2UXDJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxdJ00
2MQ8A 1HNZJ 2UXBJ 4HHUA 2KL8A 4GKJJ 5BR8J 2MEWA 3JAMU 4JI0J 4LF7J 2VQEJ 1N34J 4K0KJ 1XMOJ 4NXMJ 4JI5J 4X64J 4JI8J 4DR6J 1J5EJ 3IMQJ 1IBKJ 1N36J 5A2QU 4PWWA 4DV2J 4KHPJ 3W1YC 4LFCJ 4KY3A 5IWAJ 4JV5J 5LM7E 2E5LJ 4DR2J 1N33J 4JI2J 1IBMJ 2VQFJ 3J81U 2KVQE 4GKKJ 1FJGJ 4V1Ak 4X65J 5AJ3J 1XNQJ 2ZM6J 1IBLJ 4DV6J 3R2CJ 1HR0J 4JI4J 2F4VJ 3J7AN 4LF8J 4AQYJ 4DR7J 4DV7J 1XMQJ 3T1YJ 4X62J 2UUCJ 4LF4J 4DUYJ 4DR3J 4RJVA 2UUBJ 4YY3J 1HNWJ 4X66J 3OTOJ 4KYZA 2UUAJ 2MTLA 1I94J 4JI7J 2UU9J 4NXNJ 4DR4J 4B3MJ 4LFAJ 4DV3J 4LFBJ 4B3RJ 2UXDJ 4OX9J 4JI3J 4LF6J 4DV5J 4DR5J 2UXCJ 5IT9U 4DV4J 4B3TJ 4LF5J 5LMUJ 4DV1J 4LF9J 5FLXU 4NEYA 4DV0J 4DR1J 3R2DJ 4JI1J 3D3BJ 4YHHJ 5LMNJ 3T1HJ 4NEZA 3D3CJ 4JI6J 4JYAJ 3J80U 2HHHJ 1N32J 1XNRJ 1HNXJ 4DUZJ 4B3SJ
chains in the Genus database with same CATH superfamily
4OHYA 1R0CB 1RA6A 4HHUA 3CWJA 3TJ8A 2IM2A 5HJXA 1PAEX 1OS5A 4NCGA 4KHPJ 1MNEA 1EP4B 3W1YC 5IWAJ 1X4FA 1VQLS 3R5BA 1U8SA 1U48A 4CWBA 3X3UA 3E01B 2RRNA 1MSWD 3LUYA 4KGVB 1EETB 5CYQA 5A2QY 3AD7C 3LH2S 4CLZA 4WKYA 5DM7Q 4PXDA 2VASA 2LEAA 1QVGR 2VH7A 1N33F 3ZTOA 1FEHA 3KJVA 2BR0A 3KK1A 1BY9A 1XC9A 1C1BA 1ZYQA 1YIJS 1CJUA 4BS2A 3THTA 2C2DA 4Q8FA 3E8OA 3BSCA 4RBVA 4RW7B 2LQ9A 2JVRA 1TAUA 1NK7A 1N5QA 3V81A 4Z37A 5E5NA 4NLRA 5D0RA 3DGVA 2VONA 4CO4A 3ISZA 4Q0BA 1PC5A 3VGVA 5F41A 2DH7A 5J1EA 2V8PA 3PEHA 4DV2J 3L7OA 4WXWA 3TA0A 5T7LA 3M7VA 3OLBA 4IH7A 4XAKA 5ETQA 2HG4A 2DNLA 2YTCA 1UP1A 1SCJB 2YY3A 5B0AA 2BV3A 1S0MA 4N41A 1TUWA 3N79A 2NSCA 2OPSB 1TKTB 3BGFA 4CLKA 2PEBA 1V6HA 2CG4A 1QTNB 3CJSA 3D5MA 2HAIA 3TZWA 2CWKA 3WZ0A 2MPUA 1SC1B 2FJAB 3MUTP 4DS5A 3UDEA 4FF4A 2RNEA 1RAFB 4RW8A 1CJTA 4AXIA 3AJDA 3OR2A 1RACB 3SSSA 3CJ5A 3IBWA 4LQ3A 4QWEA 4FXDA 1RWWB 3T1HJ 3EVOA 1WG5A 2OEMA 3A3NB 2GX8A 2R9LA 3PYDA 3TWZA 1GMWD 4C8KA 1U8WA 2P6SA 1UVMA 1CBKA 1N36J 1F2HA 3TAMA 3QGHA 3WX4A 4ZCMA 3H2VE 1GT8A 3A3PB 3HFKA 4BHQA 4X65J 3AA8A 2BKNA 1X9SA 1JJ4A 2ZD1B 4NLYA 1YQHA 2ATCB 1U0HA 3KMQA 4J9RA 4DR7J 1PJ5A 2E7XA 2KTQA 2WVFA 2JEGA 2JOQA 2VB6A 4DR3J 1GEHA 2K06A 2WHOA 2DNPA 5KAKA 2RQ4A 2Z2LA 3W60A 2JEFA 2ZBQA 2HWTA 4JV2A 3NP5A 1HBOB 2C2OB 5FDLA 2YKNB 4E0DA 3AB2B 2K3IA 2HHXA 1UA0A 4LBHA 3M8ZA 1LK5A 1TUVA 1FKOB 2ZKUA 5KFEA 2QE5A 2A6OA 4P71A 4FPRA 3WQPA 3GR1A 4CH0S 4LF7J 4LR9A 1JLCA 1CPZA 1IKXB 1RK8A 1HQEB 2ZEJA 2H9ZA 4CO1A 2HYIB 2E1PA 2UV8G 2G2YA 1HWUA 4IKAA 3ITHB 2M2BA 4RUAA 4NI2B 3KUHA 1H74A 1FX2A 3R2CJ 2MKKA 3I0RB 4IOAQ 3VCDA 2F40A 3HKWA 2IFXA 4KHPF 2GMHA 5IWAF 4PG5A 1SQGA 1H2TZ 3FNNA 3W65A 2AYGA 4R5PB 5GAEI 1PYOB 4P52A 2FTRA 2HVEA 1Y0HA 2RHQB 4E98A 2HS3A 1RT6A 4YS2A 4H54A 4CH7A 2V5HG 4X4RA 3W64A 2C3PA 3E51A 1UZHA 3HF5A 3NOGA 1ZAWA 3HFZB 1PC4A 4DPWA 4A4JA 4UOHA 2CNKB 3BSAA 4USJC 3EPGA 3PYEA 4X2BA 2V94A 1XNRJ 1MMDA 1NDPA 3I87A 3VZIA 2APOA 3OL9A 5IT9Y 4NZ0A 3PZPA 3CJKA 3CTRA 3C14B 1QSLA 2MY7A 2VDHA 3V5RA 3NGSA 2ZUAA 3CCQS 1U1RA 3IAS9 4P9SA 1TZ0A 5KFXA 5DGAA 2KVQE 1CULB 5EWFA 1FD2A 1N5VA 5A8WA 3JAMY 2GFFA 1S59A 3DLHA 2B9EA 1Q8LA 2KT2A 4NE9C 1S9FA 1XMQJ 3G8SA 3OVAA 3DCAA 4DV2F 3SQGA 1PBAA 4P2FA 2YNHA 3J81Y 2OHDA 1NJXA 1FEEA 5CA5A 4LRDA 2Q6CA 4PQAA 1URRA 1WELA 2DEIA 1IVZA 3S01A 1U1KA 3PV8A 4K8RA 3V6KA 3EVMA 3N4WA 1H98A 4NLSA 4M5GA 1KOOA 3ILOA 3M8SA 1IJFB 4ZPTR 4AFFA 3S8SA 4NLTA 2ZFHA 1VBZA 1TL5A 1REVA 1RHUB 2ZH1A 3ILLA 1M90T 1X0PA 4LIRA 4G65A 4HH0A 2J0XA 3PKYA 1S10A 1NK5A 4DUZJ 4ED0A 1M1HA 3GV8B 2HZCA 2KG0A 4J5OA 2MEWA 5FLXY 2RDDA 3GJTB 1UVLA 2IVFB 2EC0A 1S4FA 4UOCA 2QLJB 1WI8A 2R42A 3DLJA 3T1HF 4PAAA 3E01A 4I6YA 1S0NA 3SCKE 1ZM4A 4Y00A 5CZXA 4DV6J 3WBZA 1RYSA 2CPEA 3SEOA 1LQ9A 4JP8A 2Q1LA 4OYOA 2WB1D 3MDFA 1T03B 1GX6A 1N36F 2QA4G 1KKHA 1GFWB 3J7A1 1PJ6A 2BKOA 3D0HE 1WEZA 5D78A 4X65F 3K7RA 3MCMA 2I1RA 1UZDA 2HRTA 4CO3A 3R7NB 4F02A 1FHTA 5C2CA 4QPTA 3D4JA 1YX2A 1PKUA 3PO5A 5CXTA 3A8IA 4DR7F 2AX0A 3K17A 4RW7A 3N01A 1Z2ZA 3H98A 4DR3F 2RS8A 1DTQA 3NCQA 3H5XA 2DGTA 1SPBP 3P8BB 4F36A 4F4AA 1YJ7A 5IC6B 2FJXA 3PXGa 2W4PA 3NL0A 2ZE2B 2LXUA 4ZPWR 5DG8A 4WXOA 3I32A 1LWEB 2KZZA 3GJRB 3C2PA 3L95X 1RT7B 4K59A 1WKLA 1AZSB 4EZ9A 3KK2B 2CPJA 2AYMA 1YG0A 2N82B 2GVZB 2GNKA 3HT0A 3QNWB 4QOTA 1KRPA 2FGOA 2HLTA 1SUQB 5D3GB 2JSXA 4LF7F 1SL2A 3HZGA 1UEKA 2OPSA 5IT4A 3VAKA 4NLUA 2ZH9A 2ZVIA 4B9MA 1TKTA 2UVWA 2MSSA 4AL6A 2WVEA 2YXLA 4ZP9A 1C0UB 5AXLA 4DV3J 2L9NA 2DHXA 2DYAA 1LFPA 1OQ3A 1WUUA 1T0TV 3PJWA 4DFMA 2E5GA 5CHCB 1N52B 2J8AA 4RW4B 3GIKA 3QLHA 4CH1A 1H72C 1WF0A 4RLEA 4QWBA 3VR1A 1QJHA 3CIMA 2DCLA 1N32J 2XLKA 3MEDB 3MM8B 1IN0A 4H4MA 2LU1A 1FKAF 2YKAA 3QWPA 1SIZA 4KPYA 1TR0A 1RTDA 2J76E 1NM2A 4ECZA 2MQNA 4Q5VA 2RHSB 1DURA 1NSAA 1X7VA 3WHIA 1BGXT 3T1AA 2QLXA 1XNRF 2MZJA 4LF1A 4TU7A 2ZD1A 2H5EA 4I6AA 1XK8A 3OL7A 1D9DA 2CG8A 4U95A 2DIVA 3EPIA 3D6HB 4NCBA 2J0WA 4B9SA 1N4LA 2NCKL 4ITSA 3M30B 3GLJA 1KQKA 1X9WA 4J9SA 4NA3A 2K8GA 4YDDB 2R2TA 2LLZA 2A1BA 2YKNA 5I3QA 1XMQF 2KU7A 2FUG9 1QUPA 2XZWA 2WTFA 6FDRA 4H4KC 5DDOC 3KFWX 2X1BA 4C8MA 4Q2MA 2R7OA 1WWHA 1NBEB 1VBKA 2FDNA 1IR1A 5KOWA 5DQHA 3M9NB 4ZOSA 3O6QA 1NDLA 4DSIA 3DLEA 1G3OA 2B5JA 3CT9A 2VKRA 2K1RB 4DR6F 1U6BA 3VHQA 2XZTB 5GMEA 1QAYA 1JKHB 2WBMA 1U49A 4Q7AA 4NI2A 2P2CB 1TL1B 4MK9A 4F2RA 2OTLS 5KT5A 4DUZF 3WIUA 3I0RA 2PEHA 3L9ZA 1YRUA 1FRHA 3DRYA 4JB8B 4FS2A 1U02A 2RIJA 4I2QB 3QJPA 3H7HB 1RT4B 2MTLA 3F41A 1U1NA 1Q79A 3LP0B 4WFBQ 4NRTA 5LXYA 1KVIA 5T41A 3IAM9 4ZITA 4JI3J 5KG1A 4DV6F 3Q86A 4DL4A 2XS2A 3AJ2A 4FVCA 4F0MA 4NLDA 1RXOB 2M8DB 4DCPB 3CXCR 2HNDB 2MY8A 4ILRA 4AD6A 3GIMA 5F8HA 3C14A 3I5AA 4Y65A 3HT3A 2YNGB 3T6JA 3B78A 2YX1A 2ROEA 2Y1JA 4OIXA 4KY3A 1LW0A 3H90A 2JFDA 4M95A 1CULA 3ZTPA 1YHQS 5DJBA 1FTRA 4GVBB 2AZ1A 4ZCIA 3T19A 1XNQJ 4PUOB 1X4CA 1U2RA 5F8JA 2OMOA 4NX9A 2YKMB 4OJ1A 2LQ5A 3RB4A 2FZKB 5EX0A 1F2GA 2X1AA 5AE2A 3OXFA 1JNZB 2IRUA 4KGZB 4AYBD 1NU4A 1RLDA 2CNLB 4N47A 3PRVA 4ZCKA 3K5MA 3VAGA 2UUAJ 4WK3A 2BUNA 3VTIA 4ANEA 1EQMA 2G1HA 2AU0A 1JIHA 5C42B 4LJMA 4YEAA 5KFYA 4K5SA 3CDUA 5KT2A 3ENQA 5E2QA 1M5KC 2WCXA 1Y00A 4NEZA 4EWTA 4ZPAA 2HHVA 2X7IA 2RRBA 3DI6A 3WDOA 4DV3F 4Y6IA 2O3DA 2QSFA 2AJ1A 2HGLA 3VZHA 2RVJA 3GV7B 2GQQA 2CVIA 2AEMA 2R7VA 2RUGA 3R97A 3ILIA 1UJ6A 4QYRA 2MMYA 2JL9A 4DL6A 1BLUA 3TQEA 3G82B 3W8GA 5KFHA 3M8WA 3UVJB 5J2MB 4YFUA 3UW1A 4RNNA 1N32F 2LA6A 4PRFA 2A2DA 4K2XA 4F4ZA 2R7WA 1J2VA 3IO1A 3BR8A 1S49A 1T03A 3AD9C 4C98A 3HJFA 1TL3A 3POTA 1QSSA 5KFGA 2B51A 2GCFA 1IBCB 4DR4J 3NNAA 3GTYX 1NKBA 1FX4A 3UN5A 1UEVA 4CIOA 3BF4A 2R8GA 4OLOA 3IGVA 3OHAA 5AXNA 4TKTA 1YDLA 3FCHA 1HI1A 2X1FA 1HNIB 2DRAA 3ISNC 1SKRA 2KKHA 3CD0A 5HMXA 2G2OA 4RBTA 3WX8A 3NBPA 1LWEA 4TXSA 2CPXA 3W5XA 2IJRA 1RT7A 1T9XA 1AZSA 2W4CA 4QZVB 1N34J 4MIWA 3BZQA 2CPZA 1VJWA 3KK2A 1XIQA 4ANDA 2GMJA 3OFHA 4DR2J 3TP2A 3Q8SB 2HFOA 1UMJA 5F8LA 4HDGA 1SUQA 3MF5A 5D3GA 3I6PA 2XGQA 3MEGB 3NG8A 1K44A 4DLGA 2DGUA 4NYPA 2LKZA 2VZ9A 2QO3A 1IQZA 3MMBB 3OJSA 2BM0A 3CO9A 2XWXA 1HI0P 5HJYA 1W2IA 2D9OA 3KK3B 3W8PA 2D3O1 1ELOA 2W1BA 1N5YB 4C7QA 4C0HA 2J9DA 2Y9HA 1ZH5A 4RW4A 2FJEB 4O44B 4IH5A 3BDPA 2PDAA 3CDAA 1BE4A 3BH6B 2R7UA 3NS6A 2FLNA 1S99A 3P5TL 4D3GA 3C15B 4RUBA 3I96A 1BQNB 1JLAB 4JI3F 1HQUA 1XEZA 2HBZB 3OSNA 1ZETA 3NGDA 2KM8C 4QBUA 2IM1A 2PI5A 4Y2IA 4BDPA 4LSZB 2V69A 4ECRA 1XMBA 5LM7E 3MTJA 3M2VA 3TQ1A 2FYXA 4BWJA 3NAIA 1AFJA 4QWAA 3E2EA 3FSIA 2AX1A 3MTKA 1NZAA 1DQ8A 1AA1B 3IGNA 4M94A 1T3OA 1T9YA 5J2QB 2MZRA 3M30A 2KN4A 1QY7A 1R8PA 4MK8A 1X60A 1RE1B 1XNQF 3MOJB 4F4XA 2UXCJ 1GMWA 5AE1A 2BJEA 4IRCA 5KG7A 1QDUB 5CYMB 1BQMB 3OBIA 4WFXA 3GG0A 1B0TA 2MLZA 2UUAF 1WF2A 2LDYA 4UT4A 1IQTA 1NJYA 3MECA 2GVDA 2VICA 2E44A 2NREA 2QYCA 4USHA 4HHHA 4X4QA 2Y1LB 4ECQA 5BXIA 5IT0A 1IWGA 3OFEA 2DEJA 3SFGA 2H4YB 3ETMA 3OHBA 4YR2A 4ED5A 4MIAA 5JXSA 2K3KA 3GIIA 2VUGA 1JKHA 1TFYA 1TL1A 3FQLA 5K20B 1CJVB 1RCXB 2G1DA 2LCWA 3M6VA 1S1VB 3LAKA 4OL8A 4I64A 1NCLA 3RAXA 4CNZA 1PYTA 5HAOA 2QMUB 2HFSA 3I0SA 5F8MA 1RT4A 1GTHA 2BEFA 3CIZA 3LP0A 3HD2A 3PY8A 3H5SA 4QR1A 5J1NA 2VFVA 4PYDA 2A6MA 3EJMA 4ERDA 4KKOB 4GC6A 5D8HB 4LVNP 3HSGA 1JWWA 4DQSA 3BGUA 1NAQA 2ZJPQ 2A3JA 4KGMA 5ETPA 4ZDNA 4CTAA 4DR4F 2F3JA 2KJWA 3BPDA 2DHHA 3R7SB 2W8KA 1UCNA 4PG7A 3MOZA 3ILJA 3N28A 2B9XA 2FHJA 3M8PB 5M2RA 2HVZA 1K0TA 2KRBA 4CO5A 2QJ3A 3HHLD 4NLQA 3AOCA 2DKOB 2XQCA 3QAEA 2B8PA 4GVBA 2B43A 1HHSA 2AJFE 3AXMA 1NB7A 4PUOA 4MKVA 4RNFA 2MJNA 2NXNA 2B9YA 4ETXA 2YKMA 5DDQC 1FXDA 2Q79A 1TP7A 4ECYA 4IFVB 1N34F 3S7RA 3G71S 1R8AA 2VFTA 2XLIA 2R2UA 4U96A 1Y3JA 4DR2F 2R8JA 4LVOP 4ZLPA 5F8IA 1RDRA 1WC1A 3AAWB 3VGSA 5C42A 3B82A 5DGBA 3MUVP 3HKZD 2AD9A 3C46A 2QGFB 1NSQA 4LSLA 3CNQP 1C0TA 1YJVA 2GQCA 5RUBA 3L7UA 4H4OB 4KV8A 1RBOB 3AXKA 2AGPA 2EW9A 3NS7B 2OELA 1WI6A 1WD6A 2VG5A 4J90A 3QGIA 3TUJC 2VC0A 2BVZA 2YPZA 3NGRA 3E3XA 2QMWA 4OX7A 3H5UA 4I56A 4I67A 3IFEA 1IM6A 4DCJB 2Z0GA 3FDSA 3PIOQ 3G6ES 4HKQA 2CZ4A 5IQQA 2VHGA 3SDEA 3QRQA 2UUCJ 2KO1A 4IG3B 5HP1B 3B4DA 1RAIB 2P9EA 1H2VZ 4NYZA 5DQGA 3QPIA 1GXLA 3CJRA 2R4FA 2MSTA 3ZZZA 3HJVA 3Q8RB 4DF4A 2DGSA 3D7SB 2P9CA 3BV8A 3CMQA 2CA9A 2HRUA 2I0XA 2OAUA 1U1QA 3H2UB 2V67A 3TARA 1TQLA 4DL0C 2YWGA 5KG3A 1PYSB 2GIFA 5DLGA 2UXCF 2JEJA 2QFJA 1F60B 2VQEJ 7FDRA 1EKRA 3JTPA 2ZC4A 3DDKA 3Q8QB 5MLCV 2MYFA 2W9CA 3DRSB 1NK9A 1KQSR 3MM9B 2QMXA 2W9BA 4OX6A 4QCLA 2NS1B 4ZVFA 5K8OA 4L76A 3CGIA 2BQRA 1H7WA 1FJEB 5G0RB 2HNZB 1KONA 2HGNA 8AT1B 2V4QA 1FNOA 3RGIA 2PA3A 4LF4J 2RSQA 1VHIA 2GA7A 1KC8T 2Q3PA 3KK3A 1P9QC 3W9JA 1N5YA 2CYYA 3H20A 4E8UA 3BBBA 3U1LA 2W24A 4O44A 4QWDA 1VBXA 3PDNA 4CLSA 4A8QA 1IKWB 4DV0F 3GPAA 1BQNA 4V19X 1RBAA 2L48A 4U8YA 1VC0A 2OSRA 1WSRA 2PSZA 4OYIA 1FT8A 1GK8A 2GJFA 1Q7YT 4OZ5A 3FBBA 3T9ZA 5C24B 2A10A 1X4BA 1HPZB 2BJ8A 3QO9B 1JJCB 2E7VA 2BANB 5K8NA 1A7GE 1DY3A 2ZJQQ 2HNYA 2H4WB 1HARA 3A1YG 3K5OA 5J2QA 3CMAS 4EMDA 3K0JA 2UVRA 1QSYA 4N8NA 4NOHA 1U2FA 4C8NA 4EYIB 4P72A 4K5RA 2D9PA 3LA0A 2VFRA 4U67Q 3U1MA 1RWVB 5K8MA 5ETSA 4DR5J 4P7VA 4J37A 5CYMA 1T9WA 3VQSA 2V4JB 4WE1B 1FWLA 2JNJA 3FJ2A 2MHNA 2PI4A 2EFNA 2JEIA 1DFDA 2FIUA 4OZJA 1T05B 1TV6A 4ZVEA 4FVMA 3J7Z5 2LP4A 2VJVA 4WYWA 1KEKA 2GIRA 4R0EA 1S0VA 1PIEA 1S1UB 3HVTA 3IBCB 2DGQA 2N3OA 4K0KJ 3UR0A 5FD1A 3A13A 2O5DA 4ECUA 4RPFA 3EYZA 5H1SV 5CD4H 1A9NB 3ETOA 2CFXA 1JLFB 4MKBA 2MQMA 1CJVA 1HW8A 2M9KA 1TAQA 3C16A 2LXIA 1S1VA 1KLMB 1FRIA 5A0YB 1NZ8A 1F3VA 4K4VA 2XCAA 1CJKB 5ETMA 3M2RA 3BO3A 4EBCA 2NPFA 2OO4A 4NZ6A 3MR7A 3AODA 5KFUA 3ZZPA 3JSBA 2XHCA 1U6ZA 5ETOA 1XWLA 3ELHA 1KOHA 2JVOA 3CW2C 4WJBA 5IOLA 1UL3A 1F9HA 4ZJLA 2DY1A 4DQPA 4XO0A 3D9BA 2UUCF 1QUVA 1RADB 1VQSA 4KC5A 1WC0A 2C42A 4ILMA 1IR2A 1K0VA 3OTEA 5KFZA 4K4SA 2YX4A 1PILA 5EX3A 1YKWA 2AJQA 2BA9A 2M8HA 1KQFB 3OUYA 1KDNA 2CQDA 4DMZA 3M8PA 1ITPA 2JFKA 4K50A 5B08A 1HNVA 1PBUA 2ALZA 3BGOP 4G1QB 2V63A 2W9AA 4OI2A 2B8QA 2RUSA 3UWTA 1JJ2R 1KSPA 1SBRA 5IQ6A 4I1TA 3BB5A 4ICLB 4KSEB 1NSPA 2G4BA 1M5PC 4IFVA 1PG5B 4GO5X 2VQEF 1T9UA 2WRMA 3QT5A 1X0FA 3RRGA 4IRKA 2NPIA 3BGRB 5LJ5Y 4X66J 3B6BA 4D3HA 2CJYB 3MR2A 2XMVA 4MAKA 4B3MJ 1P6TA 3TAPA 2ZH8A 2XSFA 3GFZA 5HBMB 4R8UB 4RO0A 1YJTA 2AHOB 3KHHA 3ULHA 2ZH4A 3NNHA 2HLUA 4J9VA 3M8RA 3W9HA 4ED4A 4LF4F 4LR7A 3R2DJ 4H4OA 3DOLB 3TNVA 2RB7A 4PWDA 2FD2A 2CKWA 4M5JA 4PQUB 1S48A 2B4VA 3L09A 3C6TB 2KYZA 4JV1A 4HT5A 2D74B 1RWXB 3X1LB 1JLEB 2IMWP 1HI8A 2R7QA 4IDKA 1MWYA 3LF0A 3M6UA 2ZH7A 1TKZA 1U2CA 1RHJB 2OD4A 2QLWA 4PPZA 3KLFB 4ALZA 3TA1A 3HSZA 2LXFA 4IOCQ 2RJZA 5MAOA 3DNCA 3JQKA 1XN9A 1WG4A 2D7SA 4R0JA 2MKIA 2B6AB 2MKSA 1UA1A 1HR0J 6AT1B 4J9PA 1L3VA 2XG8A 5HP1A 3QIPA 2HZVA 1H7XA 4RJVA 3UCUP 1IKYA 1SIWB 1L3SA 2YVSA 3KHGA 2X1GA 4LF5J 3EWGA 4AL5A 5L46A 1HFEL 2KZMA 4PPDA 2I2YA 1TU0B 5B09A 1V5VA 4M5HA 4ZVSB 1SJFA 3KLIB 2R2RA 4ED8A 2XO7A 2FJVA 3DN9A 1OY9A 4DR5F 2OH2A 1X5OA 4UY85 1K73T 4PXBA 3DRSA 1E6YB 2XB2D 4CT8A 1VS3A 3MM9A 1IKVA 1VRQC 4A8WA 1VQYA 5D77A 1SB6A 1HA1A 2G13A 2MLXA 3QQCD 4EK2A 3QAUA 5CAAA 4DS4A 3CVKA 5G0RA 2LDIA 3H4BA 2CAJA 1ZAVA 1LEOA 4K0KF 2EXUA 1RBLA 3JB9k 4RU2A 1KBRA 3G86A 3T1YJ 3R6GB 1JMTA 2ASDA 1NKCA 2J8SA 1HW9A 1N6QA 2ZVSA 1D8ZA 2VPZB 3TEGA 3UCZP 1LWFB 3TX0A 1CC7A 1Q53A 3C6UB 2JWNA 2IDLA 1T7PA 3JTNA 1TK0A 3AOAA 4DZDA 3UD3P 2QIFA 4DR1J 1H2UX 3GU0A 1IKWA 4RX6A 3WIVA 3UPFA 1Z4UA 2N3LA 5HLFA 3GE9A 3HPOA 3PW5A 2AWZA 3MURP 2UXBJ 4LSNA 2HHTA 1W25A 4MTPA 4ELUA 4AUKA 4L72B 5HL7Q 2A2CA 2DD8S 3OXLA 2VBYA 1JXLA 1NK0A 1S6QB 3D1HA 4NPOA 1WJ9A 5HMZA 2EBGA 3QO9A 1RAHB 3PW0A 2C28A 2BANA 1R43A 2BRKA 5K5MA 5DO2A 4CZCA 1IBLJ 1RTJA 4OYZA 5K8PA 3WC2A 3TVYA 4HL9A 3OJUA 2WVCA 4FYWB 2WVBA 1OSDA 1W7WA 1F0XA 3OR1A 1DBDA 3AQOA 3OTBA 1QAJA 1EARA 4KYZA 4X4TA 1KHVA 2QA1A 4DWIA 1FKPB 3HCXA 1FVQA 2GHWA 4ES3A 4PG6A 2ABYA 4OX9J 3HMJG 1MROB 4NLGA 3TI0A 4L3KA 4NLXA 2V4JA 6FD1A 3FRYA 4ENOA 4USWA 5BYRA 4WP8A 4X66F 5ADZA 2OD6A 5LMNJ 2FVPA 4O3NA 3SCJE 4B3MF 3HI9A 4YP3A 3V6JA 1U47A 3W2VB 3P5BP 1LK7A 4YB6A 2QTWA 4B3SJ 1S1UA 4GKJJ 2DCUB 3KHLA 2PC6A 1N5SA 4ELTA 2LEBA 1I6JA 1JLFA 1Y5IB 2CXEA 1B99A 2E1AA 3HHLC 4DPUA 3J81j 1AXQA 1KLMA 5A0YA 1CJKA 2VA3A 1S9GB 4M5LA 3ZNUA 1RAEB 1OYEA 4LF8J 2CJKA 1S6OA 4NZ7A 2DNRA 3TW0A 4WFYA 1NPPA 2DBBA 3SQOP 4DUYF 3R9LA 4ED7A 5KFNA 1X9MA 1P1TA 4EU0A 2YNIB 1FK9A 5LT5A 1KNZA 1UKUA 4DL7A 3IRXB 1HR0F 1VQ6S 1MU2B 1WDDA 1H73A 1TKDA 3DLGB 1L5UA 1SJ1A 2H65B 2OEKA 1UAWA 4NMXA 4OX8A 3AY0A 1NDKA 3AD8C 4WZMA 2BMBA 1FWKA 1K1SA 1VQKS 3H4DA 5KT3A 2Y8WA 4LF5F 4G1QA 3UI3A 2IBOA 3OTCA 3PRBA 4NXMJ 3ZNJ1 2AZ3A 3DYAB 3TAQA 4KO0B 3IP0A 2W2MP 4OYBA 3ZZRA 1W2BR 3DM2B 4HI1A 4DF8A 4ICLA 2GO9A 2VG7B 5A8KA 2Z57B 2CJQA 2WSFC 4OJ3A 1E6VA 2XS7A 1ZS6A 3JS9A 3F56A 2J6TA 2RRAA 4ZLJA 5HBMA 4R8UA 5U47A 4URSA 3T5HA 2R7XA 2HQGA 1S4EA 2V0NA 2QZ8A 2V8HA 4IG0B 3T1YF 3QMQA 1GX5A 3DOLA 3HHLA 1S6UA 3DXBA 4M63A 4YHHJ 3R5DA 2GQ2A 3LQVA 4PQUA 3QSIA 4BBYA 3OSPA 1R0AB 3R1HA 3C6TA 4ZJQA 2QV6A 1JLEA 4WYLA 4Z7YA 1ZAXA 3SMZA 1YLXA 1MWQA 1B3TA 3H8YA 4U7CA 4DR1F 3NGUA 4F26A 1Q7LB 4OHWA 5A6WA 1ZA2B 2KXHA 2HBRB 4TN2A 3PJXA 5K9FA 5AJ3J 2B6AA 2UXBF 4O0NA 5KT7A 1XQIA 3MR5A 5GADI 1AUSL 1QD1A 4C8LA 4ZJOA 1TL4A 2F1FA 2BOPA 1FESA 1RHRB 3BKTA 1IBLF 2KXFA 2E5IA 4PR6A 1RT5A 2CJAA 3SIPB 4DFJA 1G7CB 2UV8A 2V6AA 1RP5A 2VL1A 1FDDA 2WW4A 3OPKA 3KLIA 4URQU 3A8EA 1VRTB 2RKIA 2DY9A 4OX9F 3SI8A 5A76A 2W2QP 4ZPCA 1WHVA 1VK3A 2V2ZA 2XS5A 1LXJA 5LL6d 3OVSA 2C2NA 1ACMB 5LMNF 4Q8EA 2KT3A 4PG4A 2BDPA 4HI2A 4B3SF 1D9AA 2ACYA 4KQZA 4GKJF 5KG2A 5IC4B 3DHXA 2CDQA 1I51B 1IUJA 1EIYB 4J9OA 1IJEB 2IJFA 1YZ6A 1VMBA 4G6VB 2YWFA 4NLPA 3UDVA 1LW2A 4F3OA 3GP9A 4CDIA 5KTQA 2W25A 4B02A 3EM1A 3FEZA 5KFTA 2CQ3A 3QT7A 2UVUA 2UUWA 4EFAC 1S72S 4B3TJ 3CCVS 4LF8F 2VPWB 1O51A 2KJVA 4XK8C 2I38A 2QG9B 2NXJA 1XR5A 3AQPA 3CJQA 1A6LA 4DPOA 5JJBA 3MFHA 2UVVA 3JYTB 4IYQA 3TZZA 3THVA 1NPRA 2FJDB 4EO6A 5KG0A 4DSEA 5GVQA 3QRPA 3TO8A 4WIIA 1V9OA 4Z7CA 2F9DA 4ECSA 2QLBB 2EFOA 1VQ5S 3QRRA 1NUEA 3KUGA 3DLKB 4O3QA 2NR0A 2J0QD 2HK2A 1RCOB 2LU2A 4NXMF 3ZTQA 4UW2A 3R5GA 1SQFA 3AOBA 3OTOJ 5KFBA 1Z2LA 1FKPA 3PW7A 1RISA 3DOMB 1N88A 4ZP7A 4DX8H 4WFNQ 1SC4B 4J9KA 1KVKA 3FFIA 1FRKA 3N6NA 3U7JA 1LNQA 3LP1B 4FNIA 2OPPA 2BRLA 1YGYA 4DSLA 1H38A 3BM7A 3W2VA 1ZM9A 4IFYB 3A12A 3MPUB 1RTZA 3MGJA 2MQ8A 2NXUA 1X5TA 3EVWA 1KS2A 4CYUB 4LREA 2Z2ZA 2ASLA 2GMLA 3DLLQ 3UDCA 1NSKL 4EBDA 4YHHF 2CJ9A 2ZWPA 1U1LA 2XMUA 2XULA 4JV0A 1D9FA 4USKA 4LUBA 1RT2B 1S9GA 2WSCC 2V2KA 4QYZJ 2EEYA 1GXTA 1KVJA 4LRCA 5AXMA 1TL7B 1VR6A 1HWLA 3GJQB 2EVZA 1UVJA 1ZTTA 3C3LA 3PO4A 4WFAQ 2RH3A 4B9VA 2HFNA 1JJHA 2ILZA 1O0PA 1U26A 5AJ3F 2B7CB 3LP2B 3IRXA 4HHJA 2MGZA 1YBTA 3DLGA 2ZOMA 2XCPA 4MYUA 2WB4A 2ASYA 2FGCA 2K2PA 3O1LA 2PT0A 1LKZA 2CPFA 4N5SA 2ZNYA 1ZZNA 2KT5A 2HHHJ 1IR0A 2M88A 3HULA 3R7BB 2HPUA 3VGUA 1NXIA 3W3SA 1FF2A 3J7ZT 3CCSS 1JLBA 3FKBA 2GAHC 4I2PB 2WVDA 1TUGB 4DEZA 4RUCA 1UVNA 1R7IA 2NQPA 3LAMA 3LW5C 2OPRB 2V9KA 3TA2A 1WC5A 1ZPWX 4L73A 3P6YC 2BE7D 2BABA 1U1PA 1C4CA 1YBUA 5CQGA 3K58A 3EXYA 3KJQB 2YH1A 2COLA 4XPCA 1R0BG 3KMSA 2Z8QA 5CZVA 3KDNA 4AXJA 4B3OA 2J7UA 5EUHA 4ZIWA 2EKNA 1WEYA 3F73A 1HNWJ 3V4IA 4G1IA 2W2PP 1FRJA 4UUXA 1I94F 5KFMA 2H48B 2DNQA 5I42A 3OXGA 5HVFA 4IG0A 3VAIA 2V50A 1QE1B 1HBUA 5L39A 3S1TA 4A48A 3RB3A 3ZXWA 1R0AA 2VOPA 1T9TA 4PWUA 1F3FA 5I4MA 2EFGA 4P7TA 4A8XA 1RHMB 4CM0A 2YNFA 4B3TF 3RBZA 4ED2A 2QL7B 2ZBPA 1Z1ZA 1CEZA 4N77A 1JXVA 4C8YA 2DNMA 3KLGA 3O44A 1S12A 2CRLA 2M5YA 2AV5A 2BBEA 4Y2AA 4P75A 4PCQA 1UJ4A 4ZP6A 2OP5A 2HHUA 2QSWA 1F9EB 1RAAB 2J7WA 3K59A 2DH9A 2HKEA 1I5OB 5HO4A 3CCJS 4V19J 3GV5B 2PN6A 5B0CA 1S9EA 2FB0A 5C5JA 4JI7J 2DT9A 1UTAA 3F44A 4FXWA 2VJUA 4OYWA 2ASJA 4LIWA 3OL8A 4NL5A 5D0GA 3AT1B 4K2JA 3IR5B 4CM2A 4L74A 5KG4A 1TKXB 2DNHA 1RLCL 2XGPA 3OTOF 1O6XA 5HMWA 1SL0A 3GYXB 4OYXA 1PO6A 2IYIA 1T95A 4DX5A 2J9CA 3BN4A 3MM7B 3MI7X 3VAJA 2VDIA 3PACA 3MM5B 3O3LA 3EZ5A 4TU9A 3K5NA 3D6FB 2FQQB 3MD1A 4GKKJ 2NZ4A 1Q8IA 4R25A 1S1WA 2OFGX 4LQ9A 1RI7A 1DHMA 2PA8D 2WW8A 1OO0B 4Q43A 4UOFA 3MMAB 3MEEB 1RGVA 2E1MC 4OYMA 1LOUA 4IO1A 4C3KA 5BYQA 1B7FA 3CCWA 5F8NA 4LF6J 3DGPB 2AGOA 4X4NA 2IVYA 3MPVA 2MQQA 4QR2A 2LEPA 3IBFB 4F67A 4USIA 3OL6A 3VAFA 1YJUA 1HHQA 2HWIA 4EYHB 1EP4A 1HBNB 5DRKA 4G3IA 2HZAA 3J80U 2XM3A 1RTIB 4ZK7M 3RTVA 4OHZA 1AB8A 3MAHA 5F3TA 3JQJA 4OLPA 5CCLA 2FVQA 1EETA 3G6VA 3AFGA 4UY8T 5LXRA 3EGVA 2W2NP 2J6SA 2HHHF 3SV3A 4DOZA 2ZM6J 2HVDA 4A8SA 4M5DB 2KHCA 4C6AA 4TLRA 2F9JA 2DB1A 4YR3A 5T14A 4AQYJ 1NJIT 2BJ7A 3FBCA 1BD6A 1C2PA 1R89A 3DOMA 4ELVA 4C3MA 3NEKA 5F9NA 2F8MA 2Z4PA 2G0CA 3UCGA 1UVIA 5CYQB 1OY8A 4BC9A 3Q2SC 3PEJA 4USMA 3P49B 3FEXB 2E9TA 3CJ3A 1HNWF 1L3UA 1VJQA 3KJVB 4IFYA 4NA2A 3KK1B 4HTJA 3QJJA 1B7YB 4RW9B 2V8GA 1N54B 2R7SA 5EWEA 2ZBCA 3H42A 3CB4A 1KP6A 2XI2A 3US5A 5JVHQ 5D15A 3V81B 1VQ8S 1B0PA 2BXJA 9ATCB 4I69A 1APSA 1RT2A 1EZZB 1HLWA 4KHMA 1TL7A 4DQRA 4KFBB 1KTVA 4OZ3A 4TYAA 1HMVB 1FWPA 1DRZA 3KLEB 4ZVTB 4M5KA 1QLNA 2Y3YA 2R7TA 3LP2A 3PHEA 1IWAA 2M3DA 3UO0A 2WOMB 1DQAA 4J9NA 4OJGA 4F7VA 2F8HA 4HEA9 2BQUA 2N7YA 1LFWA 2Z30B 5F9LA 4DSJA 4BLGA 3MAAB 4KAIA 3D3CJ 4JI7F 4WFZA 3SSRA 3M4XA 3CO0P 4WF9Q 3M1VB 4RW8B 3BGLA 1S7IA 1CJTB 2DH8A 3ZTRA 1X31C 1CC8A 2EG2A 2MQLA 2AKWB 4P10A 3N6MA 2CQ4A 4QJVA 3N5BA 2IPOB 1KN6A 1TMJA 2ZOFA 5GAHU 3QYYA 3D1OA 3R5CA 3OVBA 4DX6A 1XTZA 3SCLE 4KH0B 2VKZG 2D3UA 2GC8A 1HBOA 1DJ0A 5EHHA 2JH3A 3HLUA 3TAMB 1NO8A 4Q44A 1RWKB 4YY3J 2RAQA 4FKXA 1GNKA 2VG6B 2G0IA 5M2PA 2C1EB 4GKKF 4RU9A 1DLOB 1FKOA 5GAGU 4U8VA 2H51B 4LRBA 1Q82T 5J1PA 5LOQA 1QE1A 3U1NA 4B9LA 1IKXA 1GXUA 1HQEA 1VK8A 4CCHA 4RNMA 1FVSA 1OJ4A 5F0UA 3RRHA 4B08A 3CDBA 4Y2CA 2RMLA 1N48A 3ITHA 2C2EA 2EPIA 4LF6F 3MUMP 2GJ2A 4DHVA 5E41A 2EFPA 4QU6A 3ZZ0A 4ZVGA 4YDXA 4CLLA 1T3NA 1NNDA 2DNKA 2Q6BA 5KG6A 4R5PA 4CLTA 5C7PA 2VFSA 4KRWA 4MK7A 4EI2A 1VBYA 3Q89A 1Y4ZB 1AT1B 4OI0A 1VQMS 4C11B 3IA0A 1MG7A 2BJDA 1RAGB 5LJ3Y 1JX4A 3IC1A 2N7CA 1XR6A 2ZM6F 4C4WA 2V2VA 3A3OB 5HSPA 3L3CA 3MR3A 1TKXA 4M8LA 1AFIA 3ET6B 1T02A 4UZBA 5FJ4A 3TJAA 3MM5A 1FCAA 1XMOJ 2HBYB 1S1TB 3L7PA 4TU8A 2KXNB 2EK1A 1YJWS 4LF2A 2P8IA 1VIOA 3L4BC 2ZOGA 3CJKB 2XTJP 5JMNA 1WKKA 3B8HA 4QU7A 2FPHX 2BJ1A 2H5JB 2BKPA 4PXCA 1Q8BA 3GIRA 3B54A 4OHXA 2WAQD 3MMAA 3DMJB 4ZKAA 2L08A 3JSYA 2ZH2A 5KG5A 1FRMA 1Y9OA 5F8GA 1Y10A 3FUYA 3OFGA 5ETTA 2XLJA 1WACA 2PMHA 2C2RA 1F6TA 4JUZA 2CQ1A 3BDEA 3RRKA 4P73A 3KJFB 1GMVA 2XZDB 2E5JA 3NCRA 2J9DE 4F50A 3SQGB 3DLBA 3DU5A 3Q8PB 3KLVA 1L3KA 3D3BJ 1HBNA 3CCTA 4ZVOB 4ZA1A 3FC9A 4QYZK 1SVDA 1RTIA 1SKSA 3FBEA 4F0HA 1CLFA 1YRTA 2A0FB 5CYJA 2DHGA 1RT1B 4FNHA 1P27B 5EDWA 4OZNA 4ED3A 3SSQA 1RJJA 3NWRA 3HFVA 1RB0A 3CCES 1N0VC 1KWMA 4CLFA 1REVB 4CRJA 3FSXA 4WU3A 3ENVA 2C22A 1FJGJ 3KHRA 4FS1A 3B4MA 4M5DA 1I3OB 1MW7A 2I5JB 4DU7A 3I82A 3MAQA 3EGNA 3IR6B 2FZGB 5KFVA 4XPEA 3H2LA 5I3PA 3Q8UA 4NLVA 2YQ3A 1Q1KA 2ZHOA 4ZN1A 1YWXA 2NXEA 1DQ9A 4GRSA 2NUUG 2CJBA 1G4CA 2ZE2A 4NMLA 3H5YA 4FXVA 1TK5A 4OMFG 5EGYA 2U1AA 1OPZA 4X84A 4YY3F 1JQGA 1ZM2A 1YITS 3HX9A 1HKAA 2X51A 4M5MA 4WTYA 2QL5B 2EFVA 3PM9A 2GVZA 4RW9A 4S0MA 1HWKA 2DNZA 1HNZJ 4P2XA 1FJ7A 1GH8A 3I55S 1DTQB 1J5EJ 3BKFA 3RUBL 1ZBTA 4C97A 5L8RC 2AYBA 2XNQA 2DGWA 4JI2J 2R8IA 3ZZYA 3RU0A 3K8WA 4ED6A 2Q43A 4IQXA 1C0UA 2MKJA 2F4FA 5IV4A 3GFYA 2YQ1A 1S77D 4KFBA 2IMOA 5IZHA 1X5PA 2OUGA 2HBQB 2FY1A 1HMVA 2WK4A 4Y2KA 3VQTA 3A8KA 3HM9A 3KLEA 3RYLA 3MD3A 2XMKA 4QWCA 1FDNA 4BC7A 2WOMA 3MWBA 4FYVB 3OFFA 2DRBA 3MEDA 4C0BA 2DRDA 3MM8A 5ITHA 2HHWA 4IO9Q 3QSYB 1MN7A 2WSEC 1NJWA 1KR4A 1FA0A 2VF3A 3MAAA 1R27B 1YJ9S 4ED1A 4RWWA 2P5VA 4B9NA 1JLQB 4LBPA 4QIWD 4ANCA 4Q2LA 3M1VA 2PE8A 2JZ5A 3TX8A 2VOOA 4K4XA 1M5SA 5KT6A 1ZZFA 1DTTB 4P2SA 5HMYA 4L75A 2E9ZA 3ISND 4W90B 3QLHB 2HURA 4O3OA 4LMZA 2CVEA 2KI2A 3R6LB 2CQBA 4KPCA 2UP1A 4H4MB 1WTBA 1R8HA 1RKIA 4G1PA 3T5LA 2HQCA 1RTDB 2JHEA 1VLOA 2FY8A 1XMOF 3BBCA 3GB0A 4L6V3 1GMUA 3O8WA 2VG6A 2CJXB 2AEJA 1DLOA 3M32B 2FVRA 3G4SS 1YTYA 1U6FA 3Q0AA 3BEGB 4KTQA 1YVFA 2FJBB 3BJYA 2BW2A 1BWEA 3KWMA 3Q8YA 3C8YA 2C2KB 4O4RA 1Y3KA 1O8BA 3SCIE 2RQKA 2CQIA 2LQ8A 1FE0A 4WBFA 2K1RA 4DLEA 3D68A 4Z2XA 3LPEA 4WPAA 3KNAA 4PXEA 2HFZA 9RUBA 3EGWB 3K57A 2E9RX 4ZPBA 5ETVA 5KFAA 1IBKJ 4FP9A 5KFQA 2GJIA 2XYHB 2AMCB 4I2QA 3T9NA 1WHXA 1S57A 3LGHA 1AYEA 2ZUGA 1G2EA 4N8OA 5CABA 3D6MB 3DLEB 1FNMA 2B5JB 2CNOB 3CD7A 2BJ3A 2KB2A 4C11A 2OKQA 3K2YA 2HNDA 2XI3A 3ZFVA 4J9MA 3K5PA 1FJGF 4NCAA 3IWXA 2H3EB 2OI2A 2FHJD 1VQOS 1N5TA 4KGKA 2J5AA 5KFKA 3D28A 2BQ3A 2YNGA 1HQ2A 3P4UB 3NMRA 4CLUA 3NKYA 3O2IA 3G6XA 1U25A 4TVAB 3O5TB 3KDOA 3ET6A 3QBCA 1RWPB 4JI6J 3LOUA 4XIUA 3LANA 2YWKA 2AW0A 3OW2R 2OPQB 1Q0NA 3TZXA 3J7YU 2FC8A 2M70A 2ZBRA 3VV2B 1S1TA 2CQ2A 2MXYA 2AIRB 2HMIB 1Y5NB 5IM0B 2W8LA 4A8FA 5L1LA 2IM3A 1RYRA 2VQFJ 3FCVA 4DPXA 2ZWOA 2CPDA 1NK6A 1SH2A 1HNZF 2DGOA 4IQMA 3M6XA 3MPWA 5JVGQ 3TRGA 3DMJA 3R27A 2LYVA 1J5EF 2EWHA 4CT9A 2AT1B 3KG1A 1LW0B 1B70B 2RS2A 4U7UD 4JI2F 5D0EA 5IFMA 4NXNJ 2KVIA 4UF4A 4PG8A 1KFDA 2L9WA 4X4SA 1RA7A 2ZJRQ 1U45A 4KJIA 1LWXA 3G8QA 4UOGA 5F0WA 2QA2A 5A6PA 5F3ZA 2OTJS 3G82A 2FVSA 3UVJA 1TK8A 5J2MA 3PW4A 1RT1A 4FZVA 4KE5A 2B56A 3GWCA 4O23A 1WOSA 4C8ZA 1NH7A 5E3CA 4RBUA 1XR7A 5LSLA 3GCWP 3BO2A 2RU9A 1FNXH 4DR6J 5E3AA 3R1LA 3QGGA 3DI6B 4W4MA 1VQPS 2F5GA 2D69A 1PSDA 2I5JA 3TZYA 1BQXA 1M0SA 2W4DA 4NYOA 3PX6A 1TVRB 2ZZNA 2NSBA 2KH9A 3BR9A 2IHR1 4ZHRB 1HNIA 2HFUA 2DR6A 3TVKA 3TYTA 1GAOA 1T94A 2DO4A 4J9QA 1TL3B 3POTB 2NLWA 4HDHA 4CNYA 1NK8A 2HHQA 3EGZA 4XDCA 3Q2TC 3VWSA 1U0SA 2CWXA 5BR8J 2DNGA 3TOQA 5KFJA 3MEGA 3S6EA 4RUHA 1F5AA 2V8DA 4ZN3A 2BW7A 4WK1A 3PFOA 4JV5J 4RNHA 3MMBA 1SJRA 1REGX 4DJBA 1YRXA 3LTOA 1SH0A 3AH6A 2MZTA 3FCWA 2ZH3A 3NBPB 1RZMA 5CD4A 4JI4J 4YQWA 2Y1IA 1WEXA 3T5JA 1Y5LB 4DI6A 4DN9A 1IBKF 3P96A 4GC7A 3U02A 1TMMA 2IBKA 1B64A 2DGVA 2ZDPA 1LV5A 2ZC3A 2B3TB 2RDJA 3C15A 1WTFA 2EC2A 2UXDJ 4OI6A 1JLAA 3CPWR 2V2QA 4OV1A 4BWMA 3R5JB 3N6LA 4K4ZA 2G0JA 3D0GE 3MR6A 1OSCA 2V4RA 5KOXA 3QT6A 1JLQA 1CVJA 2GO8A 5L38A 4ZVRB 1WSVA 3GMGA 2J9EA 1X5SA 4M5NA 2AGQA 3T5KA 2N4DA 1DTTA 4UQTA 7AT1B 2VV5A 1LWCB 5E3PA 5DETA 1PCAA 3ICLA 2W7OA 4DPYA 4JI6F 3V2UC 1UFKA 1F5BA 5DZ7A 4USUA 4CQ1A 1HQUB 2R2SA 2HFVA 2O01C 1FJCA 4USVA 1ZM3A 3GFHA 1WC4A 3Q83A 3I4PA 1BQMA 4ECWA 3M32A 5HVHA 2AF6A 4MT1A 5CCMA 4FYDA 1TTHB 2QX0A 3M2VB 2VQFF 2OJ3A 5D4PA 3QZ8A 2Q66A 3W61A 4EEYA 2QC3A 1HHTP 2QYGA 2XNRA 1Q8KA 1VIXA 2CQPA 3W7BA 1OMSA 2KYXA 3EICA 4DZ6A 4NXNF 1HWJA 1YK9A 3G96A 4ZCLA 2D3ZA 3W63A 3P3DA 4KR0B 4K4YA 2B9WA 4A8OA 4KT0C 1VISA 2XC9A 2VPYB 4ZVQB 2KFZA 2PO4A 2IRXA 1FDAA 5DG7A 5A2QU 2QL9B 2E29A 4IH6A 2YWHA 2J0SD 1Q78A 3MECB 2BOAA 1YZ7A 2GVDB 5D4OA 1N0UA 4TY8B 4WKRA 4LR8A 1OPIA 3GYGA 2YWWA 4C9DA 1JNRB 4CO0A 4QPXA 5J2NB 3QGPA 4KKOA 4EUVA 1V5IB 4FBTA 4DQQA 2I9SA 2FZCB 1P9YA 2JLFA 1BC6A 2ZH5A 4WZQA 1YJNS 4AL7A 2JDJA 5B0EA 4UQGA 1SKWA 2K7JA 3M9OB 4L3NA 3IN5A 1VC6A 4OI3A 3RB0A 4PYAA 2C2MB 2CADA 5HN0A 2XYGB 5H9EJ 3I0SB 5E0OA 2PMWA 1X8DA 4A47A 4ER8A 2WONB 3NNCA 2YKPA 1QAIA 1U24A 2DITA 3C66A 4DFKA 3IM8A 3LWLA 3BQ1A 4WP3A 3CC7S 2MLYA 1D09B 4TY9A 2KM8B 4F0KA 2OPQA 3D54A 3M8QB 2BE2B 2IAJB 3NCPA 4HYKA 3FEYB 5THWA 5IV3A 3RR8A 4F4KA 4DUTA 2HMIA 1FO1A 1M5OC 2PMZD 5IM0A 3VGTA 4CTAB 1MWZA 4OI4A 2R8HA 2JJ4D 1C1CB 5GMKa 2L41A 1YJRA 5BR8F 3D1QA 2RF2B 3IWNC 5DLFA 5HROB 3FMWA 3HSJA 4P6QA 4X62J 2Y0SD 1HD0A 3BPSP 5DG9A 1KTQA 4JV5F 3P45B 2HWHA 3PJ9A 1RU1A 2LQJA 2GHVC 3PX0A 2NZCA 4C3LA 3K5LA 2N4CA 4A46A 4JI4F 2HQDA 4H4KA 1D3WA 4DL5A 1F1BB 2XMWA 4OYPA 1X4EA 1ZTWA 5KFWA 3H0PA 5GADU 3FK4A 3DHWC 3BH7B 1N56A 1X4HA 1GQEA 2MJUA 1N8RT 2UXDF 3OLAA 2XYPB 1D8YA 5HK4A 5L1KA 5ETRA 4LSLB 1C0TB 2CIMA 5BYSA 3DDIA 4IG3A 4KV8B 1NHUA 3RBEA 5FIIA 1FTCA 2HAFA 2VG5B 1UWBB 3CJ0A 2HIQA 1TVRA 2MB0B 1J5OB 3W5ZA 2YQ0A 4I68A 3AB4B 1RWNB 4ZHRA 3UFCX 5LSRA 4QW8A 3FRZA 1SKUB 5ETLA 4TYBA 2PFDA 1VYAA 4AE5A 2VFUA 3LGNA 2DXEA 3HXMA 3GZ7A 3JQMA 3SDEB 4LF9J 2W7AA 1B4SA 1NDCA 3ZTSA 3D0IE 3SYZA 1EQ0A 3PYGA 1SJ4P 3A8JA 3KJNB 4ECXA 1M5VC 2HNZA 2EKYA 2AJ2A 4PWWA 2V34A 1BWVA 3EDQB 3JSMB 3QT8A 1IBMJ 4CLWA 2QRRA 3DOKB 3F0NA 4DL2A 4N76A 2QT7A 2B7BB 3SV4A 5L1IA 1S7HA 2OMLA 3GSDA 4KH1B 4JBCA 2NYHA 3DDNA 2W9CB 2AJ4A 3EZOA 2W9BB 3KOAA 1QTMA 1RWUA 2BYCA 4QR0A 2F7VA 4TQSA 3GYNA 3WC0A 2LMIA 4DV5J 5IT9U 2UZAA 5LMUJ 1Q5VA 3Q23A 2ROPA 4OQJA 1Q86T 1H0HB 8ATCB 2L3MA 2ZZTA 4UTGA 3HVAA 3PW2A 5C24A 1HD1A 4MJKA 1HPZA 1CSJA 1VGYA 2ALYB 1WC3A 2ROGA 3UE2A 2JX2A 1LWCA 3JAMU 1D1UA 3UD4P 4FYXB 3UD5A 4ZMMA 2YPYA 2DHSA 3ONQA 3J81U 1NMEB 5BJRA 3GJSB 4I6WA 4E2FB 3MZIA 2OLWA 3RBDA 1P1LA 4OZLA 3ZC4A 3IS9B 3EZUA 2DNNA 2LVWA 4OJHA 4ZP8A 4WE1A 4QQBA 3IRWP 4KHRA 1T05A 2HNYB 5IS2A 2YKQA 4X62F 5DS7A 3THPA 4DXLA 5FLXU 5E3QA 2W01A 3FGVA 3EXCX 2MKCA 3T3FA 3QIDA 2M7SA 3PFEA 5GAHI 3NLCA 4NWBA 3CMES 4EGLA 3MHYA 3QWUA 4URGA 2QLFB 4ZVPB 1HNXJ 3UNGC 1T11A 4JI0J 4Y28C 4NA1A 3HHDA 1U4BA 4YR0A 4KIAA 4HLBA 1S6PB 1K9MT 3CJ8A 4B9UA 3R3TA 3Q22A 1SH3A 4TY8A 1RUSA 1TV6B 3N0VA 3K8VA 1WDTA 1R3NA 5GAGI 3V4MA 5J2NA 3HVTB 2K7KA 1K1QA 2C3OA 3MFIA 4DFPA 3KXDA 2GIQA 4OHVA 2F63A 2VPXB 2Y8YA 4QW9A 5J2PB 1UETA 1ZA1B 1VI7A 5G4DA 3C16B 1R6VA 4K4TA 2C3YA 2M52A 2DR8A 2QFIA 4CLYA 1HIYA 2HW3A 1OYDA 2BJ9A 3M2RB 2WBRA 2RU3A 2PIIA 2KFNA 1X4GA 4I7FB 4DX7A 2WONA 2PGCA 3G87A 4DV0J 2FLPA 5KFCA 4JI1J 4FN5A 1GTEA 1G1XA 2H54B 4ES2A 1OY6A 5ETNA 2QEXS 1ROFA 2LECA 3M8QA 5HQMA 5KFSA 2BE2A 2IAJA 3SXLA 2IYGA 2P6TA 2IVMA 3BS9A 5L1JA 2Z2YB 4LF9F 3UDLA 1OWXA 3IM9A 3CDWA 3CD6S 3TANA 4C8OA 1UPPA 1D0EA 3J80Y 1KLNA 3AHPA 3BGRA 1C1CA 4DSKA 4Y2MA 5E7OB 4B9TA 3OUYB 1WC6A 3R8YA 2RF2A 2RILA 1HNVB 2BZ2A 5HROA 1RWMB 2DXFA 2HEKA 3VVUA 3KG0A 2VD3A 1OIAA 3KYLA 1T8EA 3MMJA 1IBMF 1DAXA 2B4OA 2DPJA 2YKOA 4P2MA 3BO4A 2CNNB 1T9VA 2XY6A 2YBVA 1NHVA 1PGZA 1JLGB 3NRBA 3KLFA 5DDRC 5GAEU 4IR1A 3Q8VA 3VF0B 3GILA 2D41A 2CZ9A 3BKUA 4DV5F 1NB2A 3ZZOA 3MEKA 5LMUF 2POKA 3MMCB 2O67A 5KFFA 2CQHA 4IR9A 1VQNS 4F04B 3MCSA 1VRUB 7FD1A 4PWDB 1V3SA 2VBXA 3MM6B 2R3VA 3D67A 4C0OC 3KLHB 2VODA 2D3OR 1WORA 1UWBA 3FZ2A 1SL1A 3D6TB 2OGUA 3W2WB 4W98A 2EFQA 4IDKB 1TKZB 2GHPA 2IC3B 1J5OA 3JSRA 4DV7J 4BCAA 4NASA 4F3MA 1NHKL 4YOEA 2GV1A 1Q81T 2FLOA 3M9MB 4YUDA 2CQGA 1S76D 5EWGA 4U9RA 4ZLLA 2R7RA 2W2OP 1J27A 4DV4J 1RAOA 4HR2A 4OFZA 3V6HA 3QIPB 1NRKA 1NLKL 2FC9A 3MPYA 4W92B 1VOMA 2XMTA 3M2UB 2MZSA 4PZVA 3RAMA 3HP6A 2DNOA 1E6YA 5H9FJ 4WIQA 1IKYB 2AYEA 4C48A 4JYAJ 1EX8A 1WNEA 3AJ1A 1UVKA 1WOPA 2B4PA 4ZIVA 1W26A 3PTWA 1RKJA 2KL8A 5JUMA 1M1KT 1UFWA 1EKSA 1LXNA 1UWAA 1FFWB 2V8VA 2HSEB 1XBWA 3JSMA 1U1OA 2G9OA 2CPIA 5DM6Q 4I0WA 4LT6A 3T41A 3DOKA 5A8RB 1XERA 3CDEA 3UR3C 2C3MA 3EE3A 2MZQA 3LGMA 1HNXF 1LWFA 3CUNA 2L9DA 2HHSA 5HQ8A 3C6UA 4JI0F 2F4VJ 4X4UA 4Q45A 1XJWB 2VC1A 3EUNA 1RTHB 1H3DA 5B0GA 4MMOA 1IKVB 4O3SA 1QM9A 3IG1B 4Y3CA 2UU9J 3UN3A 1FXLA 3QJLA 2ILYA 4B3RJ 2VBZA 4F3QA 3PVXA 1P8GA 2HK3A 1UEUA 3HK2A 1N6QB 3A4TA 2B4UA 4O4GB 4ZPDA 3GFXA 1S6QA 4WTOB 4UZCA 4EZ6A 2XBPA 5KFDA 3G6YA 2JC0A 2O66A 1H6KX 2IJNA 5M2UA 1O5JA 2Y0BB 5EN1A 1SV5B 2HQ3A 5GMDA 1R6YA 2IM0A 2CDRB 1UJ5A 4GVLA 4J7CA 4ZVHA 2IA6A 2ERRA 4JI1F 4Y0FA 5HLFB 3QFHA 4NLOA 4A8KA 5DQIA 5KT4A 4LSNB 5H9EK 1KQGB 1Q5YA 3IS9A 4HACB 3HD1A 3TUPA 2CZVC 1MROA 5KFRA 4JOUA 4O3RA 1RT3B 1IM4A 3ADAC 1RHKB 1EHWA 2DTJA 1HBMB 4QIVA 2IA0A 4LFAJ 3CCUS 3K89A 4U7UK 1RWOB 1RTJB 3VALA 3FMBA 4N56A 1BXNA 3RZAA 1QVFR 3PYFA 2XSJB 3GR0A 3H25A 2HS4A 2BM1A 3OR1B 1FE4A 3ENWA 1RHQB 1QAXA 1NPKA 2CPYA 1ICEB 3VAMA 3RB6A 2G2ZA 4RW6B 2AP6A 2HIYA 3CE8A 1B0VA 1JXEA 4IRDA 2RD5C 5CH7B 1HL6A 3UNYA 1S6PA 4U6PA 2F65A 4PABA 3FBFA 4WP9A 1HYSB 2ACMA 1VFJA 3H59A 2HHPA 4CI0B 3FSYA 1CS4B 2EK6A 3D66A 3JTOA 5HVGA 4Y34A 5D6GA 2HVHA 3RW6A 2Z56B 3Q24A 2MKHA 4RNOA 2OFHX 2YNIA 4TQRA 3SZ2A 4FF3A 4TNOA 3W66A 2AJ0A 3W5YA 1MU2A 5KFOA 4EBEA 1RAJA 1NK4A 4ID8A 1FD8A 5J2PA 1SQEA 5SUHA 2I8EA 4YB7A 3W62A 2D1CA 3RG6A 4MIBA 3OQ2A 1AW0A 4OV6A 4WWSA 3PG9A 1BMQB 2DHAA 4A8MP 4I7FA 4XDDA 4DV1J 4DV7F 3CCZA 4PEOA 1U7LA 4QIGA 3NGTA 4FKYA 4K7QA 1YSJA 2JRSA 3BYPA 4X4OA 1CQNA 3DYAA 4RWXA 3JXOA 4KO0A 1FK9B 1S97A 2R8KA 3DM2A 4ES1A 2ZKTA 1VQ7S 2VG7A 1RQ0A 4DV4F 3CULA 5B0DA 1WKJA 4QIFA 2DVIA 1S79A 4X64J 1EB0A 4MYTA 2QN6B 4YB5A 4JYAF 3DRRB 3NXZA 3G2XA 2HGMA 5KFLA 4MH8A 1HWIA 2YX7A 1V3ZA 4CP5A 2YH0A 3NOCA 4DU8A 5K14B 3GSIA 4GMKA 2XO6A 4ECVA 5ETKA 3HSDA 2AEFA 1Q16B 4WU2A 5DDPC 4TLQA 1FFSB 3EX7B 4YB1P 2DK2A 1TFWA 1ULRA 2M4MA 5A8KB 5C25B 3G8TA 2F4VF 3FVYA 1VCTA 2FJWA 3J7YI 1R8CA 1E6VB 4ATNA 1JLGA 2X3DA 2FHMA 2RDIA 1IXKA 2VIHA 2XHWA 2V9WA 2UU9F 3DU6A 3TUZC 3PR5B 2AQ4A 4B3RF 4DL3A 3PR4A 2HQIA 3GONA 1VC5A 3UN2A 2LQBA 3CJ2A 3MMCA 4JI8J 3IWLA 3HHLB 1VRUA 1MMNA 3RBXA 2MHEA 1FI4A 2C2ZB 3MM6A 3KTQA 3KLHA 2ADCA 2E5LJ 3HO1A 4M5IA 3DRPB 4F2SA 1UFLA 1YBAA 3W2WA 2M0GB 3U27A 2IC3A 3BQ2A 1M5HA 2BE9B 3J7AN 2HS0A 5D4NA 1Q95G 4X4PA 4WCEQ 4DUYJ 4F4WA 2UUBJ 4ID5B 3TEHB 5E3RA 2JLEA 1F9FA 2EBEA 4LFBJ 1V3RA 3CC2S 3TR5A 2F8EX 2SXLA 1VRTA 1CG2A 5HQLA 3NS5A 3V6DB 2IRYA 1U1MA 4KGXB 1EAYC 2NXCA 3AA9A 3CSKA 3G9CA 4CLPA 1KHWA 3N9UC 3M2UA 2I6WA 3DKDA 3BSNA 2WZ1A 2ZZMA 4XTTA 3SBMA 2J7KA 1KD1T 4LFAF 3ZO7A 4RR5A 4O0IA 1RT5B 3I5BA 3DRXA 2MKYA 2MDAA 2IDEA 1S1XB 5A8RA 2EG1A 2RKIB 2JC1A 1TELA 1UPMB 4UUWA 3T6BA 3CCMS 2BX6A 4DSFA 5B0FA 4DG1B 1RTHA 3TJ9A 2DR5A 4NLWA 4USTA 2CPHA 1SC3B 3KNGA 2GAGC 3MCOA 5HI7A 1FRXA 3LALA 3I4HX 2IY5B 3IG1A 2GS8A 3PX4A 3I31A 3ZZUA 2GGPB 4OI1A 4MFBB 3H40A 3IXQA 3CCRS 3JYTA 1JK9B 3KUEA 3RR7A 3NAHA 3HHEA 4O4GA 1LW2B 2OSQA 3KG4A 3DFEA 1L3TA 3GCXP 1YI2S 3MCNA 5HATA 3HVWA 2FHKA 5HANA 1PAUB 5I3UB 4NRUA 2DR7A 4CO2A 3DLKA 1SV5A 3FQKA 4DV1F 2LFVA 5AXKA 3CF5Q 1G6BA 3LPYA 4JI5J 5L9XA 3BYRA 4NCGB 4I4BA 4LFCJ 1OQ6A 1SXLA 3I9ZA 5KFPA 2UUTA 2ZITA 4HACA 4LRAA 2E66A 3BQ0A 3BSOA 1RT3A 2XEXA 4X64F 4FF1A 1BHNA 3I5CA 4F4YA 2V68A 2MQPA 4EO8A 3LP1A 4ILLA 4GO7X 1HBMA 2ADBA 5E33A 4YMEA 3CD5A 3M8YA 4OZ1A 3NMAA 3RAQA 1NJZA 2W7PA 2ZHAA 2ZBIA 2HRYA 1X4DA 2HVIA 4IOBA 1C1BB 1MMLA 2VBWA 2RQMA 3HDSA 4FYYB 1CJUB 2XSJA 3PNIA 2Z2MA 4ZVUB 4CYUA 2DPIA 4OZ2A 4P74A 3OV7A 2KG1A 3CC4S 4K4UA 4RL1A 3HZEA 1CQMA 5LSOA 2O1PA 4HTIA 2KFYA 3PHTA 1UW4A 3OT9A 4RW6A 1RU2A 1Y11A 3PKMA 5AT1B 3RJMB 5IXUA 3FFIB 1ZPVA 2KHDA 4Q0BB 2C3UA 1Y7PA 1HYSA 2RQCA 1S0OA 3IMQJ 2XY5A 5J1EB 2OPPB 1C4AA 1CS4A 4FPIA 4YN3B 5T7LB 2XMJA 3C19A 4V1Ak 3GG1A 3SFUA 5B7WA 4RZRA 2QA4S 2E5HA 2ZHBA 4JI8F 2XMMA 4FBUA 5KFIA 2KRRA 5C2GA 3LWMA 2E5LF 3DC2A 4KB7A 2FLLA 1VQ9S 2DNYA 1RSCA 1SI9A 1WHYA 3PCOB 3PRDA 4HT7A 3QFWA 4HH1A 2CQ0A 1FDBA 2DIUA 4I2PA 2UUBF 1SC6A 3OR2B 1SJQA 1MLAA 2OPRA 2CQCA 4DCOB 3LO3A 3EDRB 4LFBF 1PJ7A 4KBIA 5DZ6A 4F25A 2MGZB 3MPDA 2KDOA 3BREA 3W9IA 3CJTA 3OTDA 4DDFA 4K4WA 2ZNZA 4LRFA 3TVZA 1DARA 1F5CA 3DRRA 1BUXA 2VA2A 1N33J 1I1GA 3TUIC 2H5IB 4MKYA 2MQOA 4N7TA 4A8YA 2RT3A 5K14A 1JLBB 1URNA 2ZH6A 4PKDB 1U0HB 2FHOB 3CEDA 4X4VA 5H9FK 1FFGB 3I9V9 2DXDA 4DBQA 1UW9A 1JB0C 3BN7A 3ZZTA 1DZ5A 2DO0A 1AROP 4J9UE 3M05A 5C25A 2NYIA 4DQIA 3GIJA 4J91A 2DJWA 2CUYA 2DR9A 3OD2A 4B3OB 4AT1B 1WOOA 4J9LA 2PFFB 5FDLB 4ETZA 2GW8A 4NEYA 3IR7B 3NGKA 4O3PA 3V4IB 1Q4RA 2OIHA 3NY0A 1K47A 1EJ7L 2MZ1A 2NUHA 2A18A 2B0GA 1FERA 5I42B 2DISA 2J6UA 4FDFA 3ENAA 2RE1A 1RABB 1JLCB 1HBUB 2XWYA 3CCLS 3RW7A 2X3GA 1R31A 3DRPA 2EI5A 3QATA 5AE3A 3PIPQ 3HHNB 5SZTA 1KFSA 2YNFB 3MXHP 3UQSA 2BACA 4B17A 4FF2A 3DXSX 4JI5F 1VLYA 1M1GA 4AQYF 1NH8A 4ID5A 1VHFA 3KLGB 4DPTA 4C2MA 4LFCF 3VAHA 4ZS6A 5L9NA 3HVRA 1NEEA 1MN9A 1ZOTA 3CJ4A 3V6DA 3D2WA 2E7WA 3KKFA 3HHKA 1RT6B 3MM7A 4RKUC 1AUDA 2DGXA 1VDHA 1WHWA 2HQFA 3EMTA 1S9EB 4OZ0A 4IUFA 3M6WA 4QIEA 5B0BA 8RUCA 4M1KA 3FZBA 2JLGA 3QZ7A 4MKAA 2GZOA 2LA4A 3N5FA 1S1XA 1X4AA 1U09A 2H1YA 3MEEA 2XMAA 2E1RA 2VU5A 2Y1RI 1S5ZA 2Z58B 1FXRA 5A8WB 1WF1A 4DG1A 4F8RA 1K8AT 3DGPA 1FRLA 2U2FA 4ZLNA 1VQ4S 4DN0A 4ZPVR 2YWEA 2YNHB 1WG1A 2XY7A 1I94J 4OYAA 1S1WB 1R8BA 2GGPA 4MFBA 3NWGA 1A0OB 1NKEA 2OEJA 3R5AA 5D0HA 4HVZA 2FVCA 4ECTA 5D4LA 2PD1A 1SJ3P 2ZDOA 2ATLA 3VVTA 5I3UA 3I56S 4LBIA 2E1CA 3BBFA 3GQCA 2IIHA 2P9GA
