2UXDF

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uxdF00
1B64A 2F4VF 2J5AA 4NXNF 4DR4F 4JI6F 4LF4F 1FKAF 4JI1F 1CQMA 4AQYF 4DR2F 4X65F 4B3SF 1XMQF 2UXCF 3OTOF 2UXBF 4KHPF 4DV2F 4DV7F 2UUAF 4DR7F 4X64F 4B3MF 5IWAF 1F60B 1J5EF 1IBMF 4JI2F 2B7CB 1IJFB 2UUCF 4LFAF 1N36F 4DV0F 4DV4F 4DV3F 4LF6F 2KJWA 4DV6F 1IBLF 3ZZPA 3T1HF 1GH8A 2BVZA 4GKJF 4DV1F 4DR5F 3R3TA 4LF8F 1HNZF 4DUYF 4K0KF 4JI5F 2KJVA 1N34F 4JI0F 2UU9F 1HNXF 4B3RF 1N33F 1RISA 5LMUF 4X66F 4JI3F 2E5LF 4LFBF 4DR6F 2B7BB 1G7CB 1IJEB 2VQFF 1XNQF 4JYAF 1IBKF 1XMOF 1N32F 4DUZF 4DR1F 1LOUA 2UUBF 1XNRF 2UXDF 2VQEF 1HNWF 1I94F 4JI4F 4GKKF 4NXMF 4LF7F 4LF5F 2RJZA 4OX9F 5BR8F 4YY3F 1HR0F 4DR3F 4JI7F 4LF9F 4YHHF 5LMNF 2HHHF 1G1XA 4B3TF 2ZM6F 1FJGF 2YY3A 4JI8F 3T1YF 1QJHA 1CQNA 5AJ3F 1VMBA 2BXJA 4JV5F 4DV5F 4LFCF 4X62F
chains in the Genus database with same CATH superfamily
1UVMA 1VC5A 3CJTA 1OIAA 3D3BJ 1ZH5A 3GYNA 3KK1A 3ZFVA 2ASJA 1F0XA 3AD7C 2LCWA 2J6UA 4PYAA 2QLFB 5AE3A 2AKWB 2DR8A 1DHMA 2GAGC 1L3TA 3CULA 2MZJA 5KFFA 2NXUA 2GS8A 4DZ6A 5AJ3J 1H0HB 3BN4A 4FYWB 3HSZA 2QMXA 4FNHA 2OUGA 1KQKA 3OLAA 4JV1A 4QJVA 2MQMA 1S1WA 3N79A 2XMTA 1B0VA 1X0PA 1TZ0A 1HFEL 3NMRA 4P2MA 5AE2A 2RNEA 4DS5A 2GO9A 3QGIA 2LVWA 3VTIA 3M2VA 3KDOA 2WVBA 5HQLA 2V9KA 2YPZA 3EICA 3UD5A 2HNDA 2RSQA 1NJZA 5HI7A 4OHYA 1HNXJ 5KT2A 2RH3A 4M1KA 3PW0A 4USTA 3RJMB 2W25A 1JLGB 2VF3A 1I94J 1U1MA 3DRPB 3DYAB 1RWUA 4IQMA 1M5HA 2DGUA 2LEBA 4OX9J 1Z4UA 4IFYB 1QD1A 1UVKA 4E8UA 3LP2A 1YRTA 1XMBA 2EKNA 1XR6A 2HNYB 1RT4A 1MWYA 4USKA 4KJIA 3H4BA 2LQ9A 2QTWA 1DLOB 3M9MB 2XMWA 3DLEB 4JI4F 1Y5LB 1N36J 1FHTA 4FYXB 2AWZA 2RQCA 3VGUA 1CG2A 3UVJA 3OTEA 3QYYA 1K8AT 2ZOGA 2GVDA 2GX8A 2GMHA 1SQFA 1Q82T 4K0KJ 1CQNA 4ECSA 2V8DA 2HRTA 5RUBA 1WHYA 3PW2A 4NXNF 4YN3B 4CT9A 2WOMB 1RHJB 3DRRB 2HZCA 2C22A 2G1DA 3HSJA 2VICA 3G86A 4ED2A 4TN2A 5ETMA 4HH1A 2WRMA 4M5NA 3K7RA 2FLPA 3M6VA 1K47A 3N5FA 2ASYA 3SQGB 2HFZA 5GAEU 3N4WA 2EBEA 2GQCA 5M2PA 3CDUA 2K2PA 2DXFA 4CO1A 2Z2LA 4DPTA 2GIFA 1R8PA 3FCHA 5DM7Q 1RBLA 2RS8A 4ZP8A 4IRDA 3GCWP 3O6QA 1ZTTA 4AL7A 3EVOA 4LF4J 4V19J 1X5OA 3OW2R 4UQGA 4Y65A 1ZA2B 3GP9A 5A8KB 3C14A 4FKYA 2MB0B 1LWFA 1P27B 4C48A 2VKZG 3PX4A 3W66A 2ZH9A 2U2FA 4DBQA 2OPSA 3HKWA 1RT1B 2HPUA 1HQUB 4KC5A 4FXVA 2K1RA 2EVZA 4ECUA 2W9CA 3PFEA 2E29A 1B64A 2HQIA 1N56A 2HBYB 2GGPB 2E7WA 1N52B 3T9ZA 3FSIA 3D66A 2RF2A 1TMJA 1NPPA 4AXJA 1RWPB 1B70B 2CJXB 1TL5A 3JTOA 1LXNA 4M95A 2NQPA 1SH3A 5D8HB 4C0HA 2A6OA 2EPIA 2ZBCA 4CO2A 3HFVA 2VA2A 1T9UA 3M6UA 5ITHA 3VV2B 4P2XA 3L3CA 2DXDA 3LF0A 1QAXA 2IDEA 4LSNB 1T03A 2A10A 1TUVA 1DY3A 4USWA 2IAJB 2YKMB 2ZH3A 2NPFA 1LKZA 4X4NA 2HWTA 3C46A 3LP0A 1X8DA 4ID5A 4G65A 3FFIB 5K8PA 3TI0A 3VGTA 5I3UB 1HBNA 2J0WA 3FQLA 3NS6A 4YB6A 5IT4A 3WIVA 2HKEA 2VG5A 1WG5A 4NRTA 4MIAA 1KN6A 4MKVA 4K4WA 5M2UA 1TELA 1M5OC 2HHQA 1VHIA 1C0UB 1YZ7A 3AB2B 2YQ1A 4DV2F 4ZVHA 4BWMA 2H4YB 4OIXA 2RU9A 2HYIB 4RW4A 2BUNA 4J9PA 3ENAA 1Q16B 2EK1A 1IKWA 1RWKB 2XLKA 2QMUB 1UCNA 3H0PA 1HI8A 4WBFA 3KYLA 1UJ6A 2AHOB 1RJJA 3KUGA 2PFFB 4NYPA 3HMJG 5LMUF 1BLUA 4Q8EA 1IJEB 1B7YB 4NLWA 2VFUA 1NPRA 4GC7A 2FHOB 1Q5YA 4IH5A 4ZLNA 1FRHA 1HR0F 2LDYA 4C3MA 3J81Y 3TNVA 3I0RB 5GVQA 1PYTA 2MY8A 5GADU 3TEHB 3KJQB 5KFXA 3CD5A 3MTJA 1JKHA 4KHRA 4DPUA 1Q53A 1N33J 4LBPA 3OR2B 3VWSA 2ZITA 3T19A 1KTVA 3HHEA 3DOKB 3C6UA 4K8RA 4DV6F 2LQBA 1SUQA 3T5LA 4DV1F 1EQMA 5B0DA 2CZ4A 2BE9B 3M9OB 4NA1A 2RHQB 1LK7A 1RP5A 4O0NA 4C0OC 3MEGB 1HMVA 1HIYA 4DG1A 2FC9A 1CULB 1OWXA 2D7SA 3SFUA 4DR7J 3BGLA 1RAGB 3TANA 3LWMA 4KPCA 4CH7A 1KD1T 2IM0A 5AT1B 2OI2A 4DR3F 2X1FA 1QUPA 3UW1A 3T41A 2IYGA 4OZ0A 3KG4A 4FS1A 2UU9J 3VZIA 1N4LA 4JV2A 2VZ9A 2E66A 1VLYA 1TKTA 4YDXA 1K0VA 1MLAA 2VBXA 5H9EJ 3MPYA 2F1FA 3M30B 1IKVA 2VQEJ 3BN7A 1XBWA 1M5SA 2Z8QA 4DQQA 4AD6A 2L08A 3KLHB 2HQFA 2EG2A 4ZVQB 2ZD1A 3T1YJ 3PXGa 3JYTB 3QRPA 5DG9A 1CEZA 3P45B 4K5SA 1L3KA 3GV5B 3PNIA 1NM2A 2D3O1 1W7WA 4I67A 2QZ8A 2LP4A 3KLIB 3VAMA 3W8GA 1WDTA 1SIWB 1B0TA 5IT0A 3H25A 3DLLQ 2W1BA 1N88A 4C2MA 1S1VB 4GO7X 4F26A 1I51B 3CC2S 2AMCB 2QL7B 4TYBA 2HQGA 4HTIA 3NNAA 5L39A 1H73A 1KOOA 3R5AA 3R7SB 1T9YA 3TQ1A 4JYAJ 2F63A 2LFVA 4NCGB 1PC4A 3LAKA 4DCJB 1VK3A 1Q81T 4ITSA 4DUZJ 3VAFA 3LGNA 3RB3A 1N0UA 4MT1A 4TQRA 2KFYA 2V8HA 2KB2A 3BGRB 3UDVA 2HHHJ 3GFZA 4ZLLA 5JVGQ 1MMDA 4NLYA 3V81B 2ILZA 3K57A 3MF5A 5A6WA 4DFPA 2HHXA 4U8VA 3QAEA 4A8SA 5CQGA 4EO8A 3EZOA 2NUHA 2WSCC 2JC0A 4DCPB 3HD1A 4UQTA 2H5EA 2XSJB 1X60A 1P1TA 1C4CA 3H5UA 4TKTA 2AYEA 4QBUA 4NYZA 2CFXA 4DV0J 5F8IA 2HVHA 4LF6J 4WIQA 5CYJA 1JLEB 2ZH8A 1XR7A 2F4FA 1AXQA 2XWYA 4DPWA 3RZAA 3OSPA 1JLGA 1NXIA 4EBDA 3LUYA 1U1KA 1CJVB 5E3AA 3CJ4A 3DRPA 3DYAA 2MHNA 2XG8A 4IH7A 3UWTA 1CQMA 1LFWA 4X66J 2YKAA 1X5PA 4A4JA 2Q79A 1PJ7A 3I55S 4IFYA 3U7JA 1L5UA 1RWNB 2ERRA 2VIHA 2HNYA 2KG1A 4LR8A 4ZCIA 2BJEA 1TAQA 1QE1B 4DL0C 5K20B 3KOAA 3D28A 1DLOA 5T14A 5HO4A 5L1JA 1U0SA 3AXMA 1WHXA 2DB1A 1R0AB 2JVRA 3IO1A 4CLWA 1SKWA 2ZC3A 2NYHA 4HDHA 2WCXA 4LRCA 3G82B 2B9YA 3PJWA 3IXQA 4HI2A 5A76A 2WOMA 3DRRA 4ILLA 1HD1A 4WYWA 3Q8PB 3OR1A 3CDAA 3HPOA 5B0FA 2BEFA 2YY3A 