2UXCQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcQ00
3G6EA 4JI4Q 2DUDA 1JMCA 3KFUA 4BBSH 4L5SA 4KHZA 4JC0A 1VQEA 4HJ7A 3PO3G 5LMNL 5FJ8H 4A3BH 1Q12A 2IHEA 3M4QA 4P75A 4XIGS 5EAYA 4HIMA 1O7IA 5C3EH 4LF8Q 2I5HA 2NVTH 4YWKA 2CKZB 4LFCQ 3CC2A 1NE3A 3CW2C 3RZOH 1Q1BA 1Q1EA 4JCVE 4BA1I 4A3GH 1V43A 2LXKA 2ZTCA 4DV0Q 1QUQB 3KOJA 1X6OA 3H0GH 3U58A 1EFWA 1G51A 1NBWA 1UEBA 3J80c 4OWTB 1ASZA 1KHIA 5M5WH 3HOWH 1A63A 3L0OA 1P16A 5FLMG 3S14H 5IYDG 4JBWA 4OX9L 2MO0A 2R93H 1WI5A 4A3KG 4HJ5A 4DR1L 1XMOQ 3E9HA 3H3VI 4WJ4A 1S72A 2JA7H 1JE5A 1TWHH 1UE5A 2KHIA 2F3IA 1PYBA 3DLLA 4DUZL 1EIFA 1MJEA 2UXCL 4L5TA 1N34L 4NXNQ 5HGQA 2QEXA 2YYZA 4A3FG 3J80i 5IP7H 4BBRG 1VQIA 2WB1E 4LUZA 1N34Q 3U50C 3KDFA 1IXRA 4R4IA 3BJUA 2VY3A 5ELNA 2JA5G 2ATWA 3CCJA 3HOVH 3MEFA 4LF6Q 1KRSA 1S3OA 1VQFA 2K5HA 5BR8L 4A3IG 4DR4L 1PYSB 4IOCA 1PH5A 3I4MH 1X56A 2CQOA 1YZ6A 4AYBE 3H3VH 1CUKA 2E5LL 3CD6A 2VW9A 5K36G 4LF4L 3K7UC 2R7DA 3KF8B 5IYCH 4QY7A 4BY1G 1JT8A 3J7ZC 4KHPL 1I3QH 1YEZA 2HHHQ 5M3MG 1B70B 1E24A 3ZJYC 3S2HH 1GM5A 1OXVA 5M3FG 4L5RC 4IPHA 5HY6A 2UXCQ 4Y52H 1FGUA 3UE1A 4GNXB 2OWOA 3KDFB 4DV5Q 4NB3A 2ZJQA 5C4XG 1KIXA 1E22A 2IX0A 3CF5A 2HT1A 4P71A 2I5LX 3M9BA 1V1QA 3M85A 3A0JA 2UUAL 4WJ3M 2K50A 3BZKA 3FP9A 1WOCA 5IT9c 2A8VA 4GN5A 4TQUS 4Y7NH 3W5OA 3I4NH 2KCTA 1HZBA 4JI0Q 2D0OA 2UUAQ 5BR8Q 4A3MG 3GO5A 1L1OA 2K52A 2KENA 2UXDL 5C44G 4DV4L 1VQPA 2XTIA 4A3CH 2PI2E 4LF4Q 3GTPH 4A3JH 2UXDQ 3PUZA 4JI3Q 1G6PA 1OTCA 4LF7Q 3MXNB 2Z6KA 3NBHB 1LYLA 1EIYB 2R92G 3HOYG 1EOVA 4BA2I 1CKOA 3KYHC 4X66L 3OTOQ 4GKJL 3PV0A 2N49A 3S24A 3HOUH 1KAWA 3E0EA 3I55A 4QGUA 2YTXA 3CXCA 2WP8J 4IPDA 4MTNA 2IY5B 4UP9A 4JI7L 1HZCA 1YNXA 5GROA 4AIMA 3WWVA 3HOZH 1FJGQ 2AWNA 4R4CA 4DR5L 1VQLA 2AWOA 1RIPA 3A5UA 5LMUQ 2UU9L 3A74A 4R1JA 3M3YH 2K5NA 2BA0A 4IO9A 4DR5Q 3CAMA 3BZCA 3NEMA 3PCOB 4JI5L 3PUYA 1B7YB 3UDXA 2QGQA 3S15H 4YWMA 3D0FA 4JI1Q 4DV3L 2VQFQ 5J3BA 2AHOB 2NZHA 2I0QA 3RLFA 1CKNA 1YBYA 3S1MH 2RF4A 2YU9H 1VQAA 4UY8C 3JAMi 3T1HQ 1TWGH 4O0AA 2MQHA 1VQBA 2R7FA 1X3FA 3UDGA 3CC4A 4BY7G 2A1AA 1LTLA 2Y0SG 2AMCB 3HOYH 3W1BA 1U0LA 4UP7A 5DLQE 3CCLA 3M4OH 1EYGA 4C3HH 1WCMH 4PMWA 2FXQA 3I4MG 4QQBX 1X3EA 4DNIA 3CPWA 3RLNA 1XMQL 4A3CG 1N32Q 3CPFA 4B3RQ 4NXNL 1UWVA 1Q46A 3HOXH 5H1SE 2E2IH 3GTGH 1XTDA 4A3LG 3AEVA 1SN8A 4JI6Q 4A3EH 2ZJPA 1VQMA 5JJLA 2Z0SA 3HOZG 1AE2A 4DR6Q 4X65L 4LFAQ 4JBMA 3F2CA 3I4NG 4UP8A 4KI0A 4JI8Q 1XNRL 5LMUL 2Q2IA 4GLAC 4A75A 4DR6L 1C9OA 3CCQA 3S1RH 2R7ZG 2R6GA 3HKSA 4JBKA 2NN6G 2OQKA 5E7NA 1OXUA 3TEHB 4A3EG 4GN4B 1N33L 4LF8L 1QZHA 4GN3B 1TWCH 3HOXG 4DV7Q 4DV3Q 4C3IH 3PUVA 1RL2A 1H95A 2UUBL 4AQYL 4EQ5A 1DGSA 3GDEA 5FLMH 1PH9A 1J5EQ 2KBNA 1D8LA 1A62A 1IBLQ 3PSIA 1TWAH 2I5MX 1IZ6A 1OXSC 2N8NA 4BY7H 1YJWA 2YV5A 1VQ6A 2YTVA 1IYJB 3ULJA 1VQKA 4IFDJ 1PA6A 3L2PA 4OX9Q 4QL5A 3GTMH 2UXBQ 5GADC 1PH2A 4OXPA 4DPGA 2WB1G 4KLKA 2CWAA 5C3EG 1HNWQ 1HZAA 4DR2L 2B3GA 3K0XA 3G4SA 4DV6Q 4DV1L 1NJIC 4GKKL 2JA8H 4K0KQ 4LFAL 4LFBL 4YCVA 3PUXA 2VQEL 2JA8G 3I56A 1XNQL 1FVIA 4DR2Q 2MNAA 3AQQA 1YHAA 2R7ZH 3S16H 1QUQA 4DKAC 4GLXA 4BBRH 5C4JH 4A3FH 3PIOA 3CCRA 2IHFA 2ES2A 2PMZE 5IE8A 4DV7L 1VQHA 4DR3L 5M5XH 2F4VQ 1LM0A 1MJCA 5IWAQ 4BY1H 4GNXC 1CKNB 4ME3A 1PH4A 2R92H 2OCEA 4LUVA 2GVAA 4IJHA 4QJFA 2PQAA 4X62Q 3J81j 3CCSA 4A3KH 1Q81C 4YHHL 2HQLA 1EQRA 4R4OA 3RZDH 1IBKQ 3ICEA 4DK6C 3CMEA 3E9IA 1X3GA 1VQ5A 2C35B 2BH8A 5C44H 4R4QA 3J81c 1IBKL 1BVSA 1L1OC 4DUYQ 1YVCA 2E5LQ 1MKHA 4AH6A 2ZTDA 4GS3A 4P72A 4DV1Q 1PH8A 3AFQA 2JEAI 1VS0A 4K0KL 1AE3A 2JE6I 2GN5A 3EIVA 4L5QA 2RCNA 4B3ML 2JQOA 2WAQG 4XTCS 2Z6KC 5C4XH 1VQNA 3KF6B 2WFWA 1KD1C 3F8TA 4APVA 4LF7L 4NXMQ 3GTQH 4POFA 4A3LH 4RG1A 3STBD 5M3FH 1XPRA 3RNUA 2R93G 1ASYA 1IBML 3K8AA 2ID0A 4QIWE 1OXXK 2ZTEA 2HHHL 4TVAB 1L1OB 4P74A 1IBMQ 1HR0Q 4LF9L 3UDFA 4FDBA 3HOUG 2Q2HA 1PH6A 4POGA 1CSPA 2K14A 5LMNW 4GNXA 4LUOA 1L0WA 4DAMA 4EX5A 3K81C 1UE6A 4B3RL 1SE8A 2RHQB 4P73A 3M7NA 5C0XI 2QA4A 4JI5Q 4A3IH 2K5VA 3Q8DA 1BBWA 3TRZA 2D0PA 4JBJA 1XJVA 2VS1A 3HOVG 3RR5A 2JA5H 2JEBI 1VQ7A 3CQZH 1PHJA 1KXLA 2XGTA 1VQOA 3CP0A 1CKMA 1FJGL 4JYAL 1GO3E 3GTKH 1SLJA 1QVFA 2K75A 4H02A 1B8AA 1OXTA 4C2MH 1WJJA 4GLVB 1KQSA 4JYAQ 1SFOH 1QVGA 1SRUA 2UUCQ 4BXXG 1HNXQ 1N36L 4DV2L 1JJCB 2UUBQ 1VCIA 4YY3L 3S2DH 2JA7G 4OWXB 2LSSA 3EBEA 1WCMG 4GOPB 3DM3A 3TREA 4DV2Q 3JAMc 4DV5L 3A5ZB 5JJKA 5JEAJ 5JJIA 1VQGA 4O2DA 3HKZE 3H0GG 2N78A 4NPSA 1E7ZA 1T9HA 3JC66 1Q82C 2VUMH 4JI0L 3G48A 2OTJA 5C0XJ 3PO2G 4PG3A 4GKKQ 3ERSX 3T1HL 4JOIC 1YHBA 2IT1A 1M1KC 2OTLA 3STBC 4X64Q 2DGYA 5JEAG 3K80C 4JV5L 3PO3H 4A3DH 1UE1A 5FJ8G 4A3BG 1AH9A 4IOAA 1QVCA 3S1NH 3S17H 3GTOH 3ULPA 3CCMA 4X64L 1S40A 4JI2L 4JG2A 1KRTA 1HNZL 2IX1A 4JV5Q 1Q8KA 3TS0A 3PIPA 3CCEA 2MFIA 4X66Q 5M3MH 4DR7L 4GKJQ 1UE7A 1N36Q 1BBUA 1N8RC 3RN5A 2JA6G 1HR0W 1E3PA 1YIJA 4LFCL 4A76A 2RHSB 2B63H 1M90C 2N3SA 3GD7A 3I2ZA 1K8GA 4B3TL 4LWCA 1GD7A 2B29A 2EXDA 4JI7Q 1NY4A 1N32L 2NZOA 3RN2A 2ASBA 4JI4L 2V1CC 1Y1VH 3AFPA 2VQEQ 4B3TQ 1GKHA 4DUZQ 4A3JG 2JK8A 1KL9A 2E8GA 3PF4A 4RMFA 1A0IA 4X65Q 1PV4A 4JI8L 1JJGA 2EIFA 1JJ2A 1Y14B 2AKWB 2ZM6L 3OW2A 1LUZA 4DR1Q 3G71A 4AQYQ 4DR3Q 4A3MH 4YCUA 1Z9FA 2EQSA 2JA6H 3U4VA 4AYBG 1Y1WH 5IP7G 2ZM6Q 2ZJRA 1I50H 4DV0L 1YJ9A 1K0RA 3W1GA 3PF5A 4IFDI 4IPCA 4JOIA 4YHHQ 3J7A5 5FLXc 1MIUA 1K83H 4LF5Q 4DR4Q 4KHPQ 3J81i 1VQDA 1K73C 4DR7Q 1PH3A 2Q2UA 3FKIG 1HNWL 1XMOL 5GAEC 1YHQA 1HJPA 2F4VL 3B6YA 5LMNQ 2E2JH 1QZGA 1X65A 2KHJA 3IRBA 3OYYA 1Q7YC 1K3RA 1YITA 2VUMG 4HJ9A 2BH2A 1XPOA 1V9PA 3PGZA 5IYCG 2PQAB 2YTYA 3RLOA 1BKBA 3ULLA 4B3MQ 1XNRQ 3UDIA 4OONA 1I6HH 1YI2A 1K8AC 3KLWA 1K9MC 3FHWA 4HIKA 2CCZA 5C0XG 2VNUD 5IWAL 4DK3C 4IJLA 2K4KA 1P8LA 3I7FA 3GTLH 3FKIH 3SGIA 4A4IA 1CSQA 2D62A 3F1ZA 5IYBG 3KJPA 3PUWA 1D7QA 1EQQA 1R9TH 4MZ9A 1WFQA 1N9WA 3HFZB 1GVPA 3S1QH 4BXXH 1E1OA 3CCUA 5AJ3Q 1PH1A 1SR3A 2PNHA 1J6QA 1X55A 1IBLL 4LNQA 2CWPA 1SROA 2Q2TA 1PFSA 3K7AH 4LF5L 4X62L 5AJ3L 4DUYL 2A19A 4JI3L 2NVXH 3UE0A 2UXBL 1NMGA 1EUJA 1YJNA 1A8VA 1HH2P 3I4OA 3VDYA 4A3DG 3L7ZC 5IYBH 4R4TA 3HKZG 1XMQQ 1PVOA 1TXYA 1X54A 5IP9H 1HR0L 1VQJA 4LF9Q 1I94Q 1Y1VG 4LF6L 5IYDH 2VL6A 3PO2H 4LFBQ 1XPUA 2UU9Q 1XNQQ 4PZ7A 1I94L 2NN6I 1C7YA 4HJ8A 3CMAA 3BU2A 4A3GG 1G291 1JB7A 2MO1A 1E1TA 2ALYB 4UPAA 4A93H 4X6AH 2OQ0A 2WAQE 2PI2A 1HZ9A 5GAGC 5IP9G 1Q86C 2GVBA 4DV4Q 4OO1G 1SMXA 5GQOA 4YWLA 4HIOA 1VQ8A 1VQ9A 1C0AA 1VQCA 1WYDA 2JA9A 5IY0A 2BA1A 4BBSG 1NTGA 4C3JH 2Y0SE 1X9NA 3HOWG 4PZ6A 3ER0A 2HIXA 4A93G 1Z47A 2KCMA 4HJAA 3F2DA 1Y1WG 1KC8C 2F52A 5GAHC 2L15A 2VZAA 4PZ8A 4JI1L 1FL0A 3U4ZA 1TWFH 3EN2A 2H5XA 4GOPA 3NENA 4DV6L 1EWIA 1W2BA 2E2HH 2CFMA 2UUCL 4IPGA 2HIVA 4OO1I 4YCWA 4DAYB 4JI6L 3T1YL 4JI2Q 4NXML 1PH7A 2LXJA 3TQYA 3GTJH 1NMFA 4ALPA 4GOPC 3TS2A 3AYHB 5M5YH 3H15A 3T1YQ 3LGJA 1L2FA 2B63G 4IFDG 3CCVA 4OWWB 1W3SA 3NELA 3KF6A 4LW1A 2VQFL 3D31A 1U5KA 3CC7A 1N33Q 1J5EL 1VQ4A 1HNXL 3OTOL 4B3SQ 1IL2A 3F2BA 3KJOA 3M4PA 2NVQH 5ELOA 4YY3Q 4J15A 4MNOA 4HIDA 1I5FA 4B3SL 2JJQA 2NVYH 1HNZQ
chains in the Genus database with same CATH superfamily
3G6EA 4ABNA 2DUDA 3W3AA 3R3OA 4BBSH 4JC0A 1Y8OB 5E3FA 5FJ8H 1HHVA 1LTAD 3M4QA 1HQRD 3G6JB 4HIMA 5EBDA 1O7IA 1EQVA 1QB5D 3Q0AA 1NE3A 3TN2A 4JCVE 4BA1I 4DAVA 4NP5A 1GHKA 1X6OA 4Z9CB 1UEBA 1IW7D 3J80c 1JWMD 4OWTB 1TS2A 1ESRA 1CT1D 3S14H 5IYDG 2F0EA 3IKJA 2KHSA 4HJ5A 3VR6A 4DR1L 1BUVT 1B3QA 1JE5A 2JA7B 1UE5A 2E2DC 4DUZL 4HCEA 1N34L 3TZDA 2YYZA 2XNAC 3BVMA 1KNEA 4BBRG 1VQIA 4LUZA 1LO5D 4HSPA 3KDFA 2R7ZB 4EQNA 2VY3A 4R8NA 3OWFA 3HOVH 3NBHA 3UI2A 1L0YB 1S3OA 2K5HA 4FVMA 4IOCA 1ICFB 3CD6A 1ZKOA 4I7ZC 1SJED 5I2YA 4QY7A 3MZ5A 2A6EC 1CZGA 1HA5A 1YEZA 3DEOA 4DXFA 4KN7C 4V190 3SEBA 1DJRD 5BN5A 3NPPA 3PO3B 2HT1A 3M85A 2UUAL 3BZKA 5IT9c 1WOCA 4GN5A 1ENFA 3OMGA 2KCTA 3I90A 2D0OA 2NVTB 5I4DA 1MHWC 1F77A 5C44G 1VQPA 4K5XA 2PI2E 4A3JH 3PUZA 2K5DA 2Z9HA 3BS1A 3HOYG 2R92G 2BDOA 2WINB 4BA2I 3PV0A 3G7LA 3S24A 4YIJA 3O13A 3C1EA 3Q22A 1QJOA 2WP8J 4A93B 4IPDA 4RFBA 1EIHA 1HZCA 5AFWA 1ML0D 1RIPA 3OHXC 4R1JA 2K5NA 4IO9A 4DR5Q 3CAMA 1VF7A 3UDXA 3Q24A 2B2WA 3M7GA 3NSWA 1YBYA 1NR4A 3S1MH 5EPKA 3KLSX 3FEWX 2R7FA 1Z6HA 1WTQA 5DLQE 4UP7A 3CCLA 1I4GA 2D2CC 4PMWA 2O4XA 4ZUIA 3GTPB 2O2LD 4A3CG 1WTWA 1N32Q 1A3VA 3HKZB 4B3RQ 3J80E 4A3LG 1XTDA 2HDMA 1M8AA 3AEVA 2B2TC 5C4XB 4WORA 1BCPF 1BCPD 1FNWA 1TY2A 4DR6Q 2X6LA 1BNZA 2F0QA 3K57A 1D5MC 4JPBW 1YNNC 1RTOA 1XNRL 4RGNA 4GLAC 1QE6A 1C9OA 1N33L 2NN6G 3S9WA 4A3EG 4GN4B 5C3WA 4PV1C 1TWCH 1JWSD 2SDFA 4FF4A 2L0CA 3PUVA 1RL2A 1H95A 3OOCA 5FLMH 1PH9A 1E2WA 1B53A 1D8LA 4I65A 3LWEA 3K5NA 2I5MX 5LL6X 4BY7H 1YJWA 4IFDJ 2CQAA 2A6ED 4KK7A 3L2PA 4QL5A 1LABA 5E1FA 5GADC 4OXPA 2PZWA 1RODA 4KLKA 2WB1B 4OIJA 2F0HA 5C3EG 3S16B 1EU4A 4DR2L 2EYFA 2FINB 3G4SA 4LFAL 2JA8G 3PUXA 1ILQA 3S16H 4GLXA 1T5XD 1FD7D 4AYBB 3PIOA 2IHFA 2PMZE 4DR3L 1RTNA 5M5XH 1C48A 1LM0A 1MJCA 1H9KA 4ME3A 2CW0C 1CTMA 4QJFA 2GVAA 3VYRA 2PQAA 1X3QA 3CKIB 1S5ED 2G9HD 1IBKQ 3CMEA 1SNOA 4C3IG 2JYOA 1RF2D 5D65A 4CKBA 4R4QA 2LY7A 2EJMA 2JA6B 1L1OC 4OIKA 2IX3A 4DUYQ 2E5LQ 2PZTA 4AH6A 2JEAI 1AE3A 3EIVA 3KLRA 3EQLC 5C4XH 2Z6KC 3KF6B 4PNYA 3GTQH 1WTVA 3STBD 1GUWA 5KIXA 5M3FH 3KF8A 3RNUA 2R93G 2QF7A 4X3UA 4FF1A 3SR1A 1HR0Q 4LF9L 4FDBA 4DFAA 3P1HA 1SBBB 4POGA 4B9XA 1F2MA 4RHSA 5KNBA 5M5YB 4GNXA 4DAMA 3GTKB 4HEDA 3K81C 3C46A 2DJFC 2RHQB 5C0XI 4A3IH 2PZUA 2PW7A 2VS1A 1TWFB 2JA5H 2JEBI 5CV9A 1CHQD 3CP0A 4IZ8A 