chains in the Genus database with same CATH topology
2MQ8A 1HNZJ 2UXBJ 4HHUA 2KL8A 4GKJJ 5BR8J 2MEWA 3JAMU 4JI0J 4LF7J 2VQEJ 1N34J 4K0KJ 1XMOJ 4NXMJ 4JI5J 4X64J 4JI8J 4DR6J 1J5EJ 3IMQJ 1IBKJ 1N36J 5A2QU 4PWWA 4DV2J 4KHPJ 3W1YC 4LFCJ 4KY3A 5IWAJ 4JV5J 5LM7E 2E5LJ 4DR2J 1N33J 4JI2J 1IBMJ 2VQFJ 3J81U 2KVQE 4GKKJ 1FJGJ 4V1Ak 4X65J 5AJ3J 1XNQJ 2ZM6J 1IBLJ 4DV6J 3R2CJ 1HR0J 4JI4J 2F4VJ 3J7AN 4LF8J 4AQYJ 4DR7J 4DV7J 1XMQJ 3T1YJ 4X62J 2UUCJ 4LF4J 4DUYJ 4DR3J 4RJVA 2UUBJ 4YY3J 1HNWJ 4X66J 3OTOJ 4KYZA 2UUAJ 2MTLA 1I94J 4JI7J 2UU9J 4NXNJ 4DR4J 4B3MJ 4LFAJ 4DV3J 4LFBJ 4B3RJ 2UXDJ 4OX9J 4JI3J 4LF6J 4DV5J 4DR5J 2UXCJ 5IT9U 4DV4J 4B3TJ 4LF5J 5LMUJ 4DV1J 4LF9J 5FLXU 4NEYA 4DV0J 4DR1J 3R2DJ 4JI1J 3D3BJ 4YHHJ 5LMNJ 3T1HJ 4NEZA 3D3CJ 4JI6J 4JYAJ 3J80U 2HHHJ 1N32J 1XNRJ 1HNXJ 4DUZJ 4B3SJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQ8 A;  1HNZ J;  2UXB J;  4HHU A;  2KL8 A;  4GKJ J;  5BR8 J;  2MEW A;  3JAM U;  4JI0 J;  4LF7 J;  2VQE J;  1N34 J;  4K0K J;  1XMO J;  4NXM J;  4JI5 J;  4X64 J;  4JI8 J;  4DR6 J;  1J5E J;  3IMQ J;  1IBK J;  1N36 J;  5A2Q U;  4PWW A;  4DV2 J;  4KHP J;  3W1Y C;  4LFC J;  4KY3 A;  5IWA J;  4JV5 J;  5LM7 E;  2E5L J;  4DR2 J;  1N33 J;  4JI2 J;  1IBM J;  2VQF J;  3J81 U;  2KVQ E;  4GKK J;  1FJG J;  4V1A k;  4X65 J;  5AJ3 J;  1XNQ J;  2ZM6 J;  1IBL J;  4DV6 J;  3R2C J;  1HR0 J;  4JI4 J;  2F4V J;  3J7A N;  4LF8 J;  4AQY J;  4DR7 J;  4DV7 J;  1XMQ J;  3T1Y J;  4X62 J;  2UUC J;  4LF4 J;  4DUY J;  4DR3 J;  4RJV A;  2UUB J;  4YY3 J;  1HNW J;  4X66 J;  3OTO J;  4KYZ A;  2UUA J;  2MTL A;  1I94 J;  4JI7 J;  2UU9 J;  4NXN J;  4DR4 J;  4B3M J;  4LFA J;  4DV3 J;  4LFB J;  4B3R J;  2UXD J;  4OX9 J;  4JI3 J;  4LF6 J;  4DV5 J;  4DR5 J;  2UXC J;  5IT9 U;  4DV4 J;  4B3T J;  4LF5 J;  5LMU J;  4DV1 J;  4LF9 J;  5FLX U;  4NEY A;  4DV0 J;  4DR1 J;  3R2D J;  4JI1 J;  3D3B J;  4YHH J;  5LMN J;  3T1H J;  4NEZ A;  3D3C J;  4JI6 J;  4JYA J;  3J80 U;  2HHH J;  1N32 J;  1XNR J;  1HNX J;  4DUZ J;  4B3S J; 
#chains in the Genus database with same CATH topology
 4OHY A;  1R0C B;  1RA6 A;  4HHU A;  3CWJ A;  3TJ8 A;  2IM2 A;  5HJX A;  1PAE X;  1OS5 A;  4NCG A;  4KHP J;  1MNE A;  1EP4 B;  3W1Y C;  5IWA J;  1X4F A;  1VQL S;  3R5B A;  1U8S A;  1U48 A;  4CWB A;  3X3U A;  3E01 B;  2RRN A;  1MSW D;  3LUY A;  4KGV B;  1EET B;  5CYQ A;  5A2Q Y;  3AD7 C;  3LH2 S;  4CLZ A;  4WKY A;  5DM7 Q;  4PXD A;  2VAS A;  2LEA A;  1QVG R;  2VH7 A;  1N33 F;  3ZTO A;  1FEH A;  3KJV A;  2BR0 A;  3KK1 A;  1BY9 A;  1XC9 A;  1C1B A;  1ZYQ A;  1YIJ S;  1CJU A;  4BS2 A;  3THT A;  2C2D A;  4Q8F A;  3E8O A;  3BSC A;  4RBV A;  4RW7 B;  2LQ9 A;  2JVR A;  1TAU A;  1NK7 A;  1N5Q A;  3V81 A;  4Z37 A;  5E5N A;  4NLR A;  5D0R A;  3DGV A;  2VON A;  4CO4 A;  3ISZ A;  4Q0B A;  1PC5 A;  3VGV A;  5F41 A;  2DH7 A;  5J1E A;  2V8P A;  3PEH A;  4DV2 J;  3L7O A;  4WXW A;  3TA0 A;  5T7L A;  3M7V A;  3OLB A;  4IH7 A;  4XAK A;  5ETQ A;  2HG4 A;  2DNL A;  2YTC A;  1UP1 A;  1SCJ B;  2YY3 A;  5B0A A;  2BV3 A;  1S0M A;  4N41 A;  1TUW A;  3N79 A;  2NSC A;  2OPS B;  1TKT B;  3BGF A;  4CLK A;  2PEB A;  1V6H A;  2CG4 A;  1QTN B;  3CJS A;  3D5M A;  2HAI A;  3TZW A;  2CWK A;  3WZ0 A;  2MPU A;  1SC1 B;  2FJA B;  3MUT P;  4DS5 A;  3UDE A;  4FF4 A;  2RNE A;  1RAF B;  4RW8 A;  1CJT A;  4AXI A;  3AJD A;  3OR2 A;  1RAC B;  3SSS A;  3CJ5 A;  3IBW A;  4LQ3 A;  4QWE A;  4FXD A;  1RWW B;  3T1H J;  3EVO A;  1WG5 A;  2OEM A;  3A3N B;  2GX8 A;  2R9L A;  3PYD A;  3TWZ A;  1GMW D;  4C8K A;  1U8W A;  2P6S A;  1UVM A;  1CBK A;  1N36 J;  1F2H A;  3TAM A;  3QGH A;  3WX4 A;  4ZCM A;  3H2V E;  1GT8 A;  3A3P B;  3HFK A;  4BHQ A;  4X65 J;  3AA8 A;  2BKN A;  1X9S A;  1JJ4 A;  2ZD1 B;  4NLY A;  1YQH A;  2ATC B;  1U0H A;  3KMQ A;  4J9R A;  4DR7 J;  1PJ5 A;  2E7X A;  2KTQ A;  2WVF A;  2JEG A;  2JOQ A;  2VB6 A;  4DR3 J;  1GEH A;  2K06 A;  2WHO A;  2DNP A;  5KAK A;  2RQ4 A;  2Z2L A;  3W60 A;  2JEF A;  2ZBQ A;  2HWT A;  4JV2 A;  3NP5 A;  1HBO B;  2C2O B;  5FDL A;  2YKN B;  4E0D A;  3AB2 B;  2K3I A;  2HHX A;  1UA0 A;  4LBH A;  3M8Z A;  1LK5 A;  1TUV A;  1FKO B;  2ZKU A;  5KFE A;  2QE5 A;  2A6O A;  4P71 A;  4FPR A;  3WQP A;  3GR1 A;  4CH0 S;  4LF7 J;  4LR9 A;  1JLC A;  1CPZ A;  1IKX B;  1RK8 A;  1HQE B;  2ZEJ A;  2H9Z A;  4CO1 A;  2HYI B;  2E1P A;  2UV8 G;  2G2Y A;  1HWU A;  4IKA A;  3ITH B;  2M2B A;  4RUA A;  4NI2 B;  3KUH A;  1H74 A;  1FX2 A;  3R2C J;  2MKK A;  3I0R B;  4IOA Q;  3VCD A;  2F40 A;  3HKW A;  2IFX A;  4KHP F;  2GMH A;  5IWA F;  4PG5 A;  1SQG A;  1H2T Z;  3FNN A;  3W65 A;  2AYG A;  4R5P B;  5GAE I;  1PYO B;  4P52 A;  2FTR A;  2HVE A;  1Y0H A;  2RHQ B;  4E98 A;  2HS3 A;  1RT6 A;  4YS2 A;  4H54 A;  4CH7 A;  2V5H G;  4X4R A;  3W64 A;  2C3P A;  3E51 A;  1UZH A;  3HF5 A;  3NOG A;  1ZAW A;  3HFZ B;  1PC4 A;  4DPW A;  4A4J A;  4UOH A;  2CNK B;  3BSA A;  4USJ C;  3EPG A;  3PYE A;  4X2B A;  2V94 A;  1XNR J;  1MMD A;  1NDP A;  3I87 A;  3VZI A;  2APO A;  3OL9 A;  5IT9 Y;  4NZ0 A;  3PZP A;  3CJK A;  3CTR A;  3C14 B;  1QSL A;  2MY7 A;  2VDH A;  3V5R A;  3NGS A;  2ZUA A;  3CCQ S;  1U1R A;  3IAS 9;  4P9S A;  1TZ0 A;  5KFX A;  5DGA A;  2KVQ E;  1CUL B;  5EWF A;  1FD2 A;  1N5V A;  5A8W A;  3JAM Y;  2GFF A;  1S59 A;  3DLH A;  2B9E A;  1Q8L A;  2KT2 A;  4NE9 C;  1S9F A;  1XMQ J;  3G8S A;  3OVA A;  3DCA A;  4DV2 F;  3SQG A;  1PBA A;  4P2F A;  2YNH A;  3J81 Y;  2OHD A;  1NJX A;  1FEE A;  5CA5 A;  4LRD A;  2Q6C A;  4PQA A;  1URR A;  1WEL A;  2DEI A;  1IVZ A;  3S01 A;  1U1K A;  3PV8 A;  4K8R A;  3V6K A;  3EVM A;  3N4W A;  1H98 A;  4NLS A;  4M5G A;  1KOO A;  3ILO A;  3M8S A;  1IJF B;  4ZPT R;  4AFF A;  3S8S A;  4NLT A;  2ZFH A;  1VBZ A;  1TL5 A;  1REV A;  1RHU B;  2ZH1 A;  3ILL A;  1M90 T;  1X0P A;  4LIR A;  4G65 A;  4HH0 A;  2J0X A;  3PKY A;  1S10 A;  1NK5 A;  4DUZ J;  4ED0 A;  1M1H A;  3GV8 B;  2HZC A;  2KG0 A;  4J5O A;  2MEW A;  5FLX Y;  2RDD A;  3GJT B;  1UVL A;  2IVF B;  2EC0 A;  1S4F A;  4UOC A;  2QLJ B;  1WI8 A;  2R42 A;  3DLJ A;  3T1H F;  4PAA A;  3E01 A;  4I6Y A;  1S0N A;  3SCK E;  1ZM4 A;  4Y00 A;  5CZX A;  4DV6 J;  3WBZ A;  1RYS A;  2CPE A;  3SEO A;  1LQ9 A;  4JP8 A;  2Q1L A;  4OYO A;  2WB1 D;  3MDF A;  1T03 B;  1GX6 A;  1N36 F;  2QA4 G;  1KKH A;  1GFW B;  3J7A 1;  1PJ6 A;  2BKO A;  3D0H E;  1WEZ A;  5D78 A;  4X65 F;  3K7R A;  3MCM A;  2I1R A;  1UZD A;  2HRT A;  4CO3 A;  3R7N B;  4F02 A;  1FHT A;  5C2C A;  4QPT A;  3D4J A;  1YX2 A;  1PKU A;  3PO5 A;  5CXT A;  3A8I A;  4DR7 F;  2AX0 A;  3K17 A;  4RW7 A;  3N01 A;  1Z2Z A;  3H98 A;  4DR3 F;  2RS8 A;  1DTQ A;  3NCQ A;  3H5X A;  2DGT A;  1SPB P;  3P8B B;  4F36 A;  4F4A A;  1YJ7 A;  5IC6 B;  2FJX A;  3PXG a;  2W4P A;  3NL0 A;  2ZE2 B;  2LXU A;  4ZPW R;  5DG8 A;  4WXO A;  3I32 A;  1LWE B;  2KZZ A;  3GJR B;  3C2P A;  3L95 X;  1RT7 B;  4K59 A;  1WKL A;  1AZS B;  4EZ9 A;  3KK2 B;  2CPJ A;  2AYM A;  1YG0 A;  2N82 B;  2GVZ B;  2GNK A;  3HT0 A;  3QNW B;  4QOT A;  1KRP A;  2FGO A;  2HLT A;  1SUQ B;  5D3G B;  2JSX A;  4LF7 F;  1SL2 A;  3HZG A;  1UEK A;  2OPS A;  5IT4 A;  3VAK A;  4NLU A;  2ZH9 A;  2ZVI A;  4B9M A;  1TKT A;  2UVW A;  2MSS A;  4AL6 A;  2WVE A;  2YXL A;  4ZP9 A;  1C0U B;  5AXL A;  4DV3 J;  2L9N A;  2DHX A;  2DYA A;  1LFP A;  1OQ3 A;  1WUU A;  1T0T V;  3PJW A;  4DFM A;  2E5G A;  5CHC B;  1N52 B;  2J8A A;  4RW4 B;  3GIK A;  3QLH A;  4CH1 A;  1H72 C;  1WF0 A;  4RLE A;  4QWB A;  3VR1 A;  1QJH A;  3CIM A;  2DCL A;  1N32 J;  2XLK A;  3MED B;  3MM8 B;  1IN0 A;  4H4M A;  2LU1 A;  1FKA F;  2YKA A;  3QWP A;  1SIZ A;  4KPY A;  1TR0 A;  1RTD A;  2J76 E;  1NM2 A;  4ECZ A;  2MQN A;  4Q5V A;  2RHS B;  1DUR A;  1NSA A;  1X7V A;  3WHI A;  1BGX T;  3T1A A;  2QLX A;  1XNR F;  2MZJ A;  4LF1 A;  4TU7 A;  2ZD1 A;  2H5E A;  4I6A A;  1XK8 A;  3OL7 A;  1D9D A;  2CG8 A;  4U95 A;  2DIV A;  3EPI A;  3D6H B;  4NCB A;  2J0W A;  4B9S A;  1N4L A;  2NCK L;  4ITS A;  3M30 B;  3GLJ A;  1KQK A;  1X9W A;  4J9S A;  4NA3 A;  2K8G A;  4YDD B;  2R2T A;  2LLZ A;  2A1B A;  2YKN A;  5I3Q A;  1XMQ F;  2KU7 A;  2FUG 9;  1QUP A;  2XZW A;  2WTF A;  6FDR A;  4H4K C;  5DDO C;  3KFW X;  2X1B A;  4C8M A;  4Q2M A;  2R7O A;  1WWH A;  1NBE B;  1VBK A;  2FDN A;  1IR1 A;  5KOW A;  5DQH A;  3M9N B;  4ZOS A;  3O6Q A;  1NDL A;  4DSI A;  3DLE A;  1G3O A;  2B5J A;  3CT9 A;  2VKR A;  2K1R B;  4DR6 F;  1U6B A;  3VHQ A;  2XZT B;  5GME A;  1QAY A;  1JKH B;  2WBM A;  1U49 A;  4Q7A A;  4NI2 A;  2P2C B;  1TL1 B;  4MK9 A;  4F2R A;  2OTL S;  5KT5 A;  4DUZ F;  3WIU A;  3I0R A;  2PEH A;  3L9Z A;  1YRU A;  1FRH A;  3DRY A;  4JB8 B;  4FS2 A;  1U02 A;  2RIJ A;  4I2Q B;  3QJP A;  3H7H B;  1RT4 B;  2MTL A;  3F41 A;  1U1N A;  1Q79 A;  3LP0 B;  4WFB Q;  4NRT A;  5LXY A;  1KVI A;  5T41 A;  3IAM 9;  4ZIT A;  4JI3 J;  5KG1 A;  4DV6 F;  3Q86 A;  4DL4 A;  2XS2 A;  3AJ2 A;  4FVC A;  4F0M A;  4NLD A;  1RXO B;  2M8D B;  4DCP B;  3CXC R;  2HND B;  2MY8 A;  4ILR A;  4AD6 A;  3GIM A;  5F8H A;  3C14 A;  3I5A A;  4Y65 A;  3HT3 A;  2YNG B;  3T6J A;  3B78 A;  2YX1 A;  2ROE A;  2Y1J A;  