2UXCQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcQ00
4B3RQ 2B63G 1X9NA 2R93H 4DR3Q 4GS3A 5GAEC 3D0FA 4WJ3M 3RLOA 2PI2E 2YTXA 4LF4Q 3AFPA 4LF9Q 3CAMA 2A8VA 2HQLA 4QIWE 1K83H 2QA4A 4A76A 1T9HA 3DM3A 3OYYA 1E1OA 2C35B 5IP7G 1UE7A 2KBNA 4DUYL 1VQ5A 2E5LQ 4A3MH 1VS0A 2K4KA 2YTYA 3GTMH 1E1TA 1OXSC 2NVTH 2LSSA 5LMUL 1J5EQ 4PMWA 2HHHQ 1HNWL 5LMNQ 3F8TA 1Q12A 4BY1H 3KOJA 2AWNA 4KI0A 1JJCB 4BBRH 3L7ZC 3NEMA 2JEBI 4PZ7A 1A0IA 1N36Q 2JA5H 4LF7Q 4KHPL 1TWCH 3F2BA 3HKZE 1WCMG 3S1MH 1N8RC 4AYBG 4LFCQ 1PYSB 4JI6L 1B7YB 3EN2A 3GO5A 3PO2H 3ULJA 3PUVA 2NVYH 4KHZA 4C3IH 3I4NG 1G51A 1X3EA 4JI8Q 1QVCA 5FJ8G 2OQKA 1HR0Q 4ME3A 4UPAA 2Q2UA 1WI5A 1H95A 2BH8A 3ULPA 4JI5Q 4QY7A 5FLXc 4O2DA 3CCSA 1N34Q 5AJ3Q 3OTOL 4OO1I 1D7QA 1MIUA 1VQJA 3PIOA 2IY5B 2E2JH 1YHBA 1X3FA 3B6YA 4UP8A 3RLNA 5IWAQ 4DUZL 2F4VL 1HH2P 1FGUA 3ZJYC 4DK6C 2OWOA 2Y0SE 3RZOH 1EIFA 2KCTA 3M4OH 3RLFA 2OTLA 4KLKA 2K75A 2VW9A 2JA7H 2K5HA 4IJHA 3CCMA 4JCVE 4DV7Q 2ZJQA 1HZCA 3JC66 4TQUS 3CCLA 2UXDQ 4DR6L 2OTJA 1JE5A 3WWVA 3CCRA 3M85A 3S16H 1BBWA 1MJCA 3K7UC 1R9TH 2LXJA 1CSQA 2WAQE 5C44H 2PQAA 3GD7A 5IYDG 1Q86C 4DR7Q 1ASYA 1JT8A 1TXYA 1QZHA 2E8GA 5GAGC 2VL6A 4BA1I 1W2BA 2DUDA 4JV5Q 1VQKA 2GVAA 5HY6A 5IYBG 2RHQB 1XNRQ 4AH6A 2D0OA 4P73A 1V43A 4YCWA 4PG3A 3RR5A 2ZM6Q 1JMCA 2ASBA 4UP7A 4LFAQ 4LF8L 2JEAI 3I55A 4A3IG 4P74A 4LFCL 1WFQA 2E2IH 4GOPC 1UEBA 4IFDI 4X66L 3GDEA 2ZJRA 3I4MG 4HJ8A 3PO3H 4BY7G 4HIDA 2ZTCA 4AQYL 4GLVB 1SFOH 4A3BH 2NN6G 1OXTA 1VQMA 3FHWA 4IFDJ 2K14A 4B3ML 2GVBA 2JA8G 4DUYQ 1K0RA 3ICEA 2R92G 4DPGA 3UE1A 1S72A 1TWHH 1O7IA 4OWWB 4YWMA 5LMUQ 1HNWQ 3NELA 4LNQA 3HOVG 4X6AH 1UWVA 2VQEL 2ES2A 3CPWA 4DR1L 2WB1G 4LUZA 3S2DH 4KHPQ 1IXRA 5IP9G 1AE2A 2RCNA 1N9WA 2VZAA 1KAWA 1BBUA 1OXXK 2CFMA 2N78A 4IPDA 1YITA 4JI6Q 2VQFL 3FKIH 4A93G 4P71A 1OXUA 1PH7A 4YHHL 1GO3E 3J81j 1VQEA 1D8LA 1PH6A 3L0OA 3W5OA 1Y1WH 5K36G 4X62L 3PV0A 1L2FA 2R93G 2I0QA 1UE5A 1LTLA 4QL5A 3U50C 4OWTB 2Q2HA 3OTOQ 3G71A 4JV5L 1Q81C 2IT1A 4MNOA 1KXLA 4HIKA 1SLJA 2I5MX 2LXKA 4DUZQ 1E24A 3LGJA 1Q82C 5C4XH 2F4VQ 4A3MG 5M5YH 2ZM6L 3I7FA 4IO9A 4GOPA 4DV6L 1YVCA 4BY1G 2ZJPA 1S40A 2UUCL 4L5QA 1SMXA 4BBRG 1XNQQ 2VNUD 3KYHC 4EX5A 2JA5G 3PF4A 4DR6Q 2UUBL 1NE3A 1P16A 1VQCA 1E7ZA 3KDFA 3CP0A 4NB3A 4YCVA 5C0XI 3PO2G 1VQ6A 3Q8DA 4DR4L 2N8NA 4YWLA 3HKZG 3E9HA 4NXNL 4GLXA 1KQSA 1AH9A 3KF6B 4LF5L 1V1QA 1YNXA 5C0XJ 1EQRA 4IJLA 3E9IA 1HNZL 5GAHC 1X54A 3PF5A 1UE1A 1YI2A 1XMOL 1SROA 1L0WA 4A3FG 4C3HH 1OXVA 2Z0SA 1QVFA 2KCMA 4UP9A 4RG1A 2R7ZH 4DR2L 4DV0L 1L1OB 4A75A 4LF8Q 4B3SL 4DV3L 1K3RA 2VUMG 3G48A 3GTPH 3HOXH 4L5SA 3ER0A 4JYAL 4JI0L 4GKKL 2NZHA 3H3VI 1YBYA 2JJQA 4X64L 5JEAG 4X66Q 1PH9A 4YWKA 3PUYA 4MZ9A 2H5XA 2WFWA 1N33L 2JA7G 2DGYA 1U0LA 5EAYA 4DAMA 1C9OA 4AQYQ 1KC8C 2L15A 1XTDA 1FL0A 2K50A 4B3MQ 4A3CH 4R4TA 3CMEA 3IRBA 3PGZA 1X3GA 4GN5A 4JG2A 5C44G 2FXQA 4JI1L 1K73C 3GTLH 1PH1A 1YHAA 3BZCA 3I56A 4Y52H 1QUQB 1VQ8A 2F3IA 4IPCA 1C7YA 2VQEQ 3W1GA 2E2HH 4DR1Q 3S1NH 4A3EH 2IHFA 4C2MH 3KJPA 5JJLA 2NVXH 3S24A 1KD1C 3HOUH 4GKJL 3M4QA 1XNQL 3A5ZB 2AHOB 2ID0A 2RF4A 1IYJB 4LUOA 4O0AA 4A4IA 4AIMA 2VQFQ 4IOCA 3RZDH 4YHHQ 3KLWA 2N49A 4AYBE 4IPGA 2JK8A 4X62Q 1TWGH 5E7NA 1RIPA 2CKZB 5M5WH 4DK3C 4LF6L 2EIFA 1VQAA 3PO3G 1IZ6A 2BA1A 2OCEA 4A3KH 1HJPA 2ALYB 3DLLA 2ZTEA 4PZ8A 4XTCS 2AWOA 1TWFH 1Q1BA 3BJUA 1BKBA 1WOCA 2YV5A 4YY3Q 1FJGL 2CCZA 1G291 4OWXB 1M90C 1CKOA 3GTQH 4JBWA 3F1ZA 5H1SE 2BH2A 4DV6Q 4POFA 2UUCQ 3GTJH 1K8AC 2CQOA 2OQ0A 2ZTDA 1QZGA 4L5RC 1CSPA 1X65A 4WJ4A 2UUBQ 1KHIA 1PH2A 2IX0A 1PH3A 1CKNB 2YYZA 3FKIG 2Q2IA 1E3PA 4DR4Q 3TREA 5GROA 2R7FA 4LW1A 4NXNQ 5IY0A 3H0GH 3RN2A 1YZ6A 2K5VA 4R4IA 4A3DH 4LF5Q 3HOYH 2BA0A 1VQPA 1GD7A 1Q1EA 4HJ7A 5ELNA 1HNZQ 3MEFA 4OXPA 4HJ5A 2NVQH 3S1QH 4BBSH 1Y1VG 2AKWB 1XMOQ 5IT9c 5JEAJ 4K0KL 3E0EA 4DR2Q 1NY4A 4DV0Q 2D0PA 4NXML 4B3SQ 4DV3Q 5M3MH 5C4XG 1VQGA 4JYAQ 1C0AA 4GNXC 1K8GA 5M3FG 1I94L 4JI0Q 4JI4L 4GKKQ 1EOVA 4A3LH 1VQIA 1G6PA 4P75A 1Z9FA 4GLAC 4X64Q 1N33Q 1XJVA 1Q46A 3TS0A 4JI7L 2JQOA 4OX9L 1NJIC 4QJFA 1VQOA 1A62A 1LYLA 3M7NA 3S15H 1U5KA 2KHJA 3D31A 3PUXA 5JJKA 1Q7YC 3CQZH 4A3GH 4DV4L 4A3IH 4JI1Q 5FLMH 1E22A 1TWAH 3CCJA 1IBMQ 4DR5L 4YY3L 4DKAC 1VQFA 3L2PA 4PZ6A 2QEXA 4GOPB 4EQ5A 1IBLL 2RHSB 3K8AA 3I2ZA 5GADC 4GKJQ 4OO1G 4APVA 3ERSX 4ALPA 3OW2A 3AYHB 2R92H 1WJJA 4JI3L 2MO0A 1HZBA 4X65L 4J15A 1GKHA 3CC7A 1YEZA 4IOAA 3MXNB 3NBHB 3HOXG 3CMAA 1XPUA 2CWPA 3HFZB 3G4SA 1A63A 3H3VH 4A3BG 2Z6KA 1XMQL 2WP8J 4LF6Q 1KL9A 2EQSA 1CKMA 1AE3A 5M5XH 2HT1A 4A3CG 1EQQA 3PSIA 3PIPA 1PYBA 2NN6I 4JI2L 5IYCH 1EFWA 3H15A 3TRZA 1JJ2A 1FJGQ 3PUWA 4R4OA 3CXCA 4GNXA 3BU2A 1V9PA 3HKSA 4LWCA 4DV5L 4LFBL 4A3EG 4JBKA 3HOWH 3TQYA 3BZKA 1Y14B 1PFSA 3EBEA 3HOUG 1W3SA 2K5NA 1Z47A 2Y0SG 3CCUA 3UE0A 3U58A 4BXXH 4JOIA 1YJWA 1SN8A 3I4OA 1I50H 2JA6H 3KF6A 1RL2A 4NPSA 3UDFA 4A3JH 1GM5A 5C3EH 1VQ7A 1ASZA 2YTVA 3AFQA 4UY8C 2VS1A 4IFDG 4H02A 4TVAB 2VY3A 4HJ9A 3HOZH 1IBML 4IPHA 2UU9L 1PA6A 1N32Q 2CWAA 4LUVA 2WAQG 2UUAL 2B63H 1JJGA 1L1OA 4A3KG 1PV4A 4JBJA 3J7A5 5J3BA 3F2DA 2QGQA 1VQ4A 1XPOA 4K0KQ 3CPFA 4R4CA 3K7AH 3J7ZC 2D62A 4NXMQ 1EUJA 3AEVA 4QQBX 3GTOH 5IP7H 5BR8L 3TS2A 3CC2A 1Q8KA 3G6EA 4DV2L 1I94Q 5LMNW 4JBMA 4JI4Q 1NTGA 1NBWA 4GN4B 5HGQA 2PQAB 2N3SA 4FDBA 3CCEA 3RN5A 2Q2TA 4JI7Q 4OX9Q 3CD6A 3U4VA 3M4PA 3T1HL 4A3FH 4HJAA 3S14H 3VDYA 1VQNA 1QUQA 1S3OA 1IBKL 1WCMH 4DV4Q 1PH4A 2VUMH 4B3TQ 2UXBL 3UDXA 2KHIA 3KFUA 1YJ9A 1PH8A 1IL2A 1HZAA 3T1YL 4HIMA 1EIYB 3H0GG 1YJNA 1HR0W 4OONA 3I4NH 4A3DG 3PCOB 4DR5Q 1YIJA 5FJ8H 1PH5A 3HOYG 1P8LA 1SE8A 3RNUA 3GTGH 1I3QH 2PI2A 2B29A 1NMGA 4B3RL 2MQHA 2UXCL 1QVGA 1VCIA 1IBLQ 2HIXA 4BA2I 4BBSG 4DR3L 1VQBA 1M1KC 4DV1Q 4LF4L 4LF9L 1UE6A 1I5FA 3A74A 1X6OA 4JI3Q 4X65Q 5M3MG 1PHJA 2GN5A 2E5LL 3GTKH 1BVSA 4QGUA 4A3LG 1EWIA 3KF8B 4RMFA 1NMFA 2PMZE 1J5EL 1GVPA 2HHHL 2MO1A 3K81C 3STBC 5LMNL 1XMQQ 1J6QA 1X56A 1JB7A 3A5UA 3CW2C 1Y1WG 2EXDA 2Z6KC 2IHEA 2HIVA 4C3JH 1N32L 4LF7L 1N36L 1CUKA 4A3GG 5C0XG 4Y7NH 4JI2Q 3K80C 1HNXQ 1X55A 2V1CC 4JC0A 5FLMG 1YHQA 5IYDH 1KRTA 4JI8L 4DV5Q 3A0JA 2JA9A 4R4QA 1HR0L 4LFBQ 3S1RH 1LUZA 1CKNA 2B3GA 5IYBH 1B8AA 3J81i 4JI5L 2YU9H 1N34L 1B70B 5AJ3L 2I5LX 4DAYB 2UXCQ 1XPRA 2F52A 4R1JA 4JOIC 2JE6I 3TEHB 5IWAL 3F2CA 2NZOA 3CCVA 4B3TL 2ATWA 4DNIA 2XGTA 2MFIA 5IE8A 3J80i 2UU9Q 1MKHA 4P72A 2UUAQ 3I4MH 3S17H 5GQOA 3UDIA 4DV7L 4BY7H 1KRSA 3JAMi 4YCUA 2UXDL 1FVIA 1WYDA 3J81c 1VQHA 1LM0A 1L1OC 4GN3B 5DLQE 2PNHA 5IYCG 1VQ9A 3FP9A 1A8VA 4DV1L 2IX1A 2R7DA 5BR8Q 1KIXA 2JA8H 3ULLA 3S2HH 5JJIA 3STBD 2R7ZG 4DR7L 1MJEA 4DV2Q 2XTIA 1DGSA 2WB1E 3AQQA 2MNAA 3K0XA 4HIOA 3PUZA 3KDFB 2K52A 2KENA 2I5HA 3EIVA 3SGIA 3CCQA 3HOVH 1K9MC 3HOWG 1SRUA 3U4ZA 1Y1VH 3M9BA 3KJOA 5C4JH 3J80c 2A19A 1VQLA 1XNRL 3T1HQ 1HZ9A 4L5TA 1OTCA 3M3YH 5IP9H 5ELOA 4BXXG 2A1AA 1IBKQ 3JAMc 3W1BA 1EYGA 3UDGA 2JA6G 2UXBQ 4A3JG 3CC4A 2R6GA 5C3EG 1PVOA 5M3FH 1VQDA 4LFAL 4A93H 3T1YQ 1SR3A 1HNXL 3CF5A 3NENA 1I6HH 3HOZG 4POGA 2AMCB 4GNXB 4XIGS 4MTNA
chains in the Genus database with same CATH superfamily
3E6ZX 2R93H 2F0OA 2B2VA 3CAMA 1WTPA 4DUYL 2F0UA 2KBNA 4BY7B 4FXGC 4KN7C 4A3MH 1OXSC 2LSSA 4PMWA 3SVMA 2JA8B 5IT9L 4KI0A 1A15A 1EZ8A 4PZ7A 4KHPL 4FXDA 1WCMG 3S1MH 4LFCQ 1DONA 1Y1VB 4PMBA 3I4NG 5I9OA 4JI8Q 2B39A 5FJ8G 4HR7B 1HR0Q 1PRTC 5I6WA 5FLXc 4O2DA 1I6HB 5FO7B 2CVRA 2EYFA 3VR2A 4UP8A 3NQIA 4KKTA 1FGUA 4RKBA 3OMGA 3OWFA 4KLKA 3QJYA 2F0VA 1JICA 3OW7A 2ZJQA 2L12A 2F0HA 2NVTB 2OTJA 2XWJB 4BY1B 2PQAA 1Q86C 4DR7Q 5JOBA 1SYFA 2E8GA 5GAGC 1EOTA 1VQKA 1H9MA 3OOCA 5HY6A 3SR1A 2M00A 2K5QA 2H1EA 2D0OA 1V43A 4FO2A 1ICFB 3CRLC 1I4HA 2G9DA 2ZM6Q 1F2ZA 1QILA 4LF8L 4KKSA 3PMFA 5C4HA 1ILPA 1L0XB 3P1HA 1U9RA 4HJ8A 1SDFA 4K14A 3SDZA 2FMMA 3PIO3 1OXTA 2EE1A 2BDNA 2K14A 1LTRD 2GVBA 1K0RA 5KRUA 2Q8TA 1TWHH 1O7IA 4OWWB 3NELA 3S16B 4PNYA 1HA6A 2VQEL 3JAME 3S2DH 1V8QA 1HRJA 2RCNA 3T56B 2CFMA 4A93G 3MZ5A 4YHHL 1GO3E 2K7VA 1PH6A 2BCOA 5K36G 1Y1WH 3PV0A 5IGEA 2KVMA 2I0QA 4JV5L 2IT1A 5JPNC 2I5MX 2EYPA 3LGJA 1Q82C 2F4VQ 4TRDA 5BN3A 4JPBW 4KMUC 2JXMB 1I4PA 4DV6L 2PW7A 4XT3B 2UUCL 2BOSA 3SK4A 4BBRG 3KYHC 3H3VC 4EX5A 3PF4A 1R4QB 1P16A 1VQCA 3MXNA 3PO2G 4C3IG 4ZUJA 3HKZG 4NXNL 1PTOD 1QNUA 4LF5L 1YNXA 4ZYSA 4FVMA 5GAHC 1XMOL 5EPKA 3NPPA 2KCMA 4DR2L 1PMRA 2QEJC 4A75A 5A2QE 3SK5A 3HOXH 4L5SA 1F9SA 2NZHA 3M7GA 1YBYA 2JJQA 3NXWA 2EXZA 1N33L 2WFWA 2JA7G 2QILA 5C4XB 4AQYQ 4N8X1 1FL0A 3C3LA 3QG1A 5CBEE 3PGZA 1K73C 5C44G 2A68D 1KLGD 2NBFA 1YHAA 3K5LA 2F0MA 3I56A 3TP7A 4RHRA 5DNFA 1B9MA 1TY0A 1S5CD 2AQ3B 1EU3A 1EY0A 2E2HH 4A3EH 3C1FA 4C2MH 4H7BA 3J81L 2NVXH 1KD1C 1Q90A 3IL8A 5JJZA 3HOUH 1XNQL 3A5ZB 4KJNA 3HEJA 5E3FA 4TKOB 1IYJB 4A4IA 4C1NI 2VQFQ 1QCBD 4G57A 4IOCA 1UEAB 1Y8NB 3KLWA 4X62Q 2ENBA 4LF6L 1S4ZA 1JWSD 4OELB 3GTPB 3EQLC 3UI2A 3S9WA 2ALYB 1ZYRD 2AWOA 2QCPX 3P7JA 4OL7A 2CCZA 4OWXB 3F1ZA 2HDLA 2MGSA 2EY5A 3GTLB 3MWYW 1X65A 3D4WA 2G5DA 4LMQD 1J8IA 2KJXA 2IW3A 5EPJA 1PH3A 3ND9A 1CKNB 5C6AA 1STNA 3FKIG 2Q2IA 5I2XA 1K8MA 2R7FA 4LW1A 3H0GH 4R4IA 3HOYH 2BA0A 1GD7A 5ELNA 1HA5A 1O7LA 1WTQA 2F0KA 5J22A 3E0EA 4NXML 1MBYA 4B3SQ 2F03A 2WAQB 2NZ1D 4GNXC 1I94L 3A56A 4JI4L 1S5ED 5C4ZA 1EOVA 3T13A 1G6PA 5FLXL 1AN8A 1Q46A 3R8BA 1A6XA 4JI7L 3S15H 1LYLA 3BDCA 1LTID 2KHJA 3PUXA 1TVXA 4IUNA 5FK9C 1Q7YC 2CW0C 2RDGA 3WOFA 1SNCA 5EQ0A 3TSSA 1EWCA 1TWAH 5IOCA 5ELEA 2KUMA 4YY3L 2NYZD 4DKAC 3L2PA 5I9PA 5ISRA 4KD4A 2RHSB 4GKJQ 3KLSA 3ERSX 4HSVA 4A3DB 2LKVA 4C3HG 2R92H 4JI3L 2MO0A 1H9SA 1TY2A 4J15A 3NBHB 4IUVA 4Q5VA 2PZUA 2MJ8A 5EKKA 1AFPA 4A3BG 2Z6KA 1NUCA 3TDQA 5M3MB 3V05A 2KECA 3ONAB 1OO9B 5DM63 4ZUIA 3M4YA 1PYBA 2LS01 5E4WC 3OSOA 4NP5A 4HTHA 1FJGQ 3HKSA 1V9PA 4LWCA 4DV5L 1LT4D 1FNUA 3CQZB 1GUTA 4A3IB 1Y14B 1TS2A 4DXFA 2IWHA 1GM5A 5C3EH 1ASZA 3AFQA 4H02A 1O7ZA 1IBML 4IPHA 1B3QA 5J3BA 3R2IA 1XPOA 4QB4A 4K2LA 1SNOA 3TS2A 1FGBD 1CQFA 5I6YA 3CCEA 3RN5A 1SE4A 1PYWD 4A3FH 4EQPA 4RWSC 1VQNA 3FDTA 2R93B 1WCMH 2FJ2A 1BCPD 4ODGA 2VUMH 5CGKA 1PH8A 1HZAA 5CMDA 3I4NH 1EIYB 1YJNA 1BCPB 4OONA 4C1NK 4F88A 5FJ8H 2F0EA 3DUZA 1P8LA 1I3QH 4HSPA 2B29A 1QVGA 1VCIA 1IBLQ 1X32A 1VQBA 1M1KC 1JWUD 2B2UC 1UE6A 1I5FA 3HOZB 1X6OA 1PHJA 2GN5A 1QWYA 3BG3A 3VA7A 3GTKH 4CKCA 3RUZA 1EU4A 2PMZE 2SNMA 1NSNS 2MO1A 1J6QA 1X56A 3L9AX 3CW2C 1Y1WG 2EXDA 1K3BC 4YIJA 1N32L 4A3GG 5C0XG 1EYDA 2EYJA 4XDXA 1X55A 1YHQA 1GJXA 2CH4W 2EJMA 4JI8L 1JWMD 3A0JA 4DNTB 3HS0C 1HR0L 3S1RH 1CKNA 3OPOA 1B70B 4QF4A 3GTGB 2E2DC 1EQTA 2L9HA 1WD0A 2NZOA 3CCVA 4B3TL 3DXJC 2ATWA 1SSOA 4DNIA 2MFIA 3D8GA 3S17H 5GQOA 3UDIA 4YCUA 1WYDA 3VR4A 4HCSA 3DHQA 3EROA 5IYCG 2A69C 5JJIA 3STBD 3Q6SA 4DR7L 1DGSA 2K33A 3AQQA 4U68A 2MNAA 2I5HA 3SGIA 2K04A 4RCOA 1K9MC 1G8ZD 1GHJA 3U4ZA 5EPLA 5IGCA 5C4JH 4N8FA 2X69A 3VR3A 1HZ9A 2DNCA 2VB3X 4L5TA 1OTCA 3M3YH 5ELOA 3QIAA 1T5XD 3JAMc 1KDAA 1EYGA 3UDGA 2JA6G 3QWNA 4A3JG 3NTIA 3CC4A 1VQDA 4A93H 3R2TA 4OGQC 3T1YQ 3ERQA 4GNXB 5K36H 1SYCA 2UXCQ 4B3RQ 5IIFA 1HTPA 1H9KA 3C2PA 4ILWA 1IKLA 1BR9A 4A76A 3KK7A 4CKBA 1VQ5A 1SYGA 3NUCA 2YTYA 3HGBA 5CR3A 5LMNQ 3F8TA 3KOJA 2K01A 3S2HB 1JJCB 1EY6A 4BBRH 2B2TC 1G2SA 2F0JA 1K28A 2E74C 2JEBI 4LF7Q 1TWCH 2XSCA 1EZ6A 4AYBG 1PYSB 1NR2A 2RDHA 3EN2A 3GO5A 3PO2H 1Z7TA 3PUVA 4C3IH 2LFNA 1X3EA 3KLSX 1IKMA 1RHPA 2OQKA 1WI5A 5M3FB 4PV1C 2BH8A 3ULPA 4IN3A 4CGYB 1D7QA 1AZPA 1VQJA 2IY5B 4DFAA 2E2JH 1X3FA 2OXPA 3B6YA 1O7YA 5IWAQ 3RZOH 2F4VL 2OWOA 2Y0SE 1EIFA 1M8AA 1K83B 2K75A 3K0YA 2VW9A 2K5HA 2JA7H 4JCVE 4KTAA 4C3JG 3GTMB 1SJED 1JE5A 5HURA 1R9TH 2LXJA 4O1NA 4ZKCB 3GD7A 3MC0B 5C44H 1ONLA 1ASYA 1JT8A 2JA5B 2B8FA 1Y8PB 2VL6A 4DXGA 3Q22A 4P2CB 5IYBG 1EEID 2X6LA 2NVYB 1JC7A 1MSGA 2Z4HA 2SOBA 2RDFA 4K2KA 1EEFD 4CDEC 2EYOA 1L0YB 4LFAQ 2E2IH 4GOPC 1UEBA 2ZJRA 4BY7G 1X3QA 2KOLA 3T4AC 5JVH3 1SFOH 4AQYL 2RQXA 4GLVB 3M4OB 1VQMA 2A6ED 2JA8G 2R92G 1S72A 1SNDA 4YWMA 3J80E 5LMUQ 2R3ZA 4CJ2C 1EWHA 4LUZA 1PTOC 4RFBA 3MEHA 5IP9G 3MA2B 1KAWA 4IPDA 2Z1CA 2VQFL 3FKIH 1PFNA 3EVQA 5C3XA 3J81j 1ZEQX 3AB9A 3L0OA 4X62L 3CU7A 2K28A 1UE5A 3G71A 4DNRB 3EJIA 2SEBD 4R9WA 4HIKA 5ELBA 3TN2A 3PO3B 3LX0A 2A68C 1B50A 4HMIA 1YVCA 4BY1G 4L5QA 1SMXA 2VNUD 2AUKA 4NB3A 4F8MA 1AH9A 5CV9A 1VF5C 4K6DA 3KF6B 1EQRA 1CHPD 2C5CA 3PF5A 1UE1A 3TMEA 2BE5D 1SROA 3MAQA 1CA5A 1NAPA 2A69D 4C3HH 4A3FG 4DAVA 1OXVA 3J7A5 1QVFA 2O4XA 4RG1A 4L6TB 4B3SL 2VUMG 1ZYRC 2ZXOA 1XWEA 3I3CA 1DOKA 4A3BH 2WACA 4MZ9A 5EAYA 2WINB 3HZXA 4DAMA 3HG9A 5M5YB 3ZYYX 1SE2A 2K50A 4B3MQ 3IRBA 3DWQA 3IAYA 1X3GA 2XNAC 4GN5A 4JG2A 2FXQA 1PH1A 2L11A 2CQAA 3LNNA 1VQ8A 4IPCA 3TP6A 4RHSA 4DR1Q 4HAEA 4CHTB 3KJPA 1ESRA 4GKJL 4DAPA 2AHOB 1XTCD 3RZDH 3K5NA 4OEMB 3NTKA 1A3TA 4J6HA 2JK8A 3AMUA 2R7ZB 1RIPA 2E75C 5M5WH 2EIFA 4HCEA 2ICEC 3K58A 4KY6A 3FMCA 1F9RA 1GUGA 2RSOA 3TP5A 1Q1BA 3BJUA 5COYA 1YNJD 3NWSA 2K1BA 2F0WA 1FJGL 4WRDA 1M90C 1STYA 3GTQH 1CM9A 5H1SE 2BH2A 3OIPA 4ULLA 1K8AC 1CSPA 3MXGA 3DWPA 4WJ4A 4J1MA 5KGUA 1PH2A 3DEPA 2YYZA 3S1NB 1E3PA 4DU9A 5GROA 2NUCA 4Q0FA 3RN2A 2K5VA 3TBIB 2DN8A 4HJ7A 1QE6A 2NVQH 3S1QH 4RCNA 1IYVA 2B2WC 1ENFA 5FKAC 4JVZA 4IUTA 1TWGB 1STBA 5C4XG 2D0PA 1F77A 4JYAQ 4A3KB 1K8GA 1FD7D 4JK1C 3ITPA 5FOBB 4P75A 1D2BA 4GLAC 3T51B 3W3AA 2K03A 4I65A 1NJIC 1HCZA 4QJFA 4DF7A 4J8QA 1U5KA 4EQNA 4NDXA 3U9OA 4A3GH 3L3OC 5C0XH 3GTJB 4JI1Q 1E22A 4OIJA 1VQFA 4PZ6A 4GOPB 1SNPA 1NR4A 4EQ5A 1IBLL 2B2UA 2NN6H 5GADC 4OO1G 5KNCA 4APVA 3OW2A 2HCIA 1WJJA 2JP1A 5IGDA 1HZBA 1HUNA 2D2CC 1GKHA 4IOAA 1YEZA 4BBSB 4XQQA 2MP1A 2KHSA 2K5DA 1LT3D 2OF1A 4IALA 2EQSA 1AE3A 3PSIA 1FNVA 3PIPA 1PTOB 5IYCH 4Z9CB 3TRZA 1DXMA 2XRQD 1BCPC 3VYSA 2J0TD 4JBKA 1HQMC 2F4IA 1DYQA 1LO5D 5CORA 2F0GA 1I6VC 1Z47A 3FPPA 1YJWA 3I4OA 1I50H 4B9WA 2JA6H 3KF6A 1RL2A 1WD1A 4NPSA 4A3JH 3FRPB 4IFDG 4TVAB 2VY3A 3P20A 3T16A 1QJOA 2CWAA 4PQXA 2RBMA 2O5JC 2WAQG 1PV4A 3F2DA 3VR5A 2QGQA 1VQ4A 4G7HC 3CPFA 1VMCA 3J7ZC 2D62A 4QQBX 1EUJA 3K59A 3GTOH 4JBMA 5M5XB 1NTGA 4ZK9B 5HGQA 2VB2X 4FDBA 4OX9Q 3CD6A 3VYTA 1S3OA 2TMPA 3K57A 1PH4A 2HDMA 3UDXA 2KHIA 1K8OA 1YJ9A 3T1YL 4A3DG 1PDQA 1SAPA 1YIJA 1DOMA 1SE8A 3CKIB 4BS9A 2UXCL 4B3RL 2MQHA 2F0LA 1RTNA 4DV1Q 2L5TA 3A74A 4ZAIA 4FP5D 5CBAE 5M3MG 5HGTA 1TWCB 2B63B 3V2TA 4A3LG 4QGUA 1FYCA 1EWIA 3KF8B 4RMFA 1NMFA 1R4PB 1GVPA 3K7AB 3K81C 3STBC 2B2TA 5LMNL 1XMQQ 1JB7A 4WJWA 3J7YW 2IHEA 4ZCKA 4C3JH 2F0IA 2RCFA 4LF7L 1LTTD 4Y7NH 4JI2Q 3GV3A 2V1CC 5T1IA 5FLMG 1STGA 1O80A 2Q8RE 1KRTA 3S14B 3J81E 5KIXA 3RZOB 2Z6BA 5IGBA 1DJRD 1GUWA 5IYBH 2WKDA 3J81i 4QUCA 2DNEA 1XPRA 5IWAL 4R1JA 1EYCA 2JE6I 1SYEA 2RVLA 1V1PB 2AUJD 1WTOA 2XGTA 3BZDB 1KTKA 1RF2D 1MKHA 5KYLA 4P72A 1LT5D 4BY7H 3GP7A 3BS1A 1VQHA 1LM0A 5DLQE 3C1EA 1VQ9A 4FF2A 2JA8H 2HUGA 3ULLA 3QO2A 2WB1E 1J9OA 1HXYD 2H4OA 2K52A 2KENA 4KK7A 4FF4A 2DJFC 1SRUA 3HOWG 1Y1VH 3M9BA 3KJOA 4EGVA 1VQLA 3J80c 2E2IB 1AEXA 2N88A 5IP9H 1V1OA 2A1AA 1VDZA 2UXBQ 1F9PA 1PVOA 1SE3A 4LFAL 4F87A 2YU9B 1SR3A 2G9HD 1HNXL 3NENA 1I6HH 1VF7A 5IGFA 1TT2A 3IKJA 4POGA 3HOZG 3I55A 2HQEA 2D5DA 1LTGD 1LTSD 1D5MC 3RLOA 2PI2E 4LF4Q 2F0FA 4LF9Q 3BYYB 2A8VA 4QIWE 3A7LA 4GZYC 2HD3A 3OYYA 4UAIA 5IP7G 1UE7A 2Z8LA 3I4MB 3E0JA 1AZQA 1VS0A 1E1TA 2NVTH 5LMUL 1WTVA 2HHHQ 4G7OC 2DY8A 1Q12A 4BY1H 3A8KE 1LLRD 1TKWB 3NEMA 1N36Q 1PLFA 1CQVA 3HOVB 1N8RC 5I4DA 1SNMA 2WB1B 4M1UB 1QVCA 3NSWA 2ZT9C 3C46A 1GUSA 4F7XA 4UPAA 1H95A 4JI5Q 4MN3A 3CCSA 5AJ3Q 3PIOA 1TS4A 1YHBA 3RLNA 1SBBB 1HH2P 2A6EC 2EY6A 2KCTA 1EY8A 3RLFA 2OTLA 1S5BD 3CCMA 1LACA 3CCLA 4A3MB 3TZUA 2UXDQ 3WWVA 4QIWB 3S16H 1BBWA 1PTOF 3K7UC 4B9XA 3S1MB 1W2BA 2DUDA 4JV5Q 3N52A 2RHQB 1HPCA 4QUFA 1CI3M 4XQNA 3K5OA 1NCVA 3KUPA 4YCWA 1JMCA 2ASBA 2JEAI 4UP7A 4LFCL 1SXTA 3A8IE 2RSNA 1HFGA 2EYMA 1YNND 1CTMA 2FHTA 4HIDA 1FR3A 3X3NA 2NN6G 4B3ML 3BDOA 1BUVT 3SHLA 3ICEA 3UE1A 3MFYA 4V0BA 1A2TA 3BDLA 5LL6S 5K5PA 4LNQA 1HNWQ 3CPWA 4DR1L 1D1IA 4K8IA 1B1ZA 1N9WA 2VZAA 1BBUA 1YITA 4JI6Q 2N78A 4P71A 2BE5C 1OXUA 1PH7A 1S5FD 1DM0B 3QB3A 4RKLA 1D8LA 1F9QA 3W5OA 2PMZB 1L2FA 3VYUA 2Q2HA 5L37A 3OTOQ 1BF4A 1Q81C 1V1PA 1KXLA 1K0SA 1SLJA 2LXKA 4DUZQ 1E24A 5C4XH 4X3TA 2ICIA 5CV4A 1KDBA 2ZM6L 5D65A 4IO9A 5CV5A 2M2LA 3DMUA 2ZJPA 1XNQQ 1W6KA 4WFN3 1TWHB 2JA5G 1GUNA 4DR6Q 1EY7A 1E7ZA 4YCVA 3NBHA 1WVLA 4X3SA 5NUCA 5C0XI 1VQ6A 3Q8DA 3S2DB 3Q0AA 1RCVD 3E9HA 4GLXA 1KQSA 1BNZA 1V1QA 5C0XJ 3K5MA 4IJLA 1EY9A 1X54A 1KAAA 4RA8A 4DK0A 5C3WA 2HCCA 4OO1H 1YI2A 1CFMA 1L0WA 1Y1WB 2Z0SA 4UP9A 1E2WA 1K3RA 3GTPH 4JYAL 3ER0A 5D14A 5G3LD 1YNJC 4X66Q 2H5XA 2AQ1B 1U0LA 1RTOA 2L15A 1XTDA 2EY1A 1Q3LA 2IPKD 1JOQA 1I4XA 4R4TA 3CMEA 2KCNA 3GTLH 4JI1L 4CDCC 1QUQB 1ENCA 3E5SA 1C7YA 1HHVA 3W1GA 4N9TA 5JJLA 2IHFA 4I7ZC 2A74C 3I8ZA 4CDDC 1AW7A 2K05A 2ID0A 2RF4A 3ND8A 4LUOA 4AIMA 5D3DA 1XYIA 3VA5A 5AFWA 3A54A 1Z6HA 1RJTA 4AYBE 4IFDH 2EZVA 3J80L 4UDUC 2CKZB 3PO3G 1B3AA 1A3UA 1IZ6A 4M8AA 3HOXB 2OCEA 3MTSA 4MIUA 1HJPA 5KNBA 3DLLA 1GOZA 5ELDA 1U4PA 4PZ8A 4XTCS 1TWFH 4IUQA 2YV5A 4YY3Q 4JBWA 5EGTA 3QOLA 4POFA 1QZGA 1IW7D 3CHBD 2UUBQ 1LT6D 1KHIA 5DAUA 2B8GA 2E2HB 4A3EB 4C2MB 2KA7A 4DR4Q 2NVXB 3HOUB 2O5IC 2NB0A 1TIID 1YZ6A 2Y0SB 4A3DH 1VQPA 1BDOA 1Q1EA 1HNZQ 3MEFA 1C48A 4OXPA 4HJ5A 1Y1VG 2AKWB 3FEWX 4FF1A 1QOHA 2LY7A 1CK1A 4LJZC 4ZQ3A 4DV0Q 4DV3Q 5M3MH 1VQGA 2EJFC 4AYBB 4JI0Q 4GKKQ 1IHZA 4A3LH 5C5LA 1VQIA 4X64Q 1Z9FA 1BCPF 3EA6A 4KN4C 2JQOA 4OX9L 1RD9D 4B08A 3M7NA 1QG7A 4IUPA 3R3OA 3CQZH 3NP8A 4A3IH 5FLMH 2C9OA 1PFBA 4KJOA 1IBMQ 2ZXPA 4K5WA 1SJHD 1QNKA 2PYKA 2A5HA 2QEXA 4CJ0B 5EBDA 3H0GB 3MFGA 3HOYB 2IL8A 4RGMA 5I2YA 3MXNB 2F3WA 4Y7NB 3CMAA 2CWPA 3FPUB 3G7LA 3WOEA 1EFID 2XVSA 1E2ZA 3H3VH 1XMQL 4EVOA 4K5XA 1CKMA 3NTHA 1TQOA 4A3CG 1EQQA 2FFKB 4KV6A 4JI2L 2RKSA 2F3VA 3A8JE 3H15A 3HP3A 2NWGA 3S15B 3R93A 3PUWA 4R4OA 3CXCA 4GNXA 3BU2A 3NQTA 2J7ZA 4MTKA 1MHWC 3TP8A 2B2YC 3HOWH 3TQYA 4K8JA 1TWAB 3CCUA 3UE0A 3KBGA 5FO8B 1SN8A 1VQ7A 4RGNA 4UY8C 2N55A 4HJ9A 3HOZH 2R92B 3F2UA 1N32Q 1O78A 1JB3A 4LUVA 2F0NA 1WTHA 3WDNA 4A3KG 4NW2A 4K0KQ 1WTRA 4R4CA 3BVMA 5IP7H 3G6EA 1B4OA 4KHVA 3A7AB 4GN4B 1XX8A 3D6CA 1F2MA 3V96A 2KQ3A 4ZRZA 1BOSA 2TSSA 3U4VA 5T1GA 4HJAA 5BN4A 2EOTA 1HQRD 1QUQA 3JAML 4DV4Q 2UXBL 4B3TQ 3HRZC 3KFUA 1HR0W 5JEAH 3PCOB 4DR5Q 2ZXRA 3D3RA 5F2DA 5IT9E 1PH5A 3GTGH 1NMGA 1DCZA 4BA2I 3H91A 5C3EB 4BBSG 2M9VA 4LF4L 4LF9L 2F0DA 4RH6A 2D9UA 2CHBD 4X65Q 3MXPA 2P5ZX 1UUPA 1BVSA 3PQIA 2E76C 2HHHL 3LWUA 3H09A 4ID6A 1ILQA 5G3LF 2K5WA 2HIVA 4I7AA 1T5EA 4JW0A 1N36L 3GV6A 1KDCA 2EDGA 1GHKA 2XRSD 1C8CA 4RGOS 1RKNA 1ENAA 4A3FB 1HTLD 4R4QA 1WCMB 2JA9A 4FF3A 4LFBQ 2VUMB 1LUZA 2F0SA 1HFNA 2B3GA 4JI5L 3I72A 2PNRC 4CKEA 3I4NB 1SMYD 5M9OA 5AJ3L 1I3QB 4DAYB 4JOIC 1Y8OB 1LTAD 5IE8A 5A2QL 2UU9Q 2UUAQ 2PW5A 3GTKB 3JAMi 2OEOA 1FVIA 2UXDL 1L1OC 3GQBA 4GN3B 2IX1A 2PNHA 5BR8Q 3S2HH 4CJ1B 1MJEA 4DV2Q 1H9SB 1SEBD 5BN5A 3KDFB 3U9SA 2IX3A 1E0BA 1PFMA 1LABA 2A19A 3T1HQ 3CRKC 4XYOA 4BXXG 1WTXA 1IBKQ 2PCFB 5JVG3 3S1RB 1A2UA 1E2VA 2R6GA 5M3FH 1U4RA 2A73B 4IZ8A 3CF5A 1PXUA 5EJWA 2PZWA 2AMCB 4XIGS 1EY4A 4MTNA 2B63G 1X9NA 5FO9B 4GS3A 5GAEC 4DR3Q 3D0FA 3I4LA 4WJ3M 1TS3A 2YTXA 1BBXC 3AFPA 4H13C 1W6JA 2HQLA 2QA4A 1K83H 1T9HA 3DM3A 4KD3A 1E1OA 2C35B 3S17B 2E5LQ 3GTMH 2K4KA 4NKLA 1J5EQ 1HNWL 1I4GA 5DEHA 1ET6A 2AWNA 4XQJA 5D3IB 3J7AV 3L7ZC 2JA5H 1A0IA 3F2BA 3HKZE 2NTSA 4XYQA 1F2YA 2A6HD 4JI6L 4K6LA 1B7YB 1JORA 5LL6X 3ULJA 5C4JB 2NVYH 4KHZA 1G51A 2DJGC 3M3YB 3DM1A 2LMCB 1RDPD 3J7AF 4ME3A 2KCCA 2Q2UA 3BVGA 4A93B 5JPMC 4QY7A 5E1FA 1N34Q 1CA6A 3OTOL 4OO1I 1MIUA 1YNNC 1MSHA 4FNFA 4DUZL 1A3VA 1SNQA 2SNSA 3ZJYC 4XT1B 4MHEA 4DK6C 5ELFA 3M4OH 1NNXA 3IFTA 2WIIB 4IJHA 4DV7Q 1G2TA 1HZCA 3JC66 4TQUS 1IL8A 4DR6L 3CCRA 3M85A 1MJCA 1UNSA 1CSQA 2WAQE 4DK1A 4BBRB 5IYDG 1PZKD 1TXYA 1II3A 3KBXA 1QZHA 1I4QA 3I73A 4BA1I 2GVAA 3PO2B 2JN4A 1XNRQ 4AH6A 4C3IB 1TS5A 1D6EC 2L4NA 4P73A 3HKZB 5KEEA 2IJ0A 1Q8IA 4PG3A 2JSOA 3RR5A 3SE0A 2KEEA 4A3IG 4P74A 1PRTD 3VYRA 4WORA 3IFDA 1WFQA 3URYA 1ET9A 4IFDI 4X66L 1PRTB 3GDEA 2E2JB 2EYHA 1ICWA 3H94A 3I4MG 3PO3H 3G6JB 2ZTCA 2AQ2B 3FHWA 4IFDJ 4DUYQ 2B2VC 4DPGA 1MGSA 2JA7B 4LK1C 2J4XA 1JR0D 4U673 1STEA 4NMZA 1CZGA 1PZJD 3KLRA 4X6AH 3HOVG 1XXGA 1UWVA 1KABA 1R9TB 2ES2A 1DD2A 2EVBA 5C44B 2WB1G 4KHPQ 1IXRA 1U4LA 1AE2A 4R8NA 1OXXK 1X3PA 5CYUA 1B44D 4TSSA 1TWFB 1VQEA 3DEOA 1ESFA 3D6WA 1D5XC 4L63B 3VR6A 4DAYA 2R93G 5C5MA 1LTLA 3I90A 4QL5A 3K6OA 4OWTB 3U50C 4HEDA 4ZLTF 4MNOA 1LV9A 1EY5A 1H9JA 4A3MG 2Q8IB 1SFOB 5M5YH 3I7FA 5EKLA 2JYOA 4GOPA 1I4RA 1S40A 1QB5D 3Q23A 1BQQT 2QKIC 3OHXC 5CC4A 1B9NA 1SYDA 2UUBL 1B2TA 1CHQD 1NE3A 1F2LA 3CP0A 3KDFA 3T53B 5CV8A 2Z4IA 4CBVA 4DR4L 2N8NA 3SK8A 4YWLA 1Y69U 2GA4B 4BWGB 1D1KA 5FLXE 1GUOA 5J39A 3FKIB 3E9IA 1HNZL 2EJGC 2L0CA 1KNEA 2R7ZH 3MXUA 4DV0L 1L1OB 4LF8Q 4DV3L 3G48A 4JI0L 4GKKL 3H3VI 4X64L 3P75A 2R61A 2MUYA 5JEAG 4YWKA 3PUYA 4G7ZC 1PH9A 2DGYA 1C9OA 1TU2B 3D4DA 1KC8C 1FNWA 3H6MA 4A3CH 1IW7C 2FMCA 1S5DD 3MVVA 3BZCA 4V190 4Y52H 2F3IA 4EQOA 3E3XA 2VQEQ 3MHBA 3S1NH 4UHVA 3S24A 1G6ZA 3M4QA 3W2DA 4O0AA 4ME5A 2MHVA 2NTTA 4N9PA 1EQVA 3NK9A 4YHHQ 3FVQA 2EY2A 1ZKOA 5ELCA 2N49A 3O13A 4IQZA 4IPGA 4C3HB 1TWGH 5E7NA 1M4VA 4DK3C 1VQAA 2BA1A 4A3KH 2QDBA 4X3KA 5J1ZA 2EPBA 1JQYD 3HOWB 2ZTEA 4A3BB 1BKBA 1WOCA 4XXEA 5KNDA 1G291 2B2YA 1CKOA 3EFXD 1MI2A 4G4KA 4DV6Q 2UUCQ 3GTJH 2SDFA 2CQOA 2OQ0A 2ZTDA 4L5RC 5CV7A 2QDLA 2IX0A 2CH4A 4RGTA 3SK6A 1SYBA 3KF8A 3TREA 3RMHA 3NE5B 3QR8A 2EYLA 4NXNQ 5IY0A 1H9RA 4LF5Q 4H44C 1ZXTA 3D4RA 3RZDB 4BBSH 1B53A 4QCLA 1XMOQ 5IT9c 3Q24A 5JEAJ 4K0KL 5M5WB 4DR2Q 1NY4A 4H0LC 3SEBA 4PMCA 1G91A 1C0AA 5M3FG 3A55A 1PTOH 1N33Q 1XJVA 4L8JA 4K5VA 3TS0A 4E6IA 1VQOA 1A62A 3D31A 2BDOA 3GTQB 1JE4A 5JJKA 3SXHA 4DV4L 4R8IA 1UAPA 2L55A 2Z9HA 3CCJA 1LTBD 2OT2A 4DR5L 3OWEB 1CZWA 3K8AA 3I2ZA 4ALPA 2V4DA 1KLUD 3AYHB 4RAUC 3LWEA 4X65L 3CC7A 3S1QB 2NVQB 3HOXG 1XPUA 3HFZB 3G4SA 1A63A 4FYDA 1PRTF 2WP8J 4LF6Q 3X3MA 4O42A 1KL9A 1JOKA 5M5XH 2HT1A 4IUUA 2B2WA 2I07B 1STHA 2NN6I 1EFWA 1JJ2A 2WKCA 2K32A 5CV6A 1TR5A 4A3GB 4LFBL 4A3EG 1HUMA 3BZKA 2CW0D 3DWAA 1PFSA 3EBEA 4KY7A 1W3SA 3HOUG 2K5NA 2Y0SG 3N6RA 3U58A 4BXXH 4JOIA 4X3UA 3UDFA 2YTVA 2VS1A 1ML0D 3BVZA 2F0QA 2F0TA 2UU9L 1PA6A 4ABNA 2UUAL 2B63H 2I46A 5EBCA 1L1OA 2RA4A 1JJGA 4JBJA 1VMPA 5IGGA 2XN9C 4ZKBB 1GXDC 3K7AH 4NXMQ 3AEVA 4QMGA 5BR8L 1MD2D 1KNAA 3CC2A 1Q8KA 4DV2L 1I94Q 1RODA 5LMNW 4JI4Q 4CDFC 1STAA 2PO4A 2DY7A 4OHJA 1NBWA 2PQAB 2N3SA 1JOOA 3BYTB 5E4XA 4KY5A 4JI7Q 2Q2TA 4DGZA 3M4PA 3T1HL 3S14H 3VDYA 3PIP3 1IBKL 3RD4A 1D5ZC 1SMYC 1BXTA 1IL2A 4HIMA 3H0GG 2X6GA 3HOYG 3RNUA 1I50B 3NBIA 2PI2A 2JA6B 4A3JB 2HIXA 2KEDA 4DR3L 2PZTA 5LHY1 4KKUA 4JI3Q 3TZDA 5JAVA 2QF7A 2E5LL 2FINB 5KYIA 1J5EL 4DA2A 3NHHA 1DZ1A 4OIKA 5IODA 1CT1D 3A5UA 2MPMA 3GTOB 2Z6KC 2WV6D 3NWTA 1CUKA 2XWBB 3K80C 1HNXQ 4JC0A 1EIGA 2QW7A 1EL0A 5IYDH 3I70A 4DV5Q 4HMJA 4S3SA 1B8AA 2YU9H 2F0PA 1N34L 3I91A 4DN4M 2VXWA 4IURA 2I5LX 3OIQA 1EYAA 2L1BA 1JCKB 4LAAA 5EKIA 2F52A 3TEHB 3F2CA 1IYUA 3J80i 3I4MH 4DV7L 1KRSA 1U4MA 1EIHA 4C56C 3J81c 1BO0A 3FP9A 1A8VA 4DV1L 2R7DA 1KIXA 2PQEA 2R7ZG 1DOLA 2XTIA 3QOJA 5DM73 4C3JB 2A6HC 3K0XA 4HIOA 3PUZA 3EIVA 3CCQA 1AP0A 3HOVH 2F1MA 5A35A 1XNRL 2XIWA 2O2LD 3W1BA 5C3EG 1WTWA 2K6AA 3AU7A 3OMCA 4FXKC 4HN7A 5TSSA 1PZID 1C4QA 2PPBC
chains in the Genus database with same CATH topology
4B3RQ 2B63G 1X9NA 2R93H 4DR3Q 4GS3A 5GAEC 3D0FA 4WJ3M 3RLOA 2PI2E 2YTXA 4LF4Q 3AFPA 4LF9Q 3CAMA 2A8VA 2HQLA 4QIWE 1K83H 2QA4A 4A76A 1T9HA 3DM3A 3OYYA 1E1OA 2C35B 5IP7G 1UE7A 2KBNA 4DUYL 1VQ5A 2E5LQ 4A3MH 1VS0A 2K4KA 2YTYA 3GTMH 1E1TA 1OXSC 2NVTH 2LSSA 5LMUL 1J5EQ 4PMWA 2HHHQ 1HNWL 5LMNQ 3F8TA 1Q12A 4BY1H 3KOJA 2AWNA 4KI0A 1JJCB 4BBRH 3L7ZC 3NEMA 2JEBI 4PZ7A 1A0IA 1N36Q 2JA5H 4LF7Q 4KHPL 1TWCH 3F2BA 3HKZE 1WCMG 3S1MH 1N8RC 4AYBG 4LFCQ 1PYSB 4JI6L 1B7YB 3EN2A 3GO5A 3PO2H 3ULJA 3PUVA 2NVYH 4KHZA 4C3IH 3I4NG 1G51A 1X3EA 4JI8Q 1QVCA 5FJ8G 2OQKA 1HR0Q 4ME3A 4UPAA 2Q2UA 1WI5A 1H95A 2BH8A 3ULPA 4JI5Q 4QY7A 5FLXc 4O2DA 3CCSA 1N34Q 5AJ3Q 3OTOL 4OO1I 1D7QA 1MIUA 1VQJA 3PIOA 2IY5B 2E2JH 1YHBA 1X3FA 3B6YA 4UP8A 3RLNA 5IWAQ 4DUZL 2F4VL 1HH2P 1FGUA 3ZJYC 4DK6C 2OWOA 2Y0SE 3RZOH 1EIFA 2KCTA 3M4OH 3RLFA 2OTLA 4KLKA 2K75A 2VW9A 2JA7H 2K5HA 4IJHA 3CCMA 4JCVE 4DV7Q 2ZJQA 1HZCA 3JC66 4TQUS 3CCLA 2UXDQ 4DR6L 2OTJA 1JE5A 3WWVA 3CCRA 3M85A 3S16H 1BBWA 1MJCA 3K7UC 1R9TH 2LXJA 1CSQA 2WAQE 5C44H 2PQAA 3GD7A 5IYDG 1Q86C 4DR7Q 1ASYA 1JT8A 1TXYA 1QZHA 2E8GA 5GAGC 2VL6A 4BA1I 1W2BA 2DUDA 4JV5Q 1VQKA 2GVAA 5HY6A 5IYBG 2RHQB 1XNRQ 4AH6A 2D0OA 4P73A 1V43A 4YCWA 4PG3A 3RR5A 2ZM6Q 1JMCA 2ASBA 4UP7A 4LFAQ 4LF8L 2JEAI 3I55A 4A3IG 4P74A 4LFCL 1WFQA 2E2IH 4GOPC 1UEBA 4IFDI 4X66L 3GDEA 2ZJRA 3I4MG 4HJ8A 3PO3H 4BY7G 4HIDA 2ZTCA 4AQYL 4GLVB 1SFOH 4A3BH 2NN6G 1OXTA 1VQMA 3FHWA 4IFDJ 2K14A 4B3ML 2GVBA 2JA8G 4DUYQ 1K0RA 3ICEA 2R92G 4DPGA 3UE1A 1S72A 1TWHH 1O7IA 4OWWB 4YWMA 5LMUQ 1HNWQ 3NELA 4LNQA 3HOVG 4X6AH 1UWVA 2VQEL 2ES2A 3CPWA 4DR1L 2WB1G 4LUZA 3S2DH 4KHPQ 1IXRA 5IP9G 1AE2A 2RCNA 1N9WA 2VZAA 1KAWA 1BBUA 1OXXK 2CFMA 2N78A 4IPDA 1YITA 4JI6Q 2VQFL 3FKIH 4A93G 4P71A 1OXUA 1PH7A 4YHHL 1GO3E 3J81j 1VQEA 1D8LA 1PH6A 3L0OA 3W5OA 1Y1WH 5K36G 4X62L 3PV0A 1L2FA 2R93G 2I0QA 1UE5A 1LTLA 4QL5A 3U50C 4OWTB 2Q2HA 3OTOQ 3G71A 4JV5L 1Q81C 2IT1A 4MNOA 1KXLA 4HIKA 1SLJA 2I5MX 2LXKA 4DUZQ 1E24A 3LGJA 1Q82C 5C4XH 2F4VQ 4A3MG 5M5YH 2ZM6L 3I7FA 4IO9A 4GOPA 4DV6L 1YVCA 4BY1G 2ZJPA 1S40A 2UUCL 4L5QA 1SMXA 4BBRG 1XNQQ 2VNUD 3KYHC 4EX5A 2JA5G 3PF4A 4DR6Q 2UUBL 1NE3A 1P16A 1VQCA 1E7ZA 3KDFA 3CP0A 4NB3A 4YCVA 5C0XI 3PO2G 1VQ6A 3Q8DA 4DR4L 2N8NA 4YWLA 3HKZG 3E9HA 4NXNL 4GLXA 1KQSA 1AH9A 3KF6B 4LF5L 1V1QA 1YNXA 5C0XJ 1EQRA 4IJLA 3E9IA 1HNZL 5GAHC 1X54A 3PF5A 1UE1A 1YI2A 1XMOL 1SROA 1L0WA 4A3FG 4C3HH 1OXVA 2Z0SA 1QVFA 2KCMA 4UP9A 4RG1A 2R7ZH 4DR2L 4DV0L 1L1OB 4A75A 4LF8Q 4B3SL 4DV3L 1K3RA 2VUMG 3G48A 3GTPH 3HOXH 4L5SA 3ER0A 4JYAL 4JI0L 4GKKL 2NZHA 3H3VI 1YBYA 2JJQA 4X64L 5JEAG 4X66Q 1PH9A 4YWKA 3PUYA 4MZ9A 2H5XA 2WFWA 1N33L 2JA7G 2DGYA 1U0LA 5EAYA 4DAMA 1C9OA 4AQYQ 1KC8C 2L15A 1XTDA 1FL0A 2K50A 4B3MQ 4A3CH 4R4TA 3CMEA 3IRBA 3PGZA 1X3GA 4GN5A 4JG2A 5C44G 2FXQA 4JI1L 1K73C 3GTLH 1PH1A 1YHAA 3BZCA 3I56A 4Y52H 1QUQB 1VQ8A 2F3IA 4IPCA 1C7YA 2VQEQ 3W1GA 2E2HH 4DR1Q 3S1NH 4A3EH 2IHFA 4C2MH 3KJPA 5JJLA 2NVXH 3S24A 1KD1C 3HOUH 4GKJL 3M4QA 1XNQL 3A5ZB 2AHOB 2ID0A 2RF4A 1IYJB 4LUOA 4O0AA 4A4IA 4AIMA 2VQFQ 4IOCA 3RZDH 4YHHQ 3KLWA 2N49A 4AYBE 4IPGA 2JK8A 4X62Q 1TWGH 5E7NA 1RIPA 2CKZB 5M5WH 4DK3C 4LF6L 2EIFA 1VQAA 3PO3G 1IZ6A 2BA1A 2OCEA 4A3KH 1HJPA 2ALYB 3DLLA 2ZTEA 4PZ8A 4XTCS 2AWOA 1TWFH 1Q1BA 3BJUA 1BKBA 1WOCA 2YV5A 4YY3Q 1FJGL 2CCZA 1G291 4OWXB 1M90C 1CKOA 3GTQH 4JBWA 3F1ZA 5H1SE 2BH2A 4DV6Q 4POFA 2UUCQ 3GTJH 1K8AC 2CQOA 2OQ0A 2ZTDA 1QZGA 4L5RC 1CSPA 1X65A 4WJ4A 2UUBQ 1KHIA 1PH2A 2IX0A 1PH3A 1CKNB 2YYZA 3FKIG 2Q2IA 1E3PA 4DR4Q 3TREA 5GROA 2R7FA 4LW1A 4NXNQ 5IY0A 3H0GH 3RN2A 1YZ6A 2K5VA 4R4IA 4A3DH 4LF5Q 3HOYH 2BA0A 1VQPA 1GD7A 1Q1EA 4HJ7A 5ELNA 1HNZQ 3MEFA 4OXPA 4HJ5A 2NVQH 3S1QH 4BBSH 1Y1VG 2AKWB 1XMOQ 5IT9c 5JEAJ 4K0KL 3E0EA 4DR2Q 1NY4A 4DV0Q 2D0PA 4NXML 4B3SQ 4DV3Q 5M3MH 5C4XG 1VQGA 4JYAQ 1C0AA 4GNXC 1K8GA 5M3FG 1I94L 4JI0Q 4JI4L 4GKKQ 1EOVA 4A3LH 1VQIA 1G6PA 4P75A 1Z9FA 4GLAC 4X64Q 1N33Q 1XJVA 1Q46A 3TS0A 4JI7L 2JQOA 4OX9L 1NJIC 4QJFA 1VQOA 1A62A 1LYLA 3M7NA 3S15H 1U5KA 2KHJA 3D31A 3PUXA 5JJKA 1Q7YC 3CQZH 4A3GH 4DV4L 4A3IH 4JI1Q 5FLMH 1E22A 1TWAH 3CCJA 1IBMQ 4DR5L 4YY3L 4DKAC 1VQFA 3L2PA 4PZ6A 2QEXA 4GOPB 4EQ5A 1IBLL 2RHSB 3K8AA 3I2ZA 5GADC 4GKJQ 4OO1G 4APVA 3ERSX 4ALPA 3OW2A 3AYHB 2R92H 1WJJA 4JI3L 2MO0A 1HZBA 4X65L 4J15A 1GKHA 3CC7A 1YEZA 4IOAA 3MXNB 3NBHB 3HOXG 3CMAA 1XPUA 2CWPA 3HFZB 3G4SA 1A63A 3H3VH 4A3BG 2Z6KA 1XMQL 2WP8J 4LF6Q 1KL9A 2EQSA 1CKMA 1AE3A 5M5XH 2HT1A 4A3CG 1EQQA 3PSIA 3PIPA 1PYBA 2NN6I 4JI2L 5IYCH 1EFWA 3H15A 3TRZA 1JJ2A 1FJGQ 3PUWA 4R4OA 3CXCA 4GNXA 3BU2A 1V9PA 3HKSA 4LWCA 4DV5L 4LFBL 4A3EG 4JBKA 3HOWH 3TQYA 3BZKA 1Y14B 1PFSA 3EBEA 3HOUG 1W3SA 2K5NA 1Z47A 2Y0SG 3CCUA 3UE0A 3U58A 4BXXH 4JOIA 1YJWA 1SN8A 3I4OA 1I50H 2JA6H 3KF6A 1RL2A 4NPSA 3UDFA 4A3JH 1GM5A 5C3EH 1VQ7A 1ASZA 2YTVA 3AFQA 4UY8C 2VS1A 4IFDG 4H02A 4TVAB 2VY3A 4HJ9A 3HOZH 1IBML 4IPHA 2UU9L 1PA6A 1N32Q 2CWAA 4LUVA 2WAQG 2UUAL 2B63H 1JJGA 1L1OA 4A3KG 1PV4A 4JBJA 3J7A5 5J3BA 3F2DA 2QGQA 1VQ4A 1XPOA 4K0KQ 