2RSOA 3RMHA 2AUKA 1OXTA 1SAPA 2F0JA 2UUCQ 3SHLA 4MN3A 1HNXQ 3TDQA 1JB3A 5EQ0A 1N36L 1JJCB 1VCIA 4YY3L 2JA7G 1I4QA 2LSSA 1IYUA 2XVSA 1KAAA 4C3HG 3DM3A 1DZ1A 1UUPA 3URYA 5JJKA 5JJIA 1AP0A 4FXKC 4E6IA 2PPBC 4JI0L 3G48A 2OTJA 5A35A 4GKKQ 3AMUA 3T1HL 1QG7A 3MTSA 1M1KC 3K6OA 1FYCA 3STBC 5JEAG 4X64Q 3PO3H 5BN3A 1AH9A 4IOAA 1QVCA 3S1NH 3I70A 3EROA 2IX1A 1S40A 4JG2A 4JV5Q 5IGFA 4ZLTF 5IIFA 4IUTA 1A3TA 4UAIA 1UE7A 1I3QB 1TY0A 1J9OA 1B4OA 1M90C 4B3TL 3I2ZA 3V05A 1R9TB 1EY4A 2B29A 5K36H 2NZOA 2KQ3A 4DUZQ 2EE1A 4ZKCB 4JI8L 2EIFA 1JJ2A 1I6HB 2DN8A 2ZM6L 1STGA 3G71A 5G3LD 4DR3Q 2EQSA 1VDZA 4JK1C 1PTOB 3K59A 2ZM6Q 2A6HD 1YJ9A 1K0RA 4V0BA 2J0TD 4IFDI 4YHHQ 1B2TA 1MIUA 4DR4Q 4PMBA 5LL6S 1PH3A 2F3VA 5IGEA 2E2JH 2L9HA 1BO0A 4A3FB 1Q7YC 1K3RA 3MFYA 1YITA 2VUMG 3EVQA 3S1RB 3QG1A 4ILWA 4B3MQ 1ENCA 1K8AC 3KLWA 2CCZA 1TIID 5ELCA 2EOTA 4IUPA 3SGIA 1CSQA 5IYBG 3PUWA 4RGMA 3A8IE 1D7QA 1EQQA 1N9WA 3HFZB 2NVYB 2KEEA 2F0FA 1X55A 5ISRA 4QIWB 3K7AH 4CBVA 5AJ3L 2A19A 5JVH3 1ONLA 4RGTA 4ZCKA 1QWYA 1O78A 2YU9B 1EIGA 3S1MB 3UE0A 1QNKA 4C3IB 2FFKB 4ZAIA 2UXBL 5KEEA 1EQTA 1HH2P 3I4OA 1ESFA 4R4TA 4A3DB 3A56A 3E6ZX 1X54A 5LHY1 4LF9Q 1VQJA 1EY5A 1Y1VG 1I94Q 2VL6A 1XPUA 1LV9A 1XNQQ 4PZ7A 3L9AX 2NN6I 1C7YA 4HJ8A 2RDGA 4A3GG 2K6AA 3J80L 4N9TA 2L12A 3TMEA 2F1MA 1R4PB 3GTGB 2E2IB 4A93H 3I91A 4FO2A 2EYPA 1VQCA 2JA9A 2BA1A 2EVBA 4C3JH 3Q23A 1AW7A 3HOWG 5EKLA 4G4KA 4IALA 3ER0A 1S4ZA 2KCMA 4HJAA 1Y1WG 2E74C 5GAHC 1F9QA 3CQZB 3NQIA 4PZ8A 1FL0A 3U4ZA 1BF4A 3EN2A 3M3YB 3NENA 1W2BA 1PTOD 1D5XC 4YCWA 2F0VA 4DAYB 4OO1I 4JI2Q 2LXJA 5KNCA 2HD3A 3TS2A 3AYHB 3T1YQ 1CQFA 2QILA 3CCVA 1W3SA 2VQFL 3D31A 1U5KA 3CC7A 1J5EL 1QOHA 2QEJC 3M4PA 5CR3A 1EEID 5J39A 4MNOA 4HIDA 4KHPL 4QUFA 1DXMA 4ODGA 4FNFA 3J7AF 2I07B 1Q12A 4P75A 5FK9C 4WJWA 3GTLB 2I5HA 4X3SA 2CKZB 4YWKA 3CC2A 3LWUA 2EPBA 2SNMA 5C4ZA 1Q1EA 1U4RA 1G91A 2ZTCA 1K28A 1FGBD 1SYCA 3H0GH 1G51A 1NBWA 1ASZA 1A63A 3L0OA 1P16A 1K8OA 4JBWA 2HDLA 1BBXC 2MO0A 1WI5A 4A3KG 1NSNS 4WJ4A 2JA7H 1RD9D 1TWHH 4FYDA 1F9PA 1EIFA 1D2BA 4NXNQ 4H0LC 2QEXA 1EY8A 5IP7H 1M4VA 1IKLA 1N34Q 2CH4W 3KBXA 4TSSA 3U50C 5FLXE 2NTSA 1IXRA 4R4IA 5ELNA 4ME5A 3K5LA 2JA5G 2ATWA 3CCJA 1A3UA 2WKDA 3MEFA 4R9WA 3I4MH 1BXTA 1HTLD 1F2ZA 2ICIA 3H3VH 4N9PA 1STBA 2FJ2A 2R7DA 3KF8B 1JT8A 1K8MA 3SK5A 2XSCA 3J7ZC 2NVQB 1B70B 1UNSA 1SYGA 4IPHA 4Y52H 4C1NI 2UXCQ 1FGUA 4GNXB 2OWOA 4DV5Q 2RSNA 1E22A 3H0GB 4G7HC 1SNQA 2I5LX 1V1QA 3A0JA 4KMUC 2K50A 2K05A 3SE0A 4XT1B 3I4NH 5BR8Q 3CU7A 2D5DA 2EYMA 3FDTA 2XTIA 4A3CH 4LF4Q 1EWCA 4C1NK 1G6PA 4LF7Q 1DCZA 4DU9A 2KECA 3H6MA 2LFNA 2Z6KA 1LYLA 4HTHA 1EOVA 1ET6A 1CKOA 2QDBA 1NAPA 2N49A 1MGSA 4PMCA 1KAWA 3E0EA 2KJXA 4QGUA 2JP1A 2WKCA 3OMCA 1T5EA 4UP9A 4JI7L 5GROA 1YNXA 4AIMA 3HOZH 2D9UA 3S15B 1HRJA 2AWNA 4R4CA 4OEMB 4DR5L 4DF7A 1GUOA 2BA0A 3BZCA 3NEMA 3A7AB 5E4WC 3S15H 4YWMA 4JI1Q 1EY7A 5J3BA 2I0QA 1CKNA 2RF4A 4XYOA 1SYBA 3DWPA 3JAMi 1R4QB 2EJGC 4C3JB 4XQNA 3HOYH 4KKUA 1U0LA 3GV6A 1WCMH 4DN4M 4HMJA 1X3EA 4I7AA 4QF4A 3CPWA 4NXNL 3BZDB 1SN8A 3DMUA 1VQMA 1OO9B 3MXNA 4H13C 4JBMA 3F2CA 3I4NG 4UP8A 4JI8Q 3LNNA 1Q8IA 2NTTA 3PO2B 2MJ8A 3T16A 2B2TA 2Z6BA 2BE5D 3TEHB 1OXUA 4HMIA 4DV3Q 1I4HA 2XWBB 1C4QA 1CA5A 2UUBL 4EQ5A 3BVZA 3H91A 2B2WC 1A62A 1IBLQ 1TWAH 4NDXA 1VQ6A 1ZXTA 1VQKA 1PA6A 1S5CD 3GTMH 4DPGA 4RGOS 1BDOA 1D1IA 3I4MB 2B3GA 3K0XA 1NJIC 4GKKL 4J6HA 4K0KQ 4LFBL 1V1PB 2ZXRA 2VQEL 1FVIA 2JN4A 3DWQA 3ONAB 3CRLC 1EWHA 2E2JB 2A74C 3V2TA 4BY1H 4GNXC 1GUTA 2BE5C 4O42A 2A5HA 3CCSA 4A3KH 1KLUD 4HAEA 4R4OA 3ICEA 4DK6C 2P5ZX 4F87A 5EKKA 1VQ5A 2Q8RE 1KNAA 2V4DA 4ULLA 1YVCA 2F0TA 4K14A 2EY6A 3TP8A 1MKHA 3EJIA 4DV1Q 4NW2A 1STAA 3AFQA 2K03A 4J8QA 2KA7A 2JE6I 4L5QA 4M8AA 1WTPA 5C3EB 4XYQA 2JQOA 2WAQG 2WFWA 4C3JG 3MEHA 4LF7L 4POFA 1I4XA 1WCMB 1ASYA 1H9JA 1IBML 4EVOA 1DOMA 2ID0A 2TSSA 4TVAB 4P74A 3UDFA 3HOUG 1PH6A 1CSPA 2NZ1D 1L0WA 3GTJB 3FPPA 5D14A 3T56B 3P75A 1SE8A 4KV6A 4P73A 3M7NA 2QA4A 1U4LA 4JBJA 1XJVA 1XX8A 4JYAL 2F0WA 1SLJA 1B8AA 1WJJA 4GLVB 1PTOC 1FNVA 1SRUA 1EYCA 3DXJC 3PQIA 4UDUC 4BXXG 3R8BA 2F4IA 4DV2L 3HEJA 3GQBA 3NUCA 3WDNA 2M00A 1WCMG 3TREA 3D3RA 2PO4A 4CKCA 4QUCA 3HKZE 3HS0C 2A73B 3H0GG 5M9OA 4NPSA 1E7ZA 1U4PA 1T9HA 4QCLA 3MHBA 4B08A 2MHVA 1EOTA 1LACA 3ERSX 1B1ZA 1WTRA 4IN3A 2DGYA 1RCVD 2CH4A 5FJ8G 2EY2A 5CV8A 3S17H 3ULPA 3C3LA 4X64L 1Q8KA 2JSOA 3D4RA 3TS0A 3PIPA 4N8FA 2MFIA 4X66Q 5M3MH 2R92B 4KY7A 1G8ZD 2JA6G 1E3PA 1JICA 3D4DA 2RHSB 3WOEA 2RDFA 1IL8A 1K8GA 4LWCA 2EXDA 4JI7Q 4ZYSA 2ASBA 3HG9A 3AFPA 4B3TQ 3MVVA 1KDAA 4A3JG 2A68C 2E8GA 4RMFA 1AFPA 3J7YW 3IAYA 4X65Q 1BCPC 1Y14B 2AKWB 4AQYQ 1LUZA 4DR1Q 2JA6H 3T13A 3T53B 4AYBG 1Y1WH 2JXMB 1YNND 5IOCA 4CJ1B 1MSGA 5CV7A 3E0JA 4DV0L 3W1GA 4JOIA 3J7A5 2J7ZA 1TT2A 1B9MA 3E5SA 3J81i 1K73C 4DR7Q 1KDCA 5JEAH 1XMOL 5GAEC 3I72A 4OHJA 3W2DA 1QZGA 3IRBA 2KHJA 3OYYA 1A15A 2M9VA 4HJ9A 1V9PA 3PGZA 2YTYA 1CA6A 1XNRQ 3UDIA 3QOJA 2JA8B 2A6HC 5IWAL 4DK3C 1P8LA 1A2UA 3F1ZA 2Z8LA 4MZ9A 4ZUJA 4BXXH 3CCUA 5AJ3Q 1PH1A 1SR3A 4FXDA 1IBLL 4LNQA 2CWPA 2Q2TA 5KRUA 4X62L 4XQJA 4KKTA 4DUYL 4RCNA 2NVXH 1SYDA 1NMGA 1YJNA 1JOQA 1A8VA 3HZXA 3VDYA 1XMQQ 1PXUA 1HR0L 5IYDH 4LF6L 4LFBQ 1I94L 1Q90A 2Z4IA 3CMAA 3QIAA 1I4RA 2PYKA 3KBGA 2AQ2B 1G291 1E0BA 1STYA 1JB7A 2NYZD 1TS4A 1E1TA 2KEDA 1SXTA 2MO1A 1KLGD 2F0KA 2OQ0A 2PI2A 5IT9E 5IP9G 3HOUB 5E4XA 4YWLA 5GQOA 4HIOA 3A8KE 1C0AA 1WYDA 5CBEE 4BBSG 1NTGA 4F88A 1II3A 1SFOB 3VR2A 2A68D 4A93G 4IQZA 2EYLA 2DY7A 2VZAA 5JVG3 1TWFH 2VXWA 1EWIA 5I6WA 2FMCA 1EZ6A 2CFMA 1W6JA 2H1EA 4IPGA 1PFMA 2HIVA 5A2QL 3T1YL 4NXML 1PH7A 5IGDA 4OL7A 3IL8A 2G5DA 4GOPC 5M5YH 4RKLA 1L2FA 4IFDG 4LMQD 2FMMA 4OWWB 4LW1A 4GZYC 1IL2A 3F2BA 3KJOA 4YY3Q 5EPLA 2QKIC 1I5FA 4B3SL 3HOWH 2CW0D 4H44C 1S5FD 3S1QB 4JI4Q 4A3JB 1SYFA 4L5SA 4KHZA 4HJ7A 5LMNL 2B2VA 1JOOA 4XIGS 4LF8Q 4RCOA 2NVTH 3C2PA 3K5OA 1IHZA 2OF1A 5DM73 3P7JA 3RZOH 1GOZA 4DNTB 1PZID 1TU2B 3GV3A 4Q0FA 4A3GH 1V43A 2LXKA 2NUCA 3KOJA 1ICWA 3U58A 2GA4B 1MI2A 1KHIA 5M5WH 4R8IA 4OX9L 1Y69U 3K0YA 2EYJA 2BCOA 2DY8A 1J8IA 3E9HA 1NUCA 1TWHB 2B2YA 2KHIA 3DLLA 1TQOA 2F0LA 2R93B 1MJEA 1DONA 2UXCL 4DAPA 4A3FG 3J80i 1PTOH 1PFNA 1A2TA 3ND8A 1MD2D 1E2ZA 1NCVA 2EYHA 3MFGA 3NQTA 4LF6Q 1KRSA 5KNDA 5KGUA 1BCPB 2IJ0A 1PH5A 2HUGA 1X32A 4DA2A 1X56A 2CQOA 4AYBE 1CUKA 3TBIB 2PMZB 2VW9A 4LF4L 4MHEA 2OEOA 2X69A 1I3QH 3VR4A 1JCKB 5CMDA 1IKMA 4KD4A 5M3MG 1E24A 1PTOF 2LS01 4NB3A 5C4XG 5D3DA 5IGCA 4P71A 3M9BA 4WJ3M 2ZXOA 4L6TB 4CJ2C 1VF5C 1HZBA 3HGBA 2R3ZA 1LTSD 1QCBD 3GO5A 4A3EB 4N8X1 4FF2A 4DV4L 3GTPH 2RCFA 2O5IC 2WAQB 3MXNB 1JQYD 2RVLA 3VYSA 3AU7A 4GKJL 4IUQA 1JE4A 3TP5A 4C2MB 2YTXA 4MTNA 1RDPD 2IY5B 5EJWA 2CHBD 2H4OA 3BYTB 1FJGQ 1Y8PB 1STHA 1VQLA 2AWOA 1PZJD 3J81L 1CQVA 3A5UA 4KY5A 3A74A 3V96A 4JI5L 2QGQA 5CORA 1ILPA 3L3OC 3D0FA 4DV3L 2VQFQ 2YU9H 4UY8C 1O7ZA 3T1HQ 1TWGH 4O0AA 3UDGA 1X3FA 4BY7G 3K7AB 2A1AA 4DK0A 3H09A 1V1PA 3W1BA 3M4OH 1EYGA 2XRQD 4C3HH 1BR9A 4QQBX 2FXQA 2EY1A 3VYUA 3I4MG 4DNIA 4C56C 3KLSA 4CDEC 1XMQL 1NR2A 1UWVA 3HOXH 2NN6H 4A3EH 2IPKD 4G7ZC 2ZJPA 5JJLA 2Z0SA 4KJNA 3HOZG 4HCSA 4LFAQ 1L0XB 1NNXA 1H9SB 3WOFA 4DR6L 3CCQA 3S1RH 1LTTD 2R6GA 3JAME 4JBKA 2OQKA 5E7NA 2L1BA 4KY6A 1CI3M 1H9SA 2NVXB 1SNMA 3GDEA 3TSSA 5I9OA 1J5EQ 4KKSA 1FNUA 1IZ6A 2N8NA 2YV5A 2YTVA 4HSVA 2F0UA 3HRZC 4UHVA 4BBRB 2FHTA 2WB1G 2CWAA 3FKIB 1BQQT 1HNWQ 2K04A 4DV1L 3NK9A 2JA8H 4YCVA 1EFID 3D6CA 3HOVB 2R61A 3I56A 1YHAA 2R7ZH 1TVXA 1QUQA 4DKAC 2K7VA 4BBRH 5IE8A 2MP1A 4DV7L 2F0MA 1VMCA 5IWAQ 1STNA 2VB3X 1EY0A 2HQEA 3NTKA 4LUVA 4IJHA 4X62Q 5FOBB 4FXGC 1Q81C 2MPMA 4YHHL 3RZDH 3VYTA 2LKVA 2Q8IB 3QB3A 1EEFD 3E9IA 2BOSA 3S1NB 1X3GA 5M5WB 3OWEB 5C44H 2BH8A 1IBKL 1BVSA 1DM0B 3CHBD 3DHQA 3DM1A 4XXEA 3PIO3 2LMCB 4GS3A 4P72A 1PH8A 2QCPX 5CGKA 1SMYC 5ELEA 1KABA 4TKOB 4XTCS 2WACA 4A3LH 2F3WA 4APVA 1SSOA 1DD2A 5DM63 2J4XA 2DJGC 4OO1H 3HOWB 5ELFA 4KD3A 1IW7C 2ZTEA 5M3MB 1L1OB 4DAYA 1TWGB 1C8CA 4XT3B 1SNDA 2Q2HA 4ID6A 4F8MA 4LUOA 3S17B 2RBMA 4WFN3 5IT9L 5I6YA 1WVLA 4JI5Q 2K5VA 3Q8DA 1BBWA 3TRZA 2D0PA 1PRTC 3HOVG 3RR5A 3A54A 1VQ7A 5C5MA 3I3CA 3BDOA 1KXLA 2XGTA 1VQOA 1CKMA 1FJGL 1GO3E 3GTKH 1QVFA 2K75A 4H02A 5FO8B 1U9RA 4C2MH 1KQSA 1SFOH 4L63B 5TSSA 2UUBQ 2Y0SB 2OXPA 1S5BD 3QJYA 3EBEA 2K32A 4DV2Q 1F2LA 1V1OA 2XWJB 3GTQB 3A5ZB 5JEAJ 1VQGA 5L37A 4O2DA 2N78A 4IUUA 1G2SA 3X3NA 1Q82C 5JJZA 2VUMH 5I9PA 2PNRC 4K8IA 4PG3A 1YNJC 3R93A 4FP5D 1YHBA 5C44B 4NMZA 2A69C 4PQXA 4JV5L 5J1ZA 4A3BG 3R2TA 1XYIA 3CCMA 4JI2L 5ELBA 1AN8A 3NBIA 5K5PA 1EYDA 3SDZA 3CCEA 4GKJQ 1N36Q 1N8RC 2L4NA 2C9OA 1YIJA 3PIP3 3EFXD 5G3LF 2B63H 4ZRZA 2N3SA 1JR0D 1GD7A 1NY4A 1N32L 1F2YA 1Y1VH 2O5JC 2K01A 1H9MA 1X3PA 4DK1A 1JJGA 1XXGA 3KUPA 3OW2A 1LTID 1Z9FA 3U4VA 5FKAC 1IYVA 5IP7G 3TP7A 1I50H 1CM9A 2HCCA 4BY7B 2HCIA 4A3KB 1K83B 1VQDA 1HNWL 2CVRA 1YHQA 4BY1B 2NWGA 1HJPA 3S14B 1LT6D 2QDLA 1HTPA 1X65A 2KCCA 2MGSA 1Y1WB 4KHVA 2BH2A 1XPOA 5IYCG 1KTKA 4OONA 3RZOB 3NWTA 3FHWA 4HIKA 4EQPA 4IJLA 2K4KA 2KCNA 4A4IA 2D62A 3HOXB 4CJ0B 2AQ3B 1WFQA 3S1QH 1GVPA 3MA2B 4C3HB 1E1OA 3M4OB 1J6QA 1PLFA 1SROA 1PFSA 1EL0A 4LF5L 1O80A 3MC0B 2BDNA 4JI3L 3FVQA 2B2YC 3GTOB 2EYOA 1A6XA 4A3DG 5IYBH 3HKZG 1PVOA 1ZYRC 5C4HA 3DEPA 1TXYA 2EZVA 3ND9A 3IFDA 3PO2H 2EDGA 4OELB 2UU9Q 1MSHA 3FPUB 4IURA 4CHTB 1G6ZA 3BU2A 2RA4A 2L5TA 5CBAE 1I6VC 5CV5A 4CDDC 2XRSD 3X3MA 2E75C 5GAGC 1Q86C 1LTRD 1B44D 2GVBA 4BS9A 1VQ8A 3S2DB 5IY0A 