3U27A 4N8NA 4BWJA 4OJHA 3FBFA 3MUTP 3CC7S 4GVBA 3HCXA 4EBEA 1RBAA 1QAJA 4ZN1A 3H5SA 4TVAB 1RT7B 3SQGA 3W2VB 5HJYA 4TYAA 3BGUA 2JWNA 1OJ4A 1MMNA 3KG1A 1IKYB 4MTPA 5LJ5Y 2N82B 4KGZB 1YX2A 4U7UK 4B9VA 1FD8A 5F0WA 5EHHA 5D0HA 4IR1A 1VK8A 5EX3A 4DHVA 4J9QA 1PC5A 2FGCA 3N6MA 2CPXA 4NPOA 2XLIA 3SV3A 4X4VA 1RT1A 1HQUA 1XMQJ 2R9LA 4DV7J 3TX8A 4LBHA 3OT9A 3W1YC 3UR0A 1WF1A 2XNRA 3J80Y 2DH9A 3MEDB 2GGPA 5HATA 2HK2A 5AXMA 4NLQA 2Y8WA 4F50A 4WJBA 4DR5J 3GJSB 1S0OA 1JXVA 4K2XA 3I9ZA 4C3KA 1N6QB 2WZ1A 1SPBP 1SB6A 4FPIA 1SJRA 4WU3A 5CH7B 3K8WA 4X65F 8AT1B 4R25A 1KVIA 3OV7A 3CPWR 3HZGA 1SIZA 3BO3A 1RTZA 1Y3KA 3U02A 2HAIA 2COLA 3GMGA 2DR7A 4P72A 3QQCD 1KDNA 3PHTA 2R8KA 2DHSA 4O44A 5CHCB 4RU9A 4C8OA 1IR2A 2CQPA 4LSNA 4LSLB 2IAJA 2YKMA 3MPDA 4I2QB 4LFBF 1VOMA 1RQ0A 2A3JA 5GAHI 1VI7A 4KGMA 5L1LA 2P9GA 1XMOF 4J9UE 3RRKA 5I3UA 3RBXA 3D7SB 2GIQA 1JJ2R 1RACB 2H9ZA 2FJDB 5C24B 1HI1A 4KIAA 4HACB 1NDLA 1AA1B 4ECYA 1C0UA 1NJIT 2NXEA 1U45A 2J8AA 2Z57B 1N5SA 1QVGR 4DZDA 4JV5F 4OHWA 2DY1A 4PG8A 2ASLA 1C2PA 2WHOA 2K7JA 5KT7A 2E1PA 1LWEB 2QA4S 2C3MA 3NXZA 5I42B 5H9FK 2RT3A 2XI3A 2ZHBA 4R5PB 1KOHA 2I9SA 2Z30B 2Z2MA 4DR1J 4F04B 4H4OB 1A0OB 1A7GE 4P71A 1U1PA 1RWXB 3RW6A 4LF7J 2CJQA 3CGIA 4Q5VA 4J5OA 4KPYA 3VAKA 2MQOA 1XN9A 1D9AA 4DUYF 5HANA 1TKZB 5BYSA 2KM8B 1S49A 4O3OA 4JI0F 1ZPVA 1NKEA 2HGNA 1FJ7A 3M8ZA 4H4KC 4DQRA 2V4RA 4C8LA 3HT0A 3I0RA 3B4DA 1M0SA 2BRLA 4RUCA 5E3RA 1BQXA 1NZAA 3O3LA 2UUAJ 1DURA 2UXDF 4QCLA 3DM2B 1FKPA 3NLCA 1OPZA 1M5VC 5KFSA 1RU2A 2H3EB 1VDHA 4CWBA 3OR2A 5B0BA 2JRSA 3BSOA 1ZAWA 3I9V9 3DOKA 5MAOA 1J2VA 2CQ1A 1MG7A 4TY8B 3ULHA 2DNLA 2CNNB 2HBZB 1R8CA 3F0NA 3BDEA 2YH0A 1RKJA 1QAIA 2FUG9 5F9LA 1HA1A 4CH0S 5K8MA 1ITPA 2BA9A 1WI8A 3EX7B 3KK2B 1OY6A 2Z56B 5FLXU 5A2QY 2GVZB 3MEGA 4DV4F 3D6MB 3CJKB 1WC4A 1JXEA 1R8BA 5L1IA 1CULA 4IFVB 1R6VA 4LRAA 1Z2LA 3H2LA 2VFRA 1XC9A 3KK3B 2R7XA 3UNYA 2V2KA 1EZZB 4MMOA 1RHKB 3M6XA 3HVRA 1S79A 3KJNB 2VPYB 3TUJC 1K73T 3OTOJ 1PCAA 3TWZA 2PI5A 2IMOA 2HHPA 2DR5A 2F9JA 3TQEA 2DISA 1WF0A 2MQQA 4ZP6A 1KVJA 2HQ3A 3DDIA 3LO3A 4BS2A 3M2RB 3J7YI 3M1VB 1NEEA 2E5JA 4PAAA 5C2CA 3M30A 2DGWA 5LOQA 5CYQB 1HQEB 1KTQA 3G71S 5DJBA 5F41A 1PBAA 4F0HA 3KLHA 3OVSA 1YBTA 3JYTA 5KT3A 2OAUA 1WG4A 2ZUGA 1WKJA 1BD6A 3W9HA 3NOGA 2FLNA 4LRBA 1R0CB 2M7SA 3DLGB 2G2OA 2Z4PA 1NHVA 3D68A 1YJ7A 2XMMA 3KLIA 3OL8A 4I0WA 3M2UA 3VF0B 4ZITA 3B78A 2D9PA 4K4XA 4DSEA 2O01C 1Q0NA 2HLTA 5MLCV 1RGVA 3R7BB 4JI1J 4DQIA 1S1VA 3T9NA 2MXYA 3HHLB 1N32F 2GQ2A 2I8EA 4PG4A 4IQXA 3BSCA 2MEWA 4F3OA 2DPIA 2XS5A 2B4VA 4YHHF 4OQJA 4NCGA 2B5JB 1RTHB 4NLSA 2CQ0A 2GJ2A 1VMBA 2QYCA 2CPIA 2F4VF 1BUXA 2VG6B 1B4SA 1RT6B 4DFJA 1IWAA 2PMHA 3PO5A 3NNCA 3BGRA 2ZH7A 1PIEA 3S1TA 5I3QA 4E98A 3V81A 1W25A 3T6JA 1RAIB 4DL5A 2MYFA 4KQZA 2G0IA 3TW0A 4C8KA 4J9SA 1VQNS 1CS4B 2CJBA 4RUHA 3AQPA 1YK9A 2FVRA 2DR6A 4LF9J 1SQEA 4CLYA 5ETKA 3SCIE 3HJFA 2XSJA 4ZN3A 5KG4A 4DV5J 2BBEA 2HAFA 1JLEA 3EMTA 4ZK7M 1C1CB 2HEKA 1S77D 1URNA 3RRHA 1XIQA 2FVSA 2OMOA 5DDPC 1NHUA 2NXCA 1CJVA 1F9FA 4WE1B 4A8QA 2EC2A 4NEYA 2PC6A 2C3YA 1TL1B 3QFWA 1NKBA 2YTCA 4N77A 4X62F 2DHAA 4OYZA 3IR6B 5ADZA 1QE1A 2HS4A 4ER8A 1WUUA 2CJYB 3RYLA 1KVKA 2UXBF 3C6TB 2C2MB 3JB9k 8ATCB 3I56S 5DZ6A 3UI3A 3MZIA 1R0AA 5JMNA 1HNWJ 4GKKJ 2VJUA 2Y9HA 4OL8A 3ZZPA 1GEHA 2GHWA 1CSJA 2B9XA 1SJ3P 2ATCB 3G82A 5E3QA 2HRUA 4OI2A 4YB1P 3A3OB 1UETA 3O8WA 3CCMS 1KLNA 1FXDA 3A8IA 3CCVS 1TFWA 1TQLA 1Y11A 4UOGA 5HSPA 1TV6B 5KTQA 4OI3A 4MKAA 3Q8YA 2CDQA 1RCOB 5DLGA 1WTFA 3N01A 4KE5A 2UVVA 4F3QA 3I32A 3MR5A 1RT7A 3ISNC 5DZ7A 1VGYA 2B4PA 4OLPA 4CLKA 3W2VA 2X51A 2L41A 1WTBA 2RQKA 4E0DA 5KT4A 2D3OR 2KRRA 5AJ3F 1IKYA 1T02A 5CA5A 3G4SS 1BGXT 1DTTB 4ZVRB 4YFUA 2ZOMA 4DXLA 2M52A 1YZ6A 4QW9A 1UJ4A 2NSBA 2BM1A 2DCLA 2R4FA 1XNQJ 3JTNA 5FJ4A 3BSAA 2YWGA 2OIHA 5GAEI 4DPXA 5LL6d 3W3SA 3DRYA 4RR5A 2HRYA 4YR0A 4MH8A 3GQCA 1RAFB 3QJPA 4RW8B 3UD3P 4YUDA 2J9DA 2E44A 4ZVEA 4ELVA 1T8EA 1NPKA 1FJGJ 3DGPB 3GONA 2HWHA 2KXNB 1HNXF 1VJQA 5L46A 4MIWA 3MEDA 1WEZA 2YX4A 3IMQJ 3CCUS 3QT8A 5D4NA 3CDWA 4F0KA 3RR8A 1N6QA 3E8OA 4H4KA 1MN9A 4DQSA 2I0XA 2BRKA 1I94F 3CJQA 5CZXA 4PCQA 2K7KA 1AYEA 6AT1B 4OX9F 2Z0GA 1T0TV 3EXCX 3V6DB 2CQ4A 2WONB 4IH6A 2CIMA 4O4GB 5IT9Y 4C98A 2BV3A 3CF5Q 2ACYA 1U6ZA 1TAUA 2Y1LB 3CNQP 1FRXA 3CJ8A 2KVIA 2UVRA 3D54A 3RAQA 4LR9A 2UP1A 1OO0B 3L95X 1O5JA 3QMQA 1SL1A 2AX1A 2PE8A 3PR5B 4LSLA 2F8EX 1GK8A 1N36F 2HFUA 2YWWA 4I2QA 2MQ8A 1H74A 2EFVA 2GIRA 3H40A 5F0UA 1F2HA 3GIMA 4RZRA 2MSTA 4B08A 5A8RA 2HIYA 4K0KF 1FWPA 3FEZA 2EFPA 1S6PA 3W63A 4ZPDA 2AJ1A 3GJRB 1WD6A 3CSKA 5C24A 4HACA 2CQHA 3NEKA 4GO5X 1HQ2A 1V3SA 3X1LB 2KU7A 1WORA 1RXOB 3NMAA 2DD8S 1VQ5S 1T7PA 2B4UA 1REVA 4FF3A 5DG7A 5EWFA 2VH7A 4DV3J 1D8ZA 3DLHA 3WIUA 3AHPA 5I42A 4KV8B 4R5PA 3VAIA 3ENQA 1KWMA 2R7WA 3AOCA 4H4OA 1URRA 3UE2A 2JZ5A 2IM1A 4PUOB 4LF4F 3I82A 4CLFA 5F8MA 2CKWA 4DOZA 2OSRA 3LOUA 5CCMA 1RLDA 1G4CA 1TKZA 1GXTA 3H90A 3K5OA 2XGPA 1HHSA 3D5MA 2RU3A 2Y1RI 2NS1B 2XSFA 3CMES 3BB5A 5K5MA 2CYYA 2HLUA 4NZ0A 4ZIVA 1YJVA 2APOA 5HN0A 2XBPA 1GFWB 4OYXA 3DM2A 3KHLA 3HI9A 1SV5B 