3CPFA 4R4CA 3K7AH 3J7ZC 2D62A 4NXMQ 1EUJA 3AEVA 4QQBX 3GTOH 5IP7H 5BR8L 3TS2A 3CC2A 1Q8KA 3G6EA 4DV2L 1I94Q 5LMNW 4JBMA 4JI4Q 1NTGA 1NBWA 4GN4B 5HGQA 2PQAB 2N3SA 4FDBA 3CCEA 3RN5A 2Q2TA 4JI7Q 4OX9Q 3CD6A 3U4VA 3M4PA 3T1HL 4A3FH 4HJAA 3S14H 3VDYA 1VQNA 1QUQA 1S3OA 1IBKL 1WCMH 4DV4Q 1PH4A 2VUMH 4B3TQ 2UXBL 3UDXA 2KHIA 3KFUA 1YJ9A 1PH8A 1IL2A 1HZAA 3T1YL 4HIMA 1EIYB 3H0GG 1YJNA 1HR0W 4OONA 3I4NH 4A3DG 3PCOB 4DR5Q 1YIJA 5FJ8H 1PH5A 3HOYG 1P8LA 1SE8A 3RNUA 3GTGH 1I3QH 2PI2A 2B29A 1NMGA 4B3RL 2MQHA 2UXCL 1QVGA 1VCIA 1IBLQ 2HIXA 4BA2I 4BBSG 4DR3L 1VQBA 1M1KC 4DV1Q 4LF4L 4LF9L 1UE6A 1I5FA 3A74A 1X6OA 4JI3Q 4X65Q 5M3MG 1PHJA 2GN5A 2E5LL 3GTKH 1BVSA 4QGUA 4A3LG 1EWIA 3KF8B 4RMFA 1NMFA 2PMZE 1J5EL 1GVPA 2HHHL 2MO1A 3K81C 3STBC 5LMNL 1XMQQ 1J6QA 1X56A 1JB7A 3A5UA 3CW2C 1Y1WG 2EXDA 2Z6KC 2IHEA 2HIVA 4C3JH 1N32L 4LF7L 1N36L 1CUKA 4A3GG 5C0XG 4Y7NH 4JI2Q 3K80C 1HNXQ 1X55A 2V1CC 4JC0A 5FLMG 1YHQA 5IYDH 1KRTA 4JI8L 4DV5Q 3A0JA 2JA9A 4R4QA 1HR0L 4LFBQ 3S1RH 1LUZA 1CKNA 2B3GA 5IYBH 1B8AA 3J81i 4JI5L 2YU9H 1N34L 1B70B 5AJ3L 2I5LX 4DAYB 2UXCQ 1XPRA 2F52A 4R1JA 4JOIC 2JE6I 3TEHB 5IWAL 3F2CA 2NZOA 3CCVA 4B3TL 2ATWA 4DNIA 2XGTA 2MFIA 5IE8A 3J80i 2UU9Q 1MKHA 4P72A 2UUAQ 3I4MH 3S17H 5GQOA 3UDIA 4DV7L 4BY7H 1KRSA 3JAMi 4YCUA 2UXDL 1FVIA 1WYDA 3J81c 1VQHA 1LM0A 1L1OC 4GN3B 5DLQE 2PNHA 5IYCG 1VQ9A 3FP9A 1A8VA 4DV1L 2IX1A 2R7DA 5BR8Q 1KIXA 2JA8H 3ULLA 3S2HH 5JJIA 3STBD 2R7ZG 4DR7L 1MJEA 4DV2Q 2XTIA 1DGSA 2WB1E 3AQQA 2MNAA 3K0XA 4HIOA 3PUZA 3KDFB 2K52A 2KENA 2I5HA 3EIVA 3SGIA 3CCQA 3HOVH 1K9MC 3HOWG 1SRUA 3U4ZA 1Y1VH 3M9BA 3KJOA 5C4JH 3J80c 2A19A 1VQLA 1XNRL 3T1HQ 1HZ9A 4L5TA 1OTCA 3M3YH 5IP9H 5ELOA 4BXXG 2A1AA 1IBKQ 3JAMc 3W1BA 1EYGA 3UDGA 2JA6G 2UXBQ 4A3JG 3CC4A 2R6GA 5C3EG 1PVOA 5M3FH 1VQDA 4LFAL 4A93H 3T1YQ 1SR3A 1HNXL 3CF5A 3NENA 1I6HH 3HOZG 4POGA 2AMCB 4GNXB 4XIGS 4MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R Q;  2B63 G;  1X9N A;  2R93 H;  4DR3 Q;  4GS3 A;  5GAE C;  3D0F A;  4WJ3 M;  3RLO A;  2PI2 E;  2YTX A;  4LF4 Q;  3AFP A;  4LF9 Q;  3CAM A;  2A8V A;  2HQL A;  4QIW E;  1K83 H;  2QA4 A;  4A76 A;  1T9H A;  3DM3 A;  3OYY A;  1E1O A;  2C35 B;  5IP7 G;  1UE7 A;  2KBN A;  4DUY L;  1VQ5 A;  2E5L Q;  4A3M H;  1VS0 A;  2K4K A;  2YTY A;  3GTM H;  1E1T A;  1OXS C;  2NVT H;  2LSS A;  5LMU L;  1J5E Q;  4PMW A;  2HHH Q;  1HNW L;  5LMN Q;  3F8T A;  1Q12 A;  4BY1 H;  3KOJ A;  2AWN A;  4KI0 A;  1JJC B;  4BBR H;  3L7Z C;  3NEM A;  2JEB I;  4PZ7 A;  1A0I A;  1N36 Q;  2JA5 H;  4LF7 Q;  4KHP L;  1TWC H;  3F2B A;  3HKZ E;  1WCM G;  3S1M H;  1N8R C;  4AYB G;  4LFC Q;  1PYS B;  4JI6 L;  1B7Y B;  3EN2 A;  3GO5 A;  3PO2 H;  3ULJ A;  3PUV A;  2NVY H;  4KHZ A;  4C3I H;  3I4N G;  1G51 A;  1X3E A;  4JI8 Q;  1QVC A;  5FJ8 G;  2OQK A;  1HR0 Q;  4ME3 A;  4UPA A;  2Q2U A;  1WI5 A;  1H95 A;  2BH8 A;  3ULP A;  4JI5 Q;  4QY7 A;  5FLX c;  4O2D A;  3CCS A;  1N34 Q;  5AJ3 Q;  3OTO L;  4OO1 I;  1D7Q A;  1MIU A;  1VQJ A;  3PIO A;  2IY5 B;  2E2J H;  1YHB A;  1X3F A;  3B6Y A;  4UP8 A;  3RLN A;  5IWA Q;  4DUZ L;  2F4V L;  1HH2 P;  1FGU A;  3ZJY C;  4DK6 C;  2OWO A;  2Y0S E;  3RZO H;  1EIF A;  2KCT A;  3M4O H;  3RLF A;  2OTL A;  4KLK A;  2K75 A;  2VW9 A;  2JA7 H;  2K5H A;  4IJH A;  3CCM A;  4JCV E;  4DV7 Q;  2ZJQ A;  1HZC A;  3JC6 6;  4TQU S;  3CCL A;  2UXD Q;  4DR6 L;  2OTJ A;  1JE5 A;  3WWV A;  3CCR A;  3M85 A;  3S16 H;  1BBW A;  1MJC A;  3K7U C;  1R9T H;  2LXJ A;  1CSQ A;  2WAQ E;  5C44 H;  2PQA A;  3GD7 A;  5IYD G;  1Q86 C;  4DR7 Q;  1ASY A;  1JT8 A;  1TXY A;  1QZH A;  2E8G A;  5GAG C;  2VL6 A;  4BA1 I;  1W2B A;  2DUD A;  4JV5 Q;  1VQK A;  2GVA A;  5HY6 A;  5IYB G;  2RHQ B;  1XNR Q;  4AH6 A;  2D0O A;  4P73 A;  1V43 A;  4YCW A;  4PG3 A;  3RR5 A;  2ZM6 Q;  1JMC A;  2ASB A;  4UP7 A;  4LFA Q;  4LF8 L;  2JEA I;  3I55 A;  4A3I G;  4P74 A;  4LFC L;  1WFQ A;  2E2I H;  4GOP C;  1UEB A;  4IFD I;  4X66 L;  3GDE A;  2ZJR A;  3I4M G;  4HJ8 A;  3PO3 H;  4BY7 G;  4HID A;  2ZTC A;  4AQY L;  4GLV B;  1SFO H;  4A3B H;  2NN6 G;  1OXT A;  1VQM A;  3FHW A;  4IFD J;  2K14 A;  4B3M L;  2GVB A;  2JA8 G;  4DUY Q;  1K0R A;  3ICE A;  2R92 G;  4DPG A;  3UE1 A;  1S72 A;  1TWH H;  1O7I A;  4OWW B;  4YWM A;  5LMU Q;  1HNW Q;  3NEL A;  4LNQ A;  3HOV G;  4X6A H;  1UWV A;  2VQE L;  2ES2 A;  3CPW A;  4DR1 L;  2WB1 G;  4LUZ A;  3S2D H;  4KHP Q;  1IXR A;  5IP9 G;  1AE2 A;  2RCN A;  1N9W A;  2VZA A;  1KAW A;  1BBU A;  1OXX K;  2CFM A;  2N78 A;  4IPD A;  1YIT A;  4JI6 Q;  2VQF L;  3FKI H;  4A93 G;  4P71 A;  1OXU A;  1PH7 A;  4YHH L;  1GO3 E;  3J81 j;  1VQE A;  1D8L A;  1PH6 A;  3L0O A;  3W5O A;  1Y1W H;  5K36 G;  4X62 L;  3PV0 A;  1L2F A;  2R93 G;  2I0Q A;  1UE5 A;  1LTL A;  4QL5 A;  3U50 C;  4OWT B;  2Q2H A;  3OTO Q;  3G71 A;  4JV5 L;  1Q81 C;  2IT1 A;  4MNO A;  1KXL A;  4HIK A;  1SLJ A;  2I5M X;  2LXK A;  4DUZ Q;  1E24 A;  3LGJ A;  1Q82 C;  5C4X H;  2F4V Q;  4A3M G;  5M5Y H;  2ZM6 L;  3I7F A;  4IO9 A;  4GOP A;  4DV6 L;  1YVC A;  4BY1 G;  2ZJP A;  1S40 A;  2UUC L;  4L5Q A;  1SMX A;  4BBR G;  1XNQ Q;  2VNU D;  3KYH C;  4EX5 A;  2JA5 G;  3PF4 A;  4DR6 Q;  2UUB L;  1NE3 A;  1P16 A;  1VQC A;  1E7Z A;  3KDF A;  3CP0 A;  4NB3 A;  4YCV A;  5C0X I;  3PO2 G;  1VQ6 A;  3Q8D A;  4DR4 L;  2N8N A;  4YWL A;  3HKZ G;  3E9H A;  4NXN L;  4GLX A;  1KQS A;  1AH9 A;  3KF6 B;  4LF5 L;  1V1Q A;  1YNX A;  5C0X J;  1EQR A;  4IJL A;  3E9I A;  1HNZ L;  5GAH C;  1X54 A;  3PF5 A;  1UE1 A;  1YI2 A;  1XMO L;  1SRO A;  1L0W A;  4A3F G;  4C3H H;  1OXV A;  2Z0S A;  1QVF A;  2KCM A;  4UP9 A;  4RG1 A;  2R7Z H;  4DR2 L;  4DV0 L;  1L1O B;  4A75 A;  4LF8 Q;  4B3S L;  4DV3 L;  1K3R A;  2VUM G;  3G48 A;  3GTP H;  3HOX H;  4L5S A;  3ER0 A;  4JYA L;  4JI0 L;  4GKK L;  2NZH A;  3H3V I;  1YBY A;  2JJQ A;  4X64 L;  5JEA G;  4X66 Q;  1PH9 A;  4YWK A;  3PUY A;  4MZ9 A;  2H5X A;  2WFW A;  1N33 L;  2JA7 G;  2DGY A;  1U0L A;  5EAY A;  4DAM A;  1C9O A;  4AQY Q;  1KC8 C;  2L15 A;  1XTD A;  1FL0 A;  2K50 A;  4B3M Q;  4A3C H;  4R4T A;  3CME A;  3IRB A;  3PGZ A;  1X3G A;  4GN5 A;  4JG2 A;  5C44 G;  2FXQ A;  4JI1 L;  1K73 C;  3GTL H;  1PH1 A;  1YHA A;  3BZC A;  3I56 A;  4Y52 H;  1QUQ B;  1VQ8 A;  2F3I A;  4IPC A;  1C7Y A;  2VQE Q;  3W1G A;  2E2H H;  4DR1 Q;  3S1N H;  4A3E H;  2IHF A;  4C2M H;  3KJP A;  5JJL A;  2NVX H;  3S24 A;  1KD1 C;  3HOU H;  4GKJ L;  3M4Q A;  1XNQ L;  3A5Z B;  2AHO B;  2ID0 A;  2RF4 A;  1IYJ B;  4LUO A;  4O0A A;  4A4I A;  4AIM A;  2VQF Q;  4IOC A;  3RZD H;  4YHH Q;  3KLW A;  2N49 A;  4AYB E;  4IPG A;  2JK8 A;  4X62 Q;  1TWG H;  5E7N A;  1RIP A;  2CKZ B;  5M5W H;  4DK3 C;  4LF6 L;  2EIF A;  1VQA A;  3PO3 G;  1IZ6 A;  2BA1 A;  2OCE A;  4A3K H;  1HJP A;  2ALY B;  3DLL A;  2ZTE A;  4PZ8 A;  4XTC S;  2AWO A;  1TWF H;  1Q1B A;  3BJU A;  1BKB A;  1WOC A;  2YV5 A;  4YY3 Q;  1FJG L;  2CCZ A;  1G29 1;  4OWX B;  1M90 C;  1CKO A;  3GTQ H;  4JBW A;  3F1Z A;  5H1S E;  2BH2 A;  4DV6 Q;  4POF A;  2UUC Q;  3GTJ H;  1K8A C;  2CQO A;  2OQ0 A;  2ZTD A;  1QZG A;  4L5R C;  1CSP A;  1X65 A;  4WJ4 A;  2UUB Q;  1KHI A;  1PH2 A;  2IX0 A;  1PH3 A;  1CKN B;  2YYZ A;  3FKI G;  2Q2I A;  1E3P A;  4DR4 Q;  3TRE A;  5GRO A;  2R7F A;  4LW1 A;  4NXN Q;  5IY0 A;  3H0G H;  3RN2 A;  1YZ6 A;  2K5V A;  4R4I A;  4A3D H;  4LF5 Q;  3HOY H;  2BA0 A;  1VQP A;  1GD7 A;  1Q1E A;  4HJ7 A;  5ELN A;  1HNZ Q;  3MEF A;  4OXP A;  4HJ5 A;  2NVQ H;  3S1Q H;  4BBS H;  1Y1V G;  2AKW B;  1XMO Q;  5IT9 c;  5JEA J;  4K0K L;  3E0E A;  4DR2 Q;  1NY4 A;  4DV0 Q;  2D0P A;  4NXM L;  4B3S Q;  4DV3 Q;  5M3M H;  5C4X G;  1VQG A;  4JYA Q;  1C0A A;  4GNX C;  1K8G A;  5M3F G;  1I94 L;  4JI0 Q;  4JI4 L;  4GKK Q;  1EOV A;  4A3L H;  1VQI A;  1G6P A;  4P75 A;  1Z9F A;  4GLA C;  4X64 Q;  1N33 Q;  1XJV A;  1Q46 A;  3TS0 A;  4JI7 L;  2JQO A;  4OX9 L;  1NJI C;  4QJF A;  1VQO A;  1A62 A;  1LYL A;  3M7N A;  3S15 H;  1U5K A;  2KHJ A;  3D31 A;  3PUX A;  5JJK A;  1Q7Y C;  3CQZ H;  4A3G H;  4DV4 L;  4A3I H;  4JI1 Q;  5FLM H;  1E22 A;  1TWA H;  3CCJ A;  1IBM Q;  4DR5 L;  4YY3 L;  4DKA C;  1VQF A;  3L2P A;  4PZ6 A;  2QEX A;  4GOP B;  4EQ5 A;  1IBL L;  2RHS B;  3K8A A;  3I2Z A;  5GAD C;  4GKJ Q;  4OO1 G;  4APV A;  3ERS X;  4ALP A;  3OW2 A;  3AYH B;  2R92 H;  1WJJ A;  4JI3 L;  2MO0 A;  1HZB A;  4X65 L;  4J15 A;  1GKH A;  3CC7 A;  1YEZ A;  4IOA A;  3MXN B;  3NBH B;  3HOX G;  3CMA A;  1XPU A;  2CWP A;  3HFZ B;  3G4S A;  1A63 A;  3H3V H;  4A3B G;  2Z6K A;  1XMQ L;  2WP8 J;  4LF6 Q;  1KL9 A;  2EQS A;  1CKM A;  1AE3 A;  5M5X H;  2HT1 A;  4A3C G;  1EQQ A;  3PSI A;  3PIP A;  1PYB A;  2NN6 I;  4JI2 L;  5IYC H;  1EFW A;  3H15 A;  3TRZ A;  1JJ2 A;  1FJG Q;  3PUW A;  4R4O A;  3CXC A;  4GNX A;  3BU2 A;  1V9P A;  3HKS A;  4LWC A;  4DV5 L;  4LFB L;  4A3E G;  4JBK A;  3HOW H;  3TQY A;  3BZK A;  1Y14 B;  1PFS A;  3EBE A;  3HOU G;  1W3S A;  2K5N A;  1Z47 A;  2Y0S G;  3CCU A;  3UE0 A;  3U58 A;  4BXX H;  4JOI A;  1YJW A;  1SN8 A;  3I4O A;  1I50 H;  2JA6 H;  3KF6 A;  1RL2 A;  4NPS A;  3UDF A;  4A3J H;  1GM5 A;  5C3E H;  1VQ7 A;  1ASZ A;  2YTV A;  3AFQ A;  4UY8 C;  2VS1 A;  4IFD G;  4H02 A;  4TVA B;  2VY3 A;  4HJ9 A;  3HOZ H;  1IBM L;  4IPH A;  2UU9 L;  1PA6 A;  1N32 Q;  2CWA A;  4LUV A;  2WAQ G;  2UUA L;  2B63 H;  1JJG A;  1L1O A;  4A3K G;  