4OIX A;  4KY3 A;  1LW0 A;  3H90 A;  2JFD A;  4M95 A;  1CUL A;  3ZTP A;  1YHQ S;  5DJB A;  1FTR A;  4GVB B;  2AZ1 A;  4ZCI A;  3T19 A;  1XNQ J;  4PUO B;  1X4C A;  1U2R A;  5F8J A;  2OMO A;  4NX9 A;  2YKM B;  4OJ1 A;  2LQ5 A;  3RB4 A;  2FZK B;  5EX0 A;  1F2G A;  2X1A A;  5AE2 A;  3OXF A;  1JNZ B;  2IRU A;  4KGZ B;  4AYB D;  1NU4 A;  1RLD A;  2CNL B;  4N47 A;  3PRV A;  4ZCK A;  3K5M A;  3VAG A;  2UUA J;  4WK3 A;  2BUN A;  3VTI A;  4ANE A;  1EQM A;  2G1H A;  2AU0 A;  1JIH A;  5C42 B;  4LJM A;  4YEA A;  5KFY A;  4K5S A;  3CDU A;  5KT2 A;  3ENQ A;  5E2Q A;  1M5K C;  2WCX A;  1Y00 A;  4NEZ A;  4EWT A;  4ZPA A;  2HHV A;  2X7I A;  2RRB A;  3DI6 A;  3WDO A;  4DV3 F;  4Y6I A;  2O3D A;  2QSF A;  2AJ1 A;  2HGL A;  3VZH A;  2RVJ A;  3GV7 B;  2GQQ A;  2CVI A;  2AEM A;  2R7V A;  2RUG A;  3R97 A;  3ILI A;  1UJ6 A;  4QYR A;  2MMY A;  2JL9 A;  4DL6 A;  1BLU A;  3TQE A;  3G82 B;  3W8G A;  5KFH A;  3M8W A;  3UVJ B;  5J2M B;  4YFU A;  3UW1 A;  4RNN A;  1N32 F;  2LA6 A;  4PRF A;  2A2D A;  4K2X A;  4F4Z A;  2R7W A;  1J2V A;  3IO1 A;  3BR8 A;  1S49 A;  1T03 A;  3AD9 C;  4C98 A;  3HJF A;  1TL3 A;  3POT A;  1QSS A;  5KFG A;  2B51 A;  2GCF A;  1IBC B;  4DR4 J;  3NNA A;  3GTY X;  1NKB A;  1FX4 A;  3UN5 A;  1UEV A;  4CIO A;  3BF4 A;  2R8G A;  4OLO A;  3IGV A;  3OHA A;  5AXN A;  4TKT A;  1YDL A;  3FCH A;  1HI1 A;  2X1F A;  1HNI B;  2DRA A;  3ISN C;  1SKR A;  2KKH A;  3CD0 A;  5HMX A;  2G2O A;  4RBT A;  3WX8 A;  3NBP A;  1LWE A;  4TXS A;  2CPX A;  3W5X A;  2IJR A;  1RT7 A;  1T9X A;  1AZS A;  2W4C A;  4QZV B;  1N34 J;  4MIW A;  3BZQ A;  2CPZ A;  1VJW A;  3KK2 A;  1XIQ A;  4AND A;  2GMJ A;  3OFH A;  4DR2 J;  3TP2 A;  3Q8S B;  2HFO A;  1UMJ A;  5F8L A;  4HDG A;  1SUQ A;  3MF5 A;  5D3G A;  3I6P A;  2XGQ A;  3MEG B;  3NG8 A;  1K44 A;  4DLG A;  2DGU A;  4NYP A;  2LKZ A;  2VZ9 A;  2QO3 A;  1IQZ A;  3MMB B;  3OJS A;  2BM0 A;  3CO9 A;  2XWX A;  1HI0 P;  5HJY A;  1W2I A;  2D9O A;  3KK3 B;  3W8P A;  2D3O 1;  1ELO A;  2W1B A;  1N5Y B;  4C7Q A;  4C0H A;  2J9D A;  2Y9H A;  1ZH5 A;  4RW4 A;  2FJE B;  4O44 B;  4IH5 A;  3BDP A;  2PDA A;  3CDA A;  1BE4 A;  3BH6 B;  2R7U A;  3NS6 A;  2FLN A;  1S99 A;  3P5T L;  4D3G A;  3C15 B;  4RUB A;  3I96 A;  1BQN B;  1JLA B;  4JI3 F;  1HQU A;  1XEZ A;  2HBZ B;  3OSN A;  1ZET A;  3NGD A;  2KM8 C;  4QBU A;  2IM1 A;  2PI5 A;  4Y2I A;  4BDP A;  4LSZ B;  2V69 A;  4ECR A;  1XMB A;  5LM7 E;  3MTJ A;  3M2V A;  3TQ1 A;  2FYX A;  4BWJ A;  3NAI A;  1AFJ A;  4QWA A;  3E2E A;  3FSI A;  2AX1 A;  3MTK A;  1NZA A;  1DQ8 A;  1AA1 B;  3IGN A;  4M94 A;  1T3O A;  1T9Y A;  5J2Q B;  2MZR A;  3M30 A;  2KN4 A;  1QY7 A;  1R8P A;  4MK8 A;  1X60 A;  1RE1 B;  1XNQ F;  3MOJ B;  4F4X A;  2UXC J;  1GMW A;  5AE1 A;  2BJE A;  4IRC A;  5KG7 A;  1QDU B;  5CYM B;  1BQM B;  3OBI A;  4WFX A;  3GG0 A;  1B0T A;  2MLZ A;  2UUA F;  1WF2 A;  2LDY A;  4UT4 A;  1IQT A;  1NJY A;  3MEC A;  2GVD A;  2VIC A;  2E44 A;  2NRE A;  2QYC A;  4USH A;  4HHH A;  4X4Q A;  2Y1L B;  4ECQ A;  5BXI A;  5IT0 A;  1IWG A;  3OFE A;  2DEJ A;  3SFG A;  2H4Y B;  3ETM A;  3OHB A;  4YR2 A;  4ED5 A;  4MIA A;  5JXS A;  2K3K A;  3GII A;  2VUG A;  1JKH A;  1TFY A;  1TL1 A;  3FQL A;  5K20 B;  1CJV B;  1RCX B;  2G1D A;  2LCW A;  3M6V A;  1S1V B;  3LAK A;  4OL8 A;  4I64 A;  1NCL A;  3RAX A;  4CNZ A;  1PYT A;  5HAO A;  2QMU B;  2HFS A;  3I0S A;  5F8M A;  1RT4 A;  1GTH A;  2BEF A;  3CIZ A;  3LP0 A;  3HD2 A;  3PY8 A;  3H5S A;  4QR1 A;  5J1N A;  2VFV A;  4PYD A;  2A6M A;  3EJM A;  4ERD A;  4KKO B;  4GC6 A;  5D8H B;  4LVN P;  3HSG A;  1JWW A;  4DQS A;  3BGU A;  1NAQ A;  2ZJP Q;  2A3J A;  4KGM A;  5ETP A;  4ZDN A;  4CTA A;  4DR4 F;  2F3J A;  2KJW A;  3BPD A;  2DHH A;  3R7S B;  2W8K A;  1UCN A;  4PG7 A;  3MOZ A;  3ILJ A;  3N28 A;  2B9X A;  2FHJ A;  3M8P B;  5M2R A;  2HVZ A;  1K0T A;  2KRB A;  4CO5 A;  2QJ3 A;  3HHL D;  4NLQ A;  3AOC A;  2DKO B;  2XQC A;  3QAE A;  2B8P A;  4GVB A;  2B43 A;  1HHS A;  2AJF E;  3AXM A;  1NB7 A;  4PUO A;  4MKV A;  4RNF A;  2MJN A;  2NXN A;  2B9Y A;  4ETX A;  2YKM A;  5DDQ C;  1FXD A;  2Q79 A;  1TP7 A;  4ECY A;  4IFV B;  1N34 F;  3S7R A;  3G71 S;  1R8A A;  2VFT A;  2XLI A;  2R2U A;  4U96 A;  1Y3J A;  4DR2 F;  2R8J A;  4LVO P;  4ZLP A;  5F8I A;  1RDR A;  1WC1 A;  3AAW B;  3VGS A;  5C42 A;  3B82 A;  5DGB A;  3MUV P;  3HKZ D;  2AD9 A;  3C46 A;  2QGF B;  1NSQ A;  4LSL A;  3CNQ P;  1C0T A;  1YJV A;  2GQC A;  5RUB A;  3L7U A;  4H4O B;  4KV8 A;  1RBO B;  3AXK A;  2AGP A;  2EW9 A;  3NS7 B;  2OEL A;  1WI6 A;  1WD6 A;  2VG5 A;  4J90 A;  3QGI A;  3TUJ C;  2VC0 A;  2BVZ A;  2YPZ A;  3NGR A;  3E3X A;  2QMW A;  4OX7 A;  3H5U A;  4I56 A;  4I67 A;  3IFE A;  1IM6 A;  4DCJ B;  2Z0G A;  3FDS A;  3PIO Q;  3G6E S;  4HKQ A;  2CZ4 A;  5IQQ A;  2VHG A;  3SDE A;  3QRQ A;  2UUC J;  2KO1 A;  4IG3 B;  5HP1 B;  3B4D A;  1RAI B;  2P9E A;  1H2V Z;  4NYZ A;  5DQG A;  3QPI A;  1GXL A;  3CJR A;  2R4F A;  2MST A;  3ZZZ A;  3HJV A;  3Q8R B;  4DF4 A;  2DGS A;  3D7S B;  2P9C A;  3BV8 A;  3CMQ A;  2CA9 A;  2HRU A;  2I0X A;  2OAU A;  1U1Q A;  3H2U B;  2V67 A;  3TAR A;  1TQL A;  4DL0 C;  2YWG A;  5KG3 A;  1PYS B;  2GIF A;  5DLG A;  2UXC F;  2JEJ A;  2QFJ A;  1F60 B;  2VQE J;  7FDR A;  1EKR A;  3JTP A;  2ZC4 A;  3DDK A;  3Q8Q B;  5MLC V;  2MYF A;  2W9C A;  3DRS B;  1NK9 A;  1KQS R;  3MM9 B;  2QMX A;  2W9B A;  4OX6 A;  4QCL A;  2NS1 B;  4ZVF A;  5K8O A;  4L76 A;  3CGI A;  2BQR A;  1H7W A;  1FJE B;  5G0R B;  2HNZ B;  1KON A;  2HGN A;  8AT1 B;  2V4Q A;  1FNO A;  3RGI A;  2PA3 A;  4LF4 J;  2RSQ A;  1VHI A;  2GA7 A;  1KC8 T;  2Q3P A;  3KK3 A;  1P9Q C;  3W9J A;  1N5Y A;  2CYY A;  3H20 A;  4E8U A;  3BBB A;  3U1L A;  2W24 A;  4O44 A;  4QWD A;  1VBX A;  3PDN A;  4CLS A;  4A8Q A;  1IKW B;  4DV0 F;  3GPA A;  1BQN A;  4V19 X;  1RBA A;  2L48 A;  4U8Y A;  1VC0 A;  2OSR A;  1WSR A;  2PSZ A;  4OYI A;  1FT8 A;  1GK8 A;  2GJF A;  1Q7Y T;  4OZ5 A;  3FBB A;  3T9Z A;  5C24 B;  2A10 A;  1X4B A;  1HPZ B;  2BJ8 A;  3QO9 B;  1JJC B;  2E7V A;  2BAN B;  5K8N A;  1A7G E;  1DY3 A;  2ZJQ Q;  2HNY A;  2H4W B;  1HAR A;  3A1Y G;  3K5O A;  5J2Q A;  3CMA S;  4EMD A;  3K0J A;  2UVR A;  1QSY A;  4N8N A;  4NOH A;  1U2F A;  4C8N A;  4EYI B;  4P72 A;  4K5R A;  2D9P A;  3LA0 A;  2VFR A;  4U67 Q;  3U1M A;  1RWV B;  5K8M A;  5ETS A;  4DR5 J;  4P7V A;  4J37 A;  5CYM A;  1T9W A;  3VQS A;  2V4J B;  4WE1 B;  1FWL A;  2JNJ A;  3FJ2 A;  2MHN A;  2PI4 A;  2EFN A;  2JEI A;  1DFD A;  2FIU A;  4OZJ A;  1T05 B;  1TV6 A;  4ZVE A;  4FVM A;  3J7Z 5;  2LP4 A;  2VJV A;  4WYW A;  1KEK A;  2GIR A;  4R0E A;  1S0V A;  1PIE A;  1S1U B;  3HVT A;  3IBC B;  2DGQ A;  2N3O A;  4K0K J;  3UR0 A;  5FD1 A;  3A13 A;  2O5D A;  4ECU A;  4RPF A;  3EYZ A;  5H1S V;  5CD4 H;  1A9N B;  3ETO A;  2CFX A;  1JLF B;  4MKB A;  2MQM A;  1CJV A;  1HW8 A;  2M9K A;  1TAQ A;  3C16 A;  2LXI A;  1S1V A;  1KLM B;  1FRI A;  5A0Y B;  1NZ8 A;  1F3V A;  4K4V A;  2XCA A;  1CJK B;  5ETM A;  3M2R A;  3BO3 A;  4EBC A;  2NPF A;  2OO4 A;  4NZ6 A;  3MR7 A;  3AOD A;  5KFU A;  3ZZP A;  3JSB A;  2XHC A;  1U6Z A;  5ETO A;  1XWL A;  3ELH A;  1KOH A;  2JVO A;  3CW2 C;  4WJB A;  5IOL A;  1UL3 A;  1F9H A;  4ZJL A;  2DY1 A;  4DQP A;  4XO0 A;  3D9B A;  2UUC F;  1QUV A;  1RAD B;  1VQS A;  4KC5 A;  1WC0 A;  2C42 A;  4ILM A;  1IR2 A;  1K0V A;  3OTE A;  5KFZ A;  4K4S A;  2YX4 A;  1PIL A;  5EX3 A;  1YKW A;  2AJQ A;  2BA9 A;  2M8H A;  1KQF B;  3OUY A;  1KDN A;  2CQD A;  4DMZ A;  3M8P A;  1ITP A;  2JFK A;  4K50 A;  5B08 A;  1HNV A;  1PBU A;  2ALZ A;  3BGO P;  4G1Q B;  2V63 A;  2W9A A;  4OI2 A;  2B8Q A;  2RUS A;  3UWT A;  1JJ2 R;  1KSP A;  1SBR A;  5IQ6 A;  4I1T A;  3BB5 A;  4ICL B;  4KSE B;  1NSP A;  2G4B A;  1M5P C;  4IFV A;  1PG5 B;  4GO5 X;  2VQE F;  1T9U A;  2WRM A;  3QT5 A;  1X0F A;  3RRG A;  4IRK A;  2NPI A;  3BGR B;  5LJ5 Y;  4X66 J;  3B6B A;  4D3H A;  2CJY B;  3MR2 A;  2XMV A;  4MAK A;  4B3M J;  1P6T A;  3TAP A;  2ZH8 A;  2XSF A;  3GFZ A;  5HBM B;  4R8U B;  4RO0 A;  1YJT A;  2AHO B;  3KHH A;  3ULH A;  2ZH4 A;  3NNH A;  2HLU A;  4J9V A;  3M8R A;  3W9H A;  4ED4 A;  4LF4 F;  4LR7 A;  3R2D J;  4H4O A;  3DOL B;  3TNV A;  2RB7 A;  4PWD A;  2FD2 A;  2CKW A;  4M5J A;  4PQU B;  1S48 A;  2B4V A;  3L09 A;  3C6T B;  2KYZ A;  4JV1 A;  4HT5 A;  2D74 B;  1RWX B;  3X1L B;  1JLE B;  2IMW P;  1HI8 A;  2R7Q A;  4IDK A;  1MWY A;  3LF0 A;  3M6U A;  2ZH7 A;  1TKZ A;  1U2C A;  1RHJ B;  2OD4 A;  2QLW A;  4PPZ A;  3KLF B;  4ALZ A;  3TA1 A;  3HSZ A;  2LXF A;  4IOC Q;  2RJZ A;  5MAO A;  3DNC A;  3JQK A;  1XN9 A;  1WG4 A;  2D7S A;  4R0J A;  2MKI A;  2B6A B;  2MKS A;  1UA1 A;  1HR0 J;  6AT1 B;  4J9P A;  1L3V A;  2XG8 A;  5HP1 A;  3QIP A;  2HZV A;  1H7X A;  4RJV A;  3UCU P;  1IKY A;  1SIW B;  1L3S A;  2YVS A;  3KHG A;  2X1G A;  4LF5 J;  3EWG A;  4AL5 A;  5L46 A;  1HFE L;  2KZM A;  4PPD A;  2I2Y A;  1TU0 B;  5B09 A;  1V5V A;  4M5H A;  4ZVS B;  1SJF A;  3KLI B;  2R2R A;  4ED8 A;  2XO7 A;  2FJV A;  3DN9 A;  1OY9 A;  4DR5 F;  2OH2 A;  1X5O A;  4UY8 5;  1K73 T;  4PXB A;  3DRS A;  1E6Y B;  2XB2 D;  4CT8 A;  1VS3 A;  3MM9 A;  1IKV A;  1VRQ C;  4A8W A;  1VQY A;  5D77 A;  1SB6 A;  1HA1 A;  2G13 A;  2MLX A;  3QQC D;  4EK2 A;  3QAU A;  5CAA A;  4DS4 A;  3CVK A;  5G0R A;  2LDI A;  3H4B A;  2CAJ A;  1ZAV A;  1LEO A;  4K0K F;  2EXU A;  1RBL A;  3JB9 k;  4RU2 A;  1KBR A;  3G86 A;  3T1Y J;  3R6G B;  1JMT A;  2ASD A;  1NKC A;  2J8S A;  1HW9 A;  1N6Q A;  2ZVS A;  1D8Z A;  2VPZ B;  3TEG A;  3UCZ P;  1LWF B;  3TX0 A;  1CC7 A;  1Q53 A;  3C6U B;  2JWN A;  2IDL A;  1T7P A;  3JTN A;  1TK0 A;  3AOA A;  4DZD A;  3UD3 P;  2QIF A;  4DR1 J;  1H2U X;  3GU0 A;  1IKW A;  4RX6 A;  3WIV A;  3UPF A;  1Z4U A;  2N3L A;  5HLF A;  3GE9 A;  3HPO A;  3PW5 A;  2AWZ A;  3MUR P;  2UXB J;  4LSN A;  2HHT A;  1W25 A;  4MTP A;  4ELU A;  4AUK A;  4L72 B;  5HL7 Q;  2A2C A;  2DD8 S;  3OXL A;  2VBY A;  1JXL A;  1NK0 A;  1S6Q B;  3D1H A;  4NPO A;  1WJ9 A;  5HMZ A;  2EBG A;  3QO9 A;  1RAH B;  3PW0 A;  2C28 A;  2BAN A;  1R43 A;  2BRK A;  5K5M A;  5DO2 A;  4CZC A;  1IBL J;  1RTJ A;  4OYZ A;  5K8P A;  3WC2 A;  3TVY A;  4HL9 A;  3OJU A;  2WVC A;  4FYW B;  2WVB A;  1OSD A;  1W7W A;  1F0X A;  3OR1 A;  1DBD A;  3AQO A;  3OTB A;  1QAJ A;  1EAR A;  4KYZ A;  4X4T A;  1KHV A;  2QA1 A;  4DWI A;  1FKP B;  3HCX A;  