2CWXA 2EC0A 1S57A 2W2OP 4U6PA 2FHJA 4WP9A 1T9VA 2KXFA 4UTGA 5IM0B 1H2UX 3JAMU 2ZM6J 1WWHA 2BJ9A 4TY8A 2EW9A 2YWEA 5GADI 3ZZUA 4N41A 4JV0A 4ERDA 2ZBRA 3OFGA 2WSEC 2BM0A 2HG4A 3KK2A 4LF8J 2XZTB 3TJ9A 1U49A 2GVZA 1TU0B 5HVHA 2W2PP 4C9DA 3CJKA 1UWAA 3FVYA 2BYCA 2HBQB 3BYRA 1Q7LB 4EFAC 4IFVA 4XDDA 3DLJA 2V8GA 4M5MA 3KK3A 1X9SA 2CVEA 3K89A 2UUCF 2Q6BA 4RBVA 1UAWA 1FDDA 3RBEA 2HZAA 2FD2A 1FERA 2BJ1A 1BXNA 1IQZA 2E1MC 3ITHB 2D3ZA 3M32B 2OPQB 3M2RA 4QYZK 4DF4A 3M1VA 3U1LA 2M8HA 2HMIB 1HBUB 5A8WB 4QIGA 1TUWA 4ED6A 1HQEA 2VPWB 2XCPA 3W61A 3V4MA 4QR2A 4OZ2A 1SC1B 1D9DA 1VIXA 3RB0A 2BQRA 5KG7A 2SXLA 3BDPA 2D1CA 2VOOA 3AT1B 3HHDA 4ZVOB 3ZO7A 3DLGA 1KQGB 3FSXA 4U7CA 4RJVA 1NDPA 4CP5A 1FEHA 3PRDA 3N6NA 3QT6A 1D0EA 4OFZA 3UDLA 3BZQA 1XNRJ 3A3PB 1YQHA 2AJFE 3UNGC 1DQ9A 4DX5A 3HHLA 4X84A 1C1BB 2M8DB 2HBRB 1N33F 5CD4A 4ES1A 1TK8A 1JLQB 5HVFA 2B5JA 4X4QA 3IWXA 1RTHA 5DDQC 3SSSA 3DGVA 1RT5B 3AFGA 5F8HA 1NSPA 4NMLA 3M8PB 4W98A 1WF2A 2UV8G 2VG6A 4UOFA 1RT6A 2RDDA 1LXJA 3M8YA 3K17A 3H59A 3H5XA 3L7OA 3TVYA 2J7WA 4YEAA 4QR0A 3ZTRA 2F8MA 2ZUAA 5AXNA 2YNGB 1CS4A 3KLGB 4WF9Q 1RT2B 3GFXA 3NNHA 2BE2B 3KJVB 2VQFJ 2CJ9A 2DNQA 2CJKA 5LT5A 4DR7F 1FVSA 4ZVFA 1OY9A 2O67A 3BBBA 2BMBA 2FY8A 5ETLA 4Q7AA 4WTYA 3AA8A 4CO3A 3IRXB 1C1CA 4NOHA 1RZMA 2N7YA 3KTQA 2V50A 2MGZB 3IM9A 4WE1A 2RRNA 3HXMA 2UU9F 5KG2A 4B9MA 1NLKL 5CXTA 3B6BA 3ETOA 1TFYA 1TL1A 5DGBA 3RGIA 2FY1A 2JSXA 1YG0A 4RW7B 2VQEF 3NGDA 1X4DA 3R6GB 4NLOA 3QGPA 2YNHB 3SFGA 1SC3B 2QLJB 1QVFR 3C6TA 1EARA 5T41A 3T1YF 3I5CA 3PJ9A 5DQGA 4ETXA 4R0JA 4C11B 1CVJA 3FBCA 2YNIB 4UZCA 3N0VA 4PYDA 2Q43A 3DN9A 1U8SA 2MZTA 1KRPA 4K4YA 1KR4A 1TV6A 2YKPA 1XEZA 5HAOA 2MQPA 3ELHA 1ZTWA 3CE8A 1DAXA 4YQWA 5J2NA 1QUVA 1HW9A 4ZS6A 3HVWA 2XMUA 3MD1A 5KAKA 4FXWA 2AX0A 2MDAA 1ELOA 1UVJA 1GXUA 4DN0A 4J9MA 4JYAF 1U48A 3IGVA 3QLHB 4RBTA 4DUZF 5HMXA 5BJRA 4TNOA 2V4JB 1DTTA 1KHWA 1U2RA 4C8MA 2Y3YA 3K58A 2PA8D 4UUXA 2CQBA 3BF4A 4TU8A 3M8WA 4ES3A 2HHHF 3TAPA 2BKPA 4CI0B 1U4BA 3NGSA 2YNFB 2FDNA 2MZ1A 2L9WA 4XPEA 2XB2D 3MI7X 3VVUA 4B3RJ 4RW8A 2D41A 1WDDA 4MJKA 4NLXA 3DGPA 1FKOB 2HIQA 3CD7A 4DV0F 3DI6B 4LF6F 1WSRA 3DKDA 2Y8YA 1EAYC 2KT3A 3G6YA 7AT1B 1ZAVA 4WXWA 1IKXB 1QAYA 4I1TA 4F36A 1NK4A 3BH7B 3IS9B 1YHQS 3KNGA 1RTJB 4URQU 5GAHU 4X66F 1AUDA 4JI3F 2RRAA 3DCAA 2QL5B 4ZKAA 4OLOA 3V6DA 2ZH2A 2GMLA 2WONA 2O5DA 4O4GA 1P6TA 1E6VB 3T1AA 5ETOA 1T9TA 3P8BB 4OHZA 4CM0A 2JNJA 3P96A 3R2DJ 5KFRA 5KFPA 4ELUA 2A18A 3N5BA 3LPEA 1S12A 5BYRA 4N5SA 3GU0A 2GAHC 2WBRA 3GYGA 1U8WA 2RUSA 1IM4A 4HDGA 4K5RA 1XWLA 3MMAB 1U0HA 2C2OB 4IG3B 2C2KB 1NNDA 1YIJS 1FFGB 1RE1B 2MLZA 2V2QA 3HK2A 3IP0A 2HVDA 3QWUA 4HI1A 3RU0A 3ILOA 2ZZNA 2PGCA 2WBMA 3QIPB 2M9KA 1T95A 3MR6A 3JQMA 2NUUG 3D6FB 2JEFA 4RLEA 1UA0A 3BBCA 1UZHA 1YITS 1NRKA 2E9TA 4Q8FA 3OBIA 4NCBA 4ZOSA 3KHGA 2MLYA 4NLUA 1Q5VA 5EGYA 1N8RT 3S8SA 2GQQA 4KV8A 4J37A 3A1YG 2P6TA 4CNZA 3EDRB 1NB7A 2QFJA 2YBVA 4Z2XA 2CQGA 4PUOA 2PI4A 4USUA 2CXEA 3MMCB 2DR9A 2IY5B 3R5CA 2IPOB 1DQAA 5ETNA 4LRFA 3RB6A 3MUVP 1X4HA 2GCFA 3MHYA 2XTJP 5G0RA 2QA1A 3BPDA 1S1XA 2ZBIA 1XMQF 1LW0B 2PMWA 4DV7F 3IM8A 1FNMA 4WXOA 1SV5A 2M70A 2HK3A 4DDFA 1O51A 1ZM3A 2RRBA 3MM6B 5IM0A 4DR5F 3BS9A 2VDHA 1EJ7L 4OJ3A 2P5VA 3R8YA 1GMWD 5HP1B 1NAQA 1VJWA 2QYGA 4KO0B 3THTA 4NASA 3R5DA 4DR6F 4FVCA 4C8ZA 2CVIA 5C2GA 2C3PA 5KT6A 1W2IA 2IRYA 4X64J 1RT3B 2IVMA 4ZP9A 3J7YU 3VGVA 3MCMA 3D0HE 4NZ7A 3MR3A 4OZ3A 4P6QA 4QQBA 2L9NA 3GFYA 4QYRA 1MU2B 3ILJA 2OD6A 1D8YA 2BXJA 4B9UA 2CQIA 1GTHA 3ZNJ1 2GNKA 2B4OA 4WFNQ 5DM6Q 3PW4A 3EVWA 4LVOP 1RWOB 1RKIA 2CZ9A 1V3ZA 5E2QA 2DNZA 3ITHA 1M1HA 3M32A 2OPQA 2Y1IA 2AJ0A 4M5GA 4RO0A 5KFIA 3PV8A 2L9DA 4CDIA 3ZZZA 5L9NA 3M8SA 2HMIA 3CUNA 1HBUA 3CCSS 5A8WA 4OYPA 4ED7A 5AE1A 5EN1A 4G6VB 1QDUB 4JI8J 2YX1A 4DX8H 1UVNA 2FGOA 3OJUA 3VAGA 4WTOB 1Q95G 3AOAA 2C2EA 4OYMA 5B7WA 4F4YA 4DR1F 4EWTA 2B6AA 5J2QB 5B0GA 3ONQA 4YR2A 2CNKB 4NYOA 4LF7F 5D0RA 2DNRA 3UN5A 4I69A 2D9OA 4I2PB 2BJDA 1OPIA 2D69A 3UCZP 4QWCA 1XQIA 4F2RA 3EGVA 2F8HA 4I56A 2R8JA 3CJ3A 1C4AA 4X4RA 2W2MP 4ZCMA 3TAMB 3QT5A 4U96A 5IQQA 2UUAF 3FSYA 2AJQA 3M05A 3CO9A 1JLQA 1BQMB 3A8EA 1EQ0A 3HVAA 4KGKA 7FD1A 1RT5A 4QZVB 4DL7A 3PACA 2RDJA 4KRWA 3CJSA 4PQAA 3BM7A 3AJ1A 3WQPA 5B0EA 2R2RA 2CPHA 3R5JB 5E3PA 3GTYX 2UVWA 2IA0A 2B8PA 1H72C 2VDIA 4ES2A 4JUZA 3KLVA 1B0PA 5JJBA 2HHWA 2ROGA 2CQCA 2YNGA 3KLGA 4ZHRA 2EBGA 4LFAJ 2BKNA 1RT2A 2CJAA 1L3VA 1M90T 3DRSB 2BE2A 3KJVA 2FJVA 2JDJA 3BR8A 2YKNB 1KNZA 3HDSA 3PHEA 2ADBA 3W64A 2F65A 5KG3A 4B3OB 4IOAQ 1FK9B 3WDOA 2KT2A 2GO8A 2BJ8A 3IRXA 3GG1A 1FT8A 1T3NA 1P9YA 4GVLA 1UVLA 4Y28C 2IM2A 4TQSA 2B9WA 3OTOF 2JHEA 2MGZA 4Q2LA 2QC3A 2WVDA 4FZVA 1SC4B 3CMAS 3VCDA 1RUSA 1SH2A 1R7IA 3W9IA 4XPCA 5DG8A 1Q7YT 2E1AA 1Q1KA 1O6XA 1SC6A 2ZH5A 1MW7A 3CJRA 2ZBQA 1R8HA 1SVDA 1H38A 2DO0A 4RW7A 1JLBB 1RHMB 2YNHA 4DMZA 4JI6J 5HROB 4JP8A 2K3IA 3J7AN 1VRUB 1R31A 3GILA 3PYEA 4QOTA 1X4BA 3CCES 2YNIA 1U7LA 2LA4A 4P9SA 2DNNA 4PKDB 1HBOB 1TKXB 2WTFA 1KBRA 2RIJA 2XMVA 1GMVA 1RDRA 3WC0A 2HQCA 2LKZA 3SIPB 1HHTP 2R7UA 2QLXA 1BQNB 1SJFA 1FKAF 4JI1F 4ANCA 