5FO7B 3VA5A 1X9NA 1WD0A 5A2QE 2HIXA 1GUSA 1LTGD 1K0SA 2F52A 2EJFC 1SEBD 4JI1L 2B8GA 1MBYA 4GOPA 3OIPA 3J81E 3J7AV 2UUCL 1G2TA 5KYIA 1SE4A 2K5WA 2X6GA 3D4WA 5T1GA 3TQYA 3GTJH 3QR8A 4RAUC 2B63G 1B9NA 3NELA 3KF6A 1N33Q 1VQ4A 5ELOA 4XDXA 4J1MA 4J15A 1JORA 1E2VA 3H3VC 1HNZQ 4ZK9B 3KFUA 1JMCA 3SXHA 3RUZA 1VQEA 4DGZA 1SJHD 3PO3G 1VMPA 4A3BH 5EAYA 2IHEA 3AB9A 5C3EH 4LFCQ 5DEHA 3CW2C 1PRTF 1Q1BA 4K6DA 2KOLA 3HP3A 4DV0Q 1QUQB 3T51B 1EFWA 5FLXL 3NTHA 5FLMG 1HUMA 3TP6A 3S2HB 3BDLA 2R93H 1DYQA 1XMOQ 3H3VI 2MUYA 1S72A 4RA8A 3SK6A 2F3IA 1PYBA 4U68A 3NP8A 4IUNA 3A8JE 2ENBA 4L5TA 3P20A 5HGQA 2RDHA 4OGQC 1KDBA 2EY5A 2WB1E 3BYYB 5D3IB 1WTHA 4A3GB 3BJUA 2B8FA 3NHHA 1H9RA 1RKNA 5BR8L 1VQFA 4RKBA 5JAVA 2DNCA 4A3IG 3A55A 4JVZA 1PYSB 2XN9C 3VR3A 2ZT9C 4HN7A 1YZ6A 5C0XH 2E5LL 4S3SA 5FO9B 3GTMB 5K36G 4BBSB 1GHJA 3K7UC 5IYCH 4BY1G 4MTKA 2HHHQ 3NXWA 1HQMC 5T1IA 3ZJYC 1HPCA 2K33A 2K5QA 3S2HH 1GM5A 1OXVA 2ICEC 1ZYRD 5M3FG 4L5RC 5HY6A 3UE1A 1SDFA 1EZ8A 3KDFB 3NWSA 2ZJQA 1KIXA 2IX0A 2KUMA 5COYA 3CF5A 3FP9A 2E2HB 2A8VA 3MXPA 4TQUS 4Y7NH 3W5OA 5JPMC 4JI0Q 2SNSA 2UUAQ 4A3MG 1ET9A 1WTXA 1L1OA 2F0GA 2K52A 2KENA 2UXDL 5C6AA 3QWNA 1TS5A 2UXDQ 4JI3Q 1OTCA 1D1KA 1HFNA 3NBHB 1EIYB 3HOYB 1DOLA 3OTOQ 3KYHC 2Q8TA 4X66L 2B2UA 2B2VC 3HOUH 4TRDA 3I55A 3CXCA 2IL8A 3WWVA 3N52A 2TMPA 1AZPA 5LMUQ 2UU9L 3M3YH 3PCOB 5C5LA 3PUYA 1B7YB 1GUNA 3DUZA 2AHOB 2NZHA 2AQ1B 3I8ZA 3RLFA 3CRKC 1VQAA 5DAUA 4M1UB 5C3XA 2MQHA 1VQBA 3CC4A 1AEXA 5KYLA 1LTLA 1LTBD 2AMCB 2Y0SG 3A7LA 2QW7A 4RWSC 5IODA 2ZXPA 1LLRD 3RLNA 3NE5B 3CPFA 1Q46A 2E2IH 5H1SE 1HFGA 3GTGH 4ZQ3A 4JI6Q 3DWAA 2B2UC 1AE2A 5ELDA 5IGGA 4X65L 3T4AC 3I4NB 4KI0A 4Y7NB 3JAML 4LK1C 5LMUL 2Q2IA 1QILA 4A75A 1PMRA 2R7ZG 3C1FA 3HKSA 4LF8L 1QZHA 4GN3B 2XIWA 3HOXG 4DV7Q 3MXGA 4C3IH 3H94A 4AQYL 4JW0A 4G7OC 1DGSA 1STEA 2KBNA 5NUCA 3PSIA 4U673 1OXSC 3RD4A 1IYJB 3MXUA 3ULJA 3SVMA 4OX9Q 5C4JB 3M4YA 2UXBQ 1PH2A 4G57A 4A3MB 1TR5A 4CGYB 1HZAA 4DV6Q 2PQEA 3OPOA 1XNQL 4DR2Q 2MNAA 3AQQA 3K58A 3BDCA 1WTOA 2K28A 5C4JH 2IWHA 4A3FH 3CCRA 2ES2A 2K1BA 1VQHA 2F4VQ 1LT5D 3VR5A 1Z7TA 1EU3A 1CKNB 1PH4A 2R92H 2OCEA 3J81j 2HQLA 1EQRA 2WV6D 4KN4C 4HR7B 4K2LA 1I50B 1HUNA 1PRTD 2C35B 3J81c 3OIQA 1EYAA 1PDQA 3R2IA 1RJTA 4CDFC 1U4MA 2ZTDA 1FR3A 1VS0A 2C5CA 4K0KL 2GN5A 2F0SA 2RCNA 4B3ML 2NBFA 1TS3A 5J22A 1I4PA 1VQNA 1KD1C 3F8TA 4A3BB 4NXMQ 1PYWD 4RG1A 1XPRA 3K5MA 3U9SA 2A69D 3SK4A 3E3XA 3OW7A 3K8AA 1ENAA 4QIWE 1OXXK 1O7YA 2N55A 2SEBD 2HHHL 1IBMQ 1PFBA 1QNUA 3I73A 4K2KA 5EKIA 2F03A 4LAAA 2K14A 5LMNW 4CKEA 4EX5A 1SMYD 1YNJD 1UE6A 4DXGA 2Z1CA 4B3RL 1TKWB 2PCFB 3TZUA 1DOKA 4LJZC 1O7LA 2VUMB 1Q3LA 3CQZH 1PHJA 2AUJD 2NB0A 4K5WA 4JYAQ 3IFTA 1QVGA 2KVMA 3S2DH 4OWXB 4GOPB 4O1NA 5CYUA 3JAMc 4DV5L 4QB4A 1SE2A 3ZYYX 1RHPA 4XQQA 4L8JA 1SYEA 3JC66 3MAQA 3ERQA 5EGTA 1D5ZC 4NKLA 3I4LA 4K8JA 1XTCD 3D6WA 5C0XJ 3D8GA 3PO2G 4A3IB 2F0IA 4JOIC 5IGBA 2IT1A 1AZQA 4P2CB 2OTLA 3U9OA 1SNCA 3K80C 4A3DH 1UE1A 1GJXA 3GTOH 5HURA 1KRTA 1HNZL 4Q5VA 4KJOA 1HXYD 4DR7L 1BBUA 5EBCA 3RN5A 1W6KA 3NTIA 1PRTB 1HR0W 4BWGB 4H7BA 4LFCL 4DNRB 3MWYW 4A76A 4IFDH 3GD7A 5M3FB 1GUGA 1WD1A 3BVGA 1GXDC 3RN2A 4ZKBB 4JI4L 2V1CC 2VQEQ 1GKHA 4FF3A 2DNEA 2JK8A 1KL9A 3PF4A 1A0IA 4X3TA 4K6LA 1PV4A 4F7XA 4RHRA 4RH6A 5DNFA 1UAPA 4A3MH 3LX0A 2RQXA 4YCUA 1JC7A 1CK1A 2RKSA 1CZWA 2OT2A 2F0DA 2ZJRA 1HA6A 3PF5A 3RZDB 1TWAB 4IPCA 3KK7A 1V8QA 3FRPB 5FLXc 2F0OA 1LT4D 1K83H 4LF5Q 4KHPQ 1UEAB 2Q2UA 5I2XA 3FKIG 1HCZA 2F4VL 5M5XB 3B6YA 5LMNQ 5F2DA 3ITPA 4CDCC 2E76C 1D6EC 1LT3D 2L55A 2PQAB 3RLOA 3ULLA 1BKBA 1I6HH 3EA6A 3OSOA 1EY6A 1YI2A 1K9MC 2VNUD 5C0XG 1B50A 3QO2A 3I7FA 2L11A 5CV4A 1Y1VB 3GTLH 3FKIH 5JPNC 1XWEA 4EQOA 3KJPA 5JOBA 1R9TH 2SOBA 1CFMA 2B63B 3SK8A 2WIIB 2M2LA 2PNHA 2B39A 3PMFA 2IW3A 3F2UA 1EUJA 4X3KA 3L7ZC 1TWCB 3FMCA 3N6RA 5IP9H 1SE3A 2PW5A 2G9DA 1Y8NB 3GP7A 5HGTA 2F0PA 5CC4A 4WRDA 3HOZB 4B9WA 1CHPD 1EY9A 2VB2X 1B3AA 2ALYB 4UPAA 4X6AH 2I46A 2WAQE 1HZ9A 1S5DD 1ZEQX 1BOSA 4DV4Q 1SMXA 4OO1G 1VQ9A 2N88A 3BG3A 1SNPA 1F9RA 4QMGA 2Y0SE 1PZKD 1JWUD 4PZ6A 4EGVA 1Z47A 1JOKA 3F2DA 1KC8C 2EXZA 5EPJA 3QOLA 4KTAA 2L15A 1F9SA 2JA5B 2H5XA 4DV6L 3VA7A 5BN4A 2F0NA 2E2HH 4IUVA 4K5VA 1K3BC 4JI6L 1NMFA 2Z4HA 4ALPA 3H15A 3LGJA 4B3SQ 1HNXL 3OTOL 3Q6SA 5CV6A 2NVQH 4DR4L 4MIUA 2JJQA 2NVYH
chains in the Genus database with same CATH topology
3G6EA 4JI4Q 2DUDA 1JMCA 3KFUA 4BBSH 4L5SA 4KHZA 4JC0A 1VQEA 4HJ7A 3PO3G 5LMNL 5FJ8H 4A3BH 1Q12A 2IHEA 3M4QA 4P75A 4XIGS 5EAYA 4HIMA 1O7IA 5C3EH 4LF8Q 2I5HA 2NVTH 4YWKA 2CKZB 4LFCQ 3CC2A 1NE3A 3CW2C 3RZOH 1Q1BA 1Q1EA 4JCVE 4BA1I 4A3GH 1V43A 2LXKA 2ZTCA 4DV0Q 1QUQB 3KOJA 1X6OA 3H0GH 3U58A 1EFWA 1G51A 1NBWA 1UEBA 3J80c 4OWTB 1ASZA 1KHIA 5M5WH 3HOWH 1A63A 3L0OA 1P16A 5FLMG 3S14H 5IYDG 4JBWA 4OX9L 2MO0A 2R93H 1WI5A 4A3KG 4HJ5A 4DR1L 1XMOQ 3E9HA 3H3VI 4WJ4A 1S72A 2JA7H 1JE5A 1TWHH 1UE5A 2KHIA 2F3IA 1PYBA 3DLLA 4DUZL 1EIFA 1MJEA 2UXCL 4L5TA 1N34L 4NXNQ 5HGQA 2QEXA 2YYZA 4A3FG 3J80i 5IP7H 4BBRG 1VQIA 2WB1E 4LUZA 1N34Q 3U50C 3KDFA 1IXRA 4R4IA 3BJUA 2VY3A 5ELNA 2JA5G 2ATWA 3CCJA 3HOVH 3MEFA 4LF6Q 1KRSA 1S3OA 1VQFA 2K5HA 5BR8L 4A3IG 4DR4L 1PYSB 4IOCA 1PH5A 3I4MH 1X56A 2CQOA 1YZ6A 4AYBE 3H3VH 1CUKA 2E5LL 3CD6A 2VW9A 5K36G 4LF4L 3K7UC 2R7DA 3KF8B 5IYCH 4QY7A 4BY1G 1JT8A 3J7ZC 4KHPL 1I3QH 1YEZA 2HHHQ 5M3MG 1B70B 1E24A 3ZJYC 3S2HH 1GM5A 1OXVA 5M3FG 4L5RC 4IPHA 5HY6A 2UXCQ 4Y52H 1FGUA 3UE1A 4GNXB 2OWOA 3KDFB 4DV5Q 4NB3A 2ZJQA 5C4XG 1KIXA 1E22A 2IX0A 3CF5A 2HT1A 4P71A 2I5LX 3M9BA 1V1QA 3M85A 3A0JA 2UUAL 4WJ3M 2K50A 3BZKA 3FP9A 1WOCA 5IT9c 2A8VA 4GN5A 4TQUS 4Y7NH 3W5OA 3I4NH 2KCTA 1HZBA 4JI0Q 2D0OA 2UUAQ 5BR8Q 4A3MG 3GO5A 1L1OA 2K52A 2KENA 2UXDL 5C44G 4DV4L 1VQPA 2XTIA 4A3CH 2PI2E 4LF4Q 3GTPH 4A3JH 2UXDQ 3PUZA 4JI3Q 1G6PA 1OTCA 4LF7Q 3MXNB 2Z6KA 3NBHB 1LYLA 1EIYB 2R92G 3HOYG 1EOVA 4BA2I 1CKOA 3KYHC 4X66L 3OTOQ 4GKJL 3PV0A 2N49A 3S24A 3HOUH 1KAWA 3E0EA 3I55A 4QGUA 2YTXA 3CXCA 2WP8J 4IPDA 4MTNA 2IY5B 4UP9A 4JI7L 1HZCA 1YNXA 5GROA 4AIMA 3WWVA 3HOZH 1FJGQ 2AWNA 4R4CA 4DR5L 1VQLA 2AWOA 1RIPA 3A5UA 5LMUQ 2UU9L 3A74A 4R1JA 3M3YH 2K5NA 2BA0A 4IO9A 4DR5Q 3CAMA 3BZCA 3NEMA 3PCOB 4JI5L 3PUYA 1B7YB 3UDXA 2QGQA 3S15H 4YWMA 3D0FA 4JI1Q 4DV3L 2VQFQ 5J3BA 2AHOB 2NZHA 2I0QA 3RLFA 1CKNA 1YBYA 3S1MH 2RF4A 2YU9H 1VQAA 4UY8C 3JAMi 3T1HQ 1TWGH 4O0AA 2MQHA 1VQBA 2R7FA 1X3FA 3UDGA 3CC4A 4BY7G 2A1AA 1LTLA 2Y0SG 2AMCB 3HOYH 3W1BA 1U0LA 4UP7A 5DLQE 3CCLA 3M4OH 1EYGA 4C3HH 1WCMH 4PMWA 2FXQA 3I4MG 4QQBX 1X3EA 4DNIA 3CPWA 3RLNA 1XMQL 4A3CG 1N32Q 3CPFA 4B3RQ 4NXNL 1UWVA 1Q46A 3HOXH 5H1SE 2E2IH 3GTGH 1XTDA 4A3LG 3AEVA 1SN8A 4JI6Q 4A3EH 2ZJPA 1VQMA 5JJLA 2Z0SA 3HOZG 1AE2A 4DR6Q 4X65L 4LFAQ 4JBMA 3F2CA 3I4NG 4UP8A 4KI0A 4JI8Q 1XNRL 5LMUL 2Q2IA 4GLAC 4A75A 4DR6L 1C9OA 3CCQA 3S1RH 2R7ZG 2R6GA 3HKSA 4JBKA 2NN6G 2OQKA 5E7NA 1OXUA 3TEHB 4A3EG 4GN4B 1N33L 4LF8L 1QZHA 4GN3B 1TWCH 3HOXG 4DV7Q 4DV3Q 4C3IH 3PUVA 1RL2A 1H95A 2UUBL 4AQYL 4EQ5A 1DGSA 3GDEA 5FLMH 1PH9A 1J5EQ 2KBNA 1D8LA 1A62A 1IBLQ 3PSIA 1TWAH 2I5MX 1IZ6A 1OXSC 2N8NA 4BY7H 1YJWA 2YV5A 1VQ6A 2YTVA 1IYJB 3ULJA 1VQKA 4IFDJ 1PA6A 3L2PA 4OX9Q 4QL5A 3GTMH 2UXBQ 5GADC 1PH2A 4OXPA 4DPGA 2WB1G 4KLKA 2CWAA 5C3EG 1HNWQ 1HZAA 4DR2L 2B3GA 3K0XA 3G4SA 4DV6Q 4DV1L 1NJIC 4GKKL 2JA8H 4K0KQ 4LFAL 4LFBL 4YCVA 3PUXA 2VQEL 2JA8G 3I56A 1XNQL 1FVIA 4DR2Q 2MNAA 3AQQA 1YHAA 2R7ZH 3S16H 1QUQA 4DKAC 4GLXA 4BBRH 5C4JH 4A3FH 3PIOA 3CCRA 2IHFA 2ES2A 2PMZE 5IE8A 4DV7L 1VQHA 4DR3L 5M5XH 2F4VQ 1LM0A 1MJCA 5IWAQ 4BY1H 4GNXC 1CKNB 4ME3A 1PH4A 2R92H 2OCEA 4LUVA 2GVAA 4IJHA 4QJFA 2PQAA 4X62Q 3J81j 3CCSA 4A3KH 1Q81C 4YHHL 2HQLA 1EQRA 4R4OA 3RZDH 1IBKQ 3ICEA 4DK6C 3CMEA 3E9IA 1X3GA 1VQ5A 2C35B 2BH8A 5C44H 4R4QA 3J81c 1IBKL 1BVSA 1L1OC 4DUYQ 1YVCA 2E5LQ 1MKHA 4AH6A 2ZTDA 4GS3A 4P72A 4DV1Q 1PH8A 3AFQA 2JEAI 1VS0A 4K0KL 1AE3A 2JE6I 2GN5A 3EIVA 4L5QA 2RCNA 4B3ML 2JQOA 2WAQG 4XTCS 2Z6KC 5C4XH 1VQNA 3KF6B 2WFWA 1KD1C 3F8TA 4APVA 4LF7L 4NXMQ 3GTQH 4POFA 4A3LH 4RG1A 3STBD 5M3FH 1XPRA 3RNUA 2R93G 1ASYA 1IBML 3K8AA 2ID0A 4QIWE 1OXXK 2ZTEA 2HHHL 4TVAB 1L1OB 4P74A 1IBMQ 1HR0Q 4LF9L 3UDFA 4FDBA 3HOUG 2Q2HA 1PH6A 4POGA 1CSPA 2K14A 5LMNW 4GNXA 4LUOA 1L0WA 4DAMA 4EX5A 3K81C 1UE6A 4B3RL 1SE8A 2RHQB 4P73A 3M7NA 5C0XI 2QA4A 4JI5Q 4A3IH 2K5VA 3Q8DA 1BBWA 3TRZA 2D0PA 4JBJA 1XJVA 2VS1A 3HOVG 3RR5A 2JA5H 2JEBI 1VQ7A 3CQZH 1PHJA 1KXLA 2XGTA 1VQOA 3CP0A 1CKMA 1FJGL 4JYAL 1GO3E 3GTKH 1SLJA 1QVFA 2K75A 4H02A 1B8AA 1OXTA 4C2MH 1WJJA 4GLVB 1KQSA 4JYAQ 1SFOH 1QVGA 1SRUA 2UUCQ 4BXXG 1HNXQ 1N36L 4DV2L 1JJCB 2UUBQ 1VCIA 4YY3L 3S2DH 2JA7G 4OWXB 2LSSA 3EBEA 1WCMG 4GOPB 3DM3A 3TREA 4DV2Q 3JAMc 4DV5L 3A5ZB 5JJKA 5JEAJ 5JJIA 1VQGA 4O2DA 3HKZE 3H0GG 2N78A 4NPSA 1E7ZA 1T9HA 3JC66 1Q82C 2VUMH 4JI0L 3G48A 2OTJA 5C0XJ 3PO2G 4PG3A 4GKKQ 3ERSX 3T1HL 4JOIC 1YHBA 2IT1A 1M1KC 2OTLA 3STBC 4X64Q 2DGYA 5JEAG 3K80C 4JV5L 3PO3H 4A3DH 1UE1A 5FJ8G 4A3BG 1AH9A 4IOAA 1QVCA 3S1NH 3S17H 3GTOH 3ULPA 3CCMA 4X64L 1S40A 4JI2L 4JG2A 1KRTA 1HNZL 2IX1A 4JV5Q 1Q8KA 3TS0A 3PIPA 3CCEA 2MFIA 4X66Q 5M3MH 4DR7L 4GKJQ 1UE7A 1N36Q 1BBUA 1N8RC 3RN5A 2JA6G 1HR0W 1E3PA 1YIJA 4LFCL 4A76A 2RHSB 2B63H 1M90C 2N3SA 3GD7A 3I2ZA 1K8GA 4B3TL 4LWCA 1GD7A 2B29A 2EXDA 4JI7Q 1NY4A 1N32L 2NZOA 3RN2A 2ASBA 4JI4L 2V1CC 1Y1VH 3AFPA 2VQEQ 4B3TQ 1GKHA 4DUZQ 4A3JG 2JK8A 1KL9A 2E8GA 3PF4A 4RMFA 1A0IA 4X65Q 1PV4A 4JI8L 1JJGA 2EIFA 1JJ2A 1Y14B 2AKWB 2ZM6L 3OW2A 1LUZA 4DR1Q 3G71A 4AQYQ 4DR3Q 4A3MH 4YCUA 1Z9FA 2EQSA 2JA6H 3U4VA 4AYBG 1Y1WH 5IP7G 2ZM6Q 2ZJRA 1I50H 4DV0L 1YJ9A 1K0RA 3W1GA 3PF5A 4IFDI 4IPCA 4JOIA 4YHHQ 3J7A5 5FLXc 1MIUA 1K83H 4LF5Q 4DR4Q 4KHPQ 3J81i 1VQDA 1K73C 4DR7Q 1PH3A 2Q2UA 3FKIG 1HNWL 1XMOL 5GAEC 1YHQA 1HJPA 2F4VL 3B6YA 5LMNQ 2E2JH 1QZGA 1X65A 2KHJA 3IRBA 3OYYA 1Q7YC 1K3RA 1YITA 2VUMG 4HJ9A 2BH2A 1XPOA 1V9PA 3PGZA 5IYCG 2PQAB 2YTYA 3RLOA 1BKBA 3ULLA 4B3MQ 1XNRQ 3UDIA 4OONA 1I6HH 1YI2A 1K8AC 3KLWA 1K9MC 3FHWA 4HIKA 2CCZA 5C0XG 2VNUD 5IWAL 4DK3C 4IJLA 2K4KA 1P8LA 3I7FA 3GTLH 3FKIH 3SGIA 4A4IA 1CSQA 2D62A 3F1ZA 5IYBG 3KJPA 3PUWA 1D7QA 1EQQA 1R9TH 4MZ9A 1WFQA 1N9WA 3HFZB 1GVPA 3S1QH 4BXXH 1E1OA 3CCUA 5AJ3Q 1PH1A 1SR3A 2PNHA 1J6QA 1X55A 1IBLL 4LNQA 2CWPA 1SROA 2Q2TA 1PFSA 3K7AH 4LF5L 4X62L 5AJ3L 4DUYL 2A19A 4JI3L 2NVXH 3UE0A 2UXBL 1NMGA 1EUJA 1YJNA 1A8VA 1HH2P 3I4OA 3VDYA 4A3DG 3L7ZC 5IYBH 4R4TA 3HKZG 1XMQQ 1PVOA 1TXYA 1X54A 5IP9H 1HR0L 1VQJA 4LF9Q 1I94Q 1Y1VG 4LF6L 5IYDH 2VL6A 3PO2H 4LFBQ 1XPUA 2UU9Q 1XNQQ 4PZ7A 1I94L 2NN6I 1C7YA 4HJ8A 3CMAA 3BU2A 4A3GG 1G291 1JB7A 2MO1A 1E1TA 2ALYB 4UPAA 4A93H 4X6AH 2OQ0A 2WAQE 2PI2A 1HZ9A 5GAGC 5IP9G 1Q86C 2GVBA 4DV4Q 4OO1G 1SMXA 5GQOA 4YWLA 4HIOA 1VQ8A 1VQ9A 1C0AA 1VQCA 1WYDA 2JA9A 5IY0A 2BA1A 4BBSG 1NTGA 4C3JH 2Y0SE 1X9NA 3HOWG 4PZ6A 3ER0A 2HIXA 4A93G 1Z47A 2KCMA 4HJAA 3F2DA 1Y1WG 1KC8C 2F52A 5GAHC 2L15A 2VZAA 4PZ8A 4JI1L 1FL0A 3U4ZA 1TWFH 3EN2A 2H5XA 4GOPA 3NENA 4DV6L 1EWIA 1W2BA 2E2HH 2CFMA 2UUCL 4IPGA 2HIVA 4OO1I 4YCWA 4DAYB 4JI6L 3T1YL 4JI2Q 4NXML 1PH7A 2LXJA 3TQYA 3GTJH 1NMFA 4ALPA 4GOPC 3TS2A 3AYHB 5M5YH 3H15A 3T1YQ 3LGJA 1L2FA 2B63G 4IFDG 3CCVA 4OWWB 1W3SA 3NELA 3KF6A 4LW1A 2VQFL 3D31A 1U5KA 3CC7A 1N33Q 1J5EL 1VQ4A 1HNXL 3OTOL 4B3SQ 1IL2A 3F2BA 3KJOA 3M4PA 2NVQH 5ELOA 4YY3Q 4J15A 4MNOA 4HIDA 1I5FA 4B3SL 2JJQA 2NVYH 1HNZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E A;  4JI4 Q;  2DUD A;  1JMC A;  3KFU A;  4BBS H;  4L5S A;  4KHZ A;  4JC0 A;  1VQE A;  4HJ7 A;  3PO3 G;  5LMN L;  5FJ8 H;  4A3B H;  1Q12 A;  2IHE A;  3M4Q A;  4P75 A;  4XIG S;  5EAY A;  4HIM A;  1O7I A;  5C3E H;  4LF8 Q;  2I5H A;  2NVT H;  4YWK A;  2CKZ B;  4LFC Q;  3CC2 A;  1NE3 A;  3CW2 C;  3RZO H;  1Q1B A;  1Q1E A;  4JCV E;  4BA1 I;  4A3G H;  1V43 A;  2LXK A;  2ZTC A;  4DV0 Q;  1QUQ B;  3KOJ A;  1X6O A;  3H0G H;  3U58 A;  1EFW A;  1G51 A;  1NBW A;  1UEB A;  3J80 c;  4OWT B;  1ASZ A;  1KHI A;  5M5W H;  3HOW H;  1A63 A;  3L0O A;  1P16 A;  5FLM G;  3S14 H;  5IYD G;  4JBW A;  4OX9 L;  2MO0 A;  2R93 H;  1WI5 A;  4A3K G;  4HJ5 A;  4DR1 L;  1XMO Q;  3E9H A;  3H3V I;  4WJ4 A;  1S72 A;  2JA7 H;  1JE5 A;  1TWH H;  1UE5 A;  2KHI A;  2F3I A;  1PYB A;  3DLL A;  4DUZ L;  1EIF A;  1MJE A;  2UXC L;  4L5T A;  1N34 L;  4NXN Q;  5HGQ A;  2QEX A;  2YYZ A;  4A3F G;  3J80 i;  5IP7 H;  4BBR G;  1VQI A;  2WB1 E;  4LUZ A;  1N34 Q;  3U50 C;  3KDF A;  1IXR A;  4R4I A;  3BJU A;  2VY3 A;  5ELN A;  2JA5 G;  2ATW A;  3CCJ A;  3HOV H;  3MEF A;  4LF6 Q;  1KRS A;  1S3O A;  1VQF A;  2K5H A;  5BR8 L;  4A3I G;  4DR4 L;  1PYS B;  4IOC A;  1PH5 A;  3I4M H;  1X56 A;  2CQO A;  1YZ6 A;  4AYB E;  3H3V H;  1CUK A;  2E5L L;  3CD6 A;  2VW9 A;  5K36 G;  4LF4 L;  3K7U C;  2R7D A;  3KF8 B;  5IYC H;  4QY7 A;  4BY1 G;  1JT8 A;  3J7Z C;  4KHP L;  1I3Q H;  1YEZ A;  2HHH Q;  5M3M G;  1B70 B;  1E24 A;  3ZJY C;  3S2H H;  1GM5 A;  1OXV A;  5M3F G;  4L5R C;  4IPH A;  5HY6 A;  2UXC Q;  4Y52 H;  1FGU A;  3UE1 A;  4GNX B;  2OWO A;  3KDF B;  4DV5 Q;  4NB3 A;  2ZJQ A;  5C4X G;  1KIX A;  1E22 A;  2IX0 A;  3CF5 A;  2HT1 A;  4P71 A;  2I5L X;  3M9B A;  1V1Q A;  3M85 A;  3A0J A;  2UUA L;  4WJ3 M;  2K50 A;  3BZK A;  3FP9 A;  1WOC A;  5IT9 c;  2A8V A;  4GN5 A;  4TQU S;  4Y7N H;  3W5O A;  3I4N H;  2KCT A;  1HZB A;  4JI0 Q;  2D0O A;  2UUA Q;  5BR8 Q;  4A3M G;  3GO5 A;  1L1O A;  2K52 A;  2KEN A;  2UXD L;  5C44 G;  4DV4 L;  1VQP A;  2XTI A;  4A3C H;  2PI2 E;  4LF4 Q;  3GTP H;  4A3J H;  2UXD Q;  3PUZ A;  4JI3 Q;  1G6P A;  1OTC A;  4LF7 Q;  3MXN B;  2Z6K A;  3NBH B;  1LYL A;  1EIY B;  2R92 G;  3HOY G;  1EOV A;  4BA2 I;  1CKO A;  3KYH C;  4X66 L;  3OTO Q;  4GKJ L;  3PV0 A;  2N49 A;  3S24 A;  3HOU H;  1KAW A;  3E0E A;  3I55 A;  4QGU A;  2YTX A;  3CXC A;  2WP8 J;  4IPD A;  4MTN A;  2IY5 B;  4UP9 A;  4JI7 L;  1HZC A;  1YNX A;  5GRO A;  4AIM A;  3WWV A;  3HOZ H;  1FJG Q;  2AWN A;  4R4C A;  4DR5 L;  1VQL A;  2AWO A;  1RIP A;  3A5U A;  5LMU Q;  2UU9 L;  3A74 A;  4R1J A;  3M3Y H;  2K5N A;  2BA0 A;  4IO9 A;  4DR5 Q;  3CAM A;  3BZC A;  3NEM A;  3PCO B;  4JI5 L;  3PUY A;  1B7Y B;  3UDX A;  2QGQ A;  3S15 H;  4YWM A;  3D0F A;  4JI1 Q;  4DV3 L;  2VQF Q;  5J3B A;  2AHO B;  2NZH A;  2I0Q A;  3RLF A;  1CKN A;  1YBY A;  3S1M H;  2RF4 A;  2YU9 H;  1VQA A;  4UY8 C;  3JAM i;  3T1H Q;  1TWG H;  4O0A A;  2MQH A;  1VQB A;  2R7F A;  1X3F A;  3UDG A;  3CC4 A;  4BY7 G;  2A1A A;  1LTL A;  2Y0S G;  2AMC B;  3HOY H;  3W1B A;  1U0L A;  4UP7 A;  5DLQ E;  3CCL A;  3M4O H;  1EYG A;  4C3H H;  1WCM H;  4PMW A;  2FXQ A;  3I4M G;  4QQB X;  1X3E A;  4DNI A;  3CPW A;  3RLN A;  1XMQ L;  4A3C G;  1N32 Q;  3CPF A;  4B3R Q;  4NXN L;  1UWV A;  1Q46 A;  3HOX H;  5H1S E;  2E2I H;  3GTG H;  1XTD A;  4A3L G;  3AEV A;  1SN8 A;  4JI6 Q;  4A3E H;  2ZJP A;  1VQM A;  5JJL A;  2Z0S A;  3HOZ G;  1AE2 A;  4DR6 Q;  4X65 L;  4LFA Q;  4JBM A;  3F2C A;  3I4N G;  4UP8 A;  4KI0 A;  4JI8 Q;  1XNR L;  5LMU L;  2Q2I A;  4GLA C;  4A75 A;  4DR6 L;  1C9O A;  3CCQ A;  3S1R H;  2R7Z G;  2R6G A;  3HKS A;  4JBK A;  2NN6 G;  2OQK A;  5E7N A;  1OXU A;  3TEH B;  4A3E G;  4GN4 B;  1N33 L;  4LF8 L;  1QZH A;  4GN3 B;  1TWC H;  3HOX G;  4DV7 Q;  4DV3 Q;  4C3I H;  3PUV A;  1RL2 A;  1H95 A;  2UUB L;  4AQY L;  4EQ5 A;  1DGS A;  3GDE A;  5FLM H;  1PH9 A;  1J5E Q;  2KBN A;  1D8L A;  1A62 A;  1IBL Q;  3PSI A;  1TWA H;  2I5M X;  1IZ6 A;  1OXS C;  2N8N A;  4BY7 H;  1YJW A;  2YV5 A;  1VQ6 A;  2YTV A;  1IYJ B;  3ULJ A;  1VQK A;  4IFD J;  1PA6 A;  3L2P A;  4OX9 Q;  4QL5 A;  3GTM H;  2UXB Q;  5GAD C;  1PH2 A;  4OXP A;  4DPG A;  2WB1 G;  4KLK A;  2CWA A;  5C3E G;  1HNW Q;  1HZA A;  4DR2 L;  2B3G A;  3K0X A;  3G4S A;  4DV6 Q;  4DV1 L;  1NJI C;  4GKK L;  2JA8 H;  4K0K Q;  4LFA L;  4LFB L;  4YCV A;  3PUX A;  2VQE L;  2JA8 G;  3I56 A;  1XNQ L;  1FVI A;  4DR2 Q;  2MNA A;  3AQQ A;  1YHA A;  2R7Z H;  3S16 H;  1QUQ A;  4DKA C;  4GLX A;  4BBR H;  5C4J H;  4A3F H;  3PIO A;  3CCR A;  2IHF A;  2ES2 A;  2PMZ E;  5IE8 A;  4DV7 L;  1VQH A;  4DR3 L;  5M5X H;  2F4V Q;  1LM0 A;  1MJC A;  5IWA Q;  4BY1 H;  4GNX C;  1CKN B;  4ME3 A;  1PH4 A;  2R92 H;  2OCE A;  4LUV A;  2GVA A;  4IJH A;  4QJF A;  2PQA A;  4X62 Q;  3J81 j;  3CCS A;  4A3K H;  1Q81 C;  4YHH L;  2HQL A;  1EQR A;  4R4O A;  3RZD H;  1IBK Q;  3ICE A;  4DK6 C;  3CME A;  3E9I A;  1X3G A;  1VQ5 A;  2C35 B;  2BH8 A;  5C44 H;  4R4Q A;  3J81 c;  1IBK L;  1BVS A;  1L1O C;  4DUY Q;  1YVC A;  2E5L Q;  1MKH A;  4AH6 A;  2ZTD A;  4GS3 A;  4P72 A;  4DV1 Q;  1PH8 A;  3AFQ A;  2JEA I;  1VS0 A;  4K0K L;  1AE3 A;  2JE6 I;  2GN5 A;  3EIV A;  4L5Q A;  2RCN A;  4B3M L;  2JQO A;  2WAQ G;  4XTC S;  2Z6K C;  5C4X H;  1VQN A;  3KF6 B;  2WFW A;  1KD1 C;  3F8T A;  4APV A;  4LF7 L;  4NXM Q;  3GTQ H;  4POF A;  4A3L H;  4RG1 A;  3STB D;  5M3F H;  1XPR A;  3RNU A;  2R93 G;  1ASY A;  1IBM L;  3K8A A;  2ID0 A;  4QIW E;  1OXX K;  2ZTE A;  2HHH L;  4TVA B;  1L1O B;  4P74 A;  1IBM Q;  1HR0 Q;  4LF9 L;  3UDF A;  4FDB A;  3HOU G;  2Q2H A;  1PH6 A;  4POG A;  1CSP A;  2K14 A;  5LMN W;  4GNX A;  4LUO A;  1L0W A;  4DAM A;  4EX5 A;  3K81 C;  1UE6 A;  4B3R L;  1SE8 A;  2RHQ B;  4P73 A;  3M7N A;  5C0X I;  2QA4 A;  4JI5 Q;  4A3I H;  2K5V A;  3Q8D A;  1BBW A;  3TRZ A;  2D0P A;  4JBJ A;  1XJV A;  2VS1 A;  3HOV G;  3RR5 A;  2JA5 H;  2JEB I;  1VQ7 A;  3CQZ H;  1PHJ A;  1KXL A;  2XGT A;  1VQO A;  3CP0 A;  1CKM A;  1FJG L;  4JYA L;  1GO3 E;  3GTK H;  1SLJ A;  1QVF A;  2K75 A;  4H02 A;  1B8A A;  1OXT A;  4C2M H;  1WJJ A;  4GLV B;  1KQS A;  4JYA Q;  1SFO H;  1QVG A;  1SRU A;  2UUC Q;  4BXX G;  1HNX Q;  1N36 L;  4DV2 L;  1JJC B;  2UUB Q;  1VCI A;  4YY3 L;  3S2D H;  2JA7 G;  4OWX B;  2LSS A;  3EBE A;  1WCM G;  4GOP B;  3DM3 A;  3TRE A;  4DV2 Q;  3JAM c;  4DV5 L;  3A5Z B;  5JJK A;  5JEA J;  5JJI A;  1VQG A;  4O2D A;  3HKZ E;  3H0G G;  2N78 A;  4NPS A;  1E7Z A;  1T9H A;  3JC6 6;  1Q82 C;  2VUM H;  4JI0 L;  3G48 A;  2OTJ A;  5C0X J;  3PO2 G;  4PG3 A;  4GKK Q;  3ERS X;  3T1H L;  4JOI C;  1YHB A;  2IT1 A;  1M1K C;  2OTL A;  3STB C;  4X64 Q;  2DGY A;  5JEA G;  3K80 C;  4JV5 L;  3PO3 H;  4A3D H;  1UE1 A;  5FJ8 G;  4A3B G;  1AH9 A;  4IOA A;  1QVC A;  3S1N H;  3S17 H;  3GTO H;  3ULP A;  3CCM A;  4X64 L;  1S40 A;  4JI2 L;  4JG2 A;  1KRT A;  1HNZ L;  2IX1 A;  4JV5 Q;  1Q8K A;  3TS0 A;  3PIP A;  3CCE A;  2MFI A;  4X66 Q;  5M3M H;  4DR7 L;  4GKJ Q;  1UE7 A;  1N36 Q;  1BBU A;  1N8R C;  3RN5 A;  2JA6 G;  1HR0 W;  1E3P A;  1YIJ A;  4LFC L;  4A76 A;  2RHS B;  2B63 H;  1M90 C;  2N3S A;  3GD7 A;  3I2Z A;  1K8G A;  4B3T L;  4LWC A;  1GD7 A;  2B29 A;  2EXD A;  4JI7 Q;  1NY4 A;  1N32 L;  2NZO A;  3RN2 A;  2ASB A;  4JI4 L;  2V1C C;  1Y1V H;  3AFP A;  2VQE Q;  4B3T Q;  1GKH A;  4DUZ Q;  4A3J G;  2JK8 A;  1KL9 A;  2E8G A;  