1PV4 A;  4JBJ A;  3J7A 5;  5J3B A;  3F2D A;  2QGQ A;  1VQ4 A;  1XPO A;  4K0K Q;  3CPF A;  4R4C A;  3K7A H;  3J7Z C;  2D62 A;  4NXM Q;  1EUJ A;  3AEV A;  4QQB X;  3GTO H;  5IP7 H;  5BR8 L;  3TS2 A;  3CC2 A;  1Q8K A;  3G6E A;  4DV2 L;  1I94 Q;  5LMN W;  4JBM A;  4JI4 Q;  1NTG A;  1NBW A;  4GN4 B;  5HGQ A;  2PQA B;  2N3S A;  4FDB A;  3CCE A;  3RN5 A;  2Q2T A;  4JI7 Q;  4OX9 Q;  3CD6 A;  3U4V A;  3M4P A;  3T1H L;  4A3F H;  4HJA A;  3S14 H;  3VDY A;  1VQN A;  1QUQ A;  1S3O A;  1IBK L;  1WCM H;  4DV4 Q;  1PH4 A;  2VUM H;  4B3T Q;  2UXB L;  3UDX A;  2KHI A;  3KFU A;  1YJ9 A;  1PH8 A;  1IL2 A;  1HZA A;  3T1Y L;  4HIM A;  1EIY B;  3H0G G;  1YJN A;  1HR0 W;  4OON A;  3I4N H;  4A3D G;  3PCO B;  4DR5 Q;  1YIJ A;  5FJ8 H;  1PH5 A;  3HOY G;  1P8L A;  1SE8 A;  3RNU A;  3GTG H;  1I3Q H;  2PI2 A;  2B29 A;  1NMG A;  4B3R L;  2MQH A;  2UXC L;  1QVG A;  1VCI A;  1IBL Q;  2HIX A;  4BA2 I;  4BBS G;  4DR3 L;  1VQB A;  1M1K C;  4DV1 Q;  4LF4 L;  4LF9 L;  1UE6 A;  1I5F A;  3A74 A;  1X6O A;  4JI3 Q;  4X65 Q;  5M3M G;  1PHJ A;  2GN5 A;  2E5L L;  3GTK H;  1BVS A;  4QGU A;  4A3L G;  1EWI A;  3KF8 B;  4RMF A;  1NMF A;  2PMZ E;  1J5E L;  1GVP A;  2HHH L;  2MO1 A;  3K81 C;  3STB C;  5LMN L;  1XMQ Q;  1J6Q A;  1X56 A;  1JB7 A;  3A5U A;  3CW2 C;  1Y1W G;  2EXD A;  2Z6K C;  2IHE A;  2HIV A;  4C3J H;  1N32 L;  4LF7 L;  1N36 L;  1CUK A;  4A3G G;  5C0X G;  4Y7N H;  4JI2 Q;  3K80 C;  1HNX Q;  1X55 A;  2V1C C;  4JC0 A;  5FLM G;  1YHQ A;  5IYD H;  1KRT A;  4JI8 L;  4DV5 Q;  3A0J A;  2JA9 A;  4R4Q A;  1HR0 L;  4LFB Q;  3S1R H;  1LUZ A;  1CKN A;  2B3G A;  5IYB H;  1B8A A;  3J81 i;  4JI5 L;  2YU9 H;  1N34 L;  1B70 B;  5AJ3 L;  2I5L X;  4DAY B;  2UXC Q;  1XPR A;  2F52 A;  4R1J A;  4JOI C;  2JE6 I;  3TEH B;  5IWA L;  3F2C A;  2NZO A;  3CCV A;  4B3T L;  2ATW A;  4DNI A;  2XGT A;  2MFI A;  5IE8 A;  3J80 i;  2UU9 Q;  1MKH A;  4P72 A;  2UUA Q;  3I4M H;  3S17 H;  5GQO A;  3UDI A;  4DV7 L;  4BY7 H;  1KRS A;  3JAM i;  4YCU A;  2UXD L;  1FVI A;  1WYD A;  3J81 c;  1VQH A;  1LM0 A;  1L1O C;  4GN3 B;  5DLQ E;  2PNH A;  5IYC G;  1VQ9 A;  3FP9 A;  1A8V A;  4DV1 L;  2IX1 A;  2R7D A;  5BR8 Q;  1KIX A;  2JA8 H;  3ULL A;  3S2H H;  5JJI A;  3STB D;  2R7Z G;  4DR7 L;  1MJE A;  4DV2 Q;  2XTI A;  1DGS A;  2WB1 E;  3AQQ A;  2MNA A;  3K0X A;  4HIO A;  3PUZ A;  3KDF B;  2K52 A;  2KEN A;  2I5H A;  3EIV A;  3SGI A;  3CCQ A;  3HOV H;  1K9M C;  3HOW G;  1SRU A;  3U4Z A;  1Y1V H;  3M9B A;  3KJO A;  5C4J H;  3J80 c;  2A19 A;  1VQL A;  1XNR L;  3T1H Q;  1HZ9 A;  4L5T A;  1OTC A;  3M3Y H;  5IP9 H;  5ELO A;  4BXX G;  2A1A A;  1IBK Q;  3JAM c;  3W1B A;  1EYG A;  3UDG A;  2JA6 G;  2UXB Q;  4A3J G;  3CC4 A;  2R6G A;  5C3E G;  1PVO A;  5M3F H;  1VQD A;  4LFA L;  4A93 H;  3T1Y Q;  1SR3 A;  1HNX L;  3CF5 A;  3NEN A;  1I6H H;  3HOZ G;  4POG A;  2AMC B;  4GNX B;  4XIG S;  4MTN A; 
#chains in the Genus database with same CATH topology
 3E6Z X;  2R93 H;  2F0O A;  2B2V A;  3CAM A;  1WTP A;  4DUY L;  2F0U A;  2KBN A;  4BY7 B;  4FXG C;  4KN7 C;  4A3M H;  1OXS C;  2LSS A;  4PMW A;  3SVM A;  2JA8 B;  5IT9 L;  4KI0 A;  1A15 A;  1EZ8 A;  4PZ7 A;  4KHP L;  4FXD A;  1WCM G;  3S1M H;  4LFC Q;  1DON A;  1Y1V B;  4PMB A;  3I4N G;  5I9O A;  4JI8 Q;  2B39 A;  5FJ8 G;  4HR7 B;  1HR0 Q;  1PRT C;  5I6W A;  5FLX c;  4O2D A;  1I6H B;  5FO7 B;  2CVR A;  2EYF A;  3VR2 A;  4UP8 A;  3NQI A;  4KKT A;  1FGU A;  4RKB A;  3OMG A;  3OWF A;  4KLK A;  3QJY A;  2F0V A;  1JIC A;  3OW7 A;  2ZJQ A;  2L12 A;  2F0H A;  2NVT B;  2OTJ A;  2XWJ B;  4BY1 B;  2PQA A;  1Q86 C;  4DR7 Q;  5JOB A;  1SYF A;  2E8G A;  5GAG C;  1EOT A;  1VQK A;  1H9M A;  3OOC A;  5HY6 A;  3SR1 A;  2M00 A;  2K5Q A;  2H1E A;  2D0O A;  1V43 A;  4FO2 A;  1ICF B;  3CRL C;  1I4H A;  2G9D A;  2ZM6 Q;  1F2Z A;  1QIL A;  4LF8 L;  4KKS A;  3PMF A;  5C4H A;  1ILP A;  1L0X B;  3P1H A;  1U9R A;  4HJ8 A;  1SDF A;  4K14 A;  3SDZ A;  2FMM A;  3PIO 3;  1OXT A;  2EE1 A;  2BDN A;  2K14 A;  1LTR D;  2GVB A;  1K0R A;  5KRU A;  2Q8T A;  1TWH H;  1O7I A;  4OWW B;  3NEL A;  3S16 B;  4PNY A;  1HA6 A;  2VQE L;  3JAM E;  3S2D H;  1V8Q A;  1HRJ A;  2RCN A;  3T56 B;  2CFM A;  4A93 G;  3MZ5 A;  4YHH L;  1GO3 E;  2K7V A;  1PH6 A;  2BCO A;  5K36 G;  1Y1W H;  3PV0 A;  5IGE A;  2KVM A;  2I0Q A;  4JV5 L;  2IT1 A;  5JPN C;  2I5M X;  2EYP A;  3LGJ A;  1Q82 C;  2F4V Q;  4TRD A;  5BN3 A;  4JPB W;  4KMU C;  2JXM B;  1I4P A;  4DV6 L;  2PW7 A;  4XT3 B;  2UUC L;  2BOS A;  3SK4 A;  4BBR G;  3KYH C;  3H3V C;  4EX5 A;  3PF4 A;  1R4Q B;  1P16 A;  1VQC A;  3MXN A;  3PO2 G;  4C3I G;  4ZUJ A;  3HKZ G;  4NXN L;  1PTO D;  1QNU A;  4LF5 L;  1YNX A;  4ZYS A;  4FVM A;  5GAH C;  1XMO L;  5EPK A;  3NPP A;  2KCM A;  4DR2 L;  1PMR A;  2QEJ C;  4A75 A;  5A2Q E;  3SK5 A;  3HOX H;  4L5S A;  1F9S A;  2NZH A;  3M7G A;  1YBY A;  2JJQ A;  3NXW A;  2EXZ A;  1N33 L;  2WFW A;  2JA7 G;  2QIL A;  5C4X B;  4AQY Q;  4N8X 1;  1FL0 A;  3C3L A;  3QG1 A;  5CBE E;  3PGZ A;  1K73 C;  5C44 G;  2A68 D;  1KLG D;  2NBF A;  1YHA A;  3K5L A;  2F0M A;  3I56 A;  3TP7 A;  4RHR A;  5DNF A;  1B9M A;  1TY0 A;  1S5C D;  2AQ3 B;  1EU3 A;  1EY0 A;  2E2H H;  4A3E H;  3C1F A;  4C2M H;  4H7B A;  3J81 L;  2NVX H;  1KD1 C;  1Q90 A;  3IL8 A;  5JJZ A;  3HOU H;  1XNQ L;  3A5Z B;  4KJN A;  3HEJ A;  5E3F A;  4TKO B;  1IYJ B;  4A4I A;  4C1N I;  2VQF Q;  1QCB D;  4G57 A;  4IOC A;  1UEA B;  1Y8N B;  3KLW A;  4X62 Q;  2ENB A;  4LF6 L;  1S4Z A;  1JWS D;  4OEL B;  3GTP B;  3EQL C;  3UI2 A;  3S9W A;  2ALY B;  1ZYR D;  2AWO A;  2QCP X;  3P7J A;  4OL7 A;  2CCZ A;  4OWX B;  3F1Z A;  2HDL A;  2MGS A;  2EY5 A;  3GTL B;  3MWY W;  1X65 A;  3D4W A;  2G5D A;  4LMQ D;  1J8I A;  2KJX A;  2IW3 A;  5EPJ A;  1PH3 A;  3ND9 A;  1CKN B;  5C6A A;  1STN A;  3FKI G;  2Q2I A;  5I2X A;  1K8M A;  2R7F A;  4LW1 A;  3H0G H;  4R4I A;  3HOY H;  2BA0 A;  1GD7 A;  5ELN A;  1HA5 A;  1O7L A;  1WTQ A;  2F0K A;  5J22 A;  3E0E A;  4NXM L;  1MBY A;  4B3S Q;  2F03 A;  2WAQ B;  2NZ1 D;  4GNX C;  1I94 L;  3A56 A;  4JI4 L;  1S5E D;  5C4Z A;  1EOV A;  3T13 A;  1G6P A;  5FLX L;  1AN8 A;  1Q46 A;  3R8B A;  1A6X A;  4JI7 L;  3S15 H;  1LYL A;  3BDC A;  1LTI D;  2KHJ A;  3PUX A;  1TVX A;  4IUN A;  5FK9 C;  1Q7Y C;  2CW0 C;  2RDG A;  3WOF A;  1SNC A;  5EQ0 A;  3TSS A;  1EWC A;  1TWA H;  5IOC A;  5ELE A;  2KUM A;  4YY3 L;  2NYZ D;  4DKA C;  3L2P A;  5I9P A;  5ISR A;  4KD4 A;  2RHS B;  4GKJ Q;  3KLS A;  3ERS X;  4HSV A;  4A3D B;  2LKV A;  4C3H G;  2R92 H;  4JI3 L;  2MO0 A;  1H9S A;  1TY2 A;  4J15 A;  3NBH B;  4IUV A;  4Q5V A;  2PZU A;  2MJ8 A;  5EKK A;  1AFP A;  4A3B G;  2Z6K A;  1NUC A;  3TDQ A;  5M3M B;  3V05 A;  2KEC A;  3ONA B;  1OO9 B;  5DM6 3;  4ZUI A;  3M4Y A;  1PYB A;  2LS0 1;  5E4W C;  3OSO A;  4NP5 A;  4HTH A;  1FJG Q;  3HKS A;  1V9P A;  4LWC A;  4DV5 L;  1LT4 D;  1FNU A;  3CQZ B;  1GUT A;  4A3I B;  1Y14 B;  1TS2 A;  4DXF A;  2IWH A;  1GM5 A;  5C3E H;  1ASZ A;  3AFQ A;  4H02 A;  1O7Z A;  1IBM L;  4IPH A;  1B3Q A;  5J3B A;  3R2I A;  1XPO A;  4QB4 A;  4K2L A;  1SNO A;  3TS2 A;  1FGB D;  1CQF A;  5I6Y A;  3CCE A;  3RN5 A;  1SE4 A;  1PYW D;  4A3F H;  4EQP A;  4RWS C;  1VQN A;  3FDT A;  2R93 B;  1WCM H;  2FJ2 A;  1BCP D;  4ODG A;  2VUM H;  5CGK A;  1PH8 A;  1HZA A;  5CMD A;  3I4N H;  1EIY B;  1YJN A;  1BCP B;  4OON A;  4C1N K;  4F88 A;  5FJ8 H;  2F0E A;  3DUZ A;  1P8L A;  1I3Q H;  4HSP A;  2B29 A;  1QVG A;  1VCI A;  1IBL Q;  1X32 A;  1VQB A;  1M1K C;  1JWU D;  2B2U C;  1UE6 A;  1I5F A;  3HOZ B;  1X6O A;  1PHJ A;  2GN5 A;  1QWY A;  3BG3 A;  3VA7 A;  3GTK H;  4CKC A;  3RUZ A;  1EU4 A;  2PMZ E;  2SNM A;  1NSN S;  2MO1 A;  1J6Q A;  1X56 A;  3L9A X;  3CW2 C;  1Y1W G;  2EXD A;  1K3B C;  4YIJ A;  1N32 L;  4A3G G;  5C0X G;  1EYD A;  2EYJ A;  4XDX A;  1X55 A;  1YHQ A;  1GJX A;  2CH4 W;  2EJM A;  4JI8 L;  1JWM D;  3A0J A;  4DNT B;  3HS0 C;  1HR0 L;  3S1R H;  1CKN A;  3OPO A;  1B70 B;  4QF4 A;  3GTG B;  2E2D C;  1EQT A;  2L9H A;  1WD0 A;  2NZO A;  3CCV A;  4B3T L;  3DXJ C;  2ATW A;  1SSO A;  4DNI A;  2MFI A;  3D8G A;  3S17 H;  5GQO A;  3UDI A;  4YCU A;  1WYD A;  3VR4 A;  4HCS A;  3DHQ A;  3ERO A;  5IYC G;  2A69 C;  5JJI A;  3STB D;  3Q6S A;  4DR7 L;  1DGS A;  2K33 A;  3AQQ A;  4U68 A;  2MNA A;  2I5H A;  3SGI A;  2K04 A;  4RCO A;  1K9M C;  1G8Z D;  1GHJ A;  3U4Z A;  5EPL A;  5IGC A;  5C4J H;  4N8F A;  2X69 A;  3VR3 A;  1HZ9 A;  2DNC A;  2VB3 X;  4L5T A;  1OTC A;  3M3Y H;  5ELO A;  3QIA A;  1T5X D;  3JAM c;  1KDA A;  1EYG A;  3UDG A;  2JA6 G;  3QWN A;  4A3J G;  3NTI A;  3CC4 A;  1VQD A;  4A93 H;  3R2T A;  4OGQ C;  3T1Y Q;  3ERQ A;  4GNX B;  5K36 H;  1SYC A;  2UXC Q;  4B3R Q;  5IIF A;  1HTP A;  1H9K A;  3C2P A;  4ILW A;  1IKL A;  1BR9 A;  4A76 A;  3KK7 A;  4CKB A;  1VQ5 A;  1SYG A;  3NUC A;  2YTY A;  3HGB A;  5CR3 A;  5LMN Q;  3F8T A;  3KOJ A;  2K01 A;  3S2H B;  1JJC B;  1EY6 A;  4BBR H;  2B2T C;  1G2S A;  2F0J A;  1K28 A;  2E74 C;  2JEB I;  4LF7 Q;  1TWC H;  2XSC A;  1EZ6 A;  4AYB G;  1PYS B;  1NR2 A;  2RDH A;  3EN2 A;  3GO5 A;  3PO2 H;  1Z7T A;  3PUV A;  4C3I H;  2LFN A;  1X3E A;  3KLS X;  1IKM A;  1RHP A;  2OQK A;  1WI5 A;  5M3F B;  4PV1 C;  2BH8 A;  3ULP A;  4IN3 A;  4CGY B;  1D7Q A;  1AZP A;  1VQJ A;  2IY5 B;  4DFA A;  