1FVQ A;  2GHW A;  4ES3 A;  4PG6 A;  2ABY A;  4OX9 J;  3HMJ G;  1MRO B;  4NLG A;  3TI0 A;  4L3K A;  4NLX A;  2V4J A;  6FD1 A;  3FRY A;  4ENO A;  4USW A;  5BYR A;  4WP8 A;  4X66 F;  5ADZ A;  2OD6 A;  5LMN J;  2FVP A;  4O3N A;  3SCJ E;  4B3M F;  3HI9 A;  4YP3 A;  3V6J A;  1U47 A;  3W2V B;  3P5B P;  1LK7 A;  4YB6 A;  2QTW A;  4B3S J;  1S1U A;  4GKJ J;  2DCU B;  3KHL A;  2PC6 A;  1N5S A;  4ELT A;  2LEB A;  1I6J A;  1JLF A;  1Y5I B;  2CXE A;  1B99 A;  2E1A A;  3HHL C;  4DPU A;  3J81 j;  1AXQ A;  1KLM A;  5A0Y A;  1CJK A;  2VA3 A;  1S9G B;  4M5L A;  3ZNU A;  1RAE B;  1OYE A;  4LF8 J;  2CJK A;  1S6O A;  4NZ7 A;  2DNR A;  3TW0 A;  4WFY A;  1NPP A;  2DBB A;  3SQO P;  4DUY F;  3R9L A;  4ED7 A;  5KFN A;  1X9M A;  1P1T A;  4EU0 A;  2YNI B;  1FK9 A;  5LT5 A;  1KNZ A;  1UKU A;  4DL7 A;  3IRX B;  1HR0 F;  1VQ6 S;  1MU2 B;  1WDD A;  1H73 A;  1TKD A;  3DLG B;  1L5U A;  1SJ1 A;  2H65 B;  2OEK A;  1UAW A;  4NMX A;  4OX8 A;  3AY0 A;  1NDK A;  3AD8 C;  4WZM A;  2BMB A;  1FWK A;  1K1S A;  1VQK S;  3H4D A;  5KT3 A;  2Y8W A;  4LF5 F;  4G1Q A;  3UI3 A;  2IBO A;  3OTC A;  3PRB A;  4NXM J;  3ZNJ 1;  2AZ3 A;  3DYA B;  3TAQ A;  4KO0 B;  3IP0 A;  2W2M P;  4OYB A;  3ZZR A;  1W2B R;  3DM2 B;  4HI1 A;  4DF8 A;  4ICL A;  2GO9 A;  2VG7 B;  5A8K A;  2Z57 B;  2CJQ A;  2WSF C;  4OJ3 A;  1E6V A;  2XS7 A;  1ZS6 A;  3JS9 A;  3F56 A;  2J6T A;  2RRA A;  4ZLJ A;  5HBM A;  4R8U A;  5U47 A;  4URS A;  3T5H A;  2R7X A;  2HQG A;  1S4E A;  2V0N A;  2QZ8 A;  2V8H A;  4IG0 B;  3T1Y F;  3QMQ A;  1GX5 A;  3DOL A;  3HHL A;  1S6U A;  3DXB A;  4M63 A;  4YHH J;  3R5D A;  2GQ2 A;  3LQV A;  4PQU A;  3QSI A;  4BBY A;  3OSP A;  1R0A B;  3R1H A;  3C6T A;  4ZJQ A;  2QV6 A;  1JLE A;  4WYL A;  4Z7Y A;  1ZAX A;  3SMZ A;  1YLX A;  1MWQ A;  1B3T A;  3H8Y A;  4U7C A;  4DR1 F;  3NGU A;  4F26 A;  1Q7L B;  4OHW A;  5A6W A;  1ZA2 B;  2KXH A;  2HBR B;  4TN2 A;  3PJX A;  5K9F A;  5AJ3 J;  2B6A A;  2UXB F;  4O0N A;  5KT7 A;  1XQI A;  3MR5 A;  5GAD I;  1AUS L;  1QD1 A;  4C8L A;  4ZJO A;  1TL4 A;  2F1F A;  2BOP A;  1FES A;  1RHR B;  3BKT A;  1IBL F;  2KXF A;  2E5I A;  4PR6 A;  1RT5 A;  2CJA A;  3SIP B;  4DFJ A;  1G7C B;  2UV8 A;  2V6A A;  1RP5 A;  2VL1 A;  1FDD A;  2WW4 A;  3OPK A;  3KLI A;  4URQ U;  3A8E A;  1VRT B;  2RKI A;  2DY9 A;  4OX9 F;  3SI8 A;  5A76 A;  2W2Q P;  4ZPC A;  1WHV A;  1VK3 A;  2V2Z A;  2XS5 A;  1LXJ A;  5LL6 d;  3OVS A;  2C2N A;  1ACM B;  5LMN F;  4Q8E A;  2KT3 A;  4PG4 A;  2BDP A;  4HI2 A;  4B3S F;  1D9A A;  2ACY A;  4KQZ A;  4GKJ F;  5KG2 A;  5IC4 B;  3DHX A;  2CDQ A;  1I51 B;  1IUJ A;  1EIY B;  4J9O A;  1IJE B;  2IJF A;  1YZ6 A;  1VMB A;  4G6V B;  2YWF A;  4NLP A;  3UDV A;  1LW2 A;  4F3O A;  3GP9 A;  4CDI A;  5KTQ A;  2W25 A;  4B02 A;  3EM1 A;  3FEZ A;  5KFT A;  2CQ3 A;  3QT7 A;  2UVU A;  2UUW A;  4EFA C;  1S72 S;  4B3T J;  3CCV S;  4LF8 F;  2VPW B;  1O51 A;  2KJV A;  4XK8 C;  2I38 A;  2QG9 B;  2NXJ A;  1XR5 A;  3AQP A;  3CJQ A;  1A6L A;  4DPO A;  5JJB A;  3MFH A;  2UVV A;  3JYT B;  4IYQ A;  3TZZ A;  3THV A;  1NPR A;  2FJD B;  4EO6 A;  5KG0 A;  4DSE A;  5GVQ A;  3QRP A;  3TO8 A;  4WII A;  1V9O A;  4Z7C A;  2F9D A;  4ECS A;  2QLB B;  2EFO A;  1VQ5 S;  3QRR A;  1NUE A;  3KUG A;  3DLK B;  4O3Q A;  2NR0 A;  2J0Q D;  2HK2 A;  1RCO B;  2LU2 A;  4NXM F;  3ZTQ A;  4UW2 A;  3R5G A;  1SQF A;  3AOB A;  3OTO J;  5KFB A;  1Z2L A;  1FKP A;  3PW7 A;  1RIS A;  3DOM B;  1N88 A;  4ZP7 A;  4DX8 H;  4WFN Q;  1SC4 B;  4J9K A;  1KVK A;  3FFI A;  1FRK A;  3N6N A;  3U7J A;  1LNQ A;  3LP1 B;  4FNI A;  2OPP A;  2BRL A;  1YGY A;  4DSL A;  1H38 A;  3BM7 A;  3W2V A;  1ZM9 A;  4IFY B;  3A12 A;  3MPU B;  1RTZ A;  3MGJ A;  2MQ8 A;  2NXU A;  1X5T A;  3EVW A;  1KS2 A;  4CYU B;  4LRE A;  2Z2Z A;  2ASL A;  2GML A;  3DLL Q;  3UDC A;  1NSK L;  4EBD A;  4YHH F;  2CJ9 A;  2ZWP A;  1U1L A;  2XMU A;  2XUL A;  4JV0 A;  1D9F A;  4USK A;  4LUB A;  1RT2 B;  1S9G A;  2WSC C;  2V2K A;  4QYZ J;  2EEY A;  1GXT A;  1KVJ A;  4LRC A;  5AXM A;  1TL7 B;  1VR6 A;  1HWL A;  3GJQ B;  2EVZ A;  1UVJ A;  1ZTT A;  3C3L A;  3PO4 A;  4WFA Q;  2RH3 A;  4B9V A;  2HFN A;  1JJH A;  2ILZ A;  1O0P A;  1U26 A;  5AJ3 F;  2B7C B;  3LP2 B;  3IRX A;  4HHJ A;  2MGZ A;  1YBT A;  3DLG A;  2ZOM A;  2XCP A;  4MYU A;  2WB4 A;  2ASY A;  2FGC A;  2K2P A;  3O1L A;  2PT0 A;  1LKZ A;  2CPF A;  4N5S A;  2ZNY A;  1ZZN A;  2KT5 A;  2HHH J;  1IR0 A;  2M88 A;  3HUL A;  3R7B B;  2HPU A;  3VGU A;  1NXI A;  3W3S A;  1FF2 A;  3J7Z T;  3CCS S;  1JLB A;  3FKB A;  2GAH C;  4I2P B;  2WVD A;  1TUG B;  4DEZ A;  4RUC A;  1UVN A;  1R7I A;  2NQP A;  3LAM A;  3LW5 C;  2OPR B;  2V9K A;  3TA2 A;  1WC5 A;  1ZPW X;  4L73 A;  3P6Y C;  2BE7 D;  2BAB A;  1U1P A;  1C4C A;  1YBU A;  5CQG A;  3K58 A;  3EXY A;  3KJQ B;  2YH1 A;  2COL A;  4XPC A;  1R0B G;  3KMS A;  2Z8Q A;  5CZV A;  3KDN A;  4AXJ A;  4B3O A;  2J7U A;  5EUH A;  4ZIW A;  2EKN A;  1WEY A;  3F73 A;  1HNW J;  3V4I A;  4G1I A;  2W2P P;  1FRJ A;  4UUX A;  1I94 F;  5KFM A;  2H48 B;  2DNQ A;  5I42 A;  3OXG A;  5HVF A;  4IG0 A;  3VAI A;  2V50 A;  1QE1 B;  1HBU A;  5L39 A;  3S1T A;  4A48 A;  3RB3 A;  3ZXW A;  1R0A A;  2VOP A;  1T9T A;  4PWU A;  1F3F A;  5I4M A;  2EFG A;  4P7T A;  4A8X A;  1RHM B;  4CM0 A;  2YNF A;  4B3T F;  3RBZ A;  4ED2 A;  2QL7 B;  2ZBP A;  1Z1Z A;  1CEZ A;  4N77 A;  1JXV A;  4C8Y A;  2DNM A;  3KLG A;  3O44 A;  1S12 A;  2CRL A;  2M5Y A;  2AV5 A;  2BBE A;  4Y2A A;  4P75 A;  4PCQ A;  1UJ4 A;  4ZP6 A;  2OP5 A;  2HHU A;  2QSW A;  1F9E B;  1RAA B;  2J7W A;  3K59 A;  2DH9 A;  2HKE A;  1I5O B;  5HO4 A;  3CCJ S;  4V19 J;  3GV5 B;  2PN6 A;  5B0C A;  1S9E A;  2FB0 A;  5C5J A;  4JI7 J;  2DT9 A;  1UTA A;  3F44 A;  4FXW A;  2VJU A;  4OYW A;  2ASJ A;  4LIW A;  3OL8 A;  4NL5 A;  5D0G A;  3AT1 B;  4K2J A;  3IR5 B;  4CM2 A;  4L74 A;  5KG4 A;  1TKX B;  2DNH A;  1RLC L;  2XGP A;  3OTO F;  1O6X A;  5HMW A;  1SL0 A;  3GYX B;  4OYX A;  1PO6 A;  2IYI A;  1T95 A;  4DX5 A;  2J9C A;  3BN4 A;  3MM7 B;  3MI7 X;  3VAJ A;  2VDI A;  3PAC A;  3MM5 B;  3O3L A;  3EZ5 A;  4TU9 A;  3K5N A;  3D6F B;  2FQQ B;  3MD1 A;  4GKK J;  2NZ4 A;  1Q8I A;  4R25 A;  1S1W A;  2OFG X;  4LQ9 A;  1RI7 A;  1DHM A;  2PA8 D;  2WW8 A;  1OO0 B;  4Q43 A;  4UOF A;  3MMA B;  3MEE B;  1RGV A;  2E1M C;  4OYM A;  1LOU A;  4IO1 A;  4C3K A;  5BYQ A;  1B7F A;  3CCW A;  5F8N A;  4LF6 J;  3DGP B;  2AGO A;  4X4N A;  2IVY A;  3MPV A;  2MQQ A;  4QR2 A;  2LEP A;  3IBF B;  4F67 A;  4USI A;  3OL6 A;  3VAF A;  1YJU A;  1HHQ A;  2HWI A;  4EYH B;  1EP4 A;  1HBN B;  5DRK A;  4G3I A;  2HZA A;  3J80 U;  2XM3 A;  1RTI B;  4ZK7 M;  3RTV A;  4OHZ A;  1AB8 A;  3MAH A;  5F3T A;  3JQJ A;  4OLP A;  5CCL A;  2FVQ A;  1EET A;  3G6V A;  3AFG A;  4UY8 T;  5LXR A;  3EGV A;  2W2N P;  2J6S A;  2HHH F;  3SV3 A;  4DOZ A;  2ZM6 J;  2HVD A;  4A8S A;  4M5D B;  2KHC A;  4C6A A;  4TLR A;  2F9J A;  2DB1 A;  4YR3 A;  5T14 A;  4AQY J;  1NJI T;  2BJ7 A;  3FBC A;  1BD6 A;  1C2P A;  1R89 A;  3DOM A;  4ELV A;  4C3M A;  3NEK A;  5F9N A;  2F8M A;  2Z4P A;  2G0C A;  3UCG A;  1UVI A;  5CYQ B;  1OY8 A;  4BC9 A;  3Q2S C;  3PEJ A;  4USM A;  3P49 B;  3FEX B;  2E9T A;  3CJ3 A;  1HNW F;  1L3U A;  1VJQ A;  3KJV B;  4IFY A;  4NA2 A;  3KK1 B;  4HTJ A;  3QJJ A;  1B7Y B;  4RW9 B;  2V8G A;  1N54 B;  2R7S A;  5EWE A;  2ZBC A;  3H42 A;  3CB4 A;  1KP6 A;  2XI2 A;  3US5 A;  5JVH Q;  5D15 A;  3V81 B;  1VQ8 S;  1B0P A;  2BXJ A;  9ATC B;  4I69 A;  1APS A;  1RT2 A;  1EZZ B;  1HLW A;  4KHM A;  1TL7 A;  4DQR A;  4KFB B;  1KTV A;  4OZ3 A;  4TYA A;  1HMV B;  1FWP A;  1DRZ A;  3KLE B;  4ZVT B;  4M5K A;  1QLN A;  2Y3Y A;  2R7T A;  3LP2 A;  3PHE A;  1IWA A;  2M3D A;  3UO0 A;  2WOM B;  1DQA A;  4J9N A;  4OJG A;  4F7V A;  2F8H A;  4HEA 9;  2BQU A;  2N7Y A;  1LFW A;  2Z30 B;  5F9L A;  4DSJ A;  4BLG A;  3MAA B;  4KAI A;  3D3C J;  4JI7 F;  4WFZ A;  3SSR A;  3M4X A;  3CO0 P;  4WF9 Q;  3M1V B;  4RW8 B;  3BGL A;  1S7I A;  1CJT B;  2DH8 A;  3ZTR A;  1X31 C;  1CC8 A;  2EG2 A;  2MQL A;  2AKW B;  4P10 A;  3N6M A;  2CQ4 A;  4QJV A;  3N5B A;  2IPO B;  1KN6 A;  1TMJ A;  2ZOF A;  5GAH U;  3QYY A;  3D1O A;  3R5C A;  3OVB A;  4DX6 A;  1XTZ A;  3SCL E;  4KH0 B;  2VKZ G;  2D3U A;  2GC8 A;  1HBO A;  1DJ0 A;  5EHH A;  2JH3 A;  3HLU A;  3TAM B;  1NO8 A;  4Q44 A;  1RWK B;  4YY3 J;  2RAQ A;  4FKX A;  1GNK A;  2VG6 B;  2G0I A;  5M2P A;  2C1E B;  4GKK F;  4RU9 A;  1DLO B;  1FKO A;  5GAG U;  4U8V A;  2H51 B;  4LRB A;  1Q82 T;  5J1P A;  5LOQ A;  1QE1 A;  3U1N A;  4B9L A;  1IKX A;  1GXU A;  1HQE A;  1VK8 A;  4CCH A;  4RNM A;  1FVS A;  1OJ4 A;  5F0U A;  3RRH A;  4B08 A;  3CDB A;  4Y2C A;  2RML A;  1N48 A;  3ITH A;  2C2E A;  2EPI A;  4LF6 F;  3MUM P;  2GJ2 A;  4DHV A;  5E41 A;  2EFP A;  4QU6 A;  3ZZ0 A;  4ZVG A;  4YDX A;  4CLL A;  1T3N A;  1NND A;  2DNK A;  2Q6B A;  5KG6 A;  4R5P A;  4CLT A;  5C7P A;  2VFS A;  4KRW A;  4MK7 A;  4EI2 A;  1VBY A;  3Q89 A;  1Y4Z B;  1AT1 B;  4OI0 A;  1VQM S;  4C11 B;  3IA0 A;  1MG7 A;  2BJD A;  1RAG B;  5LJ3 Y;  1JX4 A;  3IC1 A;  2N7C A;  1XR6 A;  2ZM6 F;  4C4W A;  2V2V A;  3A3O B;  5HSP A;  3L3C A;  3MR3 A;  1TKX A;  4M8L A;  1AFI A;  3ET6 B;  1T02 A;  4UZB A;  5FJ4 A;  3TJA A;  3MM5 A;  1FCA A;  1XMO J;  2HBY B;  1S1T B;  3L7P A;  4TU8 A;  2KXN B;  2EK1 A;  1YJW S;  4LF2 A;  2P8I A;  1VIO A;  3L4B C;  2ZOG A;  3CJK B;  2XTJ P;  5JMN A;  1WKK A;  3B8H A;  4QU7 A;  2FPH X;  2BJ1 A;  2H5J B;  2BKP A;  4PXC A;  1Q8B A;  3GIR A;  3B54 A;  4OHX A;  2WAQ D;  3MMA A;  3DMJ B;  4ZKA A;  2L08 A;  3JSY A;  2ZH2 A;  5KG5 A;  1FRM A;  1Y9O A;  5F8G A;  1Y10 A;  3FUY A;  3OFG A;  5ETT A;  2XLJ A;  1WAC A;  2PMH A;  2C2R A;  1F6T A;  4JUZ A;  2CQ1 A;  3BDE A;  3RRK A;  4P73 A;  3KJF B;  1GMV A;  2XZD B;  2E5J A;  3NCR A;  2J9D E;  4F50 A;  3SQG B;  3DLB A;  3DU5 A;  3Q8P B;  3KLV A;  1L3K A;  3D3B J;  1HBN A;  3CCT A;  4ZVO B;  4ZA1 A;  3FC9 A;  4QYZ K;  1SVD A;  1RTI A;  1SKS A;  3FBE A;  4F0H A;  1CLF A;  1YRT A;  2A0F B;  5CYJ A;  2DHG A;  1RT1 B;  4FNH A;  1P27 B;  5EDW A;  4OZN A;  4ED3 A;  3SSQ A;  1RJJ A;  3NWR A;  3HFV A;  1RB0 A;  3CCE S;  1N0V C;  1KWM A;  4CLF A;  1REV B;  4CRJ A;  3FSX A;  4WU3 A;  3ENV A;  2C22 A;  1FJG J;  3KHR A;  4FS1 A;  3B4M A;  4M5D A;  1I3O B;  1MW7 A;  2I5J B;  4DU7 A;  3I82 A;  3MAQ A;  3EGN A;  3IR6 B;  