3PF4 A;  4RMF A;  1A0I A;  4X65 Q;  1PV4 A;  4JI8 L;  1JJG A;  2EIF A;  1JJ2 A;  1Y14 B;  2AKW B;  2ZM6 L;  3OW2 A;  1LUZ A;  4DR1 Q;  3G71 A;  4AQY Q;  4DR3 Q;  4A3M H;  4YCU A;  1Z9F A;  2EQS A;  2JA6 H;  3U4V A;  4AYB G;  1Y1W H;  5IP7 G;  2ZM6 Q;  2ZJR A;  1I50 H;  4DV0 L;  1YJ9 A;  1K0R A;  3W1G A;  3PF5 A;  4IFD I;  4IPC A;  4JOI A;  4YHH Q;  3J7A 5;  5FLX c;  1MIU A;  1K83 H;  4LF5 Q;  4DR4 Q;  4KHP Q;  3J81 i;  1VQD A;  1K73 C;  4DR7 Q;  1PH3 A;  2Q2U A;  3FKI G;  1HNW L;  1XMO L;  5GAE C;  1YHQ A;  1HJP A;  2F4V L;  3B6Y A;  5LMN Q;  2E2J H;  1QZG A;  1X65 A;  2KHJ A;  3IRB A;  3OYY A;  1Q7Y C;  1K3R A;  1YIT A;  2VUM G;  4HJ9 A;  2BH2 A;  1XPO A;  1V9P A;  3PGZ A;  5IYC G;  2PQA B;  2YTY A;  3RLO A;  1BKB A;  3ULL A;  4B3M Q;  1XNR Q;  3UDI A;  4OON A;  1I6H H;  1YI2 A;  1K8A C;  3KLW A;  1K9M C;  3FHW A;  4HIK A;  2CCZ A;  5C0X G;  2VNU D;  5IWA L;  4DK3 C;  4IJL A;  2K4K A;  1P8L A;  3I7F A;  3GTL H;  3FKI H;  3SGI A;  4A4I A;  1CSQ A;  2D62 A;  3F1Z A;  5IYB G;  3KJP A;  3PUW A;  1D7Q A;  1EQQ A;  1R9T H;  4MZ9 A;  1WFQ A;  1N9W A;  3HFZ B;  1GVP A;  3S1Q H;  4BXX H;  1E1O A;  3CCU A;  5AJ3 Q;  1PH1 A;  1SR3 A;  2PNH A;  1J6Q A;  1X55 A;  1IBL L;  4LNQ A;  2CWP A;  1SRO A;  2Q2T A;  1PFS A;  3K7A H;  4LF5 L;  4X62 L;  5AJ3 L;  4DUY L;  2A19 A;  4JI3 L;  2NVX H;  3UE0 A;  2UXB L;  1NMG A;  1EUJ A;  1YJN A;  1A8V A;  1HH2 P;  3I4O A;  3VDY A;  4A3D G;  3L7Z C;  5IYB H;  4R4T A;  3HKZ G;  1XMQ Q;  1PVO A;  1TXY A;  1X54 A;  5IP9 H;  1HR0 L;  1VQJ A;  4LF9 Q;  1I94 Q;  1Y1V G;  4LF6 L;  5IYD H;  2VL6 A;  3PO2 H;  4LFB Q;  1XPU A;  2UU9 Q;  1XNQ Q;  4PZ7 A;  1I94 L;  2NN6 I;  1C7Y A;  4HJ8 A;  3CMA A;  3BU2 A;  4A3G G;  1G29 1;  1JB7 A;  2MO1 A;  1E1T A;  2ALY B;  4UPA A;  4A93 H;  4X6A H;  2OQ0 A;  2WAQ E;  2PI2 A;  1HZ9 A;  5GAG C;  5IP9 G;  1Q86 C;  2GVB A;  4DV4 Q;  4OO1 G;  1SMX A;  5GQO A;  4YWL A;  4HIO A;  1VQ8 A;  1VQ9 A;  1C0A A;  1VQC A;  1WYD A;  2JA9 A;  5IY0 A;  2BA1 A;  4BBS G;  1NTG A;  4C3J H;  2Y0S E;  1X9N A;  3HOW G;  4PZ6 A;  3ER0 A;  2HIX A;  4A93 G;  1Z47 A;  2KCM A;  4HJA A;  3F2D A;  1Y1W G;  1KC8 C;  2F52 A;  5GAH C;  2L15 A;  2VZA A;  4PZ8 A;  4JI1 L;  1FL0 A;  3U4Z A;  1TWF H;  3EN2 A;  2H5X A;  4GOP A;  3NEN A;  4DV6 L;  1EWI A;  1W2B A;  2E2H H;  2CFM A;  2UUC L;  4IPG A;  2HIV A;  4OO1 I;  4YCW A;  4DAY B;  4JI6 L;  3T1Y L;  4JI2 Q;  4NXM L;  1PH7 A;  2LXJ A;  3TQY A;  3GTJ H;  1NMF A;  4ALP A;  4GOP C;  3TS2 A;  3AYH B;  5M5Y H;  3H15 A;  3T1Y Q;  3LGJ A;  1L2F A;  2B63 G;  4IFD G;  3CCV A;  4OWW B;  1W3S A;  3NEL A;  3KF6 A;  4LW1 A;  2VQF L;  3D31 A;  1U5K A;  3CC7 A;  1N33 Q;  1J5E L;  1VQ4 A;  1HNX L;  3OTO L;  4B3S Q;  1IL2 A;  3F2B A;  3KJO A;  3M4P A;  2NVQ H;  5ELO A;  4YY3 Q;  4J15 A;  4MNO A;  4HID A;  1I5F A;  4B3S L;  2JJQ A;  2NVY H;  1HNZ Q; 
#chains in the Genus database with same CATH topology
 3G6E A;  4ABN A;  2DUD A;  3W3A A;  3R3O A;  4BBS H;  4JC0 A;  1Y8O B;  5E3F A;  5FJ8 H;  1HHV A;  1LTA D;  3M4Q A;  1HQR D;  3G6J B;  4HIM A;  5EBD A;  1O7I A;  1EQV A;  1QB5 D;  3Q0A A;  1NE3 A;  3TN2 A;  4JCV E;  4BA1 I;  4DAV A;  4NP5 A;  1GHK A;  1X6O A;  4Z9C B;  1UEB A;  1IW7 D;  3J80 c;  1JWM D;  4OWT B;  1TS2 A;  1ESR A;  1CT1 D;  3S14 H;  5IYD G;  2F0E A;  3IKJ A;  2KHS A;  4HJ5 A;  3VR6 A;  4DR1 L;  1BUV T;  1B3Q A;  1JE5 A;  2JA7 B;  1UE5 A;  2E2D C;  4DUZ L;  4HCE A;  1N34 L;  3TZD A;  2YYZ A;  2XNA C;  3BVM A;  1KNE A;  4BBR G;  1VQI A;  4LUZ A;  1LO5 D;  4HSP A;  3KDF A;  2R7Z B;  4EQN A;  2VY3 A;  4R8N A;  3OWF A;  3HOV H;  3NBH A;  3UI2 A;  1L0Y B;  1S3O A;  2K5H A;  4FVM A;  4IOC A;  1ICF B;  3CD6 A;  1ZKO A;  4I7Z C;  1SJE D;  5I2Y A;  4QY7 A;  3MZ5 A;  2A6E C;  1CZG A;  1HA5 A;  1YEZ A;  3DEO A;  4DXF A;  4KN7 C;  4V19 0;  3SEB A;  1DJR D;  5BN5 A;  3NPP A;  3PO3 B;  2HT1 A;  3M85 A;  2UUA L;  3BZK A;  5IT9 c;  1WOC A;  4GN5 A;  1ENF A;  3OMG A;  2KCT A;  3I90 A;  2D0O A;  2NVT B;  5I4D A;  1MHW C;  1F77 A;  5C44 G;  1VQP A;  4K5X A;  2PI2 E;  4A3J H;  3PUZ A;  2K5D A;  2Z9H A;  3BS1 A;  3HOY G;  2R92 G;  2BDO A;  2WIN B;  4BA2 I;  3PV0 A;  3G7L A;  3S24 A;  4YIJ A;  3O13 A;  3C1E A;  3Q22 A;  1QJO A;  2WP8 J;  4A93 B;  4IPD A;  4RFB A;  1EIH A;  1HZC A;  5AFW A;  1ML0 D;  1RIP A;  3OHX C;  4R1J A;  2K5N A;  4IO9 A;  4DR5 Q;  3CAM A;  1VF7 A;  3UDX A;  3Q24 A;  2B2W A;  3M7G A;  3NSW A;  1YBY A;  1NR4 A;  3S1M H;  5EPK A;  3KLS X;  3FEW X;  2R7F A;  1Z6H A;  1WTQ A;  5DLQ E;  4UP7 A;  3CCL A;  1I4G A;  2D2C C;  4PMW A;  2O4X A;  4ZUI A;  3GTP B;  2O2L D;  4A3C G;  1WTW A;  1N32 Q;  1A3V A;  3HKZ B;  4B3R Q;  3J80 E;  4A3L G;  1XTD A;  2HDM A;  1M8A A;  3AEV A;  2B2T C;  5C4X B;  4WOR A;  1BCP F;  1BCP D;  1FNW A;  1TY2 A;  4DR6 Q;  2X6L A;  1BNZ A;  2F0Q A;  3K57 A;  1D5M C;  4JPB W;  1YNN C;  1RTO A;  1XNR L;  4RGN A;  4GLA C;  1QE6 A;  1C9O A;  1N33 L;  2NN6 G;  3S9W A;  4A3E G;  4GN4 B;  5C3W A;  4PV1 C;  1TWC H;  1JWS D;  2SDF A;  4FF4 A;  2L0C A;  3PUV A;  1RL2 A;  1H95 A;  3OOC A;  5FLM H;  1PH9 A;  1E2W A;  1B53 A;  1D8L A;  4I65 A;  3LWE A;  3K5N A;  2I5M X;  5LL6 X;  4BY7 H;  1YJW A;  4IFD J;  2CQA A;  2A6E D;  4KK7 A;  3L2P A;  4QL5 A;  1LAB A;  5E1F A;  5GAD C;  4OXP A;  2PZW A;  1ROD A;  4KLK A;  2WB1 B;  4OIJ A;  2F0H A;  5C3E G;  3S16 B;  1EU4 A;  4DR2 L;  2EYF A;  2FIN B;  3G4S A;  4LFA L;  2JA8 G;  3PUX A;  1ILQ A;  3S16 H;  4GLX A;  1T5X D;  1FD7 D;  4AYB B;  3PIO A;  2IHF A;  2PMZ E;  4DR3 L;  1RTN A;  5M5X H;  1C48 A;  1LM0 A;  1MJC A;  1H9K A;  4ME3 A;  2CW0 C;  1CTM A;  4QJF A;  2GVA A;  3VYR A;  2PQA A;  1X3Q A;  3CKI B;  1S5E D;  2G9H D;  1IBK Q;  3CME A;  1SNO A;  4C3I G;  2JYO A;  1RF2 D;  5D65 A;  4CKB A;  4R4Q A;  2LY7 A;  2EJM A;  2JA6 B;  1L1O C;  4OIK A;  2IX3 A;  4DUY Q;  2E5L Q;  2PZT A;  4AH6 A;  2JEA I;  1AE3 A;  3EIV A;  3KLR A;  3EQL C;  5C4X H;  2Z6K C;  3KF6 B;  4PNY A;  3GTQ H;  1WTV A;  3STB D;  1GUW A;  5KIX A;  5M3F H;  3KF8 A;  3RNU A;  2R93 G;  2QF7 A;  4X3U A;  4FF1 A;  3SR1 A;  1HR0 Q;  4LF9 L;  4FDB A;  4DFA A;  3P1H A;  1SBB B;  4POG A;  4B9X A;  1F2M A;  4RHS A;  5KNB A;  5M5Y B;  4GNX A;  4DAM A;  3GTK B;  4HED A;  3K81 C;  3C46 A;  2DJF C;  2RHQ B;  5C0X I;  4A3I H;  2PZU A;  2PW7 A;  2VS1 A;  1TWF B;  2JA5 H;  2JEB I;  5CV9 A;  1CHQ D;  3CP0 A;  4IZ8 A;  2RSO A;  3RMH A;  2AUK A;  1OXT A;  1SAP A;  2F0J A;  2UUC Q;  3SHL A;  4MN3 A;  1HNX Q;  3TDQ A;  1JB3 A;  5EQ0 A;  1N36 L;  1JJC B;  1VCI A;  4YY3 L;  2JA7 G;  1I4Q A;  2LSS A;  1IYU A;  2XVS A;  1KAA A;  4C3H G;  3DM3 A;  1DZ1 A;  1UUP A;  3URY A;  5JJK A;  5JJI A;  1AP0 A;  4FXK C;  4E6I A;  2PPB C;  4JI0 L;  3G48 A;  2OTJ A;  5A35 A;  4GKK Q;  3AMU A;  3T1H L;  1QG7 A;  3MTS A;  1M1K C;  3K6O A;  1FYC A;  3STB C;  5JEA G;  4X64 Q;  3PO3 H;  5BN3 A;  1AH9 A;  4IOA A;  1QVC A;  3S1N H;  3I70 A;  3ERO A;  2IX1 A;  1S40 A;  4JG2 A;  4JV5 Q;  5IGF A;  4ZLT F;  5IIF A;  4IUT A;  1A3T A;  4UAI A;  1UE7 A;  1I3Q B;  1TY0 A;  1J9O A;  1B4O A;  1M90 C;  4B3T L;  3I2Z A;  3V05 A;  1R9T B;  1EY4 A;  2B29 A;  5K36 H;  2NZO A;  2KQ3 A;  4DUZ Q;  2EE1 A;  4ZKC B;  4JI8 L;  2EIF A;  1JJ2 A;  1I6H B;  2DN8 A;  2ZM6 L;  1STG A;  3G71 A;  5G3L D;  4DR3 Q;  2EQS A;  1VDZ A;  4JK1 C;  1PTO B;  3K59 A;  2ZM6 Q;  2A6H D;  1YJ9 A;  1K0R A;  4V0B A;  2J0T D;  4IFD I;  4YHH Q;  1B2T A;  1MIU A;  4DR4 Q;  4PMB A;  5LL6 S;  1PH3 A;  2F3V A;  5IGE A;  2E2J H;  2L9H A;  1BO0 A;  4A3F B;  1Q7Y C;  1K3R A;  3MFY A;  1YIT A;  2VUM G;  3EVQ A;  3S1R B;  3QG1 A;  4ILW A;  4B3M Q;  1ENC A;  1K8A C;  3KLW A;  2CCZ A;  1TII D;  5ELC A;  2EOT A;  4IUP A;  3SGI A;  1CSQ A;  5IYB G;  3PUW A;  4RGM A;  3A8I E;  1D7Q A;  1EQQ A;  1N9W A;  3HFZ B;  2NVY B;  2KEE A;  2F0F A;  1X55 A;  5ISR A;  4QIW B;  3K7A H;  4CBV A;  5AJ3 L;  2A19 A;  5JVH 3;  1ONL A;  4RGT A;  4ZCK A;  1QWY A;  1O78 A;  2YU9 B;  1EIG A;  3S1M B;  3UE0 A;  1QNK A;  4C3I B;  2FFK B;  4ZAI A;  2UXB L;  5KEE A;  1EQT A;  1HH2 P;  3I4O A;  1ESF A;  4R4T A;  4A3D B;  3A56 A;  3E6Z X;  1X54 A;  5LHY 1;  4LF9 Q;  1VQJ A;  1EY5 A;  1Y1V G;  1I94 Q;  2VL6 A;  1XPU A;  1LV9 A;  1XNQ Q;  4PZ7 A;  3L9A X;  2NN6 I;  1C7Y A;  4HJ8 A;  2RDG A;  4A3G G;  2K6A A;  3J80 L;  4N9T A;  2L12 A;  3TME A;  2F1M A;  1R4P B;  3GTG B;  2E2I B;  4A93 H;  3I91 A;  4FO2 A;  2EYP A;  1VQC A;  2JA9 A;  2BA1 A;  2EVB A;  4C3J H;  3Q23 A;  1AW7 A;  3HOW G;  5EKL A;  4G4K A;  4IAL A;  3ER0 A;  1S4Z A;  2KCM A;  4HJA A;  1Y1W G;  2E74 C;  5GAH C;  1F9Q A;  3CQZ B;  3NQI A;  4PZ8 A;  1FL0 A;  3U4Z A;  1BF4 A;  3EN2 A;  3M3Y B;  3NEN A;  1W2B A;  1PTO D;  1D5X C;  4YCW A;  2F0V A;  4DAY B;  4OO1 I;  4JI2 Q;  2LXJ A;  5KNC A;  2HD3 A;  3TS2 A;  3AYH B;  3T1Y Q;  1CQF A;  2QIL A;  3CCV A;  1W3S A;  2VQF L;  3D31 A;  1U5K A;  3CC7 A;  1J5E L;  1QOH A;  2QEJ C;  3M4P A;  5CR3 A;  1EEI D;  5J39 A;  4MNO A;  4HID A;  4KHP L;  4QUF A;  1DXM A;  4ODG A;  4FNF A;  3J7A F;  2I07 B;  1Q12 A;  4P75 A;  5FK9 C;  4WJW A;  3GTL B;  2I5H A;  4X3S A;  2CKZ B;  4YWK A;  3CC2 A;  3LWU A;  2EPB A;  2SNM A;  5C4Z A;  1Q1E A;  1U4R A;  1G91 A;  2ZTC A;  1K28 A;  1FGB D;  