2E2J H;  1X3F A;  2OXP A;  3B6Y A;  1O7Y A;  5IWA Q;  3RZO H;  2F4V L;  2OWO A;  2Y0S E;  1EIF A;  1M8A A;  1K83 B;  2K75 A;  3K0Y A;  2VW9 A;  2K5H A;  2JA7 H;  4JCV E;  4KTA A;  4C3J G;  3GTM B;  1SJE D;  1JE5 A;  5HUR A;  1R9T H;  2LXJ A;  4O1N A;  4ZKC B;  3GD7 A;  3MC0 B;  5C44 H;  1ONL A;  1ASY A;  1JT8 A;  2JA5 B;  2B8F A;  1Y8P B;  2VL6 A;  4DXG A;  3Q22 A;  4P2C B;  5IYB G;  1EEI D;  2X6L A;  2NVY B;  1JC7 A;  1MSG A;  2Z4H A;  2SOB A;  2RDF A;  4K2K A;  1EEF D;  4CDE C;  2EYO A;  1L0Y B;  4LFA Q;  2E2I H;  4GOP C;  1UEB A;  2ZJR A;  4BY7 G;  1X3Q A;  2KOL A;  3T4A C;  5JVH 3;  1SFO H;  4AQY L;  2RQX A;  4GLV B;  3M4O B;  1VQM A;  2A6E D;  2JA8 G;  2R92 G;  1S72 A;  1SND A;  4YWM A;  3J80 E;  5LMU Q;  2R3Z A;  4CJ2 C;  1EWH A;  4LUZ A;  1PTO C;  4RFB A;  3MEH A;  5IP9 G;  3MA2 B;  1KAW A;  4IPD A;  2Z1C A;  2VQF L;  3FKI H;  1PFN A;  3EVQ A;  5C3X A;  3J81 j;  1ZEQ X;  3AB9 A;  3L0O A;  4X62 L;  3CU7 A;  2K28 A;  1UE5 A;  3G71 A;  4DNR B;  3EJI A;  2SEB D;  4R9W A;  4HIK A;  5ELB A;  3TN2 A;  3PO3 B;  3LX0 A;  2A68 C;  1B50 A;  4HMI A;  1YVC A;  4BY1 G;  4L5Q A;  1SMX A;  2VNU D;  2AUK A;  4NB3 A;  4F8M A;  1AH9 A;  5CV9 A;  1VF5 C;  4K6D A;  3KF6 B;  1EQR A;  1CHP D;  2C5C A;  3PF5 A;  1UE1 A;  3TME A;  2BE5 D;  1SRO A;  3MAQ A;  1CA5 A;  1NAP A;  2A69 D;  4C3H H;  4A3F G;  4DAV A;  1OXV A;  3J7A 5;  1QVF A;  2O4X A;  4RG1 A;  4L6T B;  4B3S L;  2VUM G;  1ZYR C;  2ZXO A;  1XWE A;  3I3C A;  1DOK A;  4A3B H;  2WAC A;  4MZ9 A;  5EAY A;  2WIN B;  3HZX A;  4DAM A;  3HG9 A;  5M5Y B;  3ZYY X;  1SE2 A;  2K50 A;  4B3M Q;  3IRB A;  3DWQ A;  3IAY A;  1X3G A;  2XNA C;  4GN5 A;  4JG2 A;  2FXQ A;  1PH1 A;  2L11 A;  2CQA A;  3LNN A;  1VQ8 A;  4IPC A;  3TP6 A;  4RHS A;  4DR1 Q;  4HAE A;  4CHT B;  3KJP A;  1ESR A;  4GKJ L;  4DAP A;  2AHO B;  1XTC D;  3RZD H;  3K5N A;  4OEM B;  3NTK A;  1A3T A;  4J6H A;  2JK8 A;  3AMU A;  2R7Z B;  1RIP A;  2E75 C;  5M5W H;  2EIF A;  4HCE A;  2ICE C;  3K58 A;  4KY6 A;  3FMC A;  1F9R A;  1GUG A;  2RSO A;  3TP5 A;  1Q1B A;  3BJU A;  5COY A;  1YNJ D;  3NWS A;  2K1B A;  2F0W A;  1FJG L;  4WRD A;  1M90 C;  1STY A;  3GTQ H;  1CM9 A;  5H1S E;  2BH2 A;  3OIP A;  4ULL A;  1K8A C;  1CSP A;  3MXG A;  3DWP A;  4WJ4 A;  4J1M A;  5KGU A;  1PH2 A;  3DEP A;  2YYZ A;  3S1N B;  1E3P A;  4DU9 A;  5GRO A;  2NUC A;  4Q0F A;  3RN2 A;  2K5V A;  3TBI B;  2DN8 A;  4HJ7 A;  1QE6 A;  2NVQ H;  3S1Q H;  4RCN A;  1IYV A;  2B2W C;  1ENF A;  5FKA C;  4JVZ A;  4IUT A;  1TWG B;  1STB A;  5C4X G;  2D0P A;  1F77 A;  4JYA Q;  4A3K B;  1K8G A;  1FD7 D;  4JK1 C;  3ITP A;  5FOB B;  4P75 A;  1D2B A;  4GLA C;  3T51 B;  3W3A A;  2K03 A;  4I65 A;  1NJI C;  1HCZ A;  4QJF A;  4DF7 A;  4J8Q A;  1U5K A;  4EQN A;  4NDX A;  3U9O A;  4A3G H;  3L3O C;  5C0X H;  3GTJ B;  4JI1 Q;  1E22 A;  4OIJ A;  1VQF A;  4PZ6 A;  4GOP B;  1SNP A;  1NR4 A;  4EQ5 A;  1IBL L;  2B2U A;  2NN6 H;  5GAD C;  4OO1 G;  5KNC A;  4APV A;  3OW2 A;  2HCI A;  1WJJ A;  2JP1 A;  5IGD A;  1HZB A;  1HUN A;  2D2C C;  1GKH A;  4IOA A;  1YEZ A;  4BBS B;  4XQQ A;  2MP1 A;  2KHS A;  2K5D A;  1LT3 D;  2OF1 A;  4IAL A;  2EQS A;  1AE3 A;  3PSI A;  1FNV A;  3PIP A;  1PTO B;  5IYC H;  4Z9C B;  3TRZ A;  1DXM A;  2XRQ D;  1BCP C;  3VYS A;  2J0T D;  4JBK A;  1HQM C;  2F4I A;  1DYQ A;  1LO5 D;  5COR A;  2F0G A;  1I6V C;  1Z47 A;  3FPP A;  1YJW A;  3I4O A;  1I50 H;  4B9W A;  2JA6 H;  3KF6 A;  1RL2 A;  1WD1 A;  4NPS A;  4A3J H;  3FRP B;  4IFD G;  4TVA B;  2VY3 A;  3P20 A;  3T16 A;  1QJO A;  2CWA A;  4PQX A;  2RBM A;  2O5J C;  2WAQ G;  1PV4 A;  3F2D A;  3VR5 A;  2QGQ A;  1VQ4 A;  4G7H C;  3CPF A;  1VMC A;  3J7Z C;  2D62 A;  4QQB X;  1EUJ A;  3K59 A;  3GTO H;  4JBM A;  5M5X B;  1NTG A;  4ZK9 B;  5HGQ A;  2VB2 X;  4FDB A;  4OX9 Q;  3CD6 A;  3VYT A;  1S3O A;  2TMP A;  3K57 A;  1PH4 A;  2HDM A;  3UDX A;  2KHI A;  1K8O A;  1YJ9 A;  3T1Y L;  4A3D G;  1PDQ A;  1SAP A;  1YIJ A;  1DOM A;  1SE8 A;  3CKI B;  4BS9 A;  2UXC L;  4B3R L;  2MQH A;  2F0L A;  1RTN A;  4DV1 Q;  2L5T A;  3A74 A;  4ZAI A;  4FP5 D;  5CBA E;  5M3M G;  5HGT A;  1TWC B;  2B63 B;  3V2T A;  4A3L G;  4QGU A;  1FYC A;  1EWI A;  3KF8 B;  4RMF A;  1NMF A;  1R4P B;  1GVP A;  3K7A B;  3K81 C;  3STB C;  2B2T A;  5LMN L;  1XMQ Q;  1JB7 A;  4WJW A;  3J7Y W;  2IHE A;  4ZCK A;  4C3J H;  2F0I A;  2RCF A;  4LF7 L;  1LTT D;  4Y7N H;  4JI2 Q;  3GV3 A;  2V1C C;  5T1I A;  5FLM G;  1STG A;  1O80 A;  2Q8R E;  1KRT A;  3S14 B;  3J81 E;  5KIX A;  3RZO B;  2Z6B A;  5IGB A;  1DJR D;  1GUW A;  5IYB H;  2WKD A;  3J81 i;  4QUC A;  2DNE A;  1XPR A;  5IWA L;  4R1J A;  1EYC A;  2JE6 I;  1SYE A;  2RVL A;  1V1P B;  2AUJ D;  1WTO A;  2XGT A;  3BZD B;  1KTK A;  1RF2 D;  1MKH A;  5KYL A;  4P72 A;  1LT5 D;  4BY7 H;  3GP7 A;  3BS1 A;  1VQH A;  1LM0 A;  5DLQ E;  3C1E A;  1VQ9 A;  4FF2 A;  2JA8 H;  2HUG A;  3ULL A;  3QO2 A;  2WB1 E;  1J9O A;  1HXY D;  2H4O A;  2K52 A;  2KEN A;  4KK7 A;  4FF4 A;  2DJF C;  1SRU A;  3HOW G;  1Y1V H;  3M9B A;  3KJO A;  4EGV A;  1VQL A;  3J80 c;  2E2I B;  1AEX A;  2N88 A;  5IP9 H;  1V1O A;  2A1A A;  1VDZ A;  2UXB Q;  1F9P A;  1PVO A;  1SE3 A;  4LFA L;  4F87 A;  2YU9 B;  1SR3 A;  2G9H D;  1HNX L;  3NEN A;  1I6H H;  1VF7 A;  5IGF A;  1TT2 A;  3IKJ A;  4POG A;  3HOZ G;  3I55 A;  2HQE A;  2D5D A;  1LTG D;  1LTS D;  1D5M C;  3RLO A;  2PI2 E;  4LF4 Q;  2F0F A;  4LF9 Q;  3BYY B;  2A8V A;  4QIW E;  3A7L A;  4GZY C;  2HD3 A;  3OYY A;  4UAI A;  5IP7 G;  1UE7 A;  2Z8L A;  3I4M B;  3E0J A;  1AZQ A;  1VS0 A;  1E1T A;  2NVT H;  5LMU L;  1WTV A;  2HHH Q;  4G7O C;  2DY8 A;  1Q12 A;  4BY1 H;  3A8K E;  1LLR D;  1TKW B;  3NEM A;  1N36 Q;  1PLF A;  1CQV A;  3HOV B;  1N8R C;  5I4D A;  1SNM A;  2WB1 B;  4M1U B;  1QVC A;  3NSW A;  2ZT9 C;  3C46 A;  1GUS A;  4F7X A;  4UPA A;  1H95 A;  4JI5 Q;  4MN3 A;  3CCS A;  5AJ3 Q;  3PIO A;  1TS4 A;  1YHB A;  3RLN A;  1SBB B;  1HH2 P;  2A6E C;  2EY6 A;  2KCT A;  1EY8 A;  3RLF A;  2OTL A;  1S5B D;  3CCM A;  1LAC A;  3CCL A;  4A3M B;  3TZU A;  2UXD Q;  3WWV A;  4QIW B;  3S16 H;  1BBW A;  1PTO F;  3K7U C;  4B9X A;  3S1M B;  1W2B A;  2DUD A;  4JV5 Q;  3N52 A;  2RHQ B;  1HPC A;  4QUF A;  1CI3 M;  4XQN A;  3K5O A;  1NCV A;  3KUP A;  4YCW A;  1JMC A;  2ASB A;  2JEA I;  4UP7 A;  4LFC L;  1SXT A;  3A8I E;  2RSN A;  1HFG A;  2EYM A;  1YNN D;  1CTM A;  2FHT A;  4HID A;  1FR3 A;  3X3N A;  2NN6 G;  4B3M L;  3BDO A;  1BUV T;  3SHL A;  3ICE A;  3UE1 A;  3MFY A;  4V0B A;  1A2T A;  3BDL A;  5LL6 S;  5K5P A;  4LNQ A;  1HNW Q;  3CPW A;  4DR1 L;  1D1I A;  4K8I A;  1B1Z A;  1N9W A;  2VZA A;  1BBU A;  1YIT A;  4JI6 Q;  2N78 A;  4P71 A;  2BE5 C;  1OXU A;  1PH7 A;  1S5F D;  1DM0 B;  3QB3 A;  4RKL A;  1D8L A;  1F9Q A;  3W5O A;  2PMZ B;  1L2F A;  3VYU A;  2Q2H A;  5L37 A;  3OTO Q;  1BF4 A;  1Q81 C;  1V1P A;  1KXL A;  1K0S A;  1SLJ A;  2LXK A;  4DUZ Q;  1E24 A;  5C4X H;  4X3T A;  2ICI A;  5CV4 A;  1KDB A;  2ZM6 L;  5D65 A;  4IO9 A;  5CV5 A;  2M2L A;  3DMU A;  2ZJP A;  1XNQ Q;  1W6K A;  4WFN 3;  1TWH B;  2JA5 G;  1GUN A;  4DR6 Q;  1EY7 A;  1E7Z A;  4YCV A;  3NBH A;  1WVL A;  4X3S A;  5NUC A;  5C0X I;  1VQ6 A;  3Q8D A;  3S2D B;  3Q0A A;  1RCV D;  3E9H A;  4GLX A;  1KQS A;  1BNZ A;  1V1Q A;  5C0X J;  3K5M A;  4IJL A;  1EY9 A;  1X54 A;  1KAA A;  4RA8 A;  4DK0 A;  5C3W A;  2HCC A;  4OO1 H;  1YI2 A;  1CFM A;  1L0W A;  1Y1W B;  2Z0S A;  4UP9 A;  1E2W A;  1K3R A;  3GTP H;  4JYA L;  3ER0 A;  5D14 A;  5G3L D;  1YNJ C;  4X66 Q;  2H5X A;  2AQ1 B;  1U0L A;  1RTO A;  2L15 A;  1XTD A;  2EY1 A;  1Q3L A;  2IPK D;  1JOQ A;  1I4X A;  4R4T A;  3CME A;  2KCN A;  3GTL H;  4JI1 L;  4CDC C;  1QUQ B;  1ENC A;  3E5S A;  1C7Y A;  1HHV A;  3W1G A;  4N9T A;  5JJL A;  2IHF A;  4I7Z C;  2A74 C;  3I8Z A;  4CDD C;  1AW7 A;  2K05 A;  2ID0 A;  2RF4 A;  3ND8 A;  4LUO A;  4AIM A;  5D3D A;  1XYI A;  3VA5 A;  5AFW A;  3A54 A;  1Z6H A;  1RJT A;  4AYB E;  4IFD H;  2EZV A;  3J80 L;  4UDU C;  2CKZ B;  3PO3 G;  1B3A A;  1A3U A;  1IZ6 A;  4M8A A;  3HOX B;  2OCE A;  3MTS A;  4MIU A;  1HJP A;  5KNB A;  3DLL A;  1GOZ A;  5ELD A;  1U4P A;  4PZ8 A;  4XTC S;  1TWF H;  4IUQ A;  2YV5 A;  4YY3 Q;  4JBW A;  5EGT A;  3QOL A;  4POF A;  1QZG A;  1IW7 D;  3CHB D;  2UUB Q;  1LT6 D;  1KHI A;  5DAU A;  2B8G A;  2E2H B;  4A3E B;  4C2M B;  2KA7 A;  4DR4 Q;  2NVX B;  3HOU B;  2O5I C;  2NB0 A;  1TII D;  1YZ6 A;  2Y0S B;  4A3D H;  1VQP A;  1BDO A;  1Q1E A;  1HNZ Q;  3MEF A;  1C48 A;  4OXP A;  4HJ5 A;  1Y1V G;  2AKW B;  3FEW X;  4FF1 A;  1QOH A;  2LY7 A;  1CK1 A;  4LJZ C;  4ZQ3 A;  4DV0 Q;  4DV3 Q;  5M3M H;  1VQG A;  2EJF C;  4AYB B;  4JI0 Q;  4GKK Q;  1IHZ A;  4A3L H;  5C5L A;  1VQI A;  4X64 Q;  1Z9F A;  1BCP F;  3EA6 A;  4KN4 C;  2JQO A;  4OX9 L;  1RD9 D;  4B08 A;  3M7N A;  1QG7 A;  4IUP A;  3R3O A;  3CQZ H;  3NP8 A;  4A3I H;  5FLM H;  2C9O A;  1PFB A;  4KJO A;  1IBM Q;  2ZXP A;  4K5W A;  1SJH D;  1QNK A;  2PYK A;  2A5H A;  2QEX A;  4CJ0 B;  5EBD A;  3H0G B;  3MFG A;  3HOY B;  2IL8 A;  4RGM A;  5I2Y A;  3MXN B;  2F3W A;  4Y7N B;  3CMA A;  2CWP A;  3FPU B;  3G7L A;  3WOE A;  1EFI D;  2XVS A;  1E2Z A;  3H3V H;  1XMQ L;  4EVO A;  4K5X A;  1CKM A;  3NTH A;  1TQO A;  4A3C G;  1EQQ A;  2FFK B;  4KV6 A;  4JI2 L;  2RKS A;  2F3V