN A;  3RZD H;  1L1O A;  4A3B G;  4GLV B;  3PV0 A;  4P75 A;  3J80 i;  4X62 Q;  3RLO A;  4JI4 L;  1XPU A;  2N49 A;  4HIO A;  1AH9 A;  4JI5 Q;  1UEB A;  4QGU A;  1S40 A;  1JB7 A;  4L5T A;  1PH1 A;  4DV1 Q;  5C44 H;  1N34 Q;  4OXP A;  4LF4 L;  3ER0 A;  3RN5 A;  4AQY Q;  4A4I A;  1L1O B;  1PH7 A;  4JI6 L;  1HNW Q;  4P74 A;  1KL9 A;  2NVY H;  4HJ5 A;  1QUQ A;  1YHQ A;  3S15 H;  3U50 C;  4Y7N H;  2RHQ B;  3OW2 A;  4JOI C;  3RR5 A;  3CF5 A;  1EQR A;  4RMF A;  4Y52 H;  1VQP A;  4X64 L;  1BBW A;  1IBM Q;  4JI2 L;  3KLW A;  3SGI A;  1NY4 A;  3TRE A;  5M3M H;  2UUA L;  3I4M G;  4B3R L;  4JI0 Q;  1N32 L;  2A1A A;  4OON A;  3TQY A;  1XJV A;  3IRB A;  4A75 A;  4DV7 Q;  4DK3 C;  1EWI A;  1PV4 A;  4A3C G;  3GDE A;  4NB3 A;  5IYC H;  2A19 A;  4JI5 L;  1K8A C;  1GVP A;  1TWH H;  2F52 A;  1X6O A;  1W3S A;  1UE1 A;  2JA9 A;  4UP8 A;  4DR3 Q;  4X62 L;  1NTG A;  5IP9 G;  4QIW E;  4ALP A;  3RN2 A;  4B3S Q;  3PO2 G;  3PIP A;  2OTL A;  3CCV A;  1WCM H;  3RNU A;  4QJF A;  4OO1 I;  1Q81 C;  2OQK A;  1X3F A;  4C3H H;  1YJ9 A;  5LMN Q;  3PO3 H;  1E1T A;  4WJ3 M;  1VS0 A;  3FHW A;  1BKB A;  3H0G H;  3UDG A;  1SN8 A;  4DV4 L;  2NN6 I;  4HJA A;  3Q8D A;  2CCZ A;  2R93 G;  1Y1V H;  4AH6 A;  5M5Y H;  2R93 H;  1I94 Q;  5FLM H;  2K50 A;  1J6Q A;  1MJC A;  2JK8 A;  2Q2I A;  3A5U A;  2VZA A;  2UUA Q;  1O7I A;  1YBY A;  4GS3 A;  3CCS A;  2IT1 A;  1D7Q A;  2E5L L;  2RHS B;  2HHH L;  1HH2 P;  1U0L A;  5C3E H;  1KRS A;  3GTL H;  4GOP B;  3TRZ A;  4A93 H;  4JG2 A;  1NMG A;  1XPR A;  3K80 C;  3TS0 A;  1HNW L;  2VUM H;  2HIX A;  3M4P A;  5JEA G;  4L5S A;  4OWX B;  3E0E A;  4YWL A;  1VQK A;  4LF4 Q;  1SRU A;  3RLF A;  3W1G A;  5IP7 H;  3ZJY C;  5IP7 G;  4DV2 Q;  1E1O A;  4QY7 A;  2Z0S A;  3PIO A;  5E7N A;  3AFP A;  2UXB L;  1TXY A;  5LMU Q;  2AKW B;  4YWM A;  1KIX A;  4LF6 L;  1HNZ Q;  5DLQ E;  1VQO A;  2PI2 A;  2CWP A;  3E9I A;  1HZC A;  5J3B A;  2JA7 H;  1VQ8 A;  2BH2 A;  4IPG A;  4DV3 L;  1Q46 A;  2KHJ A;  3K8A A;  1A0I A;  2R6G A;  4DV0 L;  1NMF A;  1N36 L;  4JI7 Q;  2NVQ H;  4BY7 H;  4NXN Q;  1IZ6 A;  4A3L G;  4K0K Q;  4NPS A;  4B3M Q;  2ZJP A;  2JJQ A;  4GOP A;  1JJ2 A;  1QVF A;  1XMO L;  1IYJ B;  4DPG A;  2E2H H;  5GQO A;  3H3V H;  4DR6 Q;  1C9O A;  1S3O A;  1UE6 A;  3PUX A;  4DR2 Q;  3HKZ G;  1RL2 A;  3UDF A;  5C44 G;  3S2H H;  3K7U C;  2ZJQ A;  1TWC H;  1U5K A;  1VQ6 A;  4KHZ A;  2JE6 I;  4UP7 A;  3PF5 A;  1N8R C;  2Q2T A;  1G51 A;  3TS2 A;  2LXK A;  1VQE A;  5H1S E;  1XMO Q;  1B7Y B;  4IJH A;  4IFD G;  5GAH C;  4TVA B;  1C7Y A;  1BBU A;  4TQU S;  3A74 A;  2N3S A;  4NXN L;  4LNQ A;  3DM3 A;  4A3E H;  4O0A A;  5C3E G;  5M3M G;  1N36 Q;  4JI7 L;  4NXM Q;  4LFA L;  2YTX A;  5FLX c;  3J7A 5;  3GTP H;  2B29 A;  4A3J G;  2MO0 A;  5IYC G;  4KHP L;  2VS1 A;  2K52 A;  3PF4 A;  4BA1 I;  1EIF A;  4DR1 Q;  3FKI G;  4UP9 A;  1LTL A;  1PH8 A;  4LFC Q;  3KOJ A;  3S1M H;  1YHA A;  4A3D G;  4NXM L;  1OXU A;  1FL0 A;  2IX0 A;  3H15 A;  4QQB X;  4PZ6 A;  1VCI A;  3CW2 C;  1L2F A;  2BA0 A;  4HJ7 A; 
#chains in the Genus database with same CATH topology
 3T1Y L;  4ME5 A;  3UE1 A;  2R93 B;  5M3F B;  4C2M H;  2F0H A;  1SE2 A;  4A3B H;  2AMC B;  4B08 A;  1DJR D;  1SYB A;  1EQQ A;  3FVQ A;  4KTA A;  1KDC A;  1DM0 B;  1E7Z A;  1CQF A;  1KAB A;  2G5D A;  1L0X B;  3F2D A;  3QOJ A;  5A2Q E;  4LF5 L;  3J7A F;  1HFG A;  2F3W A;  5HGQ A;  1GUS A;  1PH2 A;  4R4T A;  2I0Q A;  5KYL A;  2D0O A;  1B70 B;  2DJF C;  1WFQ A;  1CKM A;  5C0X J;  3HOZ G;  1CZG A;  2BE5 D;  1EZ6 A;  5IY0 A;  1BVS A;  3VA5 A;  2WKD A;  1VQI A;  2NVT B;  1K9M C;  2Q8R E;  4EX5 A;  3PO2 H;  1VQJ A;  2AWN A;  2Z6K C;  4RGM A;  3TDQ A;  3NEN A;  2E2J B;  1SYE A;  2JA5 B;  1CM9 A;  1RF2 D;  2C35 B;  1CK1 A;  1KLU D;  3DWP A;  4A3M G;  3A0J A;  4IO9 A;  4A3M H;  1TWG B;  5FLM G;  1OO9 B;  1STB A;  1CKO A;  3R3O A;  2VB2 X;  3M3Y B;  1LT4 D;  4OWT B;  2N88 A;  5IYB H;  3IAY A;  4QB4 A;  3R2T A;  4DFA A;  5I2X A;  3BG3 A;  4ZLT F;  3P20 A;  1OTC A;  4OX9 L;  1RD9 D;  1HR0 W;  1H9M A;  2EXD A;  4K6D A;  4DR5 L;  2UUC L;  2IY5 B;  4JI0 L;  2ICE C;  3EN2 A;  2NN6 H;  3TME A;  2OEO A;  1QWY A;  3NWS A;  4JI8 Q;  1PVO A;  1PFN A;  2G9H D;  1AE3 A;  2F0M A;  2X6L A;  3M4Q A;  2B3G A;  3H6M A;  2YYZ A;  1PRT B;  4OIK A;  1T5E A;  5DNF A;  1TS3 A;  2DN8 A;  3O13 A;  4JPB W;  4JI3 Q;  1A3U A;  3CCU A;  4RH6 A;  2F0J A;  2D62 A;  2O2L D;  1TWG H;  2A8V A;  2SNS A;  5C5L A;  1Q7Y C;  1YIT A;  2GVB A;  2L9H A;  3NWT A;  1PYW D;  4DGZ A;  3I4N B;  3CMA A;  3EQL C;  3I4M H;  4DAV A;  1U4M A;  5M3M B;  5E4W C;  1XTD A;  1B44 D;  3A8K E;  4DV7 L;  2D2C C;  4ZK9 B;  2BOS A;  1FNU A;  2VQE L;  4C56 C;  1X3E A;  1T9H A;  1Q12 A;  1I3Q B;  1QZH A;  1C4Q A;  2F0L A;  5DEH A;  2JA8 G;  1OXT A;  1E24 A;  1SE3 A;  1HNX Q;  1X65 A;  1Y1W G;  1DD2 A;  1LTR D;  1DYQ A;  4PG3 A;  3OIP A;  1TQO A;  1PZJ D;  1JR0 D;  1TII D;  1V8Q A;  2KBN A;  1STN A;  3G6E A;  3CPF A;  2AHO B;  4HCE A;  4KMU C;  3STB C;  4POF A;  5JJK A;  1ASY A;  1HPC A;  1GKH A;  4ULL A;  3J81 i;  2R92 G;  1V1O A;  1WYD A;  2R92 H;  3V2T A;  4GNX A;  1YI2 A;  3FKI B;  4KJO A;  1NUC A;  4P73 A;  1WCM B;  1XMQ L;  2BH8 A;  2A6E D;  3S17 H;  5ELF A;  3S1Q B;  4PMW A;  4H02 A;  4A3E B;  5C3E B;  1SR3 A;  3QIA A;  3VYT A;  2VQF Q;  1QIL A;  1Q3L A;  1CA6 A;  3EIV A;  1QE6 A;  4KLK A;  4A3I H;  2OWO A;  1F9Q A;  4A3B B;  4RGO S;  3J7A V;  3PSI A;  3GTM H;  3S1M B;  5KIX A;  4LF9 Q;  4IPC A;  5E3F A;  1Z9F A;  3HOV G;  1M8A A;  3GD7 A;  3HOV H;  3Q0A A;  1G91 A;  3NQT A;  3J7Z C;  5TSS A;  5K5P A;  3W5O A;  3DWQ A;  1PZI D;  5EKI A;  2R7Z H;  1X56 A;  3DEP A;  4OIJ A;  5LMN W;  2HUG A;  4ME3 A;  2ZXR A;  2HHH Q;  4F87 A;  1BUV T;  2JA6 B;  3GTG H;  1A6X A;  2OCE A;  2FFK B;  2QA4 A;  2YV5 A;  3T1H Q;  4DR7 L;  1VQG A;  4QUF A;  2V1C C;  4CJ2 C;  1O78 A;  1H9R A;  4XT1 B;  4R4O A;  2RDH A;  5G3L D;  4GOP C;  3S1R H;  1OXX K;  3TZD A;  3J80 E;  3TEH B;  1K3R A;  1PTO H;  3FDT A;  1GO3 E;  3I55 A;  3MC0 B;  2AQ3 B;  2CQO A;  3J80 c;  2WV6 D;  3GTM B;  3F8T A;  3KJP A;  2AUK A;  4OEL B;  2EPB A;  2D0P A;  4JOI A;  5ELD A;  2JEA I;  3GP7 A;  1YVC A;  3IKJ A;  1SND A;  4X3U A;  1KRT A;  1TS2 A;  3OMG A;  2F0U A;  2NVX H;  4CJ0 B;  1LT3 D;  3I70 A;  2HQL A;  4IJL A;  2JA5 G;  2OQ0 A;  4A3K G;  3AYH B;  4IPD A;  2XRQ D;  4CJ1 B;  2XRS D;  1OXV A;  1GD7 A;  4DV5 Q;  1TWC B;  1NSN S;  3VYR A;  3VA7 A;  5IIF A;  3PO2 B;  4KKU A;  1JE4 A;  1UE7 A;  5BN3 A;  2EVB A;  1I50 H;  4IPH A;  4YCU A;  3OSO A;  3RZO B;  2E76 C;  1A63 A;  1PRT F;  3OTO L;  5LMN L;  1J8I A;  4B9W A;  1DOL A;  2A5H A;  1PH5 A;  4LF9 L;  1HJP A;  4X65 L;  4L63 B;  2JA8 H;  4B3S L;  5D3I B;  4J6H A;  5M5Y B;  3GO5 A;  2UXD Q;  4RKB A;  4A3F H;  3C2P A;  1Q82 C;  2HDM A;  3TP6 A;  1SE4 A;  2EY5 A;  1GUO A;  2A68 C;  1AW7 A;  1HUM A;  4JI2 Q;  3BS1 A;  2R7Z G;  1RDP D;  4MHE A;  1G2T A;  3FPU B;  3U4V A;  4A93 G;  3U58 A;  3RLN A;  2VUM B;  1C0A A;  4C2M B;  1R9T H;  1CUK A;  4C3J B;  3J81 j;  4FDB A;  2ZM6 Q;  1EWC A;  5IGB A;  1CKN B;  1ENC A;  2UXD L;  5IWA Q;  2NN6 G;  3HKZ E;  4ODG A;  3STB D;  3BYY B;  1ZYR D;  4DV3 Q;  1RTO A;  3G71 A;  1JT8 A;  1BCP D;  4GLV B;  3PV0 A;  5IT9 L;  4JI4 L;  1TVX A;  5I9P A;  3K58 A;  4JI5 Q;  1UEB A;  4QGU A;  1WTW A;  1SSO A;  4A3F B;  3T13 A;  2ENB A;  3PIP 3;  5KYI A;  1WTR A;  3U50 C;  5FK9 C;  4JOI C;  2ZXP A;  3CF5 A;  1B9M A;  1EQR A;  4H44 C;  1VQP A;  1JWS D;  1IBM Q;  3KLW A;  2ZXO A;  1QOH A;  3TRE A;  3ZYY X;  1N32 L;  3TQY A;  4DK3 C;  4A3C G;  1XWE A;  3S16 B;  2F0P A;  4JI5 L;  2UUB L;  2M00 A;  3X3M A;  1I6H H;  1D5X C;  3CCV A;  3NUC A;  1WCM H;  4QJF A;  1A3V A;  3ND8 A;  5HGT A;  4WRD A;  1YJ9 A;  2IWH A;  4EQP A;  1VS0 A;  3MFY A;  4HJA A;  2CW0 D;  4H0L C;  2F0T A;  1MJC A;  1F9P A;  3QR8 A;  2UUA Q;  1O7I A;  1GHJ A;  2E5L L;  3U9O A;  2RHS B;  1NCV A;  1U0L A;  3HGB A;  4OO1 H;  2A69 C;  1HNW L;  3VR4 A;  4PMB A;  5FO7 B;  4L5S A;  4PMC A;  4LF4 Q;  4YWL A;  1Y8N B;  5IP7 H;  4HSV A;  2F0V A;  5IP7 G;  3GTP B;  4DV2 Q;  1I4G A;  1IW7 C;  5E7N A;  2UXB L;  1TXY A;  5J1Z A;  1ZEQ X;  2B2W A;  4NMZ A;  1KIX A;  5DLQ E;  1CHP D;  3I73 A;  3KLS A;  1VQ8 A;  3K8A A;  4K6L A;  1A0I A;  2A68 D;  1K83 B;  3MXG A;  3D4W A;  4EVO A;  1HXY D;  1NMF A;  4DV0 L;  4JI7 Q;  1IZ6 A;  5C4H A;  4NPS A;  3D4R A;  4GOP A;  1JJ2 A;  1QVF A;  1XMO L;  4DPG A;  2HDL A;  2A6E C;  3A7L A;  1PTO F;  1GHK A;  4E6I A;  1C9O A;  3J81 E;  1Y8P B;  1QG7 A;  5C44 G;  3S2H H;  1MGS A;  3K5L A;  2P5Z X;  4ABN A;  2Q2T A;  5IOD A;  1G51 A;  2SDF A;  1ET9 A;  4UAI A;  4A93 B;  1B7Y B;  4IJH A;  4IFD G;  1PRT C;  1XTC D;  3A8I E;  5J39 A;  4IFD H;  4BY1 B;  1C7Y A;  2EYM A;  3A74 A;  1Y69 U;  1QJO A;  4CKE A;  4HR7 B;  4O0A A;  4JI7 L;  2F0S A;  4ZRZ A;  3J7A 5;  4IUN A;  1BO0 A;  2VS1 A;  4Z9C B;  3K57 A;  1KNA A;  4DR1 Q;  1T5X D;  4H13 C;  1PH8 A;  1LTL A;  4LFC Q;  1YHA A;  4NXM L;  2NYZ D;  1OXU A;  1VCI A;  2PW5 A;  3WOF A;  1STG A;  4QUC A;  1EEF D;  4YWK A;  1B53 A;  4JBK A;  1XMQ Q;  2E8G A;  3GTQ B;  3NP8 A;  1K3B C;  2F0K A;  3ICE A;  1XYI A;  3CPW A;  4O1N A;  4POG A;  2PZW A;  4ZUI A;  2EQS A;  2L15 A;  1IL2 A;  3JAM c;  3EFX D;  