1SYC A;  3H0G H;  1G51 A;  1NBW A;  1ASZ A;  1A63 A;  3L0O A;  1P16 A;  1K8O A;  4JBW A;  2HDL A;  1BBX C;  2MO0 A;  1WI5 A;  4A3K G;  1NSN S;  4WJ4 A;  2JA7 H;  1RD9 D;  1TWH H;  4FYD A;  1F9P A;  1EIF A;  1D2B A;  4NXN Q;  4H0L C;  2QEX A;  1EY8 A;  5IP7 H;  1M4V A;  1IKL A;  1N34 Q;  2CH4 W;  3KBX A;  4TSS A;  3U50 C;  5FLX E;  2NTS A;  1IXR A;  4R4I A;  5ELN A;  4ME5 A;  3K5L A;  2JA5 G;  2ATW A;  3CCJ A;  1A3U A;  2WKD A;  3MEF A;  4R9W A;  3I4M H;  1BXT A;  1HTL D;  1F2Z A;  2ICI A;  3H3V H;  4N9P A;  1STB A;  2FJ2 A;  2R7D A;  3KF8 B;  1JT8 A;  1K8M A;  3SK5 A;  2XSC A;  3J7Z C;  2NVQ B;  1B70 B;  1UNS A;  1SYG A;  4IPH A;  4Y52 H;  4C1N I;  2UXC Q;  1FGU A;  4GNX B;  2OWO A;  4DV5 Q;  2RSN A;  1E22 A;  3H0G B;  4G7H C;  1SNQ A;  2I5L X;  1V1Q A;  3A0J A;  4KMU C;  2K50 A;  2K05 A;  3SE0 A;  4XT1 B;  3I4N H;  5BR8 Q;  3CU7 A;  2D5D A;  2EYM A;  3FDT A;  2XTI A;  4A3C H;  4LF4 Q;  1EWC A;  4C1N K;  1G6P A;  4LF7 Q;  1DCZ A;  4DU9 A;  2KEC A;  3H6M A;  2LFN A;  2Z6K A;  1LYL A;  4HTH A;  1EOV A;  1ET6 A;  1CKO A;  2QDB A;  1NAP A;  2N49 A;  1MGS A;  4PMC A;  1KAW A;  3E0E A;  2KJX A;  4QGU A;  2JP1 A;  2WKC A;  3OMC A;  1T5E A;  4UP9 A;  4JI7 L;  5GRO A;  1YNX A;  4AIM A;  3HOZ H;  2D9U A;  3S15 B;  1HRJ A;  2AWN A;  4R4C A;  4OEM B;  4DR5 L;  4DF7 A;  1GUO A;  2BA0 A;  3BZC A;  3NEM A;  3A7A B;  5E4W C;  3S15 H;  4YWM A;  4JI1 Q;  1EY7 A;  5J3B A;  2I0Q A;  1CKN A;  2RF4 A;  4XYO A;  1SYB A;  3DWP A;  3JAM i;  1R4Q B;  2EJG C;  4C3J B;  4XQN A;  3HOY H;  4KKU A;  1U0L A;  3GV6 A;  1WCM H;  4DN4 M;  4HMJ A;  1X3E A;  4I7A A;  4QF4 A;  3CPW A;  4NXN L;  3BZD B;  1SN8 A;  3DMU A;  1VQM A;  1OO9 B;  3MXN A;  4H13 C;  4JBM A;  3F2C A;  3I4N G;  4UP8 A;  4JI8 Q;  3LNN A;  1Q8I A;  2NTT A;  3PO2 B;  2MJ8 A;  3T16 A;  2B2T A;  2Z6B A;  2BE5 D;  3TEH B;  1OXU A;  4HMI A;  4DV3 Q;  1I4H A;  2XWB B;  1C4Q A;  1CA5 A;  2UUB L;  4EQ5 A;  3BVZ A;  3H91 A;  2B2W C;  1A62 A;  1IBL Q;  1TWA H;  4NDX A;  1VQ6 A;  1ZXT A;  1VQK A;  1PA6 A;  1S5C D;  3GTM H;  4DPG A;  4RGO S;  1BDO A;  1D1I A;  3I4M B;  2B3G A;  3K0X A;  1NJI C;  4GKK L;  4J6H A;  4K0K Q;  4LFB L;  1V1P B;  2ZXR A;  2VQE L;  1FVI A;  2JN4 A;  3DWQ A;  3ONA B;  3CRL C;  1EWH A;  2E2J B;  2A74 C;  3V2T A;  4BY1 H;  4GNX C;  1GUT A;  2BE5 C;  4O42 A;  2A5H A;  3CCS A;  4A3K H;  1KLU D;  4HAE A;  4R4O A;  3ICE A;  4DK6 C;  2P5Z X;  4F87 A;  5EKK A;  1VQ5 A;  2Q8R E;  1KNA A;  2V4D A;  4ULL A;  1YVC A;  2F0T A;  4K14 A;  2EY6 A;  3TP8 A;  1MKH A;  3EJI A;  4DV1 Q;  4NW2 A;  1STA A;  3AFQ A;  2K03 A;  4J8Q A;  2KA7 A;  2JE6 I;  4L5Q A;  4M8A A;  1WTP A;  5C3E B;  4XYQ A;  2JQO A;  2WAQ G;  2WFW A;  4C3J G;  3MEH A;  4LF7 L;  4POF A;  1I4X A;  1WCM B;  1ASY A;  1H9J A;  1IBM L;  4EVO A;  1DOM A;  2ID0 A;  2TSS A;  4TVA B;  4P74 A;  3UDF A;  3HOU G;  1PH6 A;  1CSP A;  2NZ1 D;  1L0W A;  3GTJ B;  3FPP A;  5D14 A;  3T56 B;  3P75 A;  1SE8 A;  4KV6 A;  4P73 A;  3M7N A;  2QA4 A;  1U4L A;  4JBJ A;  1XJV A;  1XX8 A;  4JYA L;  2F0W A;  1SLJ A;  1B8A A;  1WJJ A;  4GLV B;  1PTO C;  1FNV A;  1SRU A;  1EYC A;  3DXJ C;  3PQI A;  4UDU C;  4BXX G;  3R8B A;  2F4I A;  4DV2 L;  3HEJ A;  3GQB A;  3NUC A;  3WDN A;  2M00 A;  1WCM G;  3TRE A;  3D3R A;  2PO4 A;  4CKC A;  4QUC A;  3HKZ E;  3HS0 C;  2A73 B;  3H0G G;  5M9O A;  4NPS A;  1E7Z A;  1U4P A;  1T9H A;  4QCL A;  3MHB A;  4B08 A;  2MHV A;  1EOT A;  1LAC A;  3ERS X;  1B1Z A;  1WTR A;  4IN3 A;  2DGY A;  1RCV D;  2CH4 A;  5FJ8 G;  2EY2 A;  5CV8 A;  3S17 H;  3ULP A;  3C3L A;  4X64 L;  1Q8K A;  2JSO A;  3D4R A;  3TS0 A;  3PIP A;  4N8F A;  2MFI A;  4X66 Q;  5M3M H;  2R92 B;  4KY7 A;  1G8Z D;  2JA6 G;  1E3P A;  1JIC A;  3D4D A;  2RHS B;  3WOE A;  2RDF A;  1IL8 A;  1K8G A;  4LWC A;  2EXD A;  4JI7 Q;  4ZYS A;  2ASB A;  3HG9 A;  3AFP A;  4B3T Q;  3MVV A;  1KDA A;  4A3J G;  2A68 C;  2E8G A;  4RMF A;  1AFP A;  3J7Y W;  3IAY A;  4X65 Q;  1BCP C;  1Y14 B;  2AKW B;  4AQY Q;  1LUZ A;  4DR1 Q;  2JA6 H;  3T13 A;  3T53 B;  4AYB G;  1Y1W H;  2JXM B;  1YNN D;  5IOC A;  4CJ1 B;  1MSG A;  5CV7 A;  3E0J A;  4DV0 L;  3W1G A;  4JOI A;  3J7A 5;  2J7Z A;  1TT2 A;  1B9M A;  3E5S A;  3J81 i;  1K73 C;  4DR7 Q;  1KDC A;  5JEA H;  1XMO L;  5GAE C;  3I72 A;  4OHJ A;  3W2D A;  1QZG A;  3IRB A;  2KHJ A;  3OYY A;  1A15 A;  2M9V A;  4HJ9 A;  1V9P A;  3PGZ A;  2YTY A;  1CA6 A;  1XNR Q;  3UDI A;  3QOJ A;  2JA8 B;  2A6H C;  5IWA L;  4DK3 C;  1P8L A;  1A2U A;  3F1Z A;  2Z8L A;  4MZ9 A;  4ZUJ A;  4BXX H;  3CCU A;  5AJ3 Q;  1PH1 A;  1SR3 A;  4FXD A;  1IBL L;  4LNQ A;  2CWP A;  2Q2T A;  5KRU A;  4X62 L;  4XQJ A;  4KKT A;  4DUY L;  4RCN A;  2NVX H;  1SYD A;  1NMG A;  1YJN A;  1JOQ A;  1A8V A;  3HZX A;  3VDY A;  1XMQ Q;  1PXU A;  1HR0 L;  5IYD H;  4LF6 L;  4LFB Q;  1I94 L;  1Q90 A;  2Z4I A;  3CMA A;  3QIA A;  1I4R A;  2PYK A;  3KBG A;  2AQ2 B;  1G29 1;  1E0B A;  1STY A;  1JB7 A;  2NYZ D;  1TS4 A;  1E1T A;  2KED A;  1SXT A;  2MO1 A;  1KLG D;  2F0K A;  2OQ0 A;  2PI2 A;  5IT9 E;  5IP9 G;  3HOU B;  5E4X A;  4YWL A;  5GQO A;  4HIO A;  3A8K E;  1C0A A;  1WYD A;  5CBE E;  4BBS G;  1NTG A;  4F88 A;  1II3 A;  1SFO B;  3VR2 A;  2A68 D;  4A93 G;  4IQZ A;  2EYL A;  2DY7 A;  2VZA A;  5JVG 3;  1TWF H;  2VXW A;  1EWI A;  5I6W A;  2FMC A;  1EZ6 A;  2CFM A;  1W6J A;  2H1E A;  4IPG A;  1PFM A;  2HIV A;  5A2Q L;  3T1Y L;  4NXM L;  1PH7 A;  5IGD A;  4OL7 A;  3IL8 A;  2G5D A;  4GOP C;  5M5Y H;  4RKL A;  1L2F A;  4IFD G;  4LMQ D;  2FMM A;  4OWW B;  4LW1 A;  4GZY C;  1IL2 A;  3F2B A;  3KJO A;  4YY3 Q;  5EPL A;  2QKI C;  1I5F A;  4B3S L;  3HOW H;  2CW0 D;  4H44 C;  1S5F D;  3S1Q B;  4JI4 Q;  4A3J B;  1SYF A;  4L5S A;  4KHZ A;  4HJ7 A;  5LMN L;  2B2V A;  1JOO A;  4XIG S;  4LF8 Q;  4RCO A;  2NVT H;  3C2P A;  3K5O A;  1IHZ A;  2OF1 A;  5DM7 3;  3P7J A;  3RZO H;  1GOZ A;  4DNT B;  1PZI D;  1TU2 B;  3GV3 A;  4Q0F A;  4A3G H;  1V43 A;  2LXK A;  2NUC A;  3KOJ A;  1ICW A;  3U58 A;  2GA4 B;  1MI2 A;  1KHI A;  5M5W H;  4R8I A;  4OX9 L;  1Y69 U;  3K0Y A;  2EYJ A;  2BCO A;  2DY8 A;  1J8I A;  3E9H A;  1NUC A;  1TWH B;  2B2Y A;  2KHI A;  3DLL A;  1TQO A;  2F0L A;  2R93 B;  1MJE A;  1DON A;  2UXC L;  4DAP A;  4A3F G;  3J80 i;  1PTO H;  1PFN A;  1A2T A;  3ND8 A;  1MD2 D;  1E2Z A;  1NCV A;  2EYH A;  3MFG A;  3NQT A;  4LF6 Q;  1KRS A;  5KND A;  5KGU A;  1BCP B;  2IJ0 A;  1PH5 A;  2HUG A;  1X32 A;  4DA2 A;  1X56 A;  2CQO A;  4AYB E;  1CUK A;  3TBI B;  2PMZ B;  2VW9 A;  4LF4 L;  4MHE A;  2OEO A;  2X69 A;  1I3Q H;  3VR4 A;  1JCK B;  5CMD A;  1IKM A;  4KD4 A;  5M3M G;  1E24 A;  1PTO F;  2LS0 1;  4NB3 A;  5C4X G;  5D3D A;  5IGC A;  4P71 A;  3M9B A;  4WJ3 M;  2ZXO A;  4L6T B;  4CJ2 C;  1VF5 C;  1HZB A;  3HGB A;  2R3Z A;  1LTS D;  1QCB D;  3GO5 A;  4A3E B;  4N8X 1;  4FF2 A;  4DV4 L;  3GTP H;  2RCF A;  2O5I C;  2WAQ B;  3MXN B;  1JQY D;  2RVL A;  3VYS A;  3AU7 A;  4GKJ L;  4IUQ A;  1JE4 A;  3TP5 A;  4C2M B;  2YTX A;  4MTN A;  1RDP D;  2IY5 B;  5EJW A;  2CHB D;  2H4O A;  3BYT B;  1FJG Q;  1Y8P B;  1STH A;  1VQL A;  2AWO A;  1PZJ D;  3J81 L;  1CQV A;  3A5U A;  4KY5 A;  3A74 A;  3V96 A;  4JI5 L;  2QGQ A;  5COR A;  1ILP A;  3L3O C;  3D0F A;  4DV3 L;  2VQF Q;  2YU9 H;  4UY8 C;  1O7Z A;  3T1H Q;  1TWG H;  4O0A A;  3UDG A;  1X3F A;  4BY7 G;  3K7A B;  2A1A A;  4DK0 A;  3H09 A;  1V1P A;  3W1B A;  3M4O H;  1EYG A;  2XRQ D;  4C3H H;  1BR9 A;  4QQB X;  2FXQ A;  2EY1 A;  3VYU A;  3I4M G;  4DNI A;  4C56 C;  3KLS A;  4CDE C;  1XMQ L;  1NR2 A;  1UWV A;  3HOX H;  2NN6 H;  4A3E H;  2IPK D;  4G7Z C;  2ZJP A;  5JJL A;  2Z0S A;  4KJN A;  3HOZ G;  4HCS A;  4LFA Q;  1L0X B;  1NNX A;  1H9S B;  3WOF A;  4DR6 L;  3CCQ A;  3S1R H;  1LTT D;  2R6G A;  3JAM E;  4JBK A;  2OQK A;  5E7N A;  2L1B A;  4KY6 A;  1CI3 M;  1H9S A;  2NVX B;  1SNM A;  3GDE A;  3TSS A;  5I9O A;  1J5E Q;  4KKS A;  1FNU A;  1IZ6 A;  2N8N A;  2YV5 A;  2YTV A;  4HSV A;  2F0U A;  3HRZ C;  4UHV A;  4BBR B;  2FHT A;  2WB1 G;  2CWA A;  3FKI B;  1BQQ T;  1HNW Q;  2K04 A;  4DV1 L;  3NK9 A;  2JA8 H;  4YCV A;  1EFI D;  3D6C A;  3HOV B;  2R61 A;  3I56 A;  1YHA A;  2R7Z H;  1TVX A;  1QUQ A;  4DKA C;  2K7V A;  4BBR H;  5IE8 A;  2MP1 A;  4DV7 L;  2F0M A;  1VMC A;  5IWA Q;  1STN A;  2VB3 X;  1EY0 A;  2HQE A;  3NTK A;  4LUV A;  4IJH A;  4X62 Q;  5FOB B;  4FXG C;  1Q81 C;  2MPM A;  4YHH L;  3RZD H;  3VYT A;  2LKV A;  2Q8I B;  3QB3 A;  1EEF D;  3E9I A;  2BOS A;  3S1N B;  1X3G A;  5M5W B;  3OWE B;  5C44 H;  2BH8 A;  1IBK L;  1BVS A;  1DM0 B;  3CHB D;  3DHQ A;  3DM1 A;  4XXE A;  3PIO 3;  2LMC B;  4GS3 A;  4P72 A;  1PH8 A;  2QCP X;  5CGK A;  1SMY C;  5ELE A;  1KAB A;  4TKO B;  4XTC S;  2WAC A;  4A3L H;  2F3W A;  4APV A;  1SSO A;  1DD2 A;  5DM6 3;  2J4X A;  2DJG C;  4OO1 H;  3HOW B;  5ELF A;  4KD3 A;  1IW7 C;  2ZTE A;  5M3M B;  1L1O B;  4DAY A;  1TWG B;  1C8C A;  4XT3 B;  1SND A;  2Q2H A;  4ID6 A;  4F8M A;  4LUO A;  3S17 B;  2RBM A;  4WFN 3;  5IT9 L;  5I6Y A;  1WVL A;  4JI5 Q;  2K5V A;  3Q8D A;  1BBW A;  3TRZ A;  2D0P A;  1PRT C;  3HOV G;  3RR5 A;  3A54 A;  1VQ7 A;  5C5M A;  3I3C A;  3BDO A;  1KXL A;  2XGT A;  1VQO A;  1CKM A;  1FJG L;  1GO3 E;  3GTK H;  1QVF A;  2K75 A;  4H02 A;  5FO8 B;  1U9R A;  4C2M H;  1KQS