2FZG B;  5KFV A;  4XPE A;  3H2L A;  5I3P A;  3Q8U A;  4NLV A;  2YQ3 A;  1Q1K A;  2ZHO A;  4ZN1 A;  1YWX A;  2NXE A;  1DQ9 A;  4GRS A;  2NUU G;  2CJB A;  1G4C A;  2ZE2 A;  4NML A;  3H5Y A;  4FXV A;  1TK5 A;  4OMF G;  5EGY A;  2U1A A;  1OPZ A;  4X84 A;  4YY3 F;  1JQG A;  1ZM2 A;  1YIT S;  3HX9 A;  1HKA A;  2X51 A;  4M5M A;  4WTY A;  2QL5 B;  2EFV A;  3PM9 A;  2GVZ A;  4RW9 A;  4S0M A;  1HWK A;  2DNZ A;  1HNZ J;  4P2X A;  1FJ7 A;  1GH8 A;  3I55 S;  1DTQ B;  1J5E J;  3BKF A;  3RUB L;  1ZBT A;  4C97 A;  5L8R C;  2AYB A;  2XNQ A;  2DGW A;  4JI2 J;  2R8I A;  3ZZY A;  3RU0 A;  3K8W A;  4ED6 A;  2Q43 A;  4IQX A;  1C0U A;  2MKJ A;  2F4F A;  5IV4 A;  3GFY A;  2YQ1 A;  1S77 D;  4KFB A;  2IMO A;  5IZH A;  1X5P A;  2OUG A;  2HBQ B;  2FY1 A;  1HMV A;  2WK4 A;  4Y2K A;  3VQT A;  3A8K A;  3HM9 A;  3KLE A;  3RYL A;  3MD3 A;  2XMK A;  4QWC A;  1FDN A;  4BC7 A;  2WOM A;  3MWB A;  4FYV B;  3OFF A;  2DRB A;  3MED A;  4C0B A;  2DRD A;  3MM8 A;  5ITH A;  2HHW A;  4IO9 Q;  3QSY B;  1MN7 A;  2WSE C;  1NJW A;  1KR4 A;  1FA0 A;  2VF3 A;  3MAA A;  1R27 B;  1YJ9 S;  4ED1 A;  4RWW A;  2P5V A;  4B9N A;  1JLQ B;  4LBP A;  4QIW D;  4ANC A;  4Q2L A;  3M1V A;  2PE8 A;  2JZ5 A;  3TX8 A;  2VOO A;  4K4X A;  1M5S A;  5KT6 A;  1ZZF A;  1DTT B;  4P2S A;  5HMY A;  4L75 A;  2E9Z A;  3ISN D;  4W90 B;  3QLH B;  2HUR A;  4O3O A;  4LMZ A;  2CVE A;  2KI2 A;  3R6L B;  2CQB A;  4KPC A;  2UP1 A;  4H4M B;  1WTB A;  1R8H A;  1RKI A;  4G1P A;  3T5L A;  2HQC A;  1RTD B;  2JHE A;  1VLO A;  2FY8 A;  1XMO F;  3BBC A;  3GB0 A;  4L6V 3;  1GMU A;  3O8W A;  2VG6 A;  2CJX B;  2AEJ A;  1DLO A;  3M32 B;  2FVR A;  3G4S S;  1YTY A;  1U6F A;  3Q0A A;  3BEG B;  4KTQ A;  1YVF A;  2FJB B;  3BJY A;  2BW2 A;  1BWE A;  3KWM A;  3Q8Y A;  3C8Y A;  2C2K B;  4O4R A;  1Y3K A;  1O8B A;  3SCI E;  2RQK A;  2CQI A;  2LQ8 A;  1FE0 A;  4WBF A;  2K1R A;  4DLE A;  3D68 A;  4Z2X A;  3LPE A;  4WPA A;  3KNA A;  4PXE A;  2HFZ A;  9RUB A;  3EGW B;  3K57 A;  2E9R X;  4ZPB A;  5ETV A;  5KFA A;  1IBK J;  4FP9 A;  5KFQ A;  2GJI A;  2XYH B;  2AMC B;  4I2Q A;  3T9N A;  1WHX A;  1S57 A;  3LGH A;  1AYE A;  2ZUG A;  1G2E A;  4N8O A;  5CAB A;  3D6M B;  3DLE B;  1FNM A;  2B5J B;  2CNO B;  3CD7 A;  2BJ3 A;  2KB2 A;  4C11 A;  2OKQ A;  3K2Y A;  2HND A;  2XI3 A;  3ZFV A;  4J9M A;  3K5P A;  1FJG F;  4NCA A;  3IWX A;  2H3E B;  2OI2 A;  2FHJ D;  1VQO S;  1N5T A;  4KGK A;  2J5A A;  5KFK A;  3D28 A;  2BQ3 A;  2YNG A;  1HQ2 A;  3P4U B;  3NMR A;  4CLU A;  3NKY A;  3O2I A;  3G6X A;  1U25 A;  4TVA B;  3O5T B;  3KDO A;  3ET6 A;  3QBC A;  1RWP B;  4JI6 J;  3LOU A;  4XIU A;  3LAN A;  2YWK A;  2AW0 A;  3OW2 R;  2OPQ B;  1Q0N A;  3TZX A;  3J7Y U;  2FC8 A;  2M70 A;  2ZBR A;  3VV2 B;  1S1T A;  2CQ2 A;  2MXY A;  2AIR B;  2HMI B;  1Y5N B;  5IM0 B;  2W8L A;  4A8F A;  5L1L A;  2IM3 A;  1RYR A;  2VQF J;  3FCV A;  4DPX A;  2ZWO A;  2CPD A;  1NK6 A;  1SH2 A;  1HNZ F;  2DGO A;  4IQM A;  3M6X A;  3MPW A;  5JVG Q;  3TRG A;  3DMJ A;  3R27 A;  2LYV A;  1J5E F;  2EWH A;  4CT9 A;  2AT1 B;  3KG1 A;  1LW0 B;  1B70 B;  2RS2 A;  4U7U D;  4JI2 F;  5D0E A;  5IFM A;  4NXN J;  2KVI A;  4UF4 A;  4PG8 A;  1KFD A;  2L9W A;  4X4S A;  1RA7 A;  2ZJR Q;  1U45 A;  4KJI A;  1LWX A;  3G8Q A;  4UOG A;  5F0W A;  2QA2 A;  5A6P A;  5F3Z A;  2OTJ S;  3G82 A;  2FVS A;  3UVJ A;  1TK8 A;  5J2M A;  3PW4 A;  1RT1 A;  4FZV A;  4KE5 A;  2B56 A;  3GWC A;  4O23 A;  1WOS A;  4C8Z A;  1NH7 A;  5E3C A;  4RBU A;  1XR7 A;  5LSL A;  3GCW P;  3BO2 A;  2RU9 A;  1FNX H;  4DR6 J;  5E3A A;  3R1L A;  3QGG A;  3DI6 B;  4W4M A;  1VQP S;  2F5G A;  2D69 A;  1PSD A;  2I5J A;  3TZY A;  1BQX A;  1M0S A;  2W4D A;  4NYO A;  3PX6 A;  1TVR B;  2ZZN A;  2NSB A;  2KH9 A;  3BR9 A;  2IHR 1;  4ZHR B;  1HNI A;  2HFU A;  2DR6 A;  3TVK A;  3TYT A;  1GAO A;  1T94 A;  2DO4 A;  4J9Q A;  1TL3 B;  3POT B;  2NLW A;  4HDH A;  4CNY A;  1NK8 A;  2HHQ A;  3EGZ A;  4XDC A;  3Q2T C;  3VWS A;  1U0S A;  2CWX A;  5BR8 J;  2DNG A;  3TOQ A;  5KFJ A;  3MEG A;  3S6E A;  4RUH A;  1F5A A;  2V8D A;  4ZN3 A;  2BW7 A;  4WK1 A;  3PFO A;  4JV5 J;  4RNH A;  3MMB A;  1SJR A;  1REG X;  4DJB A;  1YRX A;  3LTO A;  1SH0 A;  3AH6 A;  2MZT A;  3FCW A;  2ZH3 A;  3NBP B;  1RZM A;  5CD4 A;  4JI4 J;  4YQW A;  2Y1I A;  1WEX A;  3T5J A;  1Y5L B;  4DI6 A;  4DN9 A;  1IBK F;  3P96 A;  4GC7 A;  3U02 A;  1TMM A;  2IBK A;  1B64 A;  2DGV A;  2ZDP A;  1LV5 A;  2ZC3 A;  2B3T B;  2RDJ A;  3C15 A;  1WTF A;  2EC2 A;  2UXD J;  4OI6 A;  1JLA A;  3CPW R;  2V2Q A;  4OV1 A;  4BWM A;  3R5J B;  3N6L A;  4K4Z A;  2G0J A;  3D0G E;  3MR6 A;  1OSC A;  2V4R A;  5KOX A;  3QT6 A;  1JLQ A;  1CVJ A;  2GO8 A;  5L38 A;  4ZVR B;  1WSV A;  3GMG A;  2J9E A;  1X5S A;  4M5N A;  2AGQ A;  3T5K A;  2N4D A;  1DTT A;  4UQT A;  7AT1 B;  2VV5 A;  1LWC B;  5E3P A;  5DET A;  1PCA A;  3ICL A;  2W7O A;  4DPY A;  4JI6 F;  3V2U C;  1UFK A;  1F5B A;  5DZ7 A;  4USU A;  4CQ1 A;  1HQU B;  2R2S A;  2HFV A;  2O01 C;  1FJC A;  4USV A;  1ZM3 A;  3GFH A;  1WC4 A;  3Q83 A;  3I4P A;  1BQM A;  4ECW A;  3M32 A;  5HVH A;  2AF6 A;  4MT1 A;  5CCM A;  4FYD A;  1TTH B;  2QX0 A;  3M2V B;  2VQF F;  2OJ3 A;  5D4P A;  3QZ8 A;  2Q66 A;  3W61 A;  4EEY A;  2QC3 A;  1HHT P;  2QYG A;  2XNR A;  1Q8K A;  1VIX A;  2CQP A;  3W7B A;  1OMS A;  2KYX A;  3EIC A;  4DZ6 A;  4NXN F;  1HWJ A;  1YK9 A;  3G96 A;  4ZCL A;  2D3Z A;  3W63 A;  3P3D A;  4KR0 B;  4K4Y A;  2B9W A;  4A8O A;  4KT0 C;  1VIS A;  2XC9 A;  2VPY B;  4ZVQ B;  2KFZ A;  2PO4 A;  2IRX A;  1FDA A;  5DG7 A;  5A2Q U;  2QL9 B;  2E29 A;  4IH6 A;  2YWH A;  2J0S D;  1Q78 A;  3MEC B;  2BOA A;  1YZ7 A;  2GVD B;  5D4O A;  1N0U A;  4TY8 B;  4WKR A;  4LR8 A;  1OPI A;  3GYG A;  2YWW A;  4C9D A;  1JNR B;  4CO0 A;  4QPX A;  5J2N B;  3QGP A;  4KKO A;  4EUV A;  1V5I B;  4FBT A;  4DQQ A;  2I9S A;  2FZC B;  1P9Y A;  2JLF A;  1BC6 A;  2ZH5 A;  4WZQ A;  1YJN S;  4AL7 A;  2JDJ A;  5B0E A;  4UQG A;  1SKW A;  2K7J A;  3M9O B;  4L3N A;  3IN5 A;  1VC6 A;  4OI3 A;  3RB0 A;  4PYA A;  2C2M B;  2CAD A;  5HN0 A;  2XYG B;  5H9E J;  3I0S B;  5E0O A;  2PMW A;  1X8D A;  4A47 A;  4ER8 A;  2WON B;  3NNC A;  2YKP A;  1QAI A;  1U24 A;  2DIT A;  3C66 A;  4DFK A;  3IM8 A;  3LWL A;  3BQ1 A;  4WP3 A;  3CC7 S;  2MLY A;  1D09 B;  4TY9 A;  2KM8 B;  4F0K A;  2OPQ A;  3D54 A;  3M8Q B;  2BE2 B;  2IAJ B;  3NCP A;  4HYK A;  3FEY B;  5THW A;  5IV3 A;  3RR8 A;  4F4K A;  4DUT A;  2HMI A;  1FO1 A;  1M5O C;  2PMZ D;  5IM0 A;  3VGT A;  4CTA B;  1MWZ A;  4OI4 A;  2R8H A;  2JJ4 D;  1C1C B;  5GMK a;  2L41 A;  1YJR A;  5BR8 F;  3D1Q A;  2RF2 B;  3IWN C;  5DLF A;  5HRO B;  3FMW A;  3HSJ A;  4P6Q A;  4X62 J;  2Y0S D;  1HD0 A;  3BPS P;  5DG9 A;  1KTQ A;  4JV5 F;  3P45 B;  2HWH A;  3PJ9 A;  1RU1 A;  2LQJ A;  2GHV C;  3PX0 A;  2NZC A;  4C3L A;  3K5L A;  2N4C A;  4A46 A;  4JI4 F;  2HQD A;  4H4K A;  1D3W A;  4DL5 A;  1F1B B;  2XMW A;  4OYP A;  1X4E A;  1ZTW A;  5KFW A;  3H0P A;  5GAD U;  3FK4 A;  3DHW C;  3BH7 B;  1N56 A;  1X4H A;  1GQE A;  2MJU A;  1N8R T;  2UXD F;  3OLA A;  2XYP B;  1D8Y A;  5HK4 A;  5L1K A;  5ETR A;  4LSL B;  1C0T B;  2CIM A;  5BYS A;  3DDI A;  4IG3 A;  4KV8 B;  1NHU A;  3RBE A;  5FII A;  1FTC A;  2HAF A;  2VG5 B;  1UWB B;  3CJ0 A;  2HIQ A;  1TVR A;  2MB0 B;  1J5O B;  3W5Z A;  2YQ0 A;  4I68 A;  3AB4 B;  1RWN B;  4ZHR A;  3UFC X;  5LSR A;  4QW8 A;  3FRZ A;  1SKU B;  5ETL A;  4TYB A;  2PFD A;  1VYA A;  4AE5 A;  2VFU A;  3LGN A;  2DXE A;  3HXM A;  3GZ7 A;  3JQM A;  3SDE B;  4LF9 J;  2W7A A;  1B4S A;  1NDC A;  3ZTS A;  3D0I E;  3SYZ A;  1EQ0 A;  3PYG A;  1SJ4 P;  3A8J A;  3KJN B;  4ECX A;  1M5V C;  2HNZ A;  2EKY A;  2AJ2 A;  4PWW A;  2V34 A;  1BWV A;  3EDQ B;  3JSM B;  3QT8 A;  1IBM J;  4CLW A;  2QRR A;  3DOK B;  3F0N A;  4DL2 A;  4N76 A;  2QT7 A;  2B7B B;  3SV4 A;  5L1I A;  1S7H A;  2OML A;  3GSD A;  4KH1 B;  4JBC A;  2NYH A;  3DDN A;  2W9C B;  2AJ4 A;  3EZO A;  2W9B B;  3KOA A;  1QTM A;  1RWU A;  2BYC A;  4QR0 A;  2F7V A;  4TQS A;  3GYN A;  3WC0 A;  2LMI A;  4DV5 J;  5IT9 U;  2UZA A;  5LMU J;  1Q5V A;  3Q23 A;  2ROP A;  4OQJ A;  1Q86 T;  1H0H B;  8ATC B;  2L3M A;  2ZZT A;  4UTG A;  3HVA A;  3PW2 A;  5C24 A;  1HD1 A;  4MJK A;  1HPZ A;  1CSJ A;  1VGY A;  2ALY B;  1WC3 A;  2ROG A;  3UE2 A;  2JX2 A;  1LWC A;  3JAM U;  1D1U A;  3UD4 P;  4FYX B;  3UD5 A;  4ZMM A;  2YPY A;  2DHS A;  3ONQ A;  3J81 U;  1NME B;  5BJR A;  3GJS B;  4I6W A;  4E2F B;  3MZI A;  2OLW A;  3RBD A;  1P1L A;  4OZL A;  3ZC4 A;  3IS9 B;  3EZU A;  2DNN A;  2LVW A;  4OJH A;  4ZP8 A;  4WE1 A;  4QQB A;  3IRW P;  4KHR A;  1T05 A;  2HNY B;  5IS2 A;  2YKQ A;  4X62 F;  5DS7 A;  3THP A;  4DXL A;  5FLX U;  5E3Q A;  2W01 A;  3FGV A;  3EXC X;  2MKC A;  3T3F A;  3QID A;  2M7S A;  3PFE A;  5GAH I;  3NLC A;  4NWB A;  3CME S;  4EGL A;  3MHY A;  3QWU A;  4URG A;  2QLF B;  4ZVP B;  1HNX J;  3UNG C;  1T11 A;  4JI0 J;  4Y28 C;  4NA1 A;  3HHD A;  1U4B A;  4YR0 A;  4KIA A;  4HLB A;  1S6P B;  1K9M T;  3CJ8 A;  4B9U A;  3R3T A;  3Q22 A;  1SH3 A;  4TY8 A;  1RUS A;  1TV6 B;  3N0V A;  3K8V A;  1WDT A;  1R3N A;  5GAG I;  3V4M A;  5J2N A;  3HVT B;  2K7K A;  1K1Q A;  2C3O A;  3MFI A;  4DFP A;  3KXD A;  2GIQ A;  4OHV A;  2F63 A;  2VPX B;  2Y8Y A;  4QW9 A;  5J2P B;  1UET A;  1ZA1 B;  1VI7 A;  5G4D A;  3C16 B;  1R6V A;  4K4T A;  2C3Y A;  2M52 A;  2DR8 A;  2QFI A;  4CLY A;  1HIY A;  2HW3 A;  1OYD A;  2BJ9 A;  3M2R B;  2WBR A;  2RU3 A;  2PII A;  2KFN A;  1X4G A;  4I7F B;  4DX7 A;  2WON A;  2PGC A;  3G87 A;  4DV0 J;  2FLP A;  5KFC A;  4JI1 J;  4FN5 A;  1GTE A;  1G1X A;  2H54 B;  4ES2 A;  1OY6 A;  5ETN A;  2QEX S;  1ROF A;  2LEC A;  3M8Q A;  5HQM A;  5KFS A;  2BE2 A;  2IAJ A;  3SXL A;  2IYG A;  2P6T A;  2IVM A;  3BS9 A;  5L1J A;  2Z2Y B;  4LF9 F;  3UDL A;  1OWX A;  3IM9 A;  3CDW A;  3CD6 S;  3TAN A;  4C8O A;  1UPP A;  1D0E A;  3J80 Y;  1KLN A;  3AHP A;  3BGR A;  1C1C A;  4DSK A;  4Y2M A;  5E7O B;  4B9T A;  3OUY B;  1WC6 A;  3R8Y A;  2RF2 A;  2RIL A;  1HNV B;  2BZ2 A;  5HRO A;  1RWM B;  2DXF A;  2HEK A;  3VVU A;  3KG0 A;  2VD3 A;  1OIA A;  3KYL A;  1T8E A;  3MMJ A;  1IBM F;  1DAX A;  2B4O A;  2DPJ A;  2YKO A;  4P2M A;  3BO4 A;  2CNN B;  1T9V A;  2XY6 A;  2YBV A;  1NHV A;  1PGZ A;  1JLG B;  3NRB A;  3KLF A;  5DDR C;  5GAE U;  4IR1 A;  3Q8V A;  3VF0 B;  3GIL A;  2D41 A;  2CZ9 A;  