4ANEA 1WI6A 2A2DA 1EB0A 1ZBTA 1U1RA 2KT5A 3W2WB 1VLOA 2VV5A 3UN2A 1PYSB 3UN3A 1K1SA 3AODA 4A8YA 4PR6A 4U8YA 3W9JA 1DARA 3FCVA 3LW5C 3PY8A 3WZ0A 4KT0C 1S9EB 5IQ6A 4YY3J 3QLHA 2XYGB 2J9CA 4LF1A 4EU0A 4OZ1A 2E9ZA 1S7HA 4A8KA 1WOPA 2DITA 1WKLA 4DCOB 2FJEB 3RB4A 3Q8SB 4YR3A 3KXDA 2PT0A 4O0IA 1VQ7S 1TMMA 1OS5A 2YNFA 2EK6A 3QRQA 2KO1A 4OYOA 2CPEA 2C3UA 2HFNA 4RU2A 2Q1LA 1UWBB 4NLVA 1BWEA 3FKBA 2FHMA 4DS4A 4LF9F 1PAUB 1CJTB 2VHGA 1UFLA 4DL6A 1FKOA 2XGQA 3GE9A 4KH0B 4L75A 3OVBA 4DV5F 2ZH1A 2GHVC 3DI6A 1VFJA 2F5GA 3QBCA 3FZBA 2ZDPA 2XWXA 1U02A 2WSFC 3G87A 1R43A 2XYPB 3W65A 4Y3CA 3IWNC 1OYEA 1FEEA 1F9EB 3IS9A 4C4WA 1PG5B 1S97A 5ETRA 1RTJA 3H98A 9ATCB 4MYUA 4Y2AA 3IC1A 4NZ6A 4PZVA 2KFZA 4Y2IA 3Q8VA 3UCGA 2NR0A 1Y9OA 2X3DA 1HWIA 1P1LA 2P9EA 1ZZFA 4AYBD 3MFHA 3BV8A 2ZWPA 2I6WA 3IR5B 2QA4G 2H65B 2DKOB 4DSLA 4F4AA 2V69A 3IRWP 5H9FJ 5KG6A 3LAMA 1HNWF 4GKKF 4QWBA 2OMLA 1RLCL 1LFPA 4QIEA 3W62A 2AIRB 2YX7A 4KGVB 4IG3A 3D1QA 3ZZ0A 1IBLJ 4X4PA 4B9LA 4GKJJ 2Q66A 2B3TB 3M9NB 3FUYA 3FQKA 2MKKA 4L6V3 5IFMA 3QIPA 1SL2A 2W7PA 3KUEA 5IC6B 3EM1A 4OX8A 4P74A 2BW2A 2BQ3A 3D1OA 3BO2A 5FIIA 2WAQD 4IR9A 3PIOQ 2UUTA 1QY7A 3F56A 3N6LA 2XO7A 4FF2A 4ILMA 1D1UA 2BW7A 2KRBA 1VQ8S 4DSKA 3EE3A 2AZ3A 1FTRA 1ZM9A 2HNDB 3FRYA 2XHWA 1RI7A 2MQNA 2XZWA 3MMCA 1FJCA 2OLWA 3NOCA 1XNQF 3I31A 2JOQA 1DJ0A 1R27B 3OXLA 2QA2A 4ZCLA 4EYHB 1MWZA 3CIMA 5BYQA 2IRXA 1TTHB 3ENWA 3N9UC 2FZKB 4W90B 1LW0A 4OYBA 4QWDA 1FJGF 3OFEA 4WFAQ 3J81U 3JSBA 3TP2A 1NJYA 4LIWA 3LANA 2VG7B 4M5LA 2R7QA 3MURP 2QRRA 2H1YA 1NJWA 6FD1A 1WACA 5F3ZA 4XK8C 4ZPBA 3DNCA 2DNYA 5AXLA 4UOHA 5L9XA 1B3TA 3K5LA 2VASA 3MM7A 4A8MP 5IZHA 2HVEA 3O2IA 1U6FA 4G1QB 5HP1A 4KO0A 1GT8A 4EI2A 4PXBA 3KWMA 4X2BA 2ABYA 2DK2A 3MEKA 2DHHA 2ZKUA 2FPHX 4Y2MA 1RT3A 1SKSA 5K14B 3TZWA 2A1BA 4HHJA 5D15A 4K4UA 1PYOB 4V19X 4Q0BB 3TARA 2VOPA 3MAHA 4DX7A 3I87A 2R8HA 2LQJA 2BR0A 4JB8B 1MU2A 1EP4B 2MKCA 4KR0B 2FJXA 3T5HA 3EVMA 2RILA 4CM2A 4HYKA 3DXBA 4NI2B 4ECZA 1VCTA 1ROFA 4HR2A 3HFKA 2R42A 3NG8A 3PO4A 2ZHOA 3K5NA 5C42B 1Y00A 4DQPA 1EX8A 5KFUA 4OI4A 4RBUA 1VYAA 3MOZA 4J9LA 3M8RA 4NX9A 1EETB 3GLJA 1Q86T 2J0XA 1UFWA 4G1PA 5F8GA 1GQEA 3HO1A 4L74A 2V5HG 5CD4H 4DV3F 1R8AA 2DJWA 4U95A 3FJ2A 3PR4A 3VAHA 4A8OA 1VQMS 3E2EA 4NLPA 2JLFA 3MWBA 1IM6A 3CCRS 3CCZA 4DLEA 3NCQA 1NDKA 3RAMA 1X4GA 3AD8C 4WFYA 3C3LA 2ZVIA 3IWLA 2W9CB 2J9DE 3BKTA 2VODA 4I2PA 3TO8A 1VHFA 3MMBB 2MHEA 3LTOA 2FJBB 4FPRA 2FYXA 3TUIC 1U6BA 3CEDA 1T05B 1LOUA 1Q4RA 2WVEA 5G4DA 2QSWA 3F73A 2RVJA 3SCLE 1BY9A 3TAMA 1RU1A 3QSYB 4QPXA 3Q8UA 5J2PB 4ECXA 3GJTB 3CCJS 2N4CA 2BOPA 2CADA 3UQSA 1BQMA 4NL5A 2CPZA 3QJJA 1R3NA 1LWXA 4KB7A 1K0TA 1S9GB 2AQ4A 4BBYA 2KFNA 4M5IA 1FRMA 4FF4A 1KC8T 1WOSA 1KQFB 3SCJE 4DF8A 2DHXA 1NO8A 2PO4A 4LQ9A 1KQSR 1YRUA 4LF8F 4CQ1A 1F2GA 2HW3A 4WPAA 5J2MB 2OJ3A 3DLBA 1PSDA 1O8BA 3LALA 4UF4A 4AL6A 4DSIA 3PX0A 3NWGA 4PXEA 3CJ5A 2YKNA 2HGLA 4H54A 4B02A 1S1UB 4B3OA 4PEOA 1FK9A 2XO6A 3NGRA 2LXIA 4LR7A 2BX6A 4JI7F 2ZJQQ 1NMEB 5KFVA 4EGLA 2G2ZA 3BO4A 2UVUA 2DNKA 1BC6A 2EXUA 2WB4A 3AOBA 1N34J 1Q8KA 3LPYA 4NE9C 5LSRA 1RAJA 5KOWA 4ECVA 3PJXA 3H7HB 4NLTA 4USIA 1UA1A 2YWHA 2VBZA 1JLBA 3DLEA 3QIDA 5J1EB 2OD4A 1RA7A 1U2CA 5HROA 3PTWA 1UVIA 1U1LA 1VRUA 1BWVA 4PWUA 3JQKA 4O3RA 3J7Z5 3F44A 1L3SA 4O3QA 3TJAA 2KJVA 2RD5C 3EGWB 2X7IA 1GXLA 3FMWA 1TK0A 1HBOA 2W9AA 1TKXA 3W60A 1FA0A 1PBUA 3QZ7A 5KFEA 4AQYJ 3TVZA 3ETMA 1NK6A 3GV7B 5L1KA 1FDBA 2AT1B 4HHHA 4A47A 2R2UA 2QT7A 5I4MA 4B3MJ 1XNRF 4Z37A 1H7XA 2V6AA 1BQNA 5HL7Q 3CO0P 1VIOA 3NAHA 4FBUA 1FD2A 3W2WA 2HHVA 1VQOS 5LJ3Y 3RW7A 2OPPB 3Q22A 3BBFA 5E41A 3IBWA 3ZZOA 3I96A 2O3DA 1MN7A 1V9OA 3VALA 2EWHA 1S9EA 5A8KA 2N4DA 2JEGA 4DG1B 2OFHX 2FJAB 5KFTA 3OUYB 4ECQA 4X4SA 2LU1A 4A46A 2RS2A 4UY85 2KJWA 3H8YA 2FQQB 3GYXB 2YVSA 1WC6A 1MWQA 1U1QA 4NLGA 2OELA 3ZTOA 2ZH4A 4CLSA 1UWBA 5KFYA 2WK4A 4ALZA 4IRKA 2VQFF 1PAEX 1CJTA 5ETQA 2JX2A 2VPXB 1ZPWX 1TUGB 4WWSA 2IDLA 4C7QA 1DQ8A 3HJVA 1U25A 1E6YB 4DI6A 3B8HA 1JJCB 5JXSA 3D6HB 3NY0A 1QM9A 1WJ9A 3J80U 4ZPTR 2WB1D 3JSMB 2M4MA 4JI5J 3KDNA 2V0NA 1T11A 2KH9A 4F25A 1X5TA 3KMQA 4OJGA 3GSIA 1RHUB 5DETA 1X9WA 1Q78A 2BOAA 1VQYA 3W7BA 5D3GB 2K8GA 4ZPCA 4KFBB 2GMJA 2OP5A 1UEUA 2P6SA 2IVFB 4NXMJ 2HZVA 1SCJB 2G1HA 5DDRC 3FFIA 3L7UA 1X31C 4LQ3A 3H20A 5KG5A 2V68A 2LA6A 2Y1JA 4L76A 4USMA 3K8VA 2LMIA 3I6PA 5DQIA 2EFQA 2IFXA 4MIBA 4WZQA 4KY3A 2DNMA 1ZM2A 5HBMB 3IA0A 4BHQA 2C2RA 3TOQA 1RAAB 1J5EJ 4KSEB 2U1AA 1FRKA 2MKJA 3EYZA 2B51A 2KHDA 2X1GA 3MM9B 1O0PA 3MPUB 3PVXA 1VISA 2VBYA 3V6JA 3L4BC 2A0FB 3PZPA 3OPKA 2E9RX 4AT1B 2B43A 1N5TA 2R8IA 4IO9Q 2J0QD 1RWWB 1T9XA 2K06A 1A9NB 2UUBJ 1VR6A 3DOMB 3KHRA 2QMWA 1IN0A 1J5OB 2F7VA 5ETVA 4G1IA 4DPOA 1Z2ZA 2ZBPA 2DIVA 2DEIA 3D3CJ 2W7OA 2LQ5A 1CJKB 1FF2A 4B3RF 3G6ES 2E5LF 3G6VA 3MGJA 2B7BB 1RAEB 2X1AA 4LMZA 1F5AA 3Q8RB 4BC7A 5KFJA 4C97A 4L72B 4A48A 4M8LA 1TVRB 5E7OB 2Q6CA 1YVFA 2MJUA 2VG7A 2FTRA 1S1TB 5BR8F 1FXRA 1XTZA 2EFGA 2O66A 3R6LB 3TZXA 3JTPA 2Y0SD 2AW0A 4IO1A 2YKQA 1H6KX 2ROEA 4NA2A 4URSA 4G1QA 4OV1A 3UPFA 1Q8IA 3OLBA 3QPIA 3CMQA 3FZ2A 1I1GA 3T5JA 