A;  1SFO H;  4L63 B;  5TSS A;  2UUB Q;  2Y0S B;  2OXP A;  1S5B D;  3QJY A;  3EBE A;  2K32 A;  4DV2 Q;  1F2L A;  1V1O A;  2XWJ B;  3GTQ B;  3A5Z B;  5JEA J;  1VQG A;  5L37 A;  4O2D A;  2N78 A;  4IUU A;  1G2S A;  3X3N A;  1Q82 C;  5JJZ A;  2VUM H;  5I9P A;  2PNR C;  4K8I A;  4PG3 A;  1YNJ C;  3R93 A;  4FP5 D;  1YHB A;  5C44 B;  4NMZ A;  2A69 C;  4PQX A;  4JV5 L;  5J1Z A;  4A3B G;  3R2T A;  1XYI A;  3CCM A;  4JI2 L;  5ELB A;  1AN8 A;  3NBI A;  5K5P A;  1EYD A;  3SDZ A;  3CCE A;  4GKJ Q;  1N36 Q;  1N8R C;  2L4N A;  2C9O A;  1YIJ A;  3PIP 3;  3EFX D;  5G3L F;  2B63 H;  4ZRZ A;  2N3S A;  1JR0 D;  1GD7 A;  1NY4 A;  1N32 L;  1F2Y A;  1Y1V H;  2O5J C;  2K01 A;  1H9M A;  1X3P A;  4DK1 A;  1JJG A;  1XXG A;  3KUP A;  3OW2 A;  1LTI D;  1Z9F A;  3U4V A;  5FKA C;  1IYV A;  5IP7 G;  3TP7 A;  1I50 H;  1CM9 A;  2HCC A;  4BY7 B;  2HCI A;  4A3K B;  1K83 B;  1VQD A;  1HNW L;  2CVR A;  1YHQ A;  4BY1 B;  2NWG A;  1HJP A;  3S14 B;  1LT6 D;  2QDL A;  1HTP A;  1X65 A;  2KCC A;  2MGS A;  1Y1W B;  4KHV A;  2BH2 A;  1XPO A;  5IYC G;  1KTK A;  4OON A;  3RZO B;  3NWT A;  3FHW A;  4HIK A;  4EQP A;  4IJL A;  2K4K A;  2KCN A;  4A4I A;  2D62 A;  3HOX B;  4CJ0 B;  2AQ3 B;  1WFQ A;  3S1Q H;  1GVP A;  3MA2 B;  4C3H B;  1E1O A;  3M4O B;  1J6Q A;  1PLF A;  1SRO A;  1PFS A;  1EL0 A;  4LF5 L;  1O80 A;  3MC0 B;  2BDN A;  4JI3 L;  3FVQ A;  2B2Y C;  3GTO B;  2EYO A;  1A6X A;  4A3D G;  5IYB H;  3HKZ G;  1PVO A;  1ZYR C;  5C4H A;  3DEP A;  1TXY A;  2EZV A;  3ND9 A;  3IFD A;  3PO2 H;  2EDG A;  4OEL B;  2UU9 Q;  1MSH A;  3FPU B;  4IUR A;  4CHT B;  1G6Z A;  3BU2 A;  2RA4 A;  2L5T A;  5CBA E;  1I6V C;  5CV5 A;  4CDD C;  2XRS D;  3X3M A;  2E75 C;  5GAG C;  1Q86 C;  1LTR D;  1B44 D;  2GVB A;  4BS9 A;  1VQ8 A;  3S2D B;  5IY0 A;  5FO7 B;  3VA5 A;  1X9N A;  1WD0 A;  5A2Q E;  2HIX A;  1GUS A;  1LTG D;  1K0S A;  2F52 A;  2EJF C;  1SEB D;  4JI1 L;  2B8G A;  1MBY A;  4GOP A;  3OIP A;  3J81 E;  3J7A V;  2UUC L;  1G2T A;  5KYI A;  1SE4 A;  2K5W A;  2X6G A;  3D4W A;  5T1G A;  3TQY A;  3GTJ H;  3QR8 A;  4RAU C;  2B63 G;  1B9N A;  3NEL A;  3KF6 A;  1N33 Q;  1VQ4 A;  5ELO A;  4XDX A;  4J1M A;  4J15 A;  1JOR A;  1E2V A;  3H3V C;  1HNZ Q;  4ZK9 B;  3KFU A;  1JMC A;  3SXH A;  3RUZ A;  1VQE A;  4DGZ A;  1SJH D;  3PO3 G;  1VMP A;  4A3B H;  5EAY A;  2IHE A;  3AB9 A;  5C3E H;  4LFC Q;  5DEH A;  3CW2 C;  1PRT F;  1Q1B A;  4K6D A;  2KOL A;  3HP3 A;  4DV0 Q;  1QUQ B;  3T51 B;  1EFW A;  5FLX L;  3NTH A;  5FLM G;  1HUM A;  3TP6 A;  3S2H B;  3BDL A;  2R93 H;  1DYQ A;  1XMO Q;  3H3V I;  2MUY A;  1S72 A;  4RA8 A;  3SK6 A;  2F3I A;  1PYB A;  4U68 A;  3NP8 A;  4IUN A;  3A8J E;  2ENB A;  4L5T A;  3P20 A;  5HGQ A;  2RDH A;  4OGQ C;  1KDB A;  2EY5 A;  2WB1 E;  3BYY B;  5D3I B;  1WTH A;  4A3G B;  3BJU A;  2B8F A;  3NHH A;  1H9R A;  1RKN A;  5BR8 L;  1VQF A;  4RKB A;  5JAV A;  2DNC A;  4A3I G;  3A55 A;  4JVZ A;  1PYS B;  2XN9 C;  3VR3 A;  2ZT9 C;  4HN7 A;  1YZ6 A;  5C0X H;  2E5L L;  4S3S A;  5FO9 B;  3GTM B;  5K36 G;  4BBS B;  1GHJ A;  3K7U C;  5IYC H;  4BY1 G;  4MTK A;  2HHH Q;  3NXW A;  1HQM C;  5T1I A;  3ZJY C;  1HPC A;  2K33 A;  2K5Q A;  3S2H H;  1GM5 A;  1OXV A;  2ICE C;  1ZYR D;  5M3F G;  4L5R C;  5HY6 A;  3UE1 A;  1SDF A;  1EZ8 A;  3KDF B;  3NWS A;  2ZJQ A;  1KIX A;  2IX0 A;  2KUM A;  5COY A;  3CF5 A;  3FP9 A;  2E2H B;  2A8V A;  3MXP A;  4TQU S;  4Y7N H;  3W5O A;  5JPM C;  4JI0 Q;  2SNS A;  2UUA Q;  4A3M G;  1ET9 A;  1WTX A;  1L1O A;  2F0G A;  2K52 A;  2KEN A;  2UXD L;  5C6A A;  3QWN A;  1TS5 A;  2UXD Q;  4JI3 Q;  1OTC A;  1D1K A;  1HFN A;  3NBH B;  1EIY B;  3HOY B;  1DOL A;  3OTO Q;  3KYH C;  2Q8T A;  4X66 L;  2B2U A;  2B2V C;  3HOU H;  4TRD A;  3I55 A;  3CXC A;  2IL8 A;  3WWV A;  3N52 A;  2TMP A;  1AZP A;  5LMU Q;  2UU9 L;  3M3Y H;  3PCO B;  5C5L A;  3PUY A;  1B7Y B;  1GUN A;  3DUZ A;  2AHO B;  2NZH A;  2AQ1 B;  3I8Z A;  3RLF A;  3CRK C;  1VQA A;  5DAU A;  4M1U B;  5C3X A;  2MQH A;  1VQB A;  3CC4 A;  1AEX A;  5KYL A;  1LTL A;  1LTB D;  2AMC B;  2Y0S G;  3A7L A;  2QW7 A;  4RWS C;  5IOD A;  2ZXP A;  1LLR D;  3RLN A;  3NE5 B;  3CPF A;  1Q46 A;  2E2I H;  5H1S E;  1HFG A;  3GTG H;  4ZQ3 A;  4JI6 Q;  3DWA A;  2B2U C;  1AE2 A;  5ELD A;  5IGG A;  4X65 L;  3T4A C;  3I4N B;  4KI0 A;  4Y7N B;  3JAM L;  4LK1 C;  5LMU L;  2Q2I A;  1QIL A;  4A75 A;  1PMR A;  2R7Z G;  3C1F A;  3HKS A;  4LF8 L;  1QZH A;  4GN3 B;  2XIW A;  3HOX G;  4DV7 Q;  3MXG A;  4C3I H;  3H94 A;  4AQY L;  4JW0 A;  4G7O C;  1DGS A;  1STE A;  2KBN A;  5NUC A;  3PSI A;  4U67 3;  1OXS C;  3RD4 A;  1IYJ B;  3MXU A;  3ULJ A;  3SVM A;  4OX9 Q;  5C4J B;  3M4Y A;  2UXB Q;  1PH2 A;  4G57 A;  4A3M B;  1TR5 A;  4CGY B;  1HZA A;  4DV6 Q;  2PQE A;  3OPO A;  1XNQ L;  4DR2 Q;  2MNA A;  3AQQ A;  3K58 A;  3BDC A;  1WTO A;  2K28 A;  5C4J H;  2IWH A;  4A3F H;  3CCR A;  2ES2 A;  2K1B A;  1VQH A;  2F4V Q;  1LT5 D;  3VR5 A;  1Z7T A;  1EU3 A;  1CKN B;  1PH4 A;  2R92 H;  2OCE A;  3J81 j;  2HQL A;  1EQR A;  2WV6 D;  4KN4 C;  4HR7 B;  4K2L A;  1I50 B;  1HUN A;  1PRT D;  2C35 B;  3J81 c;  3OIQ A;  1EYA A;  1PDQ A;  3R2I A;  1RJT A;  4CDF C;  1U4M A;  2ZTD A;  1FR3 A;  1VS0 A;  2C5C A;  4K0K L;  2GN5 A;  2F0S A;  2RCN A;  4B3M L;  2NBF A;  1TS3 A;  5J22 A;  1I4P A;  1VQN A;  1KD1 C;  3F8T A;  4A3B B;  4NXM Q;  1PYW D;  4RG1 A;  1XPR A;  3K5M A;  3U9S A;  2A69 D;  3SK4 A;  3E3X A;  3OW7 A;  3K8A A;  1ENA A;  4QIW E;  1OXX K;  1O7Y A;  2N55 A;  2SEB D;  2HHH L;  1IBM Q;  1PFB A;  1QNU A;  3I73 A;  4K2K A;  5EKI A;  2F03 A;  4LAA A;  2K14 A;  5LMN W;  4CKE A;  4EX5 A;  1SMY D;  1YNJ D;  1UE6 A;  4DXG A;  2Z1C A;  4B3R L;  1TKW B;  2PCF B;  3TZU A;  1DOK A;  4LJZ C;  1O7L A;  2VUM B;  1Q3L A;  3CQZ H;  1PHJ A;  2AUJ D;  2NB0 A;  4K5W A;  4JYA Q;  3IFT A;  1QVG A;  2KVM A;  3S2D H;  4OWX B;  4GOP B;  4O1N A;  5CYU A;  3JAM c;  4DV5 L;  4QB4 A;  1SE2 A;  3ZYY X;  1RHP A;  4XQQ A;  4L8J A;  1SYE A;  3JC6 6;  3MAQ A;  3ERQ A;  5EGT A;  1D5Z C;  4NKL A;  3I4L A;  4K8J A;  1XTC D;  3D6W A;  5C0X J;  3D8G A;  3PO2 G;  4A3I B;  2F0I A;  4JOI C;  5IGB A;  2IT1 A;  1AZQ A;  4P2C B;  2OTL A;  3U9O A;  1SNC A;  3K80 C;  4A3D H;  1UE1 A;  1GJX A;  3GTO H;  5HUR A;  1KRT A;  1HNZ L;  4Q5V A;  4KJO A;  1HXY D;  4DR7 L;  1BBU A;  5EBC A;  3RN5 A;  1W6K A;  3NTI A;  1PRT B;  1HR0 W;  4BWG B;  4H7B A;  4LFC L;  4DNR B;  3MWY W;  4A76 A;  4IFD H;  3GD7 A;  5M3F B;  1GUG A;  1WD1 A;  3BVG A;  1GXD C;  3RN2 A;  4ZKB B;  4JI4 L;  2V1C C;  2VQE Q;  1GKH A;  4FF3 A;  2DNE A;  2JK8 A;  1KL9 A;  3PF4 A;  1A0I A;  4X3T A;  4K6L A;  1PV4 A;  4F7X A;  4RHR A;  4RH6 A;  5DNF A;  1UAP A;  4A3M H;  3LX0 A;  2RQX A;  4YCU A;  1JC7 A;  1CK1 A;  2RKS A;  1CZW A;  2OT2 A;  2F0D A;  2ZJR A;  1HA6 A;  3PF5 A;  3RZD B;  1TWA B;  4IPC A;  3KK7 A;  1V8Q A;  3FRP B;  5FLX c;  2F0O A;  1LT4 D;  1K83 H;  4LF5 Q;  4KHP Q;  1UEA B;  2Q2U A;  5I2X A;  3FKI G;  1HCZ A;  2F4V L;  5M5X B;  3B6Y A;  5LMN Q;  5F2D A;  3ITP A;  4CDC C;  2E76 C;  1D6E C;  1LT3 D;  2L55 A;  2PQA B;  3RLO A;  3ULL A;  1BKB A;  1I6H H;  3EA6 A;  3OSO A;  1EY6 A;  1YI2 A;  1K9M C;  2VNU D;  5C0X G;  1B50 A;  3QO2 A;  3I7F A;  2L11 A;  5CV4 A;  1Y1V B;  3GTL H;  3FKI H;  5JPN C;  1XWE A;  4EQO A;  3KJP A;  5JOB A;  1R9T H;  2SOB A;  1CFM A;  2B63 B;  3SK8 A;  2WII B;  2M2L A;  2PNH A;  2B39 A;  3PMF A;  2IW3 A;  3F2U A;  1EUJ A;  4X3K A;  3L7Z C;  1TWC B;  3FMC A;  3N6R A;  5IP9 H;  1SE3 A;  2PW5 A;  2G9D A;  1Y8N B;  3GP7 A;  5HGT A;  2F0P A;  5CC4 A;  4WRD A;  3HOZ B;  4B9W A;  1CHP D;  1EY9 A;  2VB2 X;  1B3A A;  2ALY B;  4UPA A;  4X6A H;  2I46 A;  2WAQ E;  1HZ9 A;  1S5D D;  1ZEQ X;  1BOS A;  4DV4 Q;  1SMX A;  4OO1 G;  1VQ9 A;  2N88 A;  3BG3 A;  1SNP A;  1F9R A;  4QMG A;  2Y0S E;  1PZK D;  1JWU D;  4PZ6 A;  4EGV A;  1Z47 A;  1JOK A;  3F2D A;  1KC8 C;  2EXZ A;  5EPJ A;  3QOL A;  4KTA A;  2L15 A;  1F9S A;  2JA5 B;  2H5X A;  4DV6 L;  3VA7 A;  5BN4 A;  2F0N A;  2E2H H;  4IUV A;  4K5V A;  1K3B C;  4JI6 L;  1NMF A;  2Z4H A;  4ALP A;  3H15 A;  3LGJ A;  4B3S Q;  1HNX L;  3OTO L;  3Q6S A;  5CV6 A;  2NVQ H;  4DR4 L;  4MIU A;  2JJQ A;  2NVY H; 
#chains in the Genus database with same CATH homology