5NUC A;  4DNI A;  1EYD A;  1QNK A;  4B3M L;  5IE8 A;  4WFN 3;  1NE3 A;  3M7G A;  1S5E D;  5C0X I;  4X6A H;  2BE5 C;  5IT9 c;  5C4X H;  4G57 A;  2JA8 B;  1BDO A;  1DCZ A;  4K8I A;  5EJW A;  5DM6 3;  4OEM B;  3E5S A;  3L2P A;  4GNX B;  1PFB A;  2K5N A;  4IQZ A;  5EQ0 A;  1WTP A;  5CGK A;  1NAP A;  4KJN A;  1RJT A;  2ZTC A;  4BBR G;  3H94 A;  4GLA C;  4X3T A;  5AJ3 Q;  1EY4 A;  4CDC C;  1JOQ A;  3TP8 A;  4JBW A;  4DAY B;  2CHB D;  1I3Q H;  4KD4 A;  1YHB A;  4A3K B;  4A3D H;  5E4X A;  3M4Y A;  2R7Z B;  4LF7 Q;  1Z7T A;  4F88 A;  3GTQ H;  1K73 C;  4FP5 D;  3MEF A;  4PZ8 A;  4HIK A;  2JA6 H;  3GTO H;  3I91 A;  3ONA B;  3GTG B;  1OXS C;  2JP1 A;  1AZQ A;  5IGD A;  1G29 1;  3J81 L;  3AEV A;  3S24 A;  1KDB A;  4FVM A;  3GTK H;  2LSS A;  3FMC A;  4JBJ A;  5CMD A;  1B9N A;  3BZK A;  3WOE A;  4DN4 M;  3BYT B;  1WI5 A;  2KEN A;  2PQA A;  3HOY G;  2H4O A;  4OO1 G;  2Y0S G;  1JJG A;  3VYU A;  5KNB A;  4YY3 L;  4C3J H;  2B8F A;  2NZ1 D;  1VQ9 A;  2K5D A;  1UNS A;  3TP5 A;  4JYA Q;  2TSS A;  3W2D A;  1N32 Q;  5EKL A;  1CI3 M;  1VQC A;  1HR0 L;  1JJC B;  5EAY A;  1EFW A;  3PO3 B;  3I2Z A;  4BY7 G;  1JIC A;  3G6J B;  5I2Y A;  1B2T A;  2EJF C;  4BBR B;  1YJW A;  1XNR L;  1ZYR C;  4XYO A;  1VQB A;  2WP8 J;  2CVR A;  1VMP A;  2E2I H;  4FNF A;  1H9J A;  1TWF B;  3A54 A;  1SFO H;  5C3W A;  2F3V A;  3HOX G;  3K6O A;  3HOX H;  5BN5 A;  4RHS A;  1SMX A;  4GN4 B;  2EY2 A;  1FJG Q;  1GXD C;  4H7B A;  2YU9 H;  2RVL A;  3PGZ A;  1VQ7 A;  3DUZ A;  4MNO A;  4DV5 L;  2ZM6 L;  1YIJ A;  2NB0 A;  4N9P A;  2PI2 E;  5J22 A;  3HOW B;  4XT3 B;  4P71 A;  2ATW A;  1WOC A;  1WCM G;  2Q2U A;  4GKJ Q;  5JEA J;  3S1N H;  5DM7 3;  1I4Q A;  4IFD I;  1ZKO A;  4QIW B;  3UI2 A;  3CCM A;  1QNU A;  4G7Z C;  2NVX B;  3E6Z X;  5AJ3 L;  5FLX L;  1J5E L;  2WB1 G;  4WJ4 A;  4L5Q A;  4KV6 A;  1EFI D;  2K5V A;  4BXX H;  1B1Z A;  1QVC A;  2F0N A;  1PFS A;  3TSS A;  1VQL A;  1PH9 A;  5M5W H;  1JMC A;  1GJX A;  1MIU A;  2VQF L;  2EYJ A;  5M3F G;  4HAE A;  4DUY L;  2RF4 A;  3CCL A;  1Q8K A;  3CRK C;  1F9R A;  2BA1 A;  1WTH A;  3K0X A;  4G7O C;  4DXG A;  1CSQ A;  4KY5 A;  5KRU A;  2VW9 A;  4B9X A;  4PNY A;  4QL5 A;  2F4V Q;  2NVQ B;  1CHQ D;  4A3J B;  5A2Q L;  4LFC L;  1LTT D;  2EJG C;  3ULJ A;  2B2Y C;  3FEW X;  1IKL A;  3H0G G;  1ASZ A;  1PTO D;  4HSP A;  3GV3 A;  1X3G A;  3PIO 3;  1I6H B;  2KVM A;  1PHJ A;  1TWH B;  1QZG A;  4N8F A;  5K36 H;  2EYO A;  3I7F A;  4BXX G;  1FNW A;  2Y0S E;  1KC8 C;  3JAM E;  4LF5 Q;  1IXR A;  2XWB B;  3U9S A;  2K5H A;  1B4O A;  3U4Z A;  5I6W A;  3IFT A;  1HZA A;  2DJG C;  1VQD A;  2M9V A;  3NBH B;  2R7D A;  4ID6 A;  1IBK Q;  2B39 A;  1VMC A;  4A3M B;  4LF7 L;  5D65 A;  3FPP A;  4CKB A;  1DXM A;  5CC4 A;  4O2D A;  5ELE A;  1FVI A;  3LGJ A;  1HZB A;  1LTA D;  3SDZ A;  3GTL B;  1L1O C;  4MN3 A;  5C4X B;  4DAY A;  3QJY A;  1S5C D;  3G4S A;  4IFD J;  1I4H A;  1Y1V G;  2KCN A;  3ERQ A;  2WAQ E;  3KDF A;  1O7L A;  3T16 A;  1D1K A;  4J8Q A;  5CBA E;  4EGV A;  1HTP A;  1YJN A;  2HD3 A;  3K0Y A;  1YNN C;  5GRO A;  3NTK A;  4IAL A;  1M90 C;  1PFM A;  2A73 B;  4B3R Q;  1SBB B;  1SYC A;  2B63 G;  2B2V A;  1ESF A;  4UY8 C;  2L55 A;  3H0G B;  1ET6 A;  3KUP A;  1HRJ A;  3L9A X;  3P75 A;  4LFB L;  4DNR B;  3OMC A;  4RHR A;  1F2Z A;  1VQ4 A;  2E5L Q;  2JYO A;  3ND9 A;  3H91 A;  3CHB D;  5GAD C;  1IBL Q;  2CKZ B;  3CC4 A;  4B3T L;  4U68 A;  2PQA B;  1A8V A;  1HQR D;  4IZ8 A;  3DEO A;  3TZU A;  1QVG A;  1FJG L;  4BY1 H;  2VNU D;  3PMF A;  1HA5 A;  4LMQ D;  4C3I B;  3HOW H;  4JI1 L;  3BDC A;  2ICI A;  2MO1 A;  1A62 A;  2IW3 A;  4CGY B;  5CV8 A;  3H3V I;  4JK1 C;  1XNR Q;  1SE8 A;  4HN7 A;  1U4P A;  2CFM A;  1I6V C;  2WAC A;  1LT6 D;  4IOC A;  3S2D H;  4OL7 A;  5M3F H;  3D6C A;  3A5Z B;  5ELB A;  3K5M A;  1IYV A;  1N34 L;  4GN3 B;  4DR5 Q;  1JOO A;  2QF7 A;  1EYA A;  5LL6 X;  5IGF A;  2O5I C;  2QGQ A;  4JCV E;  4J1M A;  2EOT A;  2JA7 G;  4K0K L;  4F7X A;  2OT2 A;  1K28 A;  2GN5 A;  3OIQ A;  1W2B A;  4RWS C;  1QUQ B;  2XIW A;  5L37 A;  3RZD H;  1L1O A;  1PTO B;  4A3B G;  1XPU A;  1D5Z C;  2FJ2 A;  4EQO A;  3R93 A;  1JB7 A;  1PH1 A;  1G6Z A;  3A7A B;  4DV1 Q;  5C44 H;  3RN5 A;  2QDB A;  2SOB A;  4AQY Q;  1PRT D;  5JPM C;  1PH7 A;  5JVG 3;  1Z6H A;  4R8I A;  1YHQ A;  4HJ5 A;  1EWH A;  2F4I A;  4Y7N H;  2X6G A;  2K05 A;  2WKC A;  3OW2 A;  2K32 A;  3I8Z A;  3RR5 A;  3H09 A;  2IX3 A;  4Y52 H;  1BBW A;  4A3I B;  3SGI A;  1U9R A;  4PQX A;  1MBY A;  1U4R A;  4OON A;  3IRB A;  4DV7 Q;  1EWI A;  1PV4 A;  5IYC H;  5KNC A;  1TWH H;  4UP8 A;  4OWW B;  3GTJ B;  3PO2 G;  2KHS A;  3L3O C;  5KND A;  4B3S Q;  3HOV B;  1AFP A;  2X69 A;  4L8J A;  4DU9 A;  3RNU A;  4JVZ A;  2AUJ D;  1H9S B;  1HTL D;  1ICF B;  3MWY W;  4BBS B;  2C9O A;  4KHV A;  3MZ5 A;  4LAA A;  3RZD B;  4WJ3 M;  3FHW A;  2MPM A;  1FYC A;  2QDL A;  2CCZ A;  2KUM A;  1Y1V H;  4AH6 A;  3KBG A;  2K50 A;  1JOR A;  4RFB A;  5E1F A;  1YBY A;  4GS3 A;  2J4X A;  3CCS A;  1YNN D;  1EY7 A;  2PNR C;  1B50 A;  5FO9 B;  4GOP B;  3TRZ A;  4JG2 A;  1AP0 A;  3K80 C;  3TS0 A;  3LWE A;  2VUM H;  2HIX A;  2NUC A;  3M4P A;  5JEA G;  2AQ2 B;  1HQM C;  2E2D C;  4DK0 A;  1SRU A;  2PO4 A;  4HMI A;  1LAC A;  1E1O A;  1STY A;  4QY7 A;  3AFP A;  4RGT A;  1CA5 A;  4LF6 L;  2KCC A;  4YWM A;  1HNZ Q;  2PI2 A;  1WTO A;  5J3B A;  1SFO B;  1E0B A;  4K8J A;  1N36 L;  3EVQ A;  2ZJP A;  2JJQ A;  4RAU C;  4X3S A;  2YU9 B;  1LTS D;  5GQO A;  4OHJ A;  3SR1 A;  3H3V H;  3PUX A;  4DR2 Q;  4BWG B;  3HKZ G;  1RL2 A;  3NXW A;  1RCV D;  2F0G A;  3PF5 A;  3S15 B;  4CKC A;  5H1S E;  1XMO Q;  1PDQ A;  3S1N B;  5GAH C;  4TQU S;  4LNQ A;  2IJ0 A;  4NXN L;  3DM3 A;  1N36 Q;  5FLX c;  3C46 A;  3KLR A;  1JWU D;  2K52 A;  3BZD B;  4RA8 A;  4BA1 I;  1EIF A;  4FXD A;  2E2I B;  2L5T A;  4LJZ C;  1SYF A;  2K6A A;  1W6J A;  3KOJ A;  4XQJ A;  1K0S A;  1X32 A;  2JSO A;  3QWN A;  1UUP A;  3H15 A;  4PZ6 A;  2CH4 A;  2VXW A;  1D2B A;  2BA0 A;  4HJ7 A;  2SEB D;  5JOB A;  2E2J H;  2I46 A;  1N9W A;  1RTN A;  3F2C A;  4KN7 C;  1V1Q A;  5T1G A;  4R4Q A;  1KLG D;  4GN5 A;  2A74 C;  1IBK L;  4LWC A;  2VQE Q;  3I4L A;  3SVM A;  1I94 L;  1F2M A;  1GUG A;  3P1H A;  1LAB A;  1X3P A;  3HP3 A;  1L0Y B;  5F2D A;  1NR2 A;  4DV4 Q;  1EU3 A;  4N9T A;  1PA6 A;  3MTS A;  1II3 A;  2VL6 A;  1BOS A;  3I3C A;  5BR8 L;  4GLX A;  5K36 G;  1YZ6 A;  1E3P A;  1SXT A;  4C3I H;  2J7Z A;  2HQE A;  1CKN A;  5C44 B;  2LKV A;  2K5W A;  1Q1B A;  3CRL C;  3D3R A;  3IL8 A;  5LL6 S;  2K14 A;  4BY1 G;  1JQY D;  3CD6 A;  5C4J B;  3T4A C;  1HFN A;  1E2W A;  4GKK Q;  3S9W A;  1HR0 Q;  5ELN A;  4O42 A;  5G3L F;  2UUC Q;  3LNN A;  2R7F A;  1SEB D;  3SK6 A;  2Z8L A;  3I4O A;  2EYL A;  3SK8 A;  4C3H B;  2PW7 A;  3MXN B;  2RDF A;  4IUR A;  4A3J H;  1GUW A;  4EQ5 A;  1R9T B;  1ILP A;  1VQA A;  4LF6 Q;  5JEA H;  3KK7 A;  3L7Z C;  1FNV A;  3BDL A;  2WB1 E;  5GAG C;  3F2U A;  3C1F A;  3HOZ H;  5EPK A;  1I50 B;  1KD1 C;  1EOT A;  1SRO A;  2E74 C;  1N33 Q;  3A56 A;  2BCO A;  2F0D A;  3QG1 A;  4HCS A;  3WWV A;  1VDZ A;  1MJE A;  2EYP A;  2Z4I A;  1LTG D;  1XPO A;  1HZ9 A;  1AN8 A;  2K01 A;  1HUN A;  2O5J C;  1NNX A;  4YY3 Q;  4XTC S;  1S5B D;  1PXU A;  3ULL A;  1K83 H;  2DY7 A;  2NVY B;  4LUO A;  2RDG A;  3Q6S A;  1KQS A;  1E2Z A;  1V1P B;  5BN4 A;  5BR8 Q;  1X55 A;  3RZO H;  2WFW A;  3MXP A;  2EYF A;  4YHH Q;  2F1M A;  4IUU A;  5CV5 A;  2MNA A;  2HT1 A;  5IOC A;  4A3G G;  5T1I A;  4DAP A;  1KHI A;  5FOB B;  1TWA H;  1AZP A;  4LW1 A;  4JV5 Q;  4A3I G;  1X9N A;  3VR3 A;  4LFB Q;  3PUZ A;  5HY6 A;  3HOU H;  4JI6 Q;  1WD1 A;  3HOU G;  3EBE A;  1BNZ A;  2ES2 A;  1QB5 D;  3FRP B;  4IUP A;  4A3F G;  4FXK C;  2KA7 A;  2JEB I;  1LYL A;  2NTS A;  4I7Z C;  4KI0 A;  5JAV A;  1C8C A;  3VR2 A;  1XNQ L;  1VQN A;  1VQF A;  2KCM A;  2SNM A;  1EU4 A;  1I4P A;  2CQA A;  2WIN B;  4F8M A;  1EQT A;  3CCE A;  1PYS B;  3TBI B;  3MVV A;  1NJI C;  2UXC Q;  3M7N A;  1O7Y A;  1EY8 A;  4K5W A;  4X3K A;  2K7V A;  4AYB G;  3KDF B;  4DR6 L;  3KJO A;  2OXP A;  3ITP A;  2B2T A;  3CP0 A;  4FF3 A;  4DV0 Q;  1EYG A;  2K03 A;  1TS4 A;  4OX9 Q;  4BBS G;  3HG9 A;  1ENA A;  4FXG C;  1IYU A;  2KCT A;  2QW7 A;  5IT9 E;  3HOX B;  1H95 A;  1NR4 A;  4XIG S;  2JA7 B;  2AWO A;  1HNX L;  2IHE A;  3E3X A;  1IKM A;  4R4C A;  2JA5 H;  1IL8 A;  4A3K H;  2Z4H A;  4JBM A;  4IOA A;  5JJL A;  4QF4 A;  5C3X A;  4DV6 L;  2XN9 C;  4A3G H;  4BBR H;  2VUM G;  3D31 A;  2VB3 X;  4U67 3;  1SYD A;  3AFQ A;  3FKI H;  3X3N A;  1WTX A;  4MIU A;  3HZX A;  3M3Y H;  4FF4 A;  2H5X A;  1TWF H;  1Q1E A;  1I4R A;  2Z6K A;  3BZC A;  3WDN A;  3T1Y Q;  3KFU A;  1PMR A;  1IHZ A;  2D9U A;  3CKI B;  4CDF C;  3NSW A;  1JOK A;  1F2L A;  3A55 A;  2F0W A;  2MJ8 A;  3M9B A;  2HCI A;  4HID A;  4DR1 L;  1STA A;  5FO8 B;  4DR4 Q;  3V05 A;  3DHQ A;  3I90 A;  1KAA A;  1LM0 A;  2WAQ G;  3ERS X;  3CCR A;  3D4D A;  2JQO A;  1WTV A;  4ZKC B;  1KTK A;  3H3V C;  3DWA A;  1F9S A;  2YTV A;  1CZW A;  4Y7N B;  2KEE A;  2KQ3 A;  4P72 A;  4ZKB B;  1M1K C;  2ALY B;  1UEA B;  1I5F A;  2KED A;  3T56 B;  2B2V C;  2MQH A;  5IYD H;  5EGT A;  3MAQ A;  2L12 A;  2EXZ A;  3NK9 A;  2QIL A;  3PUV A;  2UU9 Q;  1BR9 A;  1Q90 A;  4JYA L;  4C1N K;  3K59 A;  4MZ9 A;  1BCP C;  4A3L H;  1DOK A;  1A2T A;  2Q8T A;  1JC7 A;  4LUZ A;  4R4I A;  1V9P A;  1YNX A;  5C4J H;  3PUW A;  4BBS H;  2I5H A;  3F1Z A;  2N55 A;  1HNZ L;  5M5X B;  1PYB A;  2B2T C;  1BCP F;  1CSP A;  4KKS A;  4A76 A;  3BVM A;  2L0C A;  3HRZ C;  1Y1W H;  1BF4 A;  1GUN A;  1Q86 C;  4J15 A;  1EY6 A;  1TY2 A;  3MXU A;  4DK1 A;  3GTK B;  5JVH 3;  3K7A H;  1IBM L;  5IYB G;  2FMC A;  3D0F A;  1VQM A;  2IPK D;  4HMJ A;  1A3T A;  3K81 C;  3F2B A;  4YCV A;  2MFI A;  1I4X A;  2TMP A;  3RD4 A;  4ILW A;  3JC6 6;  5CBE E;  3S16 H;  3D8G A;  2ID0 A;  4C3H G;  2N78 A;  4C3I G;  5IYD G;  1AEX A;  5M9O A;  1EZ8 A;  2H1E A;  1MD2 D;  3LWU A;  1JB3 A;  4CBV A;  4QCL A;  3D6W A;  5M5W B;  2EDG A;  3T53 B;  4MTN A;  2OF1 A;  2R61 A;  2MUY A;  4Q0F A;  2EE1 A;  3J80 i;  2N49 A;  4HIO A;  4BS9 A;  1ONL A;  1Y1W B;  2F0F A;  4FYD A;  4L6T B;  4OXP A;  4RKL A;  4LF4 L;  1KNE A;  4XQN A;  3S17 B;  4JI6 L;  1HNW Q;  4P74 A;  1O7Z A;  1SNP A;  3S15 H;  1QUQ A;  4HTH A;  4DXF A;  4C1N I;  5LHY 1;  4X64 L;  4JI2 L;  2PMZ B;  3KBX A;  1TS5 A;  1NY4 A;  1EL0 A;  1STE A;  2PZU A;  3T51 B;  1XJV A;  2EYH A;  1WD0 A;  3K5O A;  3QOL A;  1DZ1 A;  4NB3 A;  2A19 A;  1K8A C;  2F52 A;  1UE1 A;  2JA9 A;  4DR3 Q;  2F0I A;  1NTG A;  4X62 L;  4QIW E;  4ALP A;  3RN2 A;  3NTH A;  4RCO A;  2E75 C;  4TSS A;  4OO1 I;  3J80 L;  1MSH A;  1X3F A;  4C3H H;  3PO3 H;  1XXG A;  1EIG A;  1WTQ A;  2GA4 B;  4UHV A;  2F0Q A;  1BKB A;  3H0G H;  1CFM A;  2RCF A;  4DV4 L;  3UDG A;  2F03 A;  2M2L A;  2NN6 I;  3Q8D A;  2R93 G;  5CV6 A;  2R93 H;  1CTM A;  4WOR A;  4P2C B;  1O80 A;  1J6Q A;  4ZUJ A;  2JK8 A;  1CQV A;  4GZY C;  3A5U A;  2VZA A;  5COY A;  3RUZ A;  2IT1 A;  1WVL A;  1TT2 A;  2DY8 A;  3DMU A;  5C3E H;  1KRS A;  3GTL H;  4A93 H;  1XPR A;  4K14 A;  5A35 A;  4OWX B;  1XX8 A;  2BDN A;  3E0E A;  4C3J G;  3W1G A;  1SNQ A;  3ZJY C;  3BDO A;  3EA6 A;  4V0B A;  2Z0S A;  3PIO A;  2ZT9 C;  3HS0 C;  5KGU A;  5LMU Q;  2AKW B;  1VQO A;  2CWP A;  2JA7 H;  2K04 A;  4MTK A;  2BH2 A;  4IPG A;  2KHJ A;  4IN3 A;  2HCC A;  2FMM A;  2NWG A;  4PV1 C;  2NVQ H;  2EZV A;  5CV9 A;  4BY7 H;  4DA2 A;  4K0K Q;  4A3L G;  3R8B A;  2DNE A;  2Z1C A;  1YNJ D;  1B3A A;  1IYJ B;  3OWF A;  4DR6 Q;  4XQQ A;  1S5F D;  3UDF A;  5C4Z A;  1M4V A;  1TWC H;  3HEJ A;  2B8G A;  4KHZ A;  2JE6 I;  4UP7 A;  3TS2 A;  1VQE A;  1LLR D;  1SDF A;  3AB9 A;  3MFG A;  4QMG A;  2XNA C;  4KD3 A;  2LS0 1;  4RGN A;  2LFN A;  5C3E G;  5M3M G;  4LFA L;  4KY7 A;  3GTP H;  2CH4 W;  3BVZ A;  2MO0 A;  1Y8O B;  4UP9 A;  3SK4 A;  3NBH A;  4IUT A;  4A3D G;  4CDE C;  2WAQ B;  3CW2 C;  1L2F A;  4KY6 A;  4XDX A;  4JW0 A;  1WJJ A;  3TP7 A;  2NZO A;  3BJU A;  2F0E A;  2UU9 L;  1HCZ A;  1IBL L;  4ZYS A;  1L0W A;  3G7L A;  2GVA A;  3IFD A;  5M5X H;  2B2Y A;  1FD7 D;  3BVG A;  4HED A;  1U4L A;  4LUV A;  1P16 A;  3RMH A;  1PH6 A;  1BQQ T;  3OOC A;  1EUJ A;  2A69 D;  3NEL A;  3S1Q H;  2CWA A;  3HOU B;  2VY3 A;  2C5C A;  4CDD C;  2PPB C;  4HIM A;  2LXJ A;  2PYK A;  3JAM L;  1G8Z D;  2B2U A;  2KEC A;  2XTI A;  3VDY A;  4LFA Q;  5C6A A;  4DV2 L;  3VYS A;  1R4P B;  1Y14 B;  5DAU A;  1C48 A;  2ASB A;  1SYG A;  4L5R C;  4X64 Q;  3PO3 G;  3I4N G;  1N33 L;  4GKJ L;  2NTT A;  5CYU A;  1LT5 D;  1ZXT A;  2UXC L;  2NBF A;  5CR3 A;  1B3Q A;  2JA6 G;  2MHV A;  1SAP A;  1Z47 A;  4DV6 Q;  3CU7 A;  3A8J E;  2IHF A;  3OW7 A;  3BU2 A;  4JI1 Q;  1DOM A;  3UDI A;  3CME A;  4JI4 Q;  1E2V A;  4DAM A;  3K7A B;  4X65 Q;  1V43 A;  1KDA A;  2KJX A;  5FLX E;  2CW0 C;  3W3A A;  1PH4 A;  2RBM A;  5I6Y A;  1UWV A;  1Y1V B;  2F3I A;  4YCW A;  5LMU L;  2ZJR A;  5IP9 H;  1G2S A;  3ULP A;  1PH3 A;  5IWA L;  1D1I A;  4PZ7 A;  3J81 c;  1GM5 A;  1AE2 A;  1BCP B;  2XGT A;  4Q5V A;  1SNO A;  3NTI A;  2A6H C;  2XVS A;  3I72 A;  3PQI A;  2PMZ E;  1PZK D;  2I5M X;  3NEM A;  4GNX C;  3CQZ H;  2B63 B;  4FF2 A;  3SE0 A;  3HKZ B;  3S14 B;  5EBC A;  3URY A;  4DV1 L;  4JC0 A;  2XWJ B;  3DM1 A;  1ICW A;  3PCO B;  4UPA A;  1SNM A;  1XNQ Q;  2K28 A;  4FF1 A;  1MSG A;  2ZTD A;  2EJM A;  4LK1 C;  2V4D A;  1NBW A;  1P8L A;  3DXJ C;  2R3Z A;  3KF6 B;  3SHL A;  4CHT B;  2E2H B;  1EY0 A;  2UUB Q;  2N8N A;  1TR5 A;  2YTY A;  3NHH A;  3JAM i;  1PLF A;  3GV6 A;  3M4O H;  3GTJ H;  2WB1 B;  3C1E A;  3CCJ A;  1KXL A;  3KYH C;  1E22 A;  2RCN A;  1EY9 A;  5COR A;  3MXN A;  4G4K A;  3PUY A;  3I56 A;  1K0R A;  4AQY L;  3KF8 A;  3S14 H;  3S2D B;  3S1R B;  2LY7 A;  4I7A A;  2EIF A;  1B8A A;  1HA6 A;  4S3S A;  1EOV A;  4DR4 L;  4M8A A;  1VF7 A;  5JJZ A;  2A6H D;  2Z9H A;  4KHP Q;  4K2K A;  3M85 A;  3N52 A;  4FO2 A;  1X54 A;  3OWE B;  1V1P A;  1LO5 D;  2FXQ A;  1A2U A;  3G48 A;  4NP5 A;  3E0J A;  1S72 A;  2F4V L;  1K8M A;  4YIJ A;  2OTJ A;  1RHP A;  3S2H B;  3HOY B;  4DUZ L;  5EBD A;  1ROD A;  3Q23 A;  3HOZ B;  1EYC A;  1VQ5 A;  4ZAI A;  4GKK L;  2G9D A;  4DUZ Q;  4DR2 L;  5I9O A;  5C0X H;  1LUZ A;  3E9H A;  4ZCK A;  3CC2 A;  5IGG A;  2QKI C;  3MEH A;  2K4K A;  2KHI A;  4K5V A;  4AYB E;  1SJE D;  5EKK A;  2NZH A;  3L0O A;  3CAM A;  4X66 L;  5ELC A;  5JJI A;  3SEB A;  2MP1 A;  3CCQ A;  3AU7 A;  2UXB Q;  4X66 Q;  3OTO Q;  2FHT A;  3KF8 B;  4DK6 C;  3DLL A;  1D8L A;  1K8O A;  3AQQ A;  4HJ9 A;  4TRD A;  5ELO A;  4B3T Q;  4V19 0;  4NW2 A;  1K8G A;  5KEE A;  3HOY H;  3Q22 A;  1KAW A;  1YEZ A;  3OYY A;  1SMY D;  3CXC A;  4G7H C;  4K5X A;  1DGS A;  3FP9 A;  4LF8 Q;  1D5M C;  2K75 A;  1EQV A;  1LTB D;  3KF6 A;  2I5L X;  3C3L A;  3OPO A;  3Q24 A;  5C0X G;  2JN4 A;  4IUV A;  2EY1 A;  1JE5 A;  5D3D A;  1UE5 A;  1LV9 A;  4HJ8 A;  3GQB A;  2QCP X;  1S4Z A;  2DUD A;  3UDX A;  3MA2 B;  2PCF B;  4ZQ3 A;  5EPJ A;  3CQZ B;  2B63 H;  4UDU C;  4JI3 L;  4LF8 L;  4BY7 B;  5C4X G;  3T1H L;  1TU2 B;  4DR7 Q;  4RG1 A;  2AQ1 B;  3LX0 A;  1VQH A;  4JV5 L;  3HKS A;  4JI8 L;  3R2I A;  4BA2 I;  4A3C H;  2ZTE A;  1EIH A;  2L1B A;  1IW7 D;  4DKA C;  2HIV A;  2QEX A;  4OGQ C;  4AIM A;  2K33 A;  1UAP A;  4YHH L;  4KKT A;  1G6P A;  1VF5 C;  3EJI A;  2MGS A;  3I4N H;  1MKH A;  4A3D B;  4R1J A;  2KOL A;  1QCB D;  3B6Y A;  4DR3 L;  1EEI D;  1SLJ A;  1Q8I A;  4APV A;  3M4O B;  2DGY A;  2R92 B;  3HOW G;  5GAE C;  2O4X A;  2IX1 A;  1DON A;  3HFZ B;  4KK7 A;  1RIP A;  1J5E Q;  3AMU A;  1FGU A;  2NVT H;  4A3E G;  1GOZ A;  2EY6 A;  2PNH A;  3OHX C;  4K2L A;  3K5N A;  3UE0 A;  5FJ8 H;  1SMY C;  5FJ8 G;  3CC7 A;  2Q2H A;  2K5Q A;  4DUY Q;  1EIY B;  4XXE A;  3KLS X;  1ENF A;  3TN2 A;  1CT1 D;  3W1B A;  4M1U B;  2PZT A;  1YNJ C;  5FKA C;  1HHV A;  2RQX A;  5ISR A;  1X3Q A;  3NE5 B;  4P75 A;  3V96 A;  2J0T D;  4X62 Q;  3RLO A;  2IL8 A;  1AH9 A;  4A3G B;  1S40 A;  4NKL A;  4L5T A;  1TKW B;  4N8X 1;  3P7J A;  3QO2 A;  5D14 A;  1N34 Q;  4R9W A;  3ER0 A;  4A4I A;  1L1O B;  2QEJ C;  4AYB B;  1KL9 A;  1JWM D;  2NVY H;  1R4Q B;  2I07 B;  2RHQ B;  4RMF A;  1LTI D;  3ERO A;  1A15 A;  5M3M H;  4KN4 C;  2UUA L;  3I4M G;  4B3R L;  4JI0 Q;  2A1A A;  3MHB A;  3VR6 A;  4A75 A;  1SJH D;  3GDE A;  1GVP A;  1X6O A;  1W3S A;  1FGB D;  5IP9 G;  4XYQ A;  1J9O A;  1W6K A;  3PIP A;  1JCK B;  2OTL A;  1Q81 C;  2OQK A;  1STH A;  5LMN Q;  1BBX C;  4TKO B;  1E1T A;  1H9S A;  1ML0 D;  1ILQ A;  4DNT B;  1SN8 A;  1F77 A;  2WII B;  4RCN A;  5M5Y H;  1I94 Q;  5FLM H;  3NBI A;  2Q2I A;  2XSC A;  5HUR A;  4EQN A;  1D7Q A;  2RSO A;  4NDX A;  2PQE A;  2HHH L;  1HH2 P;  2F0O A;  1NMG A;  4IUQ A;  4I65 A;  1MHW C;  1VQK A;  2RKS A;  3RLF A;  2B2W C;  5I4D A;  5AFW A;  5CV7 A;  2L11 A;  1SNC A;  1TWA B;  3SXH A;  3E9I A;  1HZC A;  1FR3 A;  2FIN B;  2K1B A;  1GUT A;  4DV3 L;  1Q46 A;  1H9K A;  2R6G A;  1D6E C;  2DNC A;  4NXN Q;  2LMC B;  2B2U C;  4B3M Q;  1F2Y A;  1EY5 A;  5EPL A;  2BDO A;  2E2H H;  3I4M B;  1UE6 A;  1S3O A;  2L4N A;  3N6R A;  2JXM B;  3K7U C;  1ESR A;  2ZJQ A;  1U5K A;  3NPP A;  1VQ6 A;  1N8R C;  3GTO B;  2RA4 A;  5JPN C;  2D5D A;  2LXK A;  3QB3 A;  5CV4 A;  3VR5 A;  4TVA B;  1PTO C;  1BBU A;  1S5D D;  1RKN A;  2N3S A;  4A3E H;  4NXM Q;  2YTX A;  5IGC A;  2Q8I B;  2B29 A;  4A3J G;  1TY0 A;  5IYC G;  2Y0S B;  4KHP L;  2RSN A;  4R8N A;  3PF4 A;  3FKI G;  4DF7 A;  2Z6B A;  3S1M H;  1BXT A;  4WJW A;  5IGE A;  1FL0 A;  2IX0 A;  3NQI A;  4QQB X;  3SK5 A;  5C5M A;  3J7Y W;  1MI2 A; 
#chains in the Genus database with same CATH homology
 3T1Y L;  2E2J H;  1WJJ A;  1N9W A;  3UE1 A;  2NZO A;  3BJU A;  4C2M H;  4YWK A;  3F2C A;  2UU9 L;  4JBK A;  1XMQ Q;  1V1Q A;  1IBL L;  4A3B H;  2AMC B;  1L0W A;  2E8G A;  2GVA A;  4R4Q A;  5M5X H;  4GN5 A;  3ICE A;  1EQQ A;  3CPW A;  1IBK L;  4LWC A;  4LUV A;  4POG A;  1P16 A;  2VQE Q;  1PH6 A;  1E7Z A;  2EQS A;  2L15 A;  1IL2 A;  3JAM c;  1I94 L;  3F2D A;  4DNI A;  1EUJ A;  4B3M L;  4LF5 L;  3NEL A;  4DV4 Q;  3S1Q H;  5IE8 A;  2CWA A;  1NE3 A;  5C0X I;  5HGQ A;  4X6A H;  1PA6 A;  2VY3 A;  2VL6 A;  5IT9 c;  5C4X H;  5BR8 L;  4GLX A;  1PH2 A;  1YZ6 A;  4R4T A;  4HIM A;  2I0Q A;  1E3P A;  5K36 G;  2D0O A;  1B70 B;  4C3I H;  1WFQ A;  4OWW B;  2LXJ A;  1CKM A;  5C0X J;  3L2P A;  4GNX B;  1CKN A;  3HOZ G;  2K5N A;  5IY0 A;  1BVS A;  2XTI A;  1Q1B A;  3VDY A;  1VQI A;  2ZTC A;  4LFA Q;  4DV2 L;  4BBR G;  1K9M C;  4EX5 A;  3PO2 H;  1Y14 B;  4GLA C;  1VQJ A;  2AWN A;  2Z6K C;  5AJ3 Q;  2ASB A;  2K14 A;  4L5R C;  4JBW A;  4BY1 G;  4X64 Q;  3PO3 G;  4DAY B;  3CD6 A;  1I3Q H;  3NEN A;  1N33 L;  1YHB A;  3I4N G;  4A3D H;  4GKJ L;  4GKK Q;  4LF7 Q;  2C35 B;  2UXC L;  3GTQ H;  1HR0 Q;  1K73 C;  3MEF A;  4PZ8 A;  5ELN A;  4A3M G;  3A0J A;  1Z47 A;  2JA6 G;  4IO9 A;  4HIK A;  4DV6 Q;  4A3M H;  2UUC Q;  2JA6 H;  5FLM G;  3GTO H;  1OXS C;  2R7F A;  2IHF A;  3BU2 A;  1CKO A;  1G29 1;  4JI1 Q;  3I4O A;  3AEV A;  3UDI A;  3S24 A;  3CME A;  4JI4 Q;  3GTK H;  4DAM A;  4X65 Q;  1V43 A;  2LSS A;  3MXN B;  4OWT B;  5IYB H;  4JBJ A;  4A3J H;  3BZK A;  4OO1 G;  1PH4 A;  3HOY G;  1WI5 A;  2KEN A;  2PQA A;  4EQ5 A;  1UWV A;  2Y0S G;  2F3I A;  1VQA A;  4YCW A;  1JJG A;  5LMU L;  2ZJR A;  4LF6 Q;  5IP9 H;  4YY3 L;  3L7Z C;  3ULP A;  4C3J H;  1PH3 A;  5IWA L;  1OTC A;  4OX9 L;  1VQ9 A;  4PZ7 A;  3J81 c;  1GM5 A;  1HR0 W;  2WB1 E;  2EXD A;  1AE2 A;  2XGT A;  5GAG C;  4JYA Q;  4DR5 L;  2UUC L;  2IY5 B;  4JI0 L;  1N32 Q;  3EN2 A;  3HOZ H;  1VQC A;  1HR0 L;  4JI8 Q;  1JJC B;  5EAY A;  1KD1 C;  1SRO A;  1EFW A;  1PVO A;  2PMZ E;  1AE3 A;  2I5M X;  3M4Q A;  2B3G A;  3NEM A;  3I2Z A;  4GNX C;  3CQZ H;  1N33 Q;  4BY7 G;  2YYZ A;  3WWV A;  4JI3 Q;  1MJE A;  3CCU A;  1YJW A;  1XNR L;  2D62 A;  1VQB A;  4JC0 A;  1HZ9 A;  4DV1 L;  2WP8 J;  1TWG H;  1XPO A;  2A8V A;  1Q7Y C;  2E2I H;  4YY3 Q;  4XTC S;  3PCO B;  1SFO H;  4UPA A;  1YIT A;  3ULL A;  3HOX G;  2GVB A;  3HOX H;  1K83 H;  1SMX A;  1XNQ Q;  4LUO A;  1KQS A;  4GN4 B;  2ZTD A;  5BR8 Q;  1X55 A;  3RZO H;  1FJG Q;  3CMA A;  2WFW A;  1NBW A;  1P8L A;  3KF6 B;  3I4M H;  2YU9 H;  4YHH Q;  3PGZ A;  1VQ7 A;  1XTD A;  2N8N A;  2UUB Q;  2YTY A;  4MNO A;  2MNA A;  2HT1 A;  4DV7 L;  4DV5 L;  2ZM6 L;  3JAM i;  1YIJ A;  4A3G G;  3M4O H;  2PI2 E;  2VQE L;  1KHI A;  3GTJ H;  4P71 A;  1X3E A;  2ATW A;  1T9H A;  1WOC A;  1TWA H;  3CCJ A;  1KXL A;  1I6H H;  1WCM G;  3KYH C;  2Q2U A;  1E22 A;  4LW1 A;  4JV5 Q;  2RCN A;  4A3I G;  1X9N A;  1Q12 A;  5JEA J;  3S1N H;  4GKJ Q;  4LFB Q;  1QZH A;  4IFD I;  3PUY A;  3PUZ A;  5HY6 A;  3HOU H;  3I56 A;  1K0R A;  4JI6 Q;  3HOU G;  3EBE A;  4AQY L;  3CCM A;  3S14 H;  2JA8 G;  5AJ3 L;  1OXT A;  1J5E L;  2ES2 A;  1E24 A;  2WB1 G;  1HNX Q;  4WJ4 A;  1X65 A;  2EIF A;  4L5Q A;  4A3F G;  1Y1W G;  1B8A A;  2K5V A;  4BXX H;  1EOV A;  2JEB I;  1LYL A;  4KI0 A;  4DR4 L;  4PG3 A;  1QVC A;  2UUB L;  4KHP Q;  2KBN A;  3G6E A;  3M85 A;  1XNQ L;  1PFS A;  1X54 A;  3CPF A;  1VQL A;  1VQN A;  1PH9 A;  2AHO B;  1VQF A;  2KCM A;  5M5W H;  1JMC A;  2FXQ A;  3G48 A;  3STB C;  1S72 A;  1MIU A;  2VQF L;  4POF A;  5M3F G;  4DUY L;  1ASY A;  2F4V L;  1GKH A;  5JJK A;  2OTJ A;  3J81 i;  2RF4 A;  3CCL A;  1Q8K A;  3CCE A;  2R92 G;  1WYD A;  2R92 H;  4DUZ L;  1PYS B;  4GNX A;  1YI2 A;  2UXD Q;  1NJI C;  2UXC Q;  3M7N A;  4P73 A;  2BA1 A;  1VQ5 A;  4GKK L;  3K0X A;  4DUZ Q;  1XMQ L;  2BH8 A;  4AYB G;  4DR2 L;  3S17 H;  3KDF B;  4DR6 L;  1CSQ A;  4PMW A;  1LUZ A;  2VW9 A;  3E9H A;  4H02 A;  4QL5 A;  3KJO A;  1SR3 A;  2F4V Q;  3CC2 A;  2VQF Q;  2K4K A;  2KHI A;  3EIV A;  4AYB E;  4KLK A;  3CP0 A;  4A3I H;  4DV0 Q;  1EYG A;  2NZH A;  3L0O A;  4LFC L;  3CAM A;  2OWO A;  4OX9 Q;  4BBS G;  4X66 L;  3ULJ A;  3H0G G;  3PSI A;  5JJI A;  1ASZ A;  3GTM H;  1X3G A;  2KCT A;  4DR7 L;  3CCQ A;  4LF9 Q;  4IPC A;  1PHJ A;  1Z9F A;  4X66 Q;  3HOV G;  2UXB Q;  1QZG A;  3GD7 A;  3OTO Q;  3HOV H;  1H95 A;  4XIG S;  3KF8 B;  3J7Z C;  2AWO A;  4DK6 C;  3I7F A;  1HNX L;  4BXX G;  2IHE A;  3DLL A;  2Y0S E;  4R4C A;  1D8L A;  3W5O A;  3AQQ A;  1KC8 C;  4LF5 Q;  1IXR A;  4HJ9 A;  2K5H A;  2JA5 H;  4A3K H;  5ELO A;  4JBM A;  2R7Z H;  4IOA A;  1X56 A;  4B3T Q;  5JJL A;  3U4Z A;  1HZA A;  5LMN W;  4DV6 L;  1VQD A;  4ME3 A;  3NBH B;  1K8G A;  4A3G H;  2HHH Q;  2R7D A;  4BBR H;  3D31 A;  2VUM G;  3HOY H;  1IBK Q;  3GTG H;  1KAW A;  1YEZ A;  3AFQ A;  3FKI H;  2OCE A;  4LF7 L;  3OYY A;  3CXC A;  2QA4 A;  4O2D A;  2YV5 A;  3T1H Q;  3M3Y H;  1FVI A;  1HZB A;  1TWF H;  1DGS A;  1Q1E A;  2H5X A;  3BZC A;  2Z6K A;  3LGJ A;  3FP9 A;  3T1Y Q;  4LF8 Q;  1VQG A;  2K75 A;  3KFU A;  3KF6 A;  1L1O C;  2V1C C;  2I5L X;  4R4O A;  5C0X G;  3G4S A;  4GOP C;  3S1R H;  3M9B A;  4IFD J;  1Y1V G;  1OXX K;  3TEH B;  2WAQ E;  3KDF A;  1K3R A;  4HID A;  1JE5 A;  1GO3 E;  3I55 A;  4DR1 L;  1UE5 A;  2CQO A;  3J80 c;  4HJ8 A;  4DR4 Q;  1YJN A;  3F8T A;  5GRO A;  3KJP A;  1LM0 A;  2WAQ G;  2DUD A;  3ERS X;  3CCR A;  1M90 C;  2D0P A;  4JOI A;  2JQO A;  2JEA I;  3UDX A;  1YVC A;  4B3R Q;  2B63 H;  4JI3 L;  4LF8 L;  2B63 G;  5C4X G;  2YTV A;  1KRT A;  4UY8 C;  3T1H L;  4DR7 Q;  4RG1 A;  4LFB L;  4P72 