4K4ZA 3EUNA 3HSDA 3H2VE 5D0GA 3RRGA 4CCHA 2P9CA 4NLRA 4QYZJ 1IBKJ 5THWA 5K14A 4B9TA 4Q0BA 1IJFB 2PN6A 5A2QU 4BCAA 3V6HA 4OV6A 3DC2A 4IOCQ 5F8NA 1EP4A 1HARA 3OR1B 4L3KA 2DYAA 4WFZA 2BKOA 2VKRA 1VRTB 2JL9A 3ZC4A 4M5JA 3ZTQA 3TR5A 2AGQA 4GVBB 4NI2A 1UFKA 2XZDB 4NEZA 3CJ2A 4NA3A 2JEJA 4C3LA 1HNVB 5C42A 2H5JB 1AZSB 4RWWA 2N3LA 3PCOB 1IBMJ 3UD4P 2RJZA 2HSEB 2IA6A 1U09A 1EETA 1S76D 3D9BA 1FRLA 3CJ0A 3OL6A 1UPMB 1YJRA 1NBEB 3ZZRA 4IRCA 3FMBA 3ENVA 5HQMA 4M63A 1RCXB 2AJ4A 1YJUA 2CG8A 1JK9B 2ZZTA 3L9ZA 4OI6A 1R0BG 1FXLA 4PQUB 3HZEA 3GG0A 5D78A 4FYVB 4LF5J 3FK4A 4WK1A 3MMBA 1SH0A 5D4PA 1X4EA 5KFLA 2HS0A 3B82A 4HT5A 5IXUA 2P2CB 2WW8A 1FE4A 1T05A 1LWCB 2I1RA 4WCEQ 4B9SA 2KG0A 3E01B 2HVZA 4NMXA 3RAXA 1S4FA 4ANDA 1K9MT 2OTJS 5J2PA 1G7CB 4V1Ak 4DR2J 2MJNA 2UXCJ 2KYZA 5DRKA 3JS9A 5IWAJ 4E2FB 3Q23A 2CUYA 3ZXWA 2ZZMA 2EFNA 3MM5B 4ZVTB 1FO1A 1JXLA 1S9GA 1KFDA 1ULRA 2WVFA 1VBKA 5FD1A 4O44B 4J9VA 3HVTB 2BZ2A 1NU4A 2MPUA 4ZPVR 1NK0A 1LQ9A 2UUCJ 1UTAA 1GTEA 4CLPA 3T6BA 4X64F 5J2MA 2LDIA 1LNQA 4N56A 4OYWA 2VFVA 2H4WB 2KZMA 1CPZA 2VFSA 3I5BA 3TYTA 3W5YA 5LMNJ 3B54A 1S1UA 3P49B 3JSYA 2O1PA 5K8OA 3BPSP 4DX6A 2XLJA 2ZJPQ 2JEIA 4WFBQ 4ELTA 3Q89A 4ENOA 3R7NB 4BDPA 4X4UA 4F2SA 2C2ZB 4K59A 5F9NA 2GC8A 3WX8A 1TP7A 1RB0A 4KHPJ 3BKUA 3D0IE 2EKYA 2ILYA 1N0VC 2J6TA 5GAGU 3UDCA 3SDEB 2YQ3A 2XY7A 4RW9B 1JJ4A 4JI8F 4ZJQA 1HNZJ 5J1EA 4OYAA 1NK5A 2GZOA 2UV8A 1DFDA 3WHIA 4ZMMA 3W5XA 1S72S 3HF5A 4J91A 4OMFG 1XR5A 4P2FA 4EK2A 2WW4A 1HWJA 1AT1B 3UDEA 2ALYB 1FRJA 2VU5A 1IQTA 1FKPB 1FX4A 3N28A 4EUVA 1FRIA 4ZIWA 5KG1A 1Y0HA 4G3IA 2RKIB 1VRQC 4KGXB 1SQGA 1NUEA 1F9HA 2AU0A 5D4OA 5K8NA 4P7VA 1WEYA 3P6YC 2DGQA 4XO0A 2VONA 4B3SJ 1WELA 3T5KA 2DGVA 1WC5A 4Y6IA 2OPPA 4FN5A 5D77A 3GIKA 1WC0A 4TU7A 1X0FA 3AQOA 4WIIA 2R7VA 3MCNA 2H48B 1V3RA 4ZLJA 1UL3A 4DJBA 1PKUA 3OUYA 2BABA 2OSQA 2A6MA 4J9NA 1S5ZA 3O5TB 5KFBA 3AH6A 2IJFA 5HK4A 2CPYA 3THPA 4OHXA 2ACMA 1ZM4A 3FBBA 2BJ3A 5SUHA 3R1LA 2W2QP 2XULA 3VR1A 3J7ZT 3K2YA 2DPJA 4LFAF 3BEGB 3LH2S 1QTNB 4CTAB 2G4BA 4XIUA 3Q2SC 2BANB 4PG6A 2W24A 1HWLA 4I7FB 4DU7A 3C8YA 3OQ2A 3IG1B 1E6YA 4CNYA 3H2UB 4LFCJ 3TVKA 4OZJA 4F3MA 2W8KA 4DR4J 1REGX 3Q2TC 4EZ9A 1AFIA 4HT7A 2OFGX 3SSRA 3JSMA 4M94A 3UR3C 1S4EA 2D74B 4ED1A 4M5KA 1M5KC 2V8VA 2XMKA 2NXJA 3W5ZA 5EX0A 3PRVA 2ZEJA 5U47A 1FESA 4GMKA 5CYMB 2KKHA 1IUJA 4LRDA 4QIWD 2DIUA 3GIIA 5D3GA 4DFMA 2HNZB 1HL6A 4J7CA 4KFBA 2E5HA 1VQSA 3M2UB 1SJ4P 2JC1A 2V94A 4USVA 5IT9U 4JI6F 4BLGA 4YP3A 3C19A 2RHSB 2RQ4A 4UY8T 1H3DA 1NDCA 2XI2A 5I3PA 4FYDA 5HBMA 1PGZA 2PA3A 5GMDA 1IXKA 3Q86A 3DLKB 1NJXA 5IS2A 1IR1A 4OYIA 4YMEA 4B3TJ 1QTMA 1GMUA 4Y2KA 4RW6B 1JNZB 5EWEA 4HTJA 5CZVA 2IIHA 3WBZA 4CLTA 1RTDB 1LWEA 1N5YB 4I6AA 4YOEA 3MM9A 1P8GA 1Y7PA 3M8QB 2JVOA 2KTQA 7FDRA 4YDDB 3OSNA 2KVQE 2CZVC 4KH1B 3C16B 3MD3A 1VBYA 1YLXA 1H2VZ 1H7WA 4YY3F 4ED5A 3MXHP 2ADCA 2XY5A 1NCLA 3DDNA 1NSKL 2POKA 2AGOA 2YWFA 3DOMA 4RX6A 1J5OA 4K2JA 3KMSA 3HT3A 3OHBA 3ILLA 2JH3A 6FDRA 5JUMA 3NGKA 3L09A 2IJNA 3AB4B 1CJKA 3PKYA 4JI3J 3QRRA 3PEJA 1AROP 3UO0A 5F3TA 1OY8A 1FVQA 1EHWA 1TVRA 4OX7A 1LK5A 2A2CA 2I38A 2HWIA 3BSNA 1S1TA 4QWEA 3H42A 2ZC4A 4HHUA 2OPRB 1FJEB 3QFHA 1M5PC 4ILRA 4AL5A 1YBAA 2R2SA 3TX0A 3A12A 2E5GA 4M5DB 4AUKA 2C3OA 3CCQS 4I4BA 1G1XA 3GIJA 4TY9A 2H51B 2LXFA 2XM3A 1Q8LA 1S99A 3R27A 1RWMB 3IBCB 2ZWOA 3ZZYA 1RSCA 4HVZA 3VVTA 1XK8A 2ZE2B 5F8JA 2JFKA 3OJSA 4F4WA 2IYIA 1VRTA 1YJTA 4OJ1A 1F60B 2E7VA 2HFOA 2NSCA 4ICLB 5SZTA 2GA7A 3LP1B 1RABB 2OH2A 4RNMA 1TR0A 1YRXA 1IBLF 3G8QA 1HNVA 4XAKA 4R0EA 4GKJF 4AXIA 4FXDA 2RQMA 3A3NB 4WU2A 1JJHA 1AZSA 2XYHB 3JXOA 3HFZB 3M4XA 5CYQA 2MMYA 5DO2A 4KKOB 4DL2A 2ZHAA 1S6QB 2VBWA 4P7TA 2MZQA 4PPZA 2B0GA 2ZNZA 3LGHA 4RNNA 4ZLPA 2ZKTA 4ZPWR 1NH7A 4DL3A 1BMQB 1RA6A 3AY0A 3CXCR 4WP8A 2MZRA 1DRZA 2NCKL 2IM3A 1F5BA 3T1HJ 4I64A 3DFEA 4Q45A 1WEXA 1N5QA 4ECRA 2E1RA 2CRLA 2J8SA 2KDOA 1TK5A 3MOJB 1YI2S 4PQUA 3AA9A 5FDLB 2CNOB 4O3NA 1HWUA 2QJ3A 3BQ1A 3OVAA 1KP6A 2NYIA 1LWCA 4W4MA 3TA2A 1JB0C 1HYSB 3SI8A 3DU6A 3FNNA 3E01A 4EMDA 2BE7D 1T94A 1X9MA 2G9OA 4ZVUB 1P9QC 1F1BB 4DR6J 4Y2CA 3KHHA 2FZCB 4Y34A 4YS2A 2PDAA 1QSSA 3MM5A 3QAUA 1B99A 2QX0A 2DTJA 2MKIA 3M7VA 1EIYB 1SJQA 2UUWA 2IBKA 2DT9A 2GFFA 3SYZA 2CA9A 3HVTA 1TL3B 4KTQA 1IWGA 4JI2J 2R7OA 3C15B 3HX9A 4X4TA 5DLFA 3EXYA 2AEFA 4JBCA 2FHKA 2Z58B 1GNKA 3DOLB 5A8RB 1S6PB 4I6WA 1Z1ZA 2DRDA 2LXUA 3GWCA 2M0GB 2FVPA 5CAAA 3PFOA 4LSZB 3POTB 5DQHA 2C1EB 3G6XA 2FVCA 5E3CA 3SXLA 1JLCB 2VL1A 4LVNP 3P5BP 3TA0A 4F02A 1REVB 1N54B 1Y3JA 1D09B 3KUHA 2CQDA 2HHUA 3MECB 1Y10A 5BXIA 2HQDA 4DL4A 5KFMA 1S59A 4B17A 3PYDA 5KFWA 2FVQA 4F4XA 1HPZB 4LREA 5J1PA 4UOCA 3E3XA 3HP6A 4CYUB 3SDEA 1U2FA 4RW9A 1LV5A 4NLDA 3R5GA 1L3UA 4PABA 4ECWA 4GC6A 2RAQA 1JMTA 3MM8B 2IBOA 4Y00A 1WHVA 1K1QA 3EDQB 5F8LA 3K5MA 1WHWA 1KLMB 3OXFA 4OX6A 1AUSL 3PEHA 3QT7A 4LT6A 1PO6A 2IVYA 4R8UB 3U1MA 4DLGA 1APSA 3HKZD 3FGVA 3V2UC 2RKIA 5FLXY 1U26A 3GB0A 4K4VA 3U1NA 3CCTA 2FHJD 1FFSB 2B7CB 4M5HA 3OFFA 3EPGA 4OZ5A 2HHTA 4H4MB 1NH8A 2M88A 5HQ8A 1BE4A 3EGNA 5KFHA 4IKAA 3BQ2A 2OGUA 3NL0A 3DRXA 2VFTA 4RUAA 3KJFB 2GW8A 4DUTA 2V2ZA 4OI1A 4YB5A 5IV4A 2DY9A 2IHR1 3OD2A 1FI4A 1NSAA 4QPTA 1VQ4S 3OTCA 3AD9C 2V8PA 4WKYA 1Y4ZB 4ZPAA 1PJ5A 1DBDA 1QSYA 1JLFB 4USJC 2DGTA 2NLWA 1DTQB 3HSGA 3D6TB 2AF6A 3R97A 2B9EA 1FNOA 3GIRA 3QWPA 5KFDA 3IBFB 1PILA 4USHA 4UT4A 4P52A 4CTAA 4IDKB 3Q0AA 2BANA 2CAJA 5ETPA 3UCUP 2LEPA 2E7XA 4I7FA 3CVKA 2DNHA 1VQLS 3NS5A 4J90A 3IG1A 1S9FA 2KM8C 4O23A 2C28A 4JI4J 3JSRA 2YWKA 4QIFA 2RMLA 3IAS9 1FNXH 4PRFA 2BJ7A 2FB0A 2XS7A 2F9DA 1N34F 2W4CA 3AXKA 4EEYA 4DWIA 5LSOA 4NXNJ 5H9EK 3FC9A 5CYMA 3H4DA 2XMAA 2ZFHA 2KL8A 2IRUA 2HNZA 2VD3A 3MUMP 1VC0A 4FNIA 3D4JA 1FDNA 1MMLA 2R7SA 3CW2C 3MDFA 3D2WA 2XMJA 2DEJA 4D3HA 1VBZA 2J7KA 2I2YA 3HHLD 3C66A 4AQYF 3DLKA 4URGA 1ZYQA 3TEGA 3NCPA 2YXLA 1FTCA 3MR7A 4B3MF 4RW6A 2J0SD 2JLGA 2LYVA 1KKHA 3GSDA 1GAOA 3KFWX 5E33A 1K44A 4I68A 2KHCA 2R2TA 1RTDA 1N5YA 1AW0A 5C7PA 3M8QA 1CJUB 2MQLA 3R3TA 4Z7CA 5A0YB 3C16A 3QJLA 2FIUA 2DRAA 3DMJB 4XTTA 2XEXA 2AYMA 2MKSA 2X3GA 2L3MA 4DPYA 4ZP7A 5EDWA 2MLXA 2QG9B 1FDAA 3P4UB 3ISND 1F5CA 2R7TA 1H98A 1OSDA 2ASDA 5T7LB 1TL7B 4N76A 2DNGA 4DSJA 1FE0A 3CB4A 5H1SV 3KNAA 1X4FA 3R2CJ 1RAHB 3D67A 2GJIA 4Q2MA 2W4DA 1S7IA 4OI0A 3TUPA 1SKRA 3NBPB 2QE5A 5B0CA 4CO5A 2NPIA 3NRBA 2QIFA 4J9KA 3PDNA 2VUGA 3ICLA 4CO4A 1U47A 3PIPQ 3EPIA 4OZLA 1G2EA 1JNRB 1Y5IB 3V6KA 3A4TA 2UZAA 2MSSA 1FFWB 1GX5A 2RB7A 2OPRA 2ZDOA 3DHWC 2OKQA 2ATLA 1M1KT 4F7VA 4JI5F 2X1BA 1ZA1B 3HHLC 3CDBA 1C0TB 4RNFA 2MZSA 4M5DA 1MROB 1JIHA 5KOXA 2I5JB 1HBMB 2G0JA 3C2PA 5KFQA 4DV2J 3S6EA 4ZVPB 3GPAA 4HKQA 3L7PA 4F4ZA 3OL9A 1AFJA 4NXMF 3B4MA 2DRBA 1Q79A 2ZE2A 4O3SA 1YJNS 2W8LA 5J2NB 3SSQA 2OHDA 4ICLA 3LP1A 2DGXA 3OTBA 2P8IA 4FVMA 1T9WA 2PMZD 2C42A 5LMUJ 3RBZA 4MK7A 2J76E 5LXRA 1LW2B 5D4LA 1R6YA 3VQTA 2HHSA 1WC3A 4CO0A 4KKOA 1S6QA 1A6LA 1J5EF 1V6HA 4N8OA 4PPDA 5HMYA 5LM7E 4FP9A 1KSPA 5IV3A 3BR9A 3SZ2A 1HR0J 4N47A 1V5IB 2JLEA 3I0SB 2DXEA 4CZCA 2W2NP 4PG5A 2QL9B 5HMZA 2IJRA 3P3DA 3MR2A 2QFIA 4RNOA 4TU9A 3DU5A 3MCOA 4HL9A 2PD1A 4WYLA 2HFSA 4ED8A 3SQOP 3P5TL 2UUBF 5FDLA 2ROPA 1YGYA 2VB6A 4UW2A 2ALZA 5E0OA 4DV6J 5LSLA 4EO6A 2R7RA 2DNOA 3IGNA 1HYSA 4DV1J 3A8KA 1C1BA 1NK7A 3LWLA 3K59A 4ED4A 4CLZA 4U9RA 3CCWA 5ETTA 3GR0A 3TJ8A 1WC1A 3KG0A 2QV6A 4RKUC 1H2TZ 2E5IA 1M1GA 2G2YA 3M8PA 1KS2A 4MFBB 4F8RA 2J9EA 2MKHA 3I4HX 3RG6A 1NSQA 2PSZA 2IMWP 2DH7A 1X7VA 1JWWA 1BHNA 3MTKA 4UUWA 4DR3J 1SXLA 1S6OA 1TL3A 3CTRA 3CDEA 4MKYA 3W8PA 4L3NA 3KLFB 3C15A 1ZS6A 1F6TA 3NWRA 2KN4A 1JLAB 3RBDA 1U0HB 3NP5A 1IBKF 3DOLA 5C25B 5IC4B 1FWLA 1I3OB 3GJQB 3DDKA 4IG0B 3GV8B 1OSCA 1NKCA 3POTA 3PKMA 1JLCA 1HNIB 4TLQA 4QR1A 1AB8A 3MAAB 1UMJA 1UW9A 2MKYA 4P10A 2K3KA 3MECA 2E1CA 4HH0A 1EKSA 3RUBL 3KLEB 4XDCA 4ECTA 2CG4A 2PFDA 3QO9B 5KFZA 1IBMF 1HPZA 2DH8A 4CYUA 2DBBA 4KHMA 3BJYA 2EG1A 4F4KA 2HGMA 4CH1A 4C11A 4CLUA 1EKRA 3VZHA 3MM8A 4MK8A 2CPFA 1UEVA 1KLMA 2GHPA 1QLNA 5G0RB 3THVA 3CD0A 1V5VA 3JAMY 4Y0FA 5E5NA 1W2BR 5GAGI 1S0NA 1S1XB 1PJ6A 4R8UA 5HLFB 5HVGA 3NAIA 1YWXA 4DEZA 4LF5F 2EEYA 2Q3PA 2HS3A 3ET6B 2W01A 2WVCA 1U1OA 1QSLA 1NK8A 3OTDA 5D6GA 5M2RA 5DDOC 2C2NA 3MEEB 2VJVA 4PWDB 3TZYA 3TUZC 4IYQA 1UJ5A 4H4MA 4DR2F 3EGZA 2UXCF 5K9FA 3LQVA 3FCWA 2V4JA 5IWAF 2W7AA 1S0MA 2IC3B 1B7FA 3FDSA 4GRSA 2AEMA 1ACMB 1XERA 3CIZA 3DHXA 3I4PA 2HURA 1N5VA 1YKWA 3GFHA 2CPDA 2NZCA 3HULA 1GX6A 1JLFA 4EZ6A 3G8TA 3UFCX 1DTQA 1RISA 2AV5A 1OYDA 3AAWB 2BQUA 4NCAA 2ZNYA 3S01A 3OL7A 4JI7J 2XY6A 2DGSA 3D1HA 2EI5A 3G96A 2MY7A 2CWKA 4TXSA 4IDKA 1UZDA 4ATNA 3Q24A 2W9BB 2YPYA 1IKXA 1RTIB 1I5OB 5LMNF 4MK9A 4RNHA 4F67A 4A8WA 1UEKA 1MNEA 5B08A 1Y5NB 2GV1A 3BGOP 3X3UA 4S0MA 1JX4A 3V4IB 2DNPA 2F40A 3O1LA 4U67Q 3MFIA 2B8QA 4EYIB 2VC0A 5KFOA 5JVHQ 1E6VA 4KHPF 2DVIA 1OMSA 4WK3A 3QATA 2B6AB 3ISZA 1TKDA 3NKYA 2FLLA 3QGHA 3BQ0A 3FEYB 4J9RA 4Z7YA 1FWKA 3KK1B 1HLWA 1HNZF 3DXSX 4CLLA 4ZA1A 4QU6A 4ZDNA 8RUCA 3I5AA 4O3PA 4PXDA 4NWBA 3MMAA 2LQ8A 3EJMA 1RYSA 4NRUA 4ED3A 1JQGA 1ZOTA 4C6AA 2HVIA 1HW8A 1XJWB 3EZ5A 2OEMA 5EUHA 4LBIA 3PW7A 2OEJA 3J81j 3O44A 5LXYA 3HM9A 1YSJA 4DN9A 5KFKA 2PIIA 1WOOA 2NZ4A 2Y0BB 3IN5A 2XS2A 3PYGA 4ZJLA 3QNWB 2AYGA 2HFVA 1S10A 3FRZA 3MPVA 1S1WB 3BREA 2GJFA 4EBCA 3E51A 1CJUA 4QIVA 4B3SF 3GR1A 3M2VB 5A6PA 3A8JA 4K4TA 5A0YA 5KT5A 2M3DA 2V9WA 1RHQB 1UPPA 3DMJA 3VAJA 3CC4S 4IOBA 1IBCB 1X4AA 4ZHRB 2BVZA 1RYRA 5AXKA 5T7LA 2ZH6A 1TL7A 1SJ1A 5DS7A 1NHKL 3IR7B 2YH1A 1CBKA 3WX4A 4ZCKA 2R8GA 4P75A 5D0EA 3H5YA 3MCSA 4C0BA 2F3JA 4X65J 1J27A 3MPWA 4OZNA 1DZ5A 5J1NA 2V67A 2VA3A 4WKRA 3MMJA 1YDLA 3LGMA 3R5BA 1UW4A 3NBPA 4FYYB 3S7RA 3LP2B 2ZOFA 1S48A 1RADB 3MM6A 5EWGA 5DGAA 4IUFA 1GMWA 1RT4B 3R9LA 4L73A 3LA0A 4C8YA 5IOLA 2G13A 1I6JA 1LEOA 3BH6B 4LFCF 2J5AA 4DR4F 2C2DA 3HD2A 4LFBJ 2DO4A 3Q83A 4O4RA 2OO4A 2AJ2A 3UVJB 2AZ1A 2GVDB 1CC8A 1XMOJ 1T3OA 1C0TA 4KAIA 3FEXB 3NGUA 4YB7A 1S0VA 2CDRB 4QW8A 4K4SA 4ETZA 1MROA 2OTLS 4OHVA 2I5JA 4B9NA 1HBMA 1GH8A 2KYXA 3OXGA 1OQ6A 1VQPS 1IVZA 2VPZB 2KXHA 4P73A 4JV5J 2DCUB 3A13A 4ZVSB 4X4OA 2H5IB 2CNLB 3QZ8A 4PWWA 3PG9A 3WC2A 2KZZA 3SEOA 2L48A 1SKUB 4QU7A 4RWXA 3RR7A 1KFSA 2V63A 2Z2YB 2XQCA 2FC8A 2LEAA 3T3FA 1UP1A 3HLUA 2YQ0A 2AP6A 1LW2A 4B3TF 1CLFA 1QJHA 4DUYJ 3C14B 2RDIA 4JI0J 1WKKA 1WG1A 1KONA 4LIRA 3VHQA 3FBEA 1LWFB 2QO3A 2JJ4D 4HEA9 3I0SA 1SBRA 2OPSB 4F0MA 3J7A1 5J2QA 3SBMA 2K1RB 3G8SA 1VQ6S 2J6SA 3MAQA 2CPJA 3V5RA 1NK9A 2UXDJ 1IR0A 4W92B 2E5LJ 2N7CA 3BYPA 3ZNUA 1SI9A 1VBXA 1WNEA 3AJDA 5KFAA 2DGOA 2RF2B 1RHRB 3G9CA 1F3FA 3R1HA 1D9FA 5BR8J 1NZ8A 2LECA 4CRJA 5ETSA 1RWVB 3PRBA 2KI2A 2CQ2A 2H54B 4CIOA 4DV4J 2NXNA 4LF2A 1HKAA 4A8XA 4MFBA 2ZM6F 4ED0A 2DHGA 3CWJA 3NCRA 4A8FA 4N7TA 1HI0P 2YKOA 1NB2A 1YJ9S 4DSFA 1Q8BA 1T03B 2PEBA 1KHVA 3LP0B 4ID5B 1VQKS 3CT9A 3SV4A 1HBNB 3VGSA 3KLFA 4PG7A 1ICEB 1JLAA 3DRSA 2VG5B 3ILIA 5HJXA 3F41A 2M2BA 2XNQA 2BACA 3CD6S 3TZZA 3VQSA 5C25A 1FX2A 4FKXA 2D3UA 3TRGA 2G0CA 4IG0A 4RW4B 2NREA 1R89A 3G2XA 3IAM9 1IKWB 2LLZA 5B0AA 5KG0A 1HNIA 1OQ3A 4UZBA 3NS7B 4WP3A 3MAAA 4MKBA 4AFFA 5CCLA 1FCAA 3NGTA 4ID8A 4KYZA 3PW5A 1VC6A 5L8RC 5HMWA 5KFGA 5CABA 3KLEA 3QGGA 2FLOA 1D3WA 1G3OA 5B09A 3QO9A 4FBTA 4PXCA 4J9OA 4ZJOA 3BKFA 5GMKa 3RTVA 4K50A 3GCXP 2QLBB 4MAKA 2V4QA 2OEKA 3HHKA 4Q44A 4QWAA 2QSFA 3K5PA 3SMZA 2BDPA 4D3GA 2M5YA 1N32J 3CCLS 1RBOB 5KFCA 1KEKA 2RUGA 1ZZNA 4WFXA 1HD0A 1JKHB 4BC9A 3T1HF 3IFEA 4YHHJ 4P2SA 2ZJRQ 2B56A 1VS3A 4CT8A 2ZVSA 1HWKA 4MYTA 1ZAXA 5HLFA 1F3VA 4RUBA 5KFNA 4AE5A 2XCAA 5L38A 3PX6A 3C6UB 2F4VJ 2V34A 2QGFB 3ET6A 1WSVA 3GZ7A 1X5SA 2V2VA 2XC9A 1SUQB 1UKUA 3ZTSA 2AEJA 3EWGA 2AYBA 3MEEA 2AGPA 3PM9A 1RK8A 2QEXS 5GMEA 4PWDA 3MM7B 3KKFA 3Q8QB 3PYFA 4K7QA 4Q43A 2PEHA 4TLRA 2N3OA 1HMVB 4FS2A 4RPFA 1U1NA 1TL4A 3US5A 4RL1A 2FJWA 1X4CA 2IC3A 4HLBA 3JQJA 2AD9A 4LJMA 3D0GE 2XHCA 3ADAC 3M6WA 4LUBA 3ZZTA 3HHNB 1SL0A 1MSWD 1G6BA 4DFKA 1W26A 2EFOA 4JI2F 4DU8A 3OFHA 1U24A 2J7UA 2LU2A 2VC1A 2FZGB 4I6YA 1CC7A 2RE1A 5C5JA 1HHQA 2MTLA 1TKTB 4U7UD 1YTYA 1RAOA 4X62J 1IKVB 2W9BA 2W4PA 1VQ9S 2CQ3A 1RTIA 3EZUA 3TA1A 4C8NA 3K0JA 3AJ2A 4FF1A 2UXBJ 2JFDA 2ZD1B 3V4IA 1YBUA 2QN6B 1S6UA 1N48A 3QSIA 4ZVGA 1ZETA 2Z2ZA 4FDFA 4WZMA 3SCKE 1YJWS 3BGFA 4JOUA 4KBIA 9RUBA 3OHAA 2R3VA 2QLWA 3ZTPA 3TAQA
chains in the Genus database with same CATH topology
1BGXT 1DTTB 1UVMA 3LANA 1VC5A 2LXUA 4YFUA 1OIAA 3GWCA 2VG7B 2M0GB 2FVPA 2R7QA 2ZOMA 3MURP 2QRRA 2M52A 1NJWA 1ZH5A 3GYNA 6FD1A 1WACA 4QW9A 1UJ4A 5F3ZA 4XK8C 2NSBA 3KK1A 2BM1A 2DCLA 3PFOA 4ZPBA 2R4FA 3POTB 3ZFVA 5DQHA 3DNCA 2DNYA 3JTNA 5FJ4A 3BSAA 2YWGA 5AXLA 3G6XA 2ASJA 2FVCA 5E3CA 5L9XA 3SXLA 2OIHA 5GAEI 1JLCB 2VL1A 2VASA 4LVNP 1F0XA 3MM7A 5LL6d 3K5LA 4A8MP 5IZHA 3W3SA 3TA0A 2LCWA 3DRYA 4F02A 3O2IA 1U6FA 2HRYA 4G1QB 4YR0A 5HP1A 4MH8A 3GQCA 1REVB 2J6UA 1N54B 1Y3JA 4KO0A 5AE3A 1GT8A 4PXBA 2DR8A 3QJPA 4RW8B 1DHMA 3KWMA 3UD3P 2CQDA 4X2BA 2HHUA 2ABYA 2DK2A 3MEKA 4YUDA 1L3TA 3CULA 2MZJA 2J9DA 2E44A 3MECB 5KFFA 4ZVEA 4ELVA 1T8EA 2NXUA 4DL4A 5KFMA 2ZKUA 4B17A 2FPHX 4Y2MA 1RT3A 1SKSA 5KFWA 5K14B 1H0HB 2FVQA 2A1BA 4HHJA 2HWHA 3BN4A 2KXNB 4K4UA 4V19X 4Q0BB 1HNXF 3TARA 4MIWA 2VOPA 3MAHA 4F4XA 3I87A 2R8HA 1HPZB 5J1PA 3MEDA 2QMXA 4UOCA 3E3XA 3HP6A 2LQJA 1WEZA 4FNHA 2YX4A 3SDEA 2BR0A 1U2FA 4RW9A 3CCUS 1KQKA 3OLAA 1LV5A 1MU2A 1EP4B 4NLDA 2MKCA 4KR0B 4JV1A 1L3UA 5D4NA 4QJVA 2MQMA 2FJXA 3CDWA 4ECWA 1S1WA 3N79A 4GC6A 3T5HA 3RR8A 1N6QA 2XMTA 1B0VA 1X0PA 3E8OA 4H4KA 4DQSA 1TZ0A 2I0XA 2BRKA 1HFEL 1JMTA 3MM8B 1I94F 3NMRA 2RILA 4PCQA 2IBOA 5CZXA 4Y00A 1WHVA 1K1QA 5AE2A 2RNEA 5F8LA 3K5MA 1WHWA 3DXBA 4HYKA 4DS5A 2GO9A 2K7KA 3QGIA 2LVWA 1KLMB 4OX9F 4ECZA 3VTIA 1ROFA 2Z0GA 3OXFA 3M2VA 4OX6A 3PEHA 3EXCX 3V6DB 2CQ4A 2V9KA 3HFKA 3NG8A 3PO4A 2WONB 2ZHOA 3K5NA 5C42B 4IH6A 4LT6A 2CIMA 1Y00A 4O4GB 1PO6A 2IVYA 2HNDA 5IT9Y 2RSQA 4C98A 1NJZA 2BV3A 4DQPA 5HI7A 4R8UB 3U1MA 5KFUA 3CF5Q 2ACYA 4DLGA 1APSA 4OI4A 4RBUA 1U6ZA 4OHYA 1TAUA 1FRXA 3MOZA 4J9LA 3HKZD 3FGVA 2KVIA 5KT2A 2UVRA 3M8RA 4NX9A 2RH3A 3V2UC 3D54A 1EETB 3RAQA 2RKIA 1OO0B 5FLXY 2UP1A 4M1KA 3L95X 3PW0A 1U26A 2W25A 3GB0A 4K4VA 1JLGB 3U1NA 1O5JA 3QMQA 1SL1A 1Q86T 2AX1A 2J0XA 1UFWA 3CCTA 4G1PA 2FHJD 5F8GA 1GQEA 2B7CB 2PE8A 3PR5B 4LSLA 2F8EX 3HO1A 2V5HG 1N36F 5CD4H 4DV3F 1R8AA 4I2QA 3OFFA 1U1MA 3EPGA 3DRPB 3DYAB 4OZ5A 2EFVA 2DJWA 2GIRA 3H40A 1RWUA 5F0UA 2HHTA 3GIMA 4H4MB 1NH8A 3FJ2A 1M5HA 2DGUA 2M88A 4IQMA 5HQ8A 3PR4A 2LEBA 3EGNA 3VAHA 4A8OA 4RZRA 1Z4UA 1VQMS 3E2EA 2MSTA 4NLPA 4B08A 5A8RA 2JLFA 3MWBA 4K0KF 5KFHA 4IKAA 3BQ2A 3CCRS 3CCZA 2EFPA 1S6PA 3FEZA 3NL0A 4IFYB 4DLEA 4ZPDA 3NCQA 2AJ1A 3RAMA 3DRXA 2VFTA 4RUAA 1X4GA 1UVKA 4E8UA 2GW8A 3LP2A 4WFYA 3C3LA 3IWLA 4OI1A 2W9CB 1WD6A 2J9DE 3CSKA 4YB5A 5C24A 1YRTA 2CQHA 1XMBA 1XR6A 4GO5X 1V3SA 2IHR1 2VODA 4I2PA 2HNYB 3X1LB 2KU7A 1RT4A 3TO8A 1VHFA 1MWYA 3MMBB 2MHEA 4KJIA 2FJBB 3NMAA 4FPRA 4QPTA 3H4BA 1VQ4S 3TUIC 2LQ9A 1U6BA 3OTCA 2DD8S 3CEDA 1T05B 1VQ5S 1T7PA 1LOUA 1DLOB 1Q4RA 3M9MB 5G4DA 4WKYA 1Y4ZB 2QSWA 2XMWA 3F73A 2B4UA 1REVA 3DLEB 4ZPAA 4JI4F 2RVJA 4FF3A 5DG7A 3SCLE 1DBDA 5EWFA 1BY9A 1QSYA 1JLFB 1Y5LB 2DGTA 4USJC 2VH7A 2NLWA 1FHTA 1D8ZA 1DTQB 3TAMA 3DLHA 4QPXA 3AHPA 5J2PB 2AWZA 5I42A 2RQCA 1CG2A 2AF6A 3OTEA 3QYYA 4KV8B 2ZOGA 4R5PA 1K8AT 2GX8A 2GMHA 3VAIA 3ENQA 1FNOA 1Q82T 1CQNA 4ECSA 2V8DA 2R7WA 4ECXA 3CCJS 1WHYA 3PW2A 2N4CA 3QWPA 2BOPA 5KFDA 4H4OA 1URRA 3UQSA 3UE2A 1PILA 4NXNF 4USHA 1BQMA 4CT9A 2JZ5A 2IM1A 4NL5A 4CTAA 2CPZA 4PUOB 4LF4F 3QJJA 2WOMB 1R3NA 3I82A 3DRRB 4IDKB 4KB7A 3Q0AA 5F8MA 2BANA 2CKWA 3UCUP 4DOZA 2HZCA 2C22A 2LEPA 2OSRA 2E7XA 1S9GB 3LOUA 1K0TA 2G1DA 4I7FA 4BBYA 5CCMA 2AQ4A 3CVKA 2DNHA 1VQLS 1TKZA 1GXTA 3G86A 3NS5A 2KFNA 4ED2A 3IG1A 1S9FA 1FRMA 4FF4A 4TN2A 1KC8T 3K5OA 2XGPA 4HH1A 2KM8C 1KQFB 4O23A 2WRMA 3SCJE 1HHSA 2C28A 4DF8A 3D5MA 2DHXA 3JSRA 2YWKA 2RU3A 2Y1RI 1NO8A 2XSFA 2NS1B 3K7RA 3CMES 2FLPA 4QIFA 3BB5A 3M6VA 2RMLA 3N5FA 2ASYA 3IAS9 1FNXH 4PRFA 3SQGB 5K5MA 2FB0A 2CYYA 2PO4A 4LQ9A 1KQSR 2HFZA 2HLUA 5GAEU 3N4WA 1YRUA 4NZ0A 4LF8F 2XS7A 2EBEA 4CQ1A 2GQCA 1F2GA 1YJVA 2APOA 5HN0A 2HW3A 5M2PA 3CDUA 2XBPA 2F9DA 2K2PA 4CO1A 2Z2LA 1N34F 1R8PA 2W4CA 5J2MB 3FCHA 5DM7Q 2RS8A 3DM2A 3KHLA 3HI9A 1SV5B 4EEYA 4DWIA 2OJ3A 4ZP8A 5LSOA 2EC0A 4IRDA 4DSLA 3O6QA 3DLBA 1ZTTA 4AL7A 4U6PA 4V19J 1X5OA 1PSDA 2FHJA 1O8BA 3LALA 5CYMA 4UQGA 3H4DA 4Y65A 3OW2R 4AL6A 4DSIA 2ZFHA 3PX0A 2KXFA 3NWGA 4PXEA 5A8KB 3CJ5A 5IM0B 2YKNA 2HGLA 2IRUA 4H54A 1H2UX 2HNZA 4B02A 1WWHA 1S1UB 4TY8A 2VD3A 2EW9A 2MB0B 4B3OA 3MUMP 1VC0A 4FNIA 1FK9A 2YWEA 5GADI 3ZZUA 4N41A 1LWFA 1P27B 2LXIA 2VKZG 4JV0A 3PX4A 4ERDA 1FDNA 1MMLA 2ZH9A 2U2FA 2R7SA 3MDFA 3D2WA 4DBQA 4JI7F 2ZJQQ 3OFGA 2OPSA 2WSEC 2BM0A 5KFVA 2XMJA 4EGLA 2HG4A 3HKWA 3KK2A 3BO4A 2UVUA 4D3HA 1RT1B 2HPUA 1HQUB 4KC5A 4FXVA 2DNKA 1VBZA 2K1RA 2EVZA 1U49A 1BC6A 2J7KA 2W9CA 4ECUA 2WB4A 3PFEA 2E29A 1B64A 2I2YA 2HQIA 3HHLD 3LPYA 4C9DA 3CJKA 1N56A 3FVYA 3C66A 5LSRA 2BYCA 4AQYF 1RAJA 3DLKA 1Q7LB 2GGPB 4EFAC 4URGA 5KOWA 1ZYQA 2E7WA 4IFVA 4XDDA 1N52B 3T9ZA 4ECVA 3PJXA 3NCPA 3DLJA 2V8GA 3FSIA 3KK3A 1FTCA 4NLTA 1X9SA 4USIA 1UA1A 4B3MF 4RW6A 2YWHA 2VBZA 2CVEA 1JLBA 2J0SD 2JLGA 3DLEA 3QIDA 2LYVA 5J1EB 2RF2A 3GSDA 2OD4A 2UUCF 1GAOA 1RA7A 2Q6BA 4RBVA 1UAWA 3KFWX 1FDDA 3RBEA 5E33A 4I68A 2KHCA 2R2TA 5HROA 1N5YA 4AXJA 1RTDA 1AW0A 2FD2A 1TL5A 3JTOA 1LXNA 1FERA 4M95A 1UVIA 3M8QA 1U1LA 1VRUA 4PWUA 4O3RA 3J7Z5 3F44A 1L3SA 2NQPA 2MQLA 3R3TA 1SH3A 4O3QA 5D8HB 4C0HA 1IQZA 2KJVA 2RD5C 5A0YB 3EGWB 3QJLA 2E1MC 2EPIA 2FIUA 2DRAA 2ZBCA 3ITHB 4CO2A 1GXLA 3FMWA 2D3ZA 3DMJB 3M32B 2XEXA 2VA2A 1TK0A 1HBOA 2AYMA 2OPQB 2MKSA 2X3GA 2W9AA 3M2RA 2L3MA 3M6UA 1TKXA 5ITHA 1FA0A 4ZP7A 3QZ7A 4DF4A 5EDWA 3M1VA 3U1LA 2M8HA 5KFEA 2HMIB 1FDAA 3ISND 3TVZA 1F5CA 1HBUB 1H98A 2R7TA 5A8WB 1OSDA 2ASDA 1NK6A 3GV7B 5T7LB 5L1KA 3L3CA 1FDBA 4QIGA 4N76A 4A47A 2R2UA 2QT7A 5I4MA 4ED6A 1HQEA 3LF0A 2VPWB 1XNRF 2XCPA 2DNGA 4Z37A 1H7XA 1QAXA 4LSNB 4DSJA 1BQNA 3V4MA 4QR2A 1FE0A 3CB4A 5H1SV 1T03A 2A10A 1TUVA 5HL7Q 1D9DA 2IAJB 3KNAA 2YKMB 2ZH3A 1VIXA 1VIOA 2NPFA 3RB0A 3NAHA 1LKZA 2BQRA 5KG7A 4X4NA 2HWTA 4FBUA 2SXLA 3C46A 1FD2A 3LP0A 3W2WA 1X4FA 3BDPA 1X8DA 4ID5A 2HHVA 1VQOS 3FFIB 5K8PA 3TI0A 5LJ3Y 2GJIA 4Q2MA 2D1CA 2W4DA 5I3UB 1HBNA 2J0WA 2OPPB 3RW7A 3FQLA 2VOOA 3Q22A 3NS6A 4YB6A 4OI0A 5E41A 3IBWA 1SKRA 3NBPB 3ZZOA 2QE5A 4NRTA 2VG5A 1WG5A 5IT4A 4MIAA 3HHDA 4CO5A 5B0CA 1KN6A 3I96A 2O3DA 4K4WA 2NPIA 5M2UA 1V9OA 3NRBA 3VALA 1M5OC 2EWHA 1S9EA 3DLGA 1KQGB 2QIFA 3FSXA 4U7CA 5A8KA 4J9KA 3PDNA 2N4DA 2JEGA 1FEHA 2VUGA 3ICLA 4DG1B 2HHQA 1C0UB 2OFHX 4CO4A 3AB2B 1U47A 4DV2F 3PRDA 2FJAB 3PIPQ 3N6NA 5KFTA 3EPIA 1D0EA 4ZVHA 4OZLA 3OUYB 4ECQA 4X4SA 1G2EA 1JNRB 4OFZA 4BWMA 3UDLA 4OIXA 2RU9A 2HYIB 2LU1A 1Y5IB 3BZQA 4RW4A 4A46A 2BUNA 3V6KA 2UZAA 4J9PA 1Q16B 2RS2A 2EK1A 2MSSA 4UY85 1YQHA 2KJWA 3H8YA 1IKWA 1GX5A 2XLKA 2AJFE 3GYXB 3UNGC 1DQ9A 2RB7A 2OPRA 2ZDOA 1HI8A 3DHWC 2OKQA 3HHLA 2ATLA 3KYLA 1M1KT 4X84A 2X1BA 4JI5F 2YVSA 1C1BB 1U1QA 1UJ6A 3CDBA 3HHLC 1C0TB 1RJJA 4NLGA 2ZH4A 4RNFA 2M8DB 1UWBA 2PFFB 4NYPA 5KFYA 2MZSA 1N33F 3HMJG 5LMUF 2WK4A 4M5DA 4ES1A 1BLUA 1TK8A 4ALZA 1JLQB 1MROB 4Q8EA 1JIHA 5KOXA 4IRKA 1IJEB 2VQFF 2B5JA 2I5JB 4X4QA 3IWXA 1RTHA 1HBMB 5DDQC 4NLWA 3SSSA 2VFUA 3C2PA 2JX2A 2VPXB 1RT5B 5F8HA 5KFQA 1ZPWX 4NMLA 4GC7A 2FHOB 3M8PB 1WF2A 3S6EA 2UV8G 4C7QA 4HKQA 1DQ8A 3L7PA 2VG6A 1U25A 1RT6A 4F4ZA 3OL9A 1E6YB 3B8HA 1LXJA 4IH5A 1AFJA 4NXMF 3B4MA 2DRBA 1Q79A 5JXSA 1FRHA 3H59A 2ZE2A 1HR0F 1QM9A 3H5XA 2LDYA 4O3SA 4C3MA 3L7OA 1YJNS 2W8LA 4ZPTR 3J81Y 3TNVA 2WB1D 3I0RB 5GVQA 5J2NB 3TVYA 2MY8A 3SSQA 5GADU 2J7WA 3JSMB 2M4MA 4YEAA 4ICLA 2V0NA 3LP1A 4QR0A 2KH9A 2DGXA 5KFXA 2F8MA 5AXNA 3OTBA 4F25A 1X5TA 3KMQA 3CD5A 4OJGA 4FVMA 3MTJA 2PMZD 1JKHA 2YNGB 4KHRA 2C42A 3KLGB 4WF9Q 1Q53A 1RT2B 5DETA 4MK7A 3GFXA 2J76E 3NNHA 3OR2B 5LXRA 1LW2B 1X9WA 2BE2B 1Q78A 3VWSA 1VQYA 3KJVB 5D4LA 1R6YA 2ZITA 2CJ9A 3VQTA 2HHSA 2DNQA 3W7BA 2CJKA 3T19A 1KTVA 4CO0A 5LT5A 4KKOA 4DR7F 1FVSA 5D3GB 3HHEA 4ZVFA 1S6QA 1A6LA 2K8GA 3DOKB 1V6HA 1J5EF 4ZPCA 3C6UA 2O67A 4KFBB 4Q7AA 2GMJA 4WTYA 2OP5A 3AA8A 1UEUA 4DV6F 4N8OA 4PPDA 2LQBA 2P6SA 5HMYA 2IVFB 4CO3A 3IRXB 1C1CA 4FP9A 1SUQA 4NOHA 1KSPA 3BR9A 4DV1F 3T5LA 3SZ2A 4N47A 5DDRC 3FFIA 2JLEA 2N7YA 3KTQA 3I0SB 4CZCA 2MGZB 4LQ3A 3H20A 5KG5A 5B0DA 2LA6A 4PG5A 2CZ4A 4WE1A 2Y1JA 2RRNA 3HXMA 3M9OB 4NA1A 3K8VA 2LMIA 3I6PA