3BKU A;  4DV5 F;  1NB2 A;  3ZZO A;  3MEK A;  5LMU F;  2POK A;  3MMC B;  2O67 A;  5KFF A;  2CQH A;  4IR9 A;  1VQN S;  4F04 B;  3MCS A;  1VRU B;  7FD1 A;  4PWD B;  1V3S A;  2VBX A;  3MM6 B;  2R3V A;  3D67 A;  4C0O C;  3KLH B;  2VOD A;  2D3O R;  1WOR A;  1UWB A;  3FZ2 A;  1SL1 A;  3D6T B;  2OGU A;  3W2W B;  4W98 A;  2EFQ A;  4IDK B;  1TKZ B;  2GHP A;  2IC3 B;  1J5O A;  3JSR A;  4DV7 J;  4BCA A;  4NAS A;  4F3M A;  1NHK L;  4YOE A;  2GV1 A;  1Q81 T;  2FLO A;  3M9M B;  4YUD A;  2CQG A;  1S76 D;  5EWG A;  4U9R A;  4ZLL A;  2R7R A;  2W2O P;  1J27 A;  4DV4 J;  1RAO A;  4HR2 A;  4OFZ A;  3V6H A;  3QIP B;  1NRK A;  1NLK L;  2FC9 A;  3MPY A;  4W92 B;  1VOM A;  2XMT A;  3M2U B;  2MZS A;  4PZV A;  3RAM A;  3HP6 A;  2DNO A;  1E6Y A;  5H9F J;  4WIQ A;  1IKY B;  2AYE A;  4C48 A;  4JYA J;  1EX8 A;  1WNE A;  3AJ1 A;  1UVK A;  1WOP A;  2B4P A;  4ZIV A;  1W26 A;  3PTW A;  1RKJ A;  2KL8 A;  5JUM A;  1M1K T;  1UFW A;  1EKS A;  1LXN A;  1UWA A;  1FFW B;  2V8V A;  2HSE B;  1XBW A;  3JSM A;  1U1O A;  2G9O A;  2CPI A;  5DM6 Q;  4I0W A;  4LT6 A;  3T41 A;  3DOK A;  5A8R B;  1XER A;  3CDE A;  3UR3 C;  2C3M A;  3EE3 A;  2MZQ A;  3LGM A;  1HNX F;  1LWF A;  3CUN A;  2L9D A;  2HHS A;  5HQ8 A;  3C6U A;  4JI0 F;  2F4V J;  4X4U A;  4Q45 A;  1XJW B;  2VC1 A;  3EUN A;  1RTH B;  1H3D A;  5B0G A;  4MMO A;  1IKV B;  4O3S A;  1QM9 A;  3IG1 B;  4Y3C A;  2UU9 J;  3UN3 A;  1FXL A;  3QJL A;  2ILY A;  4B3R J;  2VBZ A;  4F3Q A;  3PVX A;  1P8G A;  2HK3 A;  1UEU A;  3HK2 A;  1N6Q B;  3A4T A;  2B4U A;  4O4G B;  4ZPD A;  3GFX A;  1S6Q A;  4WTO B;  4UZC A;  4EZ6 A;  2XBP A;  5KFD A;  3G6Y A;  2JC0 A;  2O66 A;  1H6K X;  2IJN A;  5M2U A;  1O5J A;  2Y0B B;  5EN1 A;  1SV5 B;  2HQ3 A;  5GMD A;  1R6Y A;  2IM0 A;  2CDR B;  1UJ5 A;  4GVL A;  4J7C A;  4ZVH A;  2IA6 A;  2ERR A;  4JI1 F;  4Y0F A;  5HLF B;  3QFH A;  4NLO A;  4A8K A;  5DQI A;  5KT4 A;  4LSN B;  5H9E K;  1KQG B;  1Q5Y A;  3IS9 A;  4HAC B;  3HD1 A;  3TUP A;  2CZV C;  1MRO A;  5KFR A;  4JOU A;  4O3R A;  1RT3 B;  1IM4 A;  3ADA C;  1RHK B;  1EHW A;  2DTJ A;  1HBM B;  4QIV A;  2IA0 A;  4LFA J;  3CCU S;  3K89 A;  4U7U K;  1RWO B;  1RTJ B;  3VAL A;  3FMB A;  4N56 A;  1BXN A;  3RZA A;  1QVF R;  3PYF A;  2XSJ B;  3GR0 A;  3H25 A;  2HS4 A;  2BM1 A;  3OR1 B;  1FE4 A;  3ENW A;  1RHQ B;  1QAX A;  1NPK A;  2CPY A;  1ICE B;  3VAM A;  3RB6 A;  2G2Z A;  4RW6 B;  2AP6 A;  2HIY A;  3CE8 A;  1B0V A;  1JXE A;  4IRD A;  2RD5 C;  5CH7 B;  1HL6 A;  3UNY A;  1S6P A;  4U6P A;  2F65 A;  4PAB A;  3FBF A;  4WP9 A;  1HYS B;  2ACM A;  1VFJ A;  3H59 A;  2HHP A;  4CI0 B;  3FSY A;  1CS4 B;  2EK6 A;  3D66 A;  3JTO A;  5HVG A;  4Y34 A;  5D6G A;  2HVH A;  3RW6 A;  2Z56 B;  3Q24 A;  2MKH A;  4RNO A;  2OFH X;  2YNI A;  4TQR A;  3SZ2 A;  4FF3 A;  4TNO A;  3W66 A;  2AJ0 A;  3W5Y A;  1MU2 A;  5KFO A;  4EBE A;  1RAJ A;  1NK4 A;  4ID8 A;  1FD8 A;  5J2P A;  1SQE A;  5SUH A;  2I8E A;  4YB7 A;  3W62 A;  2D1C A;  3RG6 A;  4MIB A;  3OQ2 A;  1AW0 A;  4OV6 A;  4WWS A;  3PG9 A;  1BMQ B;  2DHA A;  4A8M P;  4I7F A;  4XDD A;  4DV1 J;  4DV7 F;  3CCZ A;  4PEO A;  1U7L A;  4QIG A;  3NGT A;  4FKY A;  4K7Q A;  1YSJ A;  2JRS A;  3BYP A;  4X4O A;  1CQN A;  3DYA A;  4RWX A;  3JXO A;  4KO0 A;  1FK9 B;  1S97 A;  2R8K A;  3DM2 A;  4ES1 A;  2ZKT A;  1VQ7 S;  2VG7 A;  1RQ0 A;  4DV4 F;  3CUL A;  5B0D A;  1WKJ A;  4QIF A;  2DVI A;  1S79 A;  4X64 J;  1EB0 A;  4MYT A;  2QN6 B;  4YB5 A;  4JYA F;  3DRR B;  3NXZ A;  3G2X A;  2HGM A;  5KFL A;  4MH8 A;  1HWI A;  2YX7 A;  1V3Z A;  4CP5 A;  2YH0 A;  3NOC A;  4DU8 A;  5K14 B;  3GSI A;  4GMK A;  2XO6 A;  4ECV A;  5ETK A;  3HSD A;  2AEF A;  1Q16 B;  4WU2 A;  5DDP C;  4TLQ A;  1FFS B;  3EX7 B;  4YB1 P;  2DK2 A;  1TFW A;  1ULR A;  2M4M A;  5A8K B;  5C25 B;  3G8T A;  2F4V F;  3FVY A;  1VCT A;  2FJW A;  3J7Y I;  1R8C A;  1E6V B;  4ATN A;  1JLG A;  2X3D A;  2FHM A;  2RDI A;  1IXK A;  2VIH A;  2XHW A;  2V9W A;  2UU9 F;  3DU6 A;  3TUZ C;  3PR5 B;  2AQ4 A;  4B3R F;  4DL3 A;  3PR4 A;  2HQI A;  3GON A;  1VC5 A;  3UN2 A;  2LQB A;  3CJ2 A;  3MMC A;  4JI8 J;  3IWL A;  3HHL B;  1VRU A;  1MMN A;  3RBX A;  2MHE A;  1FI4 A;  2C2Z B;  3MM6 A;  3KTQ A;  3KLH A;  2ADC A;  2E5L J;  3HO1 A;  4M5I A;  3DRP B;  4F2S A;  1UFL A;  1YBA A;  3W2W A;  2M0G B;  3U27 A;  2IC3 A;  3BQ2 A;  1M5H A;  2BE9 B;  3J7A N;  2HS0 A;  5D4N A;  1Q95 G;  4X4P A;  4WCE Q;  4DUY J;  4F4W A;  2UUB J;  4ID5 B;  3TEH B;  5E3R A;  2JLE A;  1F9F A;  2EBE A;  4LFB J;  1V3R A;  3CC2 S;  3TR5 A;  2F8E X;  2SXL A;  1VRT A;  1CG2 A;  5HQL A;  3NS5 A;  3V6D B;  2IRY A;  1U1M A;  4KGX B;  1EAY C;  2NXC A;  3AA9 A;  3CSK A;  3G9C A;  4CLP A;  1KHW A;  3N9U C;  3M2U A;  2I6W A;  3DKD A;  3BSN A;  2WZ1 A;  2ZZM A;  4XTT A;  3SBM A;  2J7K A;  1KD1 T;  4LFA F;  3ZO7 A;  4RR5 A;  4O0I A;  1RT5 B;  3I5B A;  3DRX A;  2MKY A;  2MDA A;  2IDE A;  1S1X B;  5A8R A;  2EG1 A;  2RKI B;  2JC1 A;  1TEL A;  1UPM B;  4UUW A;  3T6B A;  3CCM S;  2BX6 A;  4DSF A;  5B0F A;  4DG1 B;  1RTH A;  3TJ9 A;  2DR5 A;  4NLW A;  4UST A;  2CPH A;  1SC3 B;  3KNG A;  2GAG C;  3MCO A;  5HI7 A;  1FRX A;  3LAL A;  3I4H X;  2IY5 B;  3IG1 A;  2GS8 A;  3PX4 A;  3I31 A;  3ZZU A;  2GGP B;  4OI1 A;  4MFB B;  3H40 A;  3IXQ A;  3CCR S;  3JYT A;  1JK9 B;  3KUE A;  3RR7 A;  3NAH A;  3HHE A;  4O4G A;  1LW2 B;  2OSQ A;  3KG4 A;  3DFE A;  1L3T A;  3GCX P;  1YI2 S;  3MCN A;  5HAT A;  3HVW A;  2FHK A;  5HAN A;  1PAU B;  5I3U B;  4NRU A;  2DR7 A;  4CO2 A;  3DLK A;  1SV5 A;  3FQK A;  4DV1 F;  2LFV A;  5AXK A;  3CF5 Q;  1G6B A;  3LPY A;  4JI5 J;  5L9X A;  3BYR A;  4NCG B;  4I4B A;  4LFC J;  1OQ6 A;  1SXL A;  3I9Z A;  5KFP A;  2UUT A;  2ZIT A;  4HAC A;  4LRA A;  2E66 A;  3BQ0 A;  3BSO A;  1RT3 A;  2XEX A;  4X64 F;  4FF1 A;  1BHN A;  3I5C A;  4F4Y A;  2V68 A;  2MQP A;  4EO8 A;  3LP1 A;  4ILL A;  4GO7 X;  1HBM A;  2ADB A;  5E33 A;  4YME A;  3CD5 A;  3M8Y A;  4OZ1 A;  3NMA A;  3RAQ A;  1NJZ A;  2W7P A;  2ZHA A;  2ZBI A;  2HRY A;  1X4D A;  2HVI A;  4IOB A;  1C1B B;  1MML A;  2VBW A;  2RQM A;  3HDS A;  4FYY B;  1CJU B;  2XSJ A;  3PNI A;  2Z2M A;  4ZVU B;  4CYU A;  2DPI A;  4OZ2 A;  4P74 A;  3OV7 A;  2KG1 A;  3CC4 S;  4K4U A;  4RL1 A;  3HZE A;  1CQM A;  5LSO A;  2O1P A;  4HTI A;  2KFY A;  3PHT A;  1UW4 A;  3OT9 A;  4RW6 A;  1RU2 A;  1Y11 A;  3PKM A;  5AT1 B;  3RJM B;  5IXU A;  3FFI B;  1ZPV A;  2KHD A;  4Q0B B;  2C3U A;  1Y7P A;  1HYS A;  2RQC A;  1S0O A;  3IMQ J;  2XY5 A;  5J1E B;  2OPP B;  1C4A A;  1CS4 A;  4FPI A;  4YN3 B;  5T7L B;  2XMJ A;  3C19 A;  4V1A k;  3GG1 A;  3SFU A;  5B7W A;  4RZR A;  2QA4 S;  2E5H A;  2ZHB A;  4JI8 F;  2XMM A;  4FBU A;  5KFI A;  2KRR A;  5C2G A;  3LWM A;  2E5L F;  3DC2 A;  4KB7 A;  2FLL A;  1VQ9 S;  2DNY A;  1RSC A;  1SI9 A;  1WHY A;  3PCO B;  3PRD A;  4HT7 A;  3QFW A;  4HH1 A;  2CQ0 A;  1FDB A;  2DIU A;  4I2P A;  2UUB F;  1SC6 A;  3OR2 B;  1SJQ A;  1MLA A;  2OPR A;  2CQC A;  4DCO B;  3LO3 A;  3EDR B;  4LFB F;  1PJ7 A;  4KBI A;  5DZ6 A;  4F25 A;  2MGZ B;  3MPD A;  2KDO A;  3BRE A;  3W9I A;  3CJT A;  3OTD A;  4DDF A;  4K4W A;  2ZNZ A;  4LRF A;  3TVZ A;  1DAR A;  1F5C A;  3DRR A;  1BUX A;  2VA2 A;  1N33 J;  1I1G A;  3TUI C;  2H5I B;  4MKY A;  2MQO A;  4N7T A;  4A8Y A;  2RT3 A;  5K14 A;  1JLB B;  1URN A;  2ZH6 A;  4PKD B;  1U0H B;  2FHO B;  3CED A;  4X4V A;  5H9F K;  1FFG B;  3I9V 9;  2DXD A;  4DBQ A;  1UW9 A;  1JB0 C;  3BN7 A;  3ZZT A;  1DZ5 A;  2DO0 A;  1ARO P;  4J9U E;  3M05 A;  5C25 A;  2NYI A;  4DQI A;  3GIJ A;  4J91 A;  2DJW A;  2CUY A;  2DR9 A;  3OD2 A;  4B3O B;  4AT1 B;  1WOO A;  4J9L A;  2PFF B;  5FDL B;  4ETZ A;  2GW8 A;  4NEY A;  3IR7 B;  3NGK A;  4O3P A;  3V4I B;  1Q4R A;  2OIH A;  3NY0 A;  1K47 A;  1EJ7 L;  2MZ1 A;  2NUH A;  2A18 A;  2B0G A;  1FER A;  5I42 B;  2DIS A;  2J6U A;  4FDF A;  3ENA A;  2RE1 A;  1RAB B;  1JLC B;  1HBU B;  2XWY A;  3CCL S;  3RW7 A;  2X3G A;  1R31 A;  3DRP A;  2EI5 A;  3QAT A;  5AE3 A;  3PIP Q;  3HHN B;  5SZT A;  1KFS A;  2YNF B;  3MXH P;  3UQS A;  2BAC A;  4B17 A;  4FF2 A;  3DXS X;  4JI5 F;  1VLY A;  1M1G A;  4AQY F;  1NH8 A;  4ID5 A;  1VHF A;  3KLG B;  4DPT A;  4C2M A;  4LFC F;  3VAH A;  4ZS6 A;  5L9N A;  3HVR A;  1NEE A;  1MN9 A;  1ZOT A;  3CJ4 A;  3V6D A;  3D2W A;  2E7W A;  3KKF A;  3HHK A;  1RT6 B;  3MM7 A;  4RKU C;  1AUD A;  2DGX A;  1VDH A;  1WHW A;  2HQF A;  3EMT A;  1S9E B;  4OZ0 A;  4IUF A;  3M6W A;  4QIE A;  5B0B A;  8RUC A;  4M1K A;  3FZB A;  2JLG A;  3QZ7 A;  4MKA A;  2GZO A;  2LA4 A;  3N5F A;  1S1X A;  1X4A A;  1U09 A;  2H1Y A;  3MEE A;  2XMA A;  2E1R A;  2VU5 A;  2Y1R I;  1S5Z A;  2Z58 B;  1FXR A;  5A8W B;  1WF1 A;  4DG1 A;  4F8R A;  1K8A T;  3DGP A;  1FRL A;  2U2F A;  4ZLN A;  1VQ4 S;  4DN0 A;  4ZPV R;  2YWE A;  2YNH B;  1WG1 A;  2XY7 A;  1I94 J;  4OYA A;  1S1W B;  1R8B A;  2GGP A;  4MFB A;  3NWG A;  1A0O B;  1NKE A;  2OEJ A;  3R5A A;  5D0H A;  4HVZ A;  2FVC A;  4ECT A;  5D4L A;  2PD1 A;  1SJ3 P;  2ZDO A;  2ATL A;  3VVT A;  5I3U A;  3I56 S;  4LBI A;  2E1C A;  3BBF A;  3GQC A;  2IIH A;  2P9G A; 
#chains in the Genus database with same CATH homology
 2MQ8 A;  1HNZ J;  2UXB J;  4HHU A;  2KL8 A;  4GKJ J;  5BR8 J;  2MEW A;  3JAM U;  4JI0 J;  4LF7 J;  2VQE J;  1N34 J;  4K0K J;  1XMO J;  4NXM J;  4JI5 J;  4X64 J;  4JI8 J;  4DR6 J;  1J5E J;  3IMQ J;  1IBK J;  1N36 J;  5A2Q U;  4PWW A;  4DV2 J;  4KHP J;  3W1Y C;  4LFC J;  4KY3 A;  5IWA J;  4JV5 J;  5LM7 E;  2E5L J;  4DR2 J;  1N33 J;  4JI2 J;  1IBM J;  2VQF J;  3J81 U;  2KVQ E;  4GKK J;  1FJG J;  4V1A k;  4X65 J;  5AJ3 J;  1XNQ J;  2ZM6 J;  1IBL J;  4DV6 J;  3R2C J;  1HR0 J;  4JI4 J;  2F4V J;  3J7A N;  4LF8 J;  4AQY J;  4DR7 J;  4DV7 J;  1XMQ J;  3T1Y J;  4X62 J;  2UUC J;  4LF4 J;  4DUY J;  4DR3 J;  4RJV A;  2UUB J;  4YY3 J;  1HNW J;  4X66 J;  3OTO J;  4KYZ A;  2UUA J;  2MTL A;  1I94 J;  4JI7 J;  2UU9 J;  4NXN J;  4DR4 J;  4B3M J;  4LFA J;  4DV3 J;  4LFB J;  4B3R J;  2UXD J;  4OX9 J;  4JI3 J;  4LF6 J;  4DV5 J;  4DR5 J;  2UXC J;  5IT9 U;  4DV4 J;  4B3T J;  4LF5 J;  5LMU J;  4DV1 J;  4LF9 J;  5FLX U;  4NEY A;  4DV0 J;  4DR1 J;  3R2D J;  4JI1 J;  3D3B J;  4YHH J;  5LMN J;  3T1H J;  4NEZ A;  3D3C J;  4JI6 J;  4JYA J;  3J80 U;  2HHH J;  1N32 J;  1XNR J;  1HNX J;  4DUZ J;  4B3S J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...