A;  1M1K C;  2ALY B;  2NVX H;  1I5F A;  1VQH A;  4JV5 L;  5IYD H;  3HKS A;  2HQL A;  2MQH A;  4JI8 L;  4IJL A;  1VQ4 A;  2E5L Q;  2OQ0 A;  4A3K G;  2JA5 G;  3AYH B;  4IPD A;  5GAD C;  1OXV A;  1IBL Q;  4BA2 I;  4A3C H;  2ZTE A;  3PUV A;  2CKZ B;  2UU9 Q;  4DKA C;  1GD7 A;  4DV5 Q;  3CC4 A;  4JYA L;  2HIV A;  4B3T L;  2QEX A;  4MZ9 A;  4AIM A;  2PQA B;  4A3L H;  1A8V A;  1UE7 A;  4YHH L;  1G6P A;  1QVG A;  1I50 H;  4IPH A;  4YCU A;  1FJG L;  3I4N H;  4BY1 H;  4LUZ A;  1MKH A;  4R4I A;  1V9P A;  1YNX A;  3OTO L;  5LMN L;  5C4J H;  2VNU D;  1A63 A;  4R1J A;  3PUW A;  4BBS H;  2I5H A;  1PH5 A;  3F1Z A;  4LF9 L;  1HJP A;  4X65 L;  1HNZ L;  2JA8 H;  4B3S L;  3B6Y A;  1PYB A;  4DR3 L;  1SLJ A;  4APV A;  3HOW H;  2DGY A;  1CSP A;  3GO5 A;  4JI1 L;  2MO1 A;  4A76 A;  1A62 A;  5GAE C;  4A3F H;  1Y1W H;  2IX1 A;  3HOW G;  1Q82 C;  1Q86 C;  3HFZ B;  3H3V I;  1RIP A;  1J5E Q;  4J15 A;  1XNR Q;  1FGU A;  1SE8 A;  2NVT H;  2CFM A;  3K7A H;  4JI2 Q;  1IBM L;  2R7Z G;  5IYB G;  3D0F A;  1VQM A;  3U4V A;  4A3E G;  4A93 G;  3U58 A;  4IOC A;  2PNH A;  3RLN A;  3K81 C;  3S2D H;  3F2B A;  1C0A A;  1R9T H;  5M3F H;  4YCV A;  2MFI A;  1CUK A;  3J81 j;  3A5Z B;  3UE0 A;  5FJ8 H;  3JC6 6;  5FJ8 G;  4FDB A;  2ZM6 Q;  4GN3 B;  3CC7 A;  4DR5 Q;  2Q2H A;  1N34 L;  3S16 H;  2ID0 A;  2N78 A;  1CKN B;  5IYD G;  4DUY Q;  2UXD L;  5IWA Q;  2NN6 G;  2QGQ A;  4JCV E;  1EIY B;  2JA7 G;  3HKZ E;  4K0K L;  3STB D;  2GN5 A;  1W2B A;  3W1B A;  4DV3 Q;  1QUQ B;  3G71 A;  1JT8 A;  4MTN A;  3RZD H;  1L1O A;  4A3B G;  4GLV B;  3PV0 A;  4P75 A;  3J80 i;  4X62 Q;  3RLO A;  4JI4 L;  1XPU A;  2N49 A;  4HIO A;  1AH9 A;  4JI5 Q;  1UEB A;  4QGU A;  1S40 A;  1JB7 A;  4L5T A;  1PH1 A;  4DV1 Q;  5C44 H;  1N34 Q;  4OXP A;  4LF4 L;  3ER0 A;  3RN5 A;  4AQY Q;  4A4I A;  1L1O B;  1PH7 A;  4JI6 L;  1HNW Q;  4P74 A;  1KL9 A;  2NVY H;  4HJ5 A;  1QUQ A;  1YHQ A;  3S15 H;  3U50 C;  4Y7N H;  2RHQ B;  3OW2 A;  4JOI C;  3RR5 A;  3CF5 A;  1EQR A;  4RMF A;  4Y52 H;  1VQP A;  4X64 L;  1BBW A;  1IBM Q;  4JI2 L;  3KLW A;  3SGI A;  1NY4 A;  3TRE A;  5M3M H;  2UUA L;  3I4M G;  4B3R L;  4JI0 Q;  1N32 L;  2A1A A;  4OON A;  3TQY A;  1XJV A;  3IRB A;  4A75 A;  4DV7 Q;  4DK3 C;  1EWI A;  1PV4 A;  4A3C G;  3GDE A;  4NB3 A;  5IYC H;  2A19 A;  4JI5 L;  1K8A C;  1GVP A;  1TWH H;  2F52 A;  1X6O A;  1W3S A;  1UE1 A;  2JA9 A;  4UP8 A;  4DR3 Q;  4X62 L;  1NTG A;  5IP9 G;  4QIW E;  4ALP A;  3RN2 A;  4B3S Q;  3PO2 G;  3PIP A;  2OTL A;  3CCV A;  1WCM H;  3RNU A;  4QJF A;  4OO1 I;  1Q81 C;  2OQK A;  1X3F A;  4C3H H;  1YJ9 A;  5LMN Q;  3PO3 H;  1E1T A;  4WJ3 M;  1VS0 A;  3FHW A;  1BKB A;  3H0G H;  3UDG A;  1SN8 A;  4DV4 L;  2NN6 I;  4HJA A;  3Q8D A;  2CCZ A;  2R93 G;  1Y1V H;  4AH6 A;  5M5Y H;  2R93 H;  1I94 Q;  5FLM H;  2K50 A;  1J6Q A;  1MJC A;  2JK8 A;  2Q2I A;  3A5U A;  2VZA A;  2UUA Q;  1O7I A;  1YBY A;  4GS3 A;  3CCS A;  2IT1 A;  1D7Q A;  2E5L L;  2RHS B;  2HHH L;  1HH2 P;  1U0L A;  5C3E H;  1KRS A;  3GTL H;  4GOP B;  3TRZ A;  4A93 H;  4JG2 A;  1NMG A;  1XPR A;  3K80 C;  3TS0 A;  1HNW L;  2VUM H;  2HIX A;  3M4P A;  5JEA G;  4L5S A;  4OWX B;  3E0E A;  4YWL A;  1VQK A;  4LF4 Q;  1SRU A;  3RLF A;  3W1G A;  5IP7 H;  3ZJY C;  5IP7 G;  4DV2 Q;  1E1O A;  4QY7 A;  2Z0S A;  3PIO A;  5E7N A;  3AFP A;  2UXB L;  1TXY A;  5LMU Q;  2AKW B;  4YWM A;  1KIX A;  4LF6 L;  1HNZ Q;  5DLQ E;  1VQO A;  2PI2 A;  2CWP A;  3E9I A;  1HZC A;  5J3B A;  2JA7 H;  1VQ8 A;  2BH2 A;  4IPG A;  4DV3 L;  1Q46 A;  2KHJ A;  3K8A A;  1A0I A;  2R6G A;  4DV0 L;  1NMF A;  1N36 L;  4JI7 Q;  2NVQ H;  4BY7 H;  4NXN Q;  1IZ6 A;  4A3L G;  4K0K Q;  4NPS A;  4B3M Q;  2ZJP A;  2JJQ A;  4GOP A;  1JJ2 A;  1QVF A;  1XMO L;  1IYJ B;  4DPG A;  2E2H H;  5GQO A;  3H3V H;  4DR6 Q;  1C9O A;  1S3O A;  1UE6 A;  3PUX A;  4DR2 Q;  3HKZ G;  1RL2 A;  3UDF A;  5C44 G;  3S2H H;  3K7U C;  2ZJQ A;  1TWC H;  1U5K A;  1VQ6 A;  4KHZ A;  2JE6 I;  4UP7 A;  3PF5 A;  1N8R C;  2Q2T A;  1G51 A;  3TS2 A;  2LXK A;  1VQE A;  5H1S E;  1XMO Q;  1B7Y B;  4IJH A;  4IFD G;  5GAH C;  4TVA B;  1C7Y A;  1BBU A;  4TQU S;  3A74 A;  2N3S A;  4NXN L;  4LNQ A;  3DM3 A;  4A3E H;  4O0A A;  5C3E G;  5M3M G;  1N36 Q;  4JI7 L;  4NXM Q;  4LFA L;  2YTX A;  5FLX c;  3J7A 5;  3GTP H;  2B29 A;  4A3J G;  2MO0 A;  5IYC G;  4KHP L;  2VS1 A;  2K52 A;  3PF4 A;  4BA1 I;  1EIF A;  4DR1 Q;  3FKI G;  4UP9 A;  1LTL A;  1PH8 A;  4LFC Q;  3KOJ A;  3S1M H;  1YHA A;  4A3D G;  4NXM L;  1OXU A;  1FL0 A;  2IX0 A;  3H15 A;  4QQB X;  4PZ6 A;  1VCI A;  3CW2 C;  1L2F A;  2BA0 A;  4HJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...