 3G6E A;  4JI4 Q;  2DUD A;  1JMC A;  3KFU A;  4BBS H;  4L5S A;  4KHZ A;  4JC0 A;  1VQE A;  4HJ7 A;  3PO3 G;  5LMN L;  5FJ8 H;  4A3B H;  1Q12 A;  2IHE A;  3M4Q A;  4P75 A;  4XIG S;  5EAY A;  4HIM A;  1O7I A;  5C3E H;  4LF8 Q;  2I5H A;  2NVT H;  4YWK A;  2CKZ B;  4LFC Q;  3CC2 A;  1NE3 A;  3CW2 C;  3RZO H;  1Q1B A;  1Q1E A;  4JCV E;  4BA1 I;  4A3G H;  1V43 A;  2LXK A;  2ZTC A;  4DV0 Q;  1QUQ B;  3KOJ A;  1X6O A;  3H0G H;  3U58 A;  1EFW A;  1G51 A;  1NBW A;  1UEB A;  3J80 c;  4OWT B;  1ASZ A;  1KHI A;  5M5W H;  3HOW H;  1A63 A;  3L0O A;  1P16 A;  5FLM G;  3S14 H;  5IYD G;  4JBW A;  4OX9 L;  2MO0 A;  2R93 H;  1WI5 A;  4A3K G;  4HJ5 A;  4DR1 L;  1XMO Q;  3E9H A;  3H3V I;  4WJ4 A;  1S72 A;  2JA7 H;  1JE5 A;  1TWH H;  1UE5 A;  2KHI A;  2F3I A;  1PYB A;  3DLL A;  4DUZ L;  1EIF A;  1MJE A;  2UXC L;  4L5T A;  1N34 L;  4NXN Q;  5HGQ A;  2QEX A;  2YYZ A;  4A3F G;  3J80 i;  5IP7 H;  4BBR G;  1VQI A;  2WB1 E;  4LUZ A;  1N34 Q;  3U50 C;  3KDF A;  1IXR A;  4R4I A;  3BJU A;  2VY3 A;  5ELN A;  2JA5 G;  2ATW A;  3CCJ A;  3HOV H;  3MEF A;  4LF6 Q;  1KRS A;  1S3O A;  1VQF A;  2K5H A;  5BR8 L;  4A3I G;  4DR4 L;  1PYS B;  4IOC A;  1PH5 A;  3I4M H;  1X56 A;  2CQO A;  1YZ6 A;  4AYB E;  3H3V H;  1CUK A;  2E5L L;  3CD6 A;  2VW9 A;  5K36 G;  4LF4 L;  3K7U C;  2R7D A;  3KF8 B;  5IYC H;  4QY7 A;  4BY1 G;  1JT8 A;  3J7Z C;  4KHP L;  1I3Q H;  1YEZ A;  2HHH Q;  5M3M G;  1B70 B;  1E24 A;  3ZJY C;  3S2H H;  1GM5 A;  1OXV A;  5M3F G;  4L5R C;  4IPH A;  5HY6 A;  2UXC Q;  4Y52 H;  1FGU A;  3UE1 A;  4GNX B;  2OWO A;  3KDF B;  4DV5 Q;  4NB3 A;  2ZJQ A;  5C4X G;  1KIX A;  1E22 A;  2IX0 A;  3CF5 A;  2HT1 A;  4P71 A;  2I5L X;  3M9B A;  1V1Q A;  3M85 A;  3A0J A;  2UUA L;  4WJ3 M;  2K50 A;  3BZK A;  3FP9 A;  1WOC A;  5IT9 c;  2A8V A;  4GN5 A;  4TQU S;  4Y7N H;  3W5O A;  3I4N H;  2KCT A;  1HZB A;  4JI0 Q;  2D0O A;  2UUA Q;  5BR8 Q;  4A3M G;  3GO5 A;  1L1O A;  2K52 A;  2KEN A;  2UXD L;  5C44 G;  4DV4 L;  1VQP A;  2XTI A;  4A3C H;  2PI2 E;  4LF4 Q;  3GTP H;  4A3J H;  2UXD Q;  3PUZ A;  4JI3 Q;  1G6P A;  1OTC A;  4LF7 Q;  3MXN B;  2Z6K A;  3NBH B;  1LYL A;  1EIY B;  2R92 G;  3HOY G;  1EOV A;  4BA2 I;  1CKO A;  3KYH C;  4X66 L;  3OTO Q;  4GKJ L;  3PV0 A;  2N49 A;  3S24 A;  3HOU H;  1KAW A;  3E0E A;  3I55 A;  4QGU A;  2YTX A;  3CXC A;  2WP8 J;  4IPD A;  4MTN A;  2IY5 B;  4UP9 A;  4JI7 L;  1HZC A;  1YNX A;  5GRO A;  4AIM A;  3WWV A;  3HOZ H;  1FJG Q;  2AWN A;  4R4C A;  4DR5 L;  1VQL A;  2AWO A;  1RIP A;  3A5U A;  5LMU Q;  2UU9 L;  3A74 A;  4R1J A;  3M3Y H;  2K5N A;  2BA0 A;  4IO9 A;  4DR5 Q;  3CAM A;  3BZC A;  3NEM A;  3PCO B;  4JI5 L;  3PUY A;  1B7Y B;  3UDX A;  2QGQ A;  3S15 H;  4YWM A;  3D0F A;  4JI1 Q;  4DV3 L;  2VQF Q;  5J3B A;  2AHO B;  2NZH A;  2I0Q A;  3RLF A;  1CKN A;  1YBY A;  3S1M H;  2RF4 A;  2YU9 H;  1VQA A;  4UY8 C;  3JAM i;  3T1H Q;  1TWG H;  4O0A A;  2MQH A;  1VQB A;  2R7F A;  1X3F A;  3UDG A;  3CC4 A;  4BY7 G;  2A1A A;  1LTL A;  2Y0S G;  2AMC B;  3HOY H;  3W1B A;  1U0L A;  4UP7 A;  5DLQ E;  3CCL A;  3M4O H;  1EYG A;  4C3H H;  1WCM H;  4PMW A;  2FXQ A;  3I4M G;  4QQB X;  1X3E A;  4DNI A;  3CPW A;  3RLN A;  1XMQ L;  4A3C G;  1N32 Q;  3CPF A;  4B3R Q;  4NXN L;  1UWV A;  1Q46 A;  3HOX H;  5H1S E;  2E2I H;  3GTG H;  1XTD A;  4A3L G;  3AEV A;  1SN8 A;  4JI6 Q;  4A3E H;  2ZJP A;  1VQM A;  5JJL A;  2Z0S A;  3HOZ G;  1AE2 A;  4DR6 Q;  4X65 L;  4LFA Q;  4JBM A;  3F2C A;  3I4N G;  4UP8 A;  4KI0 A;  4JI8 Q;  1XNR L;  5LMU L;  2Q2I A;  4GLA C;  4A75 A;  4DR6 L;  1C9O A;  3CCQ A;  3S1R H;  2R7Z G;  2R6G A;  3HKS A;  4JBK A;  2NN6 G;  2OQK A;  5E7N A;  1OXU A;  3TEH B;  4A3E G;  4GN4 B;  1N33 L;  4LF8 L;  1QZH A;  4GN3 B;  1TWC H;  3HOX G;  4DV7 Q;  4DV3 Q;  4C3I H;  3PUV A;  1RL2 A;  1H95 A;  2UUB L;  4AQY L;  4EQ5 A;  1DGS A;  3GDE A;  5FLM H;  1PH9 A;  1J5E Q;  2KBN A;  1D8L A;  1A62 A;  1IBL Q;  3PSI A;  1TWA H;  2I5M X;  1IZ6 A;  1OXS C;  2N8N A;  4BY7 H;  1YJW A;  2YV5 A;  1VQ6 A;  2YTV A;  1IYJ B;  3ULJ A;  1VQK A;  4IFD J;  1PA6 A;  3L2P A;  4OX9 Q;  4QL5 A;  3GTM H;  2UXB Q;  5GAD C;  1PH2 A;  4OXP A;  4DPG A;  2WB1 G;  4KLK A;  2CWA A;  5C3E G;  1HNW Q;  1HZA A;  4DR2 L;  2B3G A;  3K0X A;  3G4S A;  4DV6 Q;  4DV1 L;  1NJI C;  4GKK L;  2JA8 H;  4K0K Q;  4LFA L;  4LFB L;  4YCV A;  3PUX A;  2VQE L;  2JA8 G;  3I56 A;  1XNQ L;  1FVI A;  4DR2 Q;  2MNA A;  3AQQ A;  1YHA A;  2R7Z H;  3S16 H;  1QUQ A;  4DKA C;  4GLX A;  4BBR H;  5C4J H;  4A3F H;  3PIO A;  3CCR A;  2IHF A;  2ES2 A;  2PMZ E;  5IE8 A;  4DV7 L;  1VQH A;  4DR3 L;  5M5X H;  2F4V Q;  1LM0 A;  1MJC A;  5IWA Q;  4BY1 H;  4GNX C;  1CKN B;  4ME3 A;  1PH4 A;  2R92 H;  2OCE A;  4LUV A;  2GVA A;  4IJH A;  4QJF A;  2PQA A;  4X62 Q;  3J81 j;  3CCS A;  4A3K H;  1Q81 C;  4YHH L;  2HQL A;  1EQR A;  4R4O A;  3RZD H;  1IBK Q;  3ICE A;  4DK6 C;  3CME A;  3E9I A;  1X3G A;  1VQ5 A;  2C35 B;  2BH8 A;  5C44 H;  4R4Q A;  3J81 c;  1IBK L;  1BVS A;  1L1O C;  4DUY Q;  1YVC A;  2E5L Q;  1MKH A;  4AH6 A;  2ZTD A;  4GS3 A;  4P72 A;  4DV1 Q;  1PH8 A;  3AFQ A;  2JEA I;  1VS0 A;  4K0K L;  1AE3 A;  2JE6 I;  2GN5 A;  3EIV A;  4L5Q A;  2RCN A;  4B3M L;  2JQO A;  2WAQ G;  4XTC S;  2Z6K C;  5C4X H;  1VQN A;  3KF6 B;  2WFW A;  1KD1 C;  3F8T A;  4APV A;  4LF7 L;  4NXM Q;  3GTQ H;  4POF A;  4A3L H;  4RG1 A;  3STB D;  5M3F H;  1XPR A;  3RNU A;  2R93 G;  1ASY A;  1IBM L;  3K8A A;  2ID0 A;  4QIW E;  1OXX K;  2ZTE A;  2HHH L;  4TVA B;  1L1O B;  4P74 A;  1IBM Q;  1HR0 Q;  4LF9 L;  3UDF A;  4FDB A;  3HOU G;  2Q2H A;  1PH6 A;  4POG A;  1CSP A;  2K14 A;  5LMN W;  4GNX A;  4LUO A;  1L0W A;  4DAM A;  4EX5 A;  3K81 C;  1UE6 A;  4B3R L;  1SE8 A;  2RHQ B;  4P73 A;  3M7N A;  5C0X I;  2QA4 A;  4JI5 Q;  4A3I H;  2K5V A;  3Q8D A;  1BBW A;  3TRZ A;  2D0P A;  4JBJ A;  1XJV A;  2VS1 A;  3HOV G;  3RR5 A;  2JA5 H;  2JEB I;  1VQ7 A;  3CQZ H;  1PHJ A;  1KXL A;  2XGT A;  1VQO A;  3CP0 A;  1CKM A;  1FJG L;  4JYA L;  1GO3 E;  3GTK H;  1SLJ A;  1QVF A;  2K75 A;  4H02 A;  1B8A A;  1OXT A;  4C2M H;  1WJJ A;  4GLV B;  1KQS A;  4JYA Q;  1SFO H;  1QVG A;  1SRU A;  2UUC Q;  4BXX G;  1HNX Q;  1N36 L;  4DV2 L;  1JJC B;  2UUB Q;  1VCI A;  4YY3 L;  3S2D H;  2JA7 G;  4OWX B;  2LSS A;  3EBE A;  1WCM G;  4GOP B;  3DM3 A;  3TRE A;  4DV2 Q;  3JAM c;  4DV5 L;  3A5Z B;  5JJK A;  5JEA J;  5JJI A;  1VQG A;  4O2D A;  3HKZ E;  3H0G G;  2N78 A;  4NPS A;  1E7Z A;  1T9H A;  3JC6 6;  1Q82 C;  2VUM H;  4JI0 L;  3G48 A;  2OTJ A;  5C0X J;  3PO2 G;  4PG3 A;  4GKK Q;  3ERS X;  3T1H L;  4JOI C;  1YHB A;  2IT1 A;  1M1K C;  2OTL A;  3STB C;  4X64 Q;  2DGY A;  5JEA G;  3K80 C;  4JV5 L;  3PO3 H;  4A3D H;  1UE1 A;  5FJ8 G;  4A3B G;  1AH9 A;  4IOA A;  1QVC A;  3S1N H;  3S17 H;  3GTO H;  3ULP A;  3CCM A;  4X64 L;  1S40 A;  4JI2 L;  4JG2 A;  1KRT A;  1HNZ L;  2IX1 A;  4JV5 Q;  1Q8K A;  3TS0 A;  3PIP A;  3CCE A;  2MFI A;  4X66 Q;  5M3M H;  4DR7 L;  4GKJ Q;  1UE7 A;  1N36 Q;  1BBU A;  1N8R C;  3RN5 A;  2JA6 G;  1HR0 W;  1E3P A;  1YIJ A;  4LFC L;  4A76 A;  2RHS B;  2B63 H;  1M90 C;  2N3S A;  3GD7 A;  3I2Z A;  1K8G A;  4B3T L;  4LWC A;  1GD7 A;  2B29 A;  2EXD A;  4JI7 Q;  1NY4 A;  1N32 L;  2NZO A;  3RN2 A;  2ASB A;  4JI4 L;  2V1C C;  1Y1V H;  3AFP A;  2VQE Q;  4B3T Q;  1GKH A;  4DUZ Q;  4A3J G;  2JK8 A;  1KL9 A;  2E8G A;  3PF4 A;  4RMF A;  1A0I A;  4X65 Q;  1PV4 A;  4JI8 L;  1JJG A;  2EIF A;  1JJ2 A;  1Y14 B;  2AKW B;  2ZM6 L;  3OW2 A;  1LUZ A;  4DR1 Q;  3G71 A;  4AQY Q;  4DR3 Q;  4A3M H;  4YCU A;  1Z9F A;  2EQS A;  2JA6 H;  3U4V A;  4AYB G;  1Y1W H;  5IP7 G;  2ZM6 Q;  2ZJR A;  1I50 H;  4DV0 L;  1YJ9 A;  1K0R A;  3W1G A;  3PF5 A;  4IFD I;  4IPC A;  4JOI A;  4YHH Q;  3J7A 5;  5FLX c;  1MIU A;  1K83 H;  4LF5 Q;  4DR4 Q;  4KHP Q;  3J81 i;  1VQD A;  1K73 C;  4DR7 Q;  1PH3 A;  2Q2U A;  3FKI G;  1HNW L;  1XMO L;  5GAE C;  1YHQ A;  1HJP A;  2F4V L;  3B6Y A;  5LMN Q;  2E2J H;  1QZG A;  1X65 A;  2KHJ A;  3IRB A;  3OYY A;  1Q7Y C;  1K3R A;  1YIT A;  2VUM G;  4HJ9 A;  2BH2 A;  1XPO A;  1V9P A;  3PGZ A;  5IYC G;  2PQA B;  2YTY A;  3RLO A;  1BKB A;  3ULL A;  4B3M Q;  1XNR Q;  3UDI A;  4OON A;  1I6H H;  1YI2 A;  1K8A C;  3KLW A;  1K9M C;  3FHW A;  4HIK A;  2CCZ A;  5C0X G;  2VNU D;  5IWA L;  4DK3 C;  4IJL A;  2K4K A;  1P8L A;  3I7F A;  3GTL H;  3FKI H;  3SGI A;  4A4I A;  1CSQ A;  2D62 A;  3F1Z A;  5IYB G;  3KJP A;  3PUW A;  1D7Q A;  1EQQ A;  1R9T H;  4MZ9 A;  1WFQ A;  1N9W A;  3HFZ B;  1GVP A;  3S1Q H;  4BXX H;  1E1O A;  3CCU A;  5AJ3 Q;  1PH1 A;  1SR3 A;  2PNH A;  1J6Q A;  1X55 A;  1IBL L;  4LNQ A;  2CWP A;  1SRO A;  2Q2T A;  1PFS A;  3K7A H;  4LF5 L;  4X62 L;  5AJ3 L;  4DUY L;  2A19 A;  4JI3 L;  2NVX H;  3UE0 A;  2UXB L;  1NMG A;  1EUJ A;  1YJN A;  1A8V A;  1HH2 P;  3I4O A;  3VDY A;  4A3D G;  3L7Z C;  5IYB H;  4R4T A;  3HKZ G;  1XMQ Q;  1PVO A;  1TXY A;  1X54 A;  5IP9 H;  1HR0 L;  1VQJ A;  4LF9 Q;  1I94 Q;  1Y1V G;  4LF6 L;  5IYD H;  2VL6 A;  3PO2 H;  4LFB Q;  1XPU A;  2UU9 Q;  1XNQ Q;  4PZ7 A;  1I94 L;  2NN6 I;  1C7Y A;  4HJ8 A;  3CMA A;  3BU2 A;  4A3G G;  1G29 1;  1JB7 A;  2MO1 A;  1E1T A;  2ALY B;  4UPA A;  4A93 H;  4X6A H;  2OQ0 A;  2WAQ E;  2PI2 A;  1HZ9 A;  5GAG C;  5IP9 G;  1Q86 C;  2GVB A;  4DV4 Q;  4OO1 G;  1SMX A;  5GQO A;  4YWL A;  4HIO A;  1VQ8 A;  1VQ9 A;  1C0A A;  1VQC A;  1WYD A;  2JA9 A;  5IY0 A;  2BA1 A;  4BBS G;  1NTG A;  4C3J H;  2Y0S E;  1X9N A;  3HOW G;  4PZ6 A;  3ER0 A;  2HIX A;  4A93 G;  1Z47 A;  2KCM A;  4HJA A;  3F2D A;  1Y1W G;  1KC8 C;  2F52 A;  5GAH C;  2L15 A;  2VZA A;  4PZ8 A;  4JI1 L;  1FL0 A;  3U4Z A;  1TWF H;  3EN2 A;  2H5X A;  4GOP A;  3NEN A;  4DV6 L;  1EWI A;  1W2B A;  2E2H H;  2CFM A;  2UUC L;  4IPG A;  2HIV A;  4OO1 I;  4YCW A;  4DAY B;  4JI6 L;  3T1Y L;  4JI2 Q;  4NXM L;  1PH7 A;  2LXJ A;  3TQY A;  3GTJ H;  1NMF A;  4ALP A;  4GOP C;  3TS2 A;  3AYH B;  5M5Y H;  3H15 A;  3T1Y Q;  3LGJ A;  1L2F A;  2B63 G;  4IFD G;  3CCV A;  4OWW B;  1W3S A;  3NEL A;  3KF6 A;  4LW1 A;  2VQF L;  3D31 A;  1U5K A;  3CC7 A;  1N33 Q;  1J5E L;  1VQ4 A;  1HNX L;  3OTO L;  4B3S Q;  1IL2 A;  3F2B A;  3KJO A;  3M4P A;  2NVQ H;  5ELO A;  4YY3 Q;  4J15 A;  4MNO A;  4HID A;  1I5F A;  4B3S L;  2JJQ A;  2NVY H;  1HNZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...