A;  3A8J E;  3H15 A;  3HP3 A;  2NWG A;  3S15 B;  3R93 A;  3PUW A;  4R4O A;  3CXC A;  4GNX A;  3BU2 A;  3NQT A;  2J7Z A;  4MTK A;  1MHW C;  3TP8 A;  2B2Y C;  3HOW H;  3TQY A;  4K8J A;  1TWA B;  3CCU A;  3UE0 A;  3KBG A;  5FO8 B;  1SN8 A;  1VQ7 A;  4RGN A;  4UY8 C;  2N55 A;  4HJ9 A;  3HOZ H;  2R92 B;  3F2U A;  1N32 Q;  1O78 A;  1JB3 A;  4LUV A;  2F0N A;  1WTH A;  3WDN A;  4A3K G;  4NW2 A;  4K0K Q;  1WTR A;  4R4C A;  3BVM A;  5IP7 H;  3G6E A;  1B4O A;  4KHV A;  3A7A B;  4GN4 B;  1XX8 A;  3D6C A;  1F2M A;  3V96 A;  2KQ3 A;  4ZRZ A;  1BOS A;  2TSS A;  3U4V A;  5T1G A;  4HJA A;  5BN4 A;  2EOT A;  1HQR D;  1QUQ A;  3JAM L;  4DV4 Q;  2UXB L;  4B3T Q;  3HRZ C;  3KFU A;  1HR0 W;  5JEA H;  3PCO B;  4DR5 Q;  2ZXR A;  3D3R A;  5F2D A;  5IT9 E;  1PH5 A;  3GTG H;  1NMG A;  1DCZ A;  4BA2 I;  3H91 A;  5C3E B;  4BBS G;  2M9V A;  4LF4 L;  4LF9 L;  2F0D A;  4RH6 A;  2D9U A;  2CHB D;  4X65 Q;  3MXP A;  2P5Z X;  1UUP A;  1BVS A;  3PQI A;  2E76 C;  2HHH L;  3LWU A;  3H09 A;  4ID6 A;  1ILQ A;  5G3L F;  2K5W A;  2HIV A;  4I7A A;  1T5E A;  4JW0 A;  1N36 L;  3GV6 A;  1KDC A;  2EDG A;  1GHK A;  2XRS D;  1C8C A;  4RGO S;  1RKN A;  1ENA A;  4A3F B;  1HTL D;  4R4Q A;  1WCM B;  2JA9 A;  4FF3 A;  4LFB Q;  2VUM B;  1LUZ A;  2F0S A;  1HFN A;  2B3G A;  4JI5 L;  3I72 A;  2PNR C;  4CKE A;  3I4N B;  1SMY D;  5M9O A;  5AJ3 L;  1I3Q B;  4DAY B;  4JOI C;  1Y8O B;  1LTA D;  5IE8 A;  5A2Q L;  2UU9 Q;  2UUA Q;  2PW5 A;  3GTK B;  3JAM i;  2OEO A;  1FVI A;  2UXD L;  1L1O C;  3GQB A;  4GN3 B;  2IX1 A;  2PNH A;  5BR8 Q;  3S2H H;  4CJ1 B;  1MJE A;  4DV2 Q;  1H9S B;  1SEB D;  5BN5 A;  3KDF B;  3U9S A;  2IX3 A;  1E0B A;  1PFM A;  1LAB A;  2A19 A;  3T1H Q;  3CRK C;  4XYO A;  4BXX G;  1WTX A;  1IBK Q;  2PCF B;  5JVG 3;  3S1R B;  1A2U A;  1E2V A;  2R6G A;  5M3F H;  1U4R A;  2A73 B;  4IZ8 A;  3CF5 A;  1PXU A;  5EJW A;  2PZW A;  2AMC B;  4XIG S;  1EY4 A;  4MTN A;  2B63 G;  1X9N A;  5FO9 B;  4GS3 A;  5GAE C;  4DR3 Q;  3D0F A;  3I4L A;  4WJ3 M;  1TS3 A;  2YTX A;  1BBX C;  3AFP A;  4H13 C;  1W6J A;  2HQL A;  2QA4 A;  1K83 H;  1T9H A;  3DM3 A;  4KD3 A;  1E1O A;  2C35 B;  3S17 B;  2E5L Q;  3GTM H;  2K4K A;  4NKL A;  1J5E Q;  1HNW L;  1I4G A;  5DEH A;  1ET6 A;  2AWN A;  4XQJ A;  5D3I B;  3J7A V;  3L7Z C;  2JA5 H;  1A0I A;  3F2B A;  3HKZ E;  2NTS A;  4XYQ A;  1F2Y A;  2A6H D;  4JI6 L;  4K6L A;  1B7Y B;  1JOR A;  5LL6 X;  3ULJ A;  5C4J B;  2NVY H;  4KHZ A;  1G51 A;  2DJG C;  3M3Y B;  3DM1 A;  2LMC B;  1RDP D;  3J7A F;  4ME3 A;  2KCC A;  2Q2U A;  3BVG A;  4A93 B;  5JPM C;  4QY7 A;  5E1F A;  1N34 Q;  1CA6 A;  3OTO L;  4OO1 I;  1MIU A;  1YNN C;  1MSH A;  4FNF A;  4DUZ L;  1A3V A;  1SNQ A;  2SNS A;  3ZJY C;  4XT1 B;  4MHE A;  4DK6 C;  5ELF A;  3M4O H;  1NNX A;  3IFT A;  2WII B;  4IJH A;  4DV7 Q;  1G2T A;  1HZC A;  3JC6 6;  4TQU S;  1IL8 A;  4DR6 L;  3CCR A;  3M85 A;  1MJC A;  1UNS A;  1CSQ A;  2WAQ E;  4DK1 A;  4BBR B;  5IYD G;  1PZK D;  1TXY A;  1II3 A;  3KBX A;  1QZH A;  1I4Q A;  3I73 A;  4BA1 I;  2GVA A;  3PO2 B;  2JN4 A;  1XNR Q;  4AH6 A;  4C3I B;  1TS5 A;  1D6E C;  2L4N A;  4P73 A;  3HKZ B;  5KEE A;  2IJ0 A;  1Q8I A;  4PG3 A;  2JSO A;  3RR5 A;  3SE0 A;  2KEE A;  4A3I G;  4P74 A;  1PRT D;  3VYR A;  4WOR A;  3IFD A;  1WFQ A;  3URY A;  1ET9 A;  4IFD I;  4X66 L;  1PRT B;  3GDE A;  2E2J B;  2EYH A;  1ICW A;  3H94 A;  3I4M G;  3PO3 H;  3G6J B;  2ZTC A;  2AQ2 B;  3FHW A;  4IFD J;  4DUY Q;  2B2V C;  4DPG A;  1MGS A;  2JA7 B;  4LK1 C;  2J4X A;  1JR0 D;  4U67 3;  1STE A;  4NMZ A;  1CZG A;  1PZJ D;  3KLR A;  4X6A H;  3HOV G;  1XXG A;  1UWV A;  1KAB A;  1R9T B;  2ES2 A;  1DD2 A;  2EVB A;  5C44 B;  2WB1 G;  4KHP Q;  1IXR A;  1U4L A;  1AE2 A;  4R8N A;  1OXX K;  1X3P A;  5CYU A;  1B44 D;  4TSS A;  1TWF B;  1VQE A;  3DEO A;  1ESF A;  3D6W A;  1D5X C;  4L63 B;  3VR6 A;  4DAY A;  2R93 G;  5C5M A;  1LTL A;  3I90 A;  4QL5 A;  3K6O A;  4OWT B;  3U50 C;  4HED A;  4ZLT F;  4MNO A;  1LV9 A;  1EY5 A;  1H9J A;  4A3M G;  2Q8I B;  1SFO B;  5M5Y H;  3I7F A;  5EKL A;  2JYO A;  4GOP A;  1I4R A;  1S40 A;  1QB5 D;  3Q23 A;  1BQQ T;  2QKI C;  3OHX C;  5CC4 A;  1B9N A;  1SYD A;  2UUB L;  1B2T A;  1CHQ D;  1NE3 A;  1F2L A;  3CP0 A;  3KDF A;  3T53 B;  5CV8 A;  2Z4I A;  4CBV A;  4DR4 L;  2N8N A;  3SK8 A;  4YWL A;  1Y69 U;  2GA4 B;  4BWG B;  1D1K A;  5FLX E;  1GUO A;  5J39 A;  3FKI B;  3E9I A;  1HNZ L;  2EJG C;  2L0C A;  1KNE A;  2R7Z H;  3MXU A;  4DV0 L;  1L1O B;  4LF8 Q;  4DV3 L;  3G48 A;  4JI0 L;  4GKK L;  3H3V I;  4X64 L;  3P75 A;  2R61 A;  2MUY A;  5JEA G;  4YWK A;  3PUY A;  4G7Z C;  1PH9 A;  2DGY A;  1C9O A;  1TU2 B;  3D4D A;  1KC8 C;  1FNW A;  3H6M A;  4A3C H;  1IW7 C;  2FMC A;  1S5D D;  3MVV A;  3BZC A;  4V19 0;  4Y52 H;  2F3I A;  4EQO A;  3E3X A;  2VQE Q;  3MHB A;  3S1N H;  4UHV A;  3S24 A;  1G6Z A;  3M4Q A;  3W2D A;  4O0A A;  4ME5 A;  2MHV A;  2NTT A;  4N9P A;  1EQV A;  3NK9 A;  4YHH Q;  3FVQ A;  2EY2 A;  1ZKO A;  5ELC A;  2N49 A;  3O13 A;  4IQZ A;  4IPG A;  4C3H B;  1TWG H;  5E7N A;  1M4V A;  4DK3 C;  1VQA A;  2BA1 A;  4A3K H;  2QDB A;  4X3K A;  5J1Z A;  2EPB A;  1JQY D;  3HOW B;  2ZTE A;  4A3B B;  1BKB A;  1WOC A;  4XXE A;  5KND A;  1G29 1;  2B2Y A;  1CKO A;  3EFX D;  1MI2 A;  4G4K A;  4DV6 Q;  2UUC Q;  3GTJ H;  2SDF A;  2CQO A;  2OQ0 A;  2ZTD A;  4L5R C;  5CV7 A;  2QDL A;  2IX0 A;  2CH4 A;  4RGT A;  3SK6 A;  1SYB A;  3KF8 A;  3TRE A;  3RMH A;  3NE5 B;  3QR8 A;  2EYL A;  4NXN Q;  5IY0 A;  1H9R A;  4LF5 Q;  4H44 C;  1ZXT A;  3D4R A;  3RZD B;  4BBS H;  1B53 A;  4QCL A;  1XMO Q;  5IT9 c;  3Q24 A;  5JEA J;  4K0K L;  5M5W B;  4DR2 Q;  1NY4 A;  4H0L C;  3SEB A;  4PMC A;  1G91 A;  1C0A A;  5M3F G;  3A55 A;  1PTO H;  1N33 Q;  1XJV A;  4L8J A;  4K5V A;  3TS0 A;  4E6I A;  1VQO A;  1A62 A;  3D31 A;  2BDO A;  3GTQ B;  1JE4 A;  5JJK A;  3SXH A;  4DV4 L;  4R8I A;  1UAP A;  2L55 A;  2Z9H A;  3CCJ A;  1LTB D;  2OT2 A;  4DR5 L;  3OWE B;  1CZW A;  3K8A A;  3I2Z A;  4ALP A;  2V4D A;  1KLU D;  3AYH B;  4RAU C;  3LWE A;  4X65 L;  3CC7 A;  3S1Q B;  2NVQ B;  3HOX G;  1XPU A;  3HFZ B;  3G4S A;  1A63 A;  4FYD A;  1PRT F;  2WP8 J;  4LF6 Q;  3X3M A;  4O42 A;  1KL9 A;  1JOK A;  5M5X H;  2HT1 A;  4IUU A;  2B2W A;  2I07 B;  1STH A;  2NN6 I;  1EFW A;  1JJ2 A;  2WKC A;  2K32 A;  5CV6 A;  1TR5 A;  4A3G B;  4LFB L;  4A3E G;  1HUM A;  3BZK A;  2CW0 D;  3DWA A;  1PFS A;  3EBE A;  4KY7 A;  1W3S A;  3HOU G;  2K5N A;  2Y0S G;  3N6R A;  3U58 A;  4BXX H;  4JOI A;  4X3U A;  3UDF A;  2YTV A;  2VS1 A;  1ML0 D;  3BVZ A;  2F0Q A;  2F0T A;  2UU9 L;  1PA6 A;  4ABN A;  2UUA L;  2B63 H;  2I46 A;  5EBC A;  1L1O A;  2RA4 A;  1JJG A;  4JBJ A;  1VMP A;  5IGG A;  2XN9 C;  4ZKB B;  1GXD C;  3K7A H;  4NXM Q;  3AEV A;  4QMG A;  5BR8 L;  1MD2 D;  1KNA A;  3CC2 A;  1Q8K A;  4DV2 L;  1I94 Q;  1ROD A;  5LMN W;  4JI4 Q;  4CDF C;  1STA A;  2PO4 A;  2DY7 A;  4OHJ A;  1NBW A;  2PQA B;  2N3S A;  1JOO A;  3BYT B;  5E4X A;  4KY5 A;  4JI7 Q;  2Q2T A;  4DGZ A;  3M4P A;  3T1H L;  3S14 H;  3VDY A;  3PIP 3;  1IBK L;  3RD4 A;  1D5Z C;  1SMY C;  1BXT A;  1IL2 A;  4HIM A;  3H0G G;  2X6G A;  3HOY G;  3RNU A;  1I50 B;  3NBI A;  2PI2 A;  2JA6 B;  4A3J B;  2HIX A;  2KED A;  4DR3 L;  2PZT A;  5LHY 1;  4KKU A;  4JI3 Q;  3TZD A;  5JAV A;  2QF7 A;  2E5L L;  2FIN B;  5KYI A;  1J5E L;  4DA2 A;  3NHH A;  1DZ1 A;  4OIK A;  5IOD A;  1CT1 D;  3A5U A;  2MPM A;  3GTO B;  2Z6K C;  2WV6 D;  3NWT A;  1CUK A;  2XWB B;  3K80 C;  1HNX Q;  4JC0 A;  1EIG A;  2QW7 A;  1EL0 A;  5IYD H;  3I70 A;  4DV5 Q;  4HMJ A;  4S3S A;  1B8A A;  2YU9 H;  2F0P A;  1N34 L;  3I91 A;  4DN4 M;  2VXW A;  4IUR A;  2I5L X;  3OIQ A;  1EYA A;  2L1B A;  1JCK B;  4LAA A;  5EKI A;  2F52 A;  3TEH B;  3F2C A;  1IYU A;  3J80 i;  3I4M H;  4DV7 L;  1KRS A;  1U4M A;  1EIH A;  4C56 C;  3J81 c;  1BO0 A;  3FP9 A;  1A8V A;  4DV1 L;  2R7D A;  1KIX A;  2PQE A;  2R7Z G;  1DOL A;  2XTI A;  3QOJ A;  5DM7 3;  4C3J B;  2A6H C;  3K0X A;  4HIO A;  3PUZ A;  3EIV A;  3CCQ A;  1AP0 A;  3HOV H;  2F1M A;  5A35 A;  1XNR L;  2XIW A;  2O2L D;  3W1B A;  5C3E G;  1WTW A;  2K6A A;  3AU7 A;  3OMC A;  4FXK C;  4HN7 A;  5TSS A;  1PZI D;  1C4Q A;  2PPB C; 
#chains in the Genus database with same CATH homology
 4B3R Q;  2B63 G;  1X9N A;  2R93 H;  4DR3 Q;  4GS3 A;  5GAE C;  3D0F A;  4WJ3 M;  3RLO A;  2PI2 E;  2YTX A;  4LF4 Q;  3AFP A;  4LF9 Q;  3CAM A;  2A8V A;  2HQL A;  4QIW E;  1K83 H;  2QA4 A;  4A76 A;  1T9H A;  3DM3 A;  3OYY A;  1E1O A;  2C35 B;  5IP7 G;  1UE7 A;  2KBN A;  4DUY L;  1VQ5 A;  2E5L Q;  4A3M H;  1VS0 A;  2K4K A;  2YTY A;  3GTM H;  1E1T A;  1OXS C;  2NVT H;  2LSS A;  5LMU L;  1J5E Q;  4PMW A;  2HHH Q;  1HNW L;  5LMN Q;  3F8T A;  1Q12 A;  4BY1 H;  3KOJ A;  2AWN A;  4KI0 A;  1JJC B;  4BBR H;  3L7Z C;  3NEM A;  2JEB I;  4PZ7 A;  1A0I A;  1N36 Q;  2JA5 H;  4LF7 Q;  4KHP L;  1TWC H;  3F2B A;  3HKZ E;  1WCM G;  3S1M H;  1N8R C;  4AYB G;  4LFC Q;  1PYS B;  4JI6 L;  1B7Y B;  3EN2 A;  3GO5 A;  3PO2 H;  3ULJ A;  3PUV A;  2NVY H;  4KHZ A;  4C3I H;  3I4N G;  1G51 A;  1X3E A;  4JI8 Q;  1QVC A;  5FJ8 G;  2OQK A;  1HR0 Q;  4ME3 A;  4UPA A;  2Q2U A;  1WI5 A;  1H95 A;  2BH8 A;  3ULP A;  4JI5 Q;  4QY7 A;  5FLX c;  4O2D A;  3CCS A;  1N34 Q;  5AJ3 Q;  3OTO L;  4OO1 I;  1D7Q A;  1MIU A;  1VQJ A;  3PIO A;  2IY5 B;  2E2J H;  1YHB A;  1X3F A;  3B6Y A;  4UP8 A;  3RLN A;  5IWA Q;  4DUZ L;  2F4V L;  1HH2 P;  1FGU A;  3ZJY C;  4DK6 C;  2OWO A;  2Y0S E;  3RZO H;  1EIF A;  2KCT A;  3M4O H;  3RLF A;  2OTL A;  4KLK A;  2K75 A;  2VW9 A;  2JA7 H;  2K5H A;  4IJH A;  3CCM A;  4JCV E;  4DV7 Q;  2ZJQ A;  1HZC A;  3JC6 6;  4TQU S;  3CCL A;  2UXD Q;  4DR6 L;  2OTJ A;  1JE5 A;  3WWV A;  3CCR A;  3M85 A;  3S16 H;  1BBW A;  1MJC A;  3K7U C;  1R9T H;  2LXJ A;  1CSQ A;  2WAQ E;  5C44 H;  2PQA A;  3GD7 A;  5IYD G;  1Q86 C;  4DR7 Q;  1ASY A;  1JT8 A;  1TXY A;  1QZH A;  2E8G A;  5GAG C;  2VL6 A;  4BA1 I;  1W2B A;  2DUD A;  4JV5 Q;  1VQK A;  2GVA A;  5HY6 A;  5IYB G;  2RHQ B;  1XNR Q;  4AH6 A;  2D0O A;  4P73 A;  1V43 A;  4YCW A;  4PG3 A;  3RR5 A;  2ZM6 Q;  1JMC A;  2ASB A;  4UP7 A;  4LFA Q;  4LF8 L;  2JEA I;  3I55 A;  4A3I G;  4P74 A;  4LFC L;  1WFQ A;  2E2I H;  4GOP C;  1UEB A;  4IFD I;  4X66 L;  3GDE A;  2ZJR A;  3I4M G;  4HJ8 A;  3PO3 H;  4BY7 G;  4HID A;  2ZTC A;  4AQY L;  4GLV B;  1SFO H;  4A3B H;  2NN6 G;  1OXT A;  1VQM A;  3FHW A;  4IFD J;  2K14 A;  4B3M L;  2GVB A;  2JA8 G;  4DUY Q;  1K0R A;  3ICE A;  2R92 G;  4DPG A;  3UE1 A;  1S72 A;  1TWH H;  1O7I A;  4OWW B;  4YWM A;  5LMU Q;  1HNW Q;  3NEL A;  4LNQ A;  3HOV G;  4X6A H;  1UWV A;  2VQE L;  2ES2 A;  3CPW A;  4DR1 L;  2WB1 G;  4LUZ A;  3S2D H;  4KHP Q;  1IXR A;  5IP9 G;  1AE2 A;  2RCN A;  1N9W A;  2VZA A;  1KAW A;  1BBU A;  1OXX K;  2CFM A;  2N78 A;  4IPD A;  1YIT A;  4JI6 Q;  2VQF L;  3FKI H;  4A93 G;  4P71 A;  1OXU A;  1PH7 A;  4YHH L;  1GO3 E;  3J81 j;  1VQE A;  1D8L A;  1PH6 A;  3L0O A;  3W5O A;  1Y1W H;  5K36 G;  4X62 L;  3PV0 A;  1L2F A;  2R93 G;  2I0Q A;  1UE5 A;  1LTL A;  4QL5 A;  3U50 C;  4OWT B;  2Q2H A;  3OTO Q;  3G71 A;  4JV5 L;  1Q81 C;  2IT1 A;  4MNO A;  1KXL A;  4HIK A;  1SLJ A;  2I5M X;  2LXK A;  4DUZ Q;  1E24 A;  3LGJ A;  1Q82 C;  5C4X H;  2F4V Q;  4A3M G;  5M5Y H;  2ZM6 L;  3I7F A;  4IO9 A;  4GOP A;  4DV6 L;  1YVC A;  4BY1 G;  2ZJP A;  1S40 A;  2UUC L;  4L5Q A;  1SMX A;  4BBR G;  1XNQ Q;  2VNU D;  3KYH C;  4EX5 A;  2JA5 G;  3PF4 A;  4DR6 Q;  2UUB L;  1NE3 A;  1P16 A;  1VQC A;  1E7Z A;  3KDF A;  3CP0 A;  4NB3 A;  4YCV A;  5C0X I;  3PO2 G;  1VQ6 A;  3Q8D A;  4DR4 L;  2N8N A;  4YWL A;  3HKZ G;  3E9H A;  4NXN L;  4GLX A;  1KQS A;  1AH9 A;  3KF6 B;  4LF5 L;  1V1Q A;  1YNX A;  5C0X J;  1EQR A;  4IJL A;  3E9I A;  1HNZ L;  5GAH C;  1X54 A;  3PF5 A;  1UE1 A;  1YI2 A;  1XMO L;  1SRO A;  1L0W A;  4A3F G;  4C3H H;  1OXV A;  2Z0S A;  1QVF A;  2KCM A;  4UP9 A;  4RG1 A;  2R7Z H;  4DR2 L;  4DV0 L;  1L1O B;  4A75 A;  4LF8 Q;  4B3S L;  4DV3 L;  1K3R A;  2VUM G;  3G48 A;  3GTP H;  3HOX H;  4L5S A;  3ER0 A;  4JYA L;  4JI0 L;  4GKK L;  2NZH A;  3H3V I;  1YBY A;  2JJQ A;  4X64 L;  5JEA G;  4X66 Q;  1PH9 A;  4YWK A;  3PUY A;  4MZ9 A;  2H5X A;  2WFW A;  1N33 L;  2JA7 G;  2DGY A;  1U0L A;  5EAY A;  4DAM A;  1C9O A;  4AQY Q;  1KC8 C;  2L15 A;  1XTD A;  1FL0 A;  2K50 A;  4B3M Q;  4A3C H;  4R4T A;  3CME A;  3IRB A;  3PGZ A;  1X3G A;  4GN5 A;  4JG2 A;  5C44 G;  2FXQ A;  4JI1 L;  1K73 C;  3GTL H;  1PH1 A;  1YHA A;  3BZC A;  3I56 A;  4Y52 H;  1QUQ B;  1VQ8 A;  2F3I A;  4IPC A;  1C7Y A;  2VQE Q;  3W1G A;  2E2H H;  4DR1 Q;  3S1N H;  4A3E H;  2IHF A;  4C2M H;  3KJP A;  5JJL A;  2NVX H;  3S24 A;  1KD1 C;  3HOU H;  4GKJ L;  3M4Q A;  1XNQ L;  3A5Z B;  2AHO B;  2ID0 A;  2RF4 A;  1IYJ B;  4LUO A;  4O0A A;  4A4I A;  4AIM A;  2VQF Q;  4IOC A;  3RZD H;  4YHH Q;  3KLW A;  2N49 A;  4AYB E;  4IPG A;  2JK8 A;  4X62 Q;  1TWG H;  5E7N A;  1RIP A;  2CKZ B;  5M5W H;  4DK3 C;  4LF6 L;  2EIF A;  1VQA A;  3PO3 G;  1IZ6 A;  2BA1 A;  2OCE A;  4A3K H;  1HJP A;  2ALY B;  3DLL A;  2ZTE A;  4PZ8 A;  4XTC S;  2AWO A;  1TWF H;  1Q1B A;  3BJU A;  1BKB A;  1WOC A;  2YV5 A;  4YY3 Q;  1FJG L;  2CCZ A;  1G29 1;  4OWX B;  1M90 C;  1CKO A;  3GTQ H;  4JBW A;  3F1Z A;  5H1S E;  2BH2 A;  4DV6 Q;  4POF A;  2UUC Q;  3GTJ H;  1K8A C;  2CQO A;  2OQ0 A;  2ZTD A;  1QZG A;  4L5R C;  1CSP A;  1X65 A;  4WJ4 A;  2UUB Q;  1KHI A;  1PH2 A;  2IX0 A;  1PH3 A;  1CKN B;  2YYZ A;  3FKI G;  2Q2I A;  1E3P A;  4DR4 Q;  3TRE A;  5GRO A;  2R7F A;  4LW1 A;  4NXN Q;  5IY0 A;  3H0G H;  3RN2 A;  1YZ6 A;  2K5V A;  4R4I A;  4A3D H;  4LF5 Q;  3HOY H;  2BA0 A;  1VQP A;  1GD7 A;  1Q1E A;  4HJ7 A;  5ELN A;  1HNZ Q;  3MEF A;  4OXP A;  4HJ5 A;  2NVQ H;  3S1Q H;  4BBS H;  1Y1V G;  2AKW B;  1XMO Q;  5IT9 c;  5JEA J;  4K0K L;  3E0E A;  4DR2 Q;  1NY4 A;  4DV0 Q;  2D0P A;  4NXM L;  4B3S Q;  4DV3 Q;  5M3M H;  5C4X G;  1VQG A;  4JYA Q;  1C0A A;  4GNX C;  1K8G A;  5M3F G;  1I94 L;  4JI0 Q;  4JI4 L;  4GKK Q;  1EOV A;  4A3L H;  1VQI A;  1G6P A;  4P75 A;  1Z9F A;  4GLA C;  4X64 Q;  1N33 Q;  1XJV A;  1Q46 A;  3TS0 A;  4JI7 L;  2JQO A;  4OX9 L;  1NJI C;  4QJF A;  1VQO A;  1A62 A;  1LYL A;  3M7N A;  3S15 H;  1U5K A;  2KHJ A;  3D31 A;  3PUX A;  5JJK A;  1Q7Y C;  3CQZ H;  4A3G H;  4DV4 L;  4A3I H;  4JI1 Q;  5FLM H;  1E22 A;  1TWA H;  3CCJ A;  1IBM Q;  4DR5 L;  4YY3 L;  4DKA C;  1VQF A;  3L2P A;  4PZ6 A;  2QEX A;  4GOP B;  4EQ5 A;  1IBL L;  2RHS B;  3K8A A;  3I2Z A;  5GAD C;  4GKJ Q;  4OO1 G;  4APV A;  3ERS X;  4ALP A;  3OW2 A;  3AYH B;  2R92 H;  1WJJ A;  4JI3 L;  2MO0 A;  1HZB A;  4X65 L;  4J15 A;  1GKH A;  3CC7 A;  1YEZ A;  4IOA A;  3MXN B;  3NBH B;  3HOX G;  3CMA A;  1XPU A;  2CWP A;  3HFZ B;  3G4S A;  1A63 A;  3H3V H;  4A3B G;  2Z6K A;  1XMQ L;  2WP8 J;  4LF6 Q;  1KL9 A;  2EQS A;  1CKM A;  1AE3 A;  5M5X H;  2HT1 A;  4A3C G;  1EQQ A;  3PSI A;  3PIP A;  1PYB A;  2NN6 I;  4JI2 L;  5IYC H;  1EFW A;  3H15 A;  3TRZ A;  1JJ2 A;  1FJG Q;  3PUW A;  4R4O A;  3CXC A;  4GNX A;  3BU2 A;  1V9P A;  3HKS A;  4LWC A;  4DV5 L;  4LFB L;  4A3E G;  4JBK A;  3HOW H;  3TQY A;  3BZK A;  1Y14 B;  1PFS A;  3EBE A;  3HOU G;  1W3S A;  2K5N A;  1Z47 A;  2Y0S G;  3CCU A;  3UE0 A;  3U58 A;  4BXX H;  4JOI A;  1YJW A;  1SN8 A;  3I4O A;  1I50 H;  2JA6 H;  3KF6 A;  1RL2 A;  4NPS A;  3UDF A;  4A3J H;  1GM5 A;  5C3E H;  1VQ7 A;  1ASZ A;  2YTV A;  3AFQ A;  4UY8 C;  2VS1 A;  4IFD G;  4H02 A;  4TVA B;  2VY3 A;  4HJ9 A;  3HOZ H;  1IBM L;  4IPH A;  2UU9 L;  1PA6 A;  1N32 Q;  2CWA A;  4LUV A;  2WAQ G;  2UUA L;  2B63 H;  1JJG A;  1L1O A;  4A3K G;  1PV4 A;  4JBJ A;  3J7A 5;  5J3B A;  3F2D A;  2QGQ A;  1VQ4 A;  1XPO A;  4K0K Q;  3CPF A;  4R4C A;  3K7A H;  3J7Z C;  2D62 A;  4NXM Q;  1EUJ A;  3AEV A;  4QQB X;  3GTO H;  5IP7 H;  5BR8 L;  3TS2 A;  3CC2 A;  1Q8K A;  3G6E A;  4DV2 L;  1I94 Q;  5LMN W;  4JBM A;  4JI4 Q;  1NTG A;  1NBW A;  4GN4 B;  5HGQ A;  2PQA B;  2N3S A;  4FDB A;  3CCE A;  3RN5 A;  2Q2T A;  4JI7 Q;  4OX9 Q;  3CD6 A;  3U4V A;  3M4P A;  3T1H L;  4A3F H;  4HJA A;  3S14 H;  3VDY A;  1VQN A;  1QUQ A;  1S3O A;  1IBK L;  1WCM H;  4DV4 Q;  1PH4 A;  2VUM H;  4B3T Q;  2UXB L;  3UDX A;  2KHI A;  3KFU A;  1YJ9 A;  1PH8 A;  1IL2 A;  1HZA A;  3T1Y L;  4HIM A;  1EIY B;  3H0G G;  1YJN A;  1HR0 W;  4OON A;  3I4N H;  4A3D G;  3PCO B;  4DR5 Q;  1YIJ A;  5FJ8 H;  1PH5 A;  3HOY G;  1P8L A;  1SE8 A;  3RNU A;  3GTG H;  1I3Q H;  2PI2 A;  2B29 A;  1NMG A;  4B3R L;  2MQH A;  2UXC L;  1QVG A;  1VCI A;  1IBL Q;  2HIX A;  4BA2 I;  4BBS G;  4DR3 L;  1VQB A;  1M1K C;  4DV1 Q;  4LF4 L;  4LF9 L;  1UE6 A;  1I5F A;  3A74 A;  1X6O A;  4JI3 Q;  4X65 Q;  5M3M G;  1PHJ A;  2GN5 A;  2E5L L;  3GTK H;  1BVS A;  4QGU A;  4A3L G;  1EWI A;  3KF8 B;  4RMF A;  1NMF A;  2PMZ E;  1J5E L;  1GVP A;  2HHH L;  2MO1 A;  3K81 C;  3STB C;  5LMN L;  1XMQ Q;  1J6Q A;  1X56 A;  1JB7 A;  3A5U A;  3CW2 C;  1Y1W G;  2EXD A;  2Z6K C;  2IHE A;  2HIV A;  4C3J H;  1N32 L;  4LF7 L;  1N36 L;  1CUK A;  4A3G G;  5C0X G;  4Y7N H;  4JI2 Q;  3K80 C;  1HNX Q;  1X55 A;  2V1C C;  4JC0 A;  5FLM G;  1YHQ A;  5IYD H;  1KRT A;  4JI8 L;  4DV5 Q;  3A0J A;  2JA9 A;  4R4Q A;  1HR0 L;  4LFB Q;  3S1R H;  1LUZ A;  1CKN A;  2B3G A;  5IYB H;  1B8A A;  3J81 i;  4JI5 L;  2YU9 H;  1N34 L;  1B70 B;  5AJ3 L;  2I5L X;  4DAY B;  2UXC Q;  1XPR A;  2F52 A;  4R1J A;  4JOI C;  2JE6 I;  3TEH B;  5IWA L;  3F2C A;  2NZO A;  3CCV A;  4B3T L;  2ATW A;  4DNI A;  2XGT A;  2MFI A;  5IE8 A;  3J80 i;  2UU9 Q;  1MKH A;  4P72 A;  2UUA Q;  3I4M H;  3S17 H;  5GQO A;  3UDI A;  4DV7 L;  4BY7 H;  1KRS A;  3JAM i;  4YCU A;  2UXD L;  1FVI A;  1WYD A;  3J81 c;  1VQH A;  1LM0 A;  1L1O C;  4GN3 B;  5DLQ E;  2PNH A;  5IYC G;  1VQ9 A;  3FP9 A;  1A8V A;  4DV1 L;  2IX1 A;  2R7D A;  5BR8 Q;  1KIX A;  2JA8 H;  3ULL A;  3S2H H;  5JJI A;  3STB D;  2R7Z G;  4DR7 L;  1MJE A;  4DV2 Q;  2XTI A;  1DGS A;  2WB1 E;  3AQQ A;  2MNA A;  3K0X A;  4HIO A;  3PUZ A;  3KDF B;  2K52 A;  2KEN A;  2I5H A;  3EIV A;  3SGI A;  3CCQ A;  3HOV H;  1K9M C;  3HOW G;  1SRU A;  3U4Z A;  1Y1V H;  3M9B A;  3KJO A;  5C4J H;  3J80 c;  2A19 A;  1VQL A;  1XNR L;  3T1H Q;  1HZ9 A;  4L5T A;  1OTC A;  3M3Y H;  5IP9 H;  5ELO A;  4BXX G;  2A1A A;  1IBK Q;  3JAM c;  3W1B A;  1EYG A;  3UDG A;  2JA6 G;  2UXB Q;  4A3J G;  3CC4 A;  2R6G A;  5C3E G;  1PVO A;  5M3F H;  1VQD A;  4LFA L;  4A93 H;  3T1Y Q;  1SR3 A;  1HNX L;  3CF5 A;  3NEN A;  1I6H H;  3HOZ G;  4POG A;  2AMC B;  4GNX B;  4XIG S;  4MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...