2UXDJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxdJ00
4K0KJ 2ZM6J 3D3CJ 5IT9U 4X65J 3T1YJ 1XNQJ 3D3BJ 3IMQJ 1I94J 4V1Ak 4JI5J 4DV1J 1IBMJ 4DV0J 4B3SJ 4JI3J 2MQ8A 4LFCJ 1N34J 3JAMU 2UUCJ 4DV2J 4B3MJ 4NEYA 4JI1J 4LF5J 2UXCJ 4GKKJ 2UUAJ 2F4VJ 2UUBJ 4KHPJ 4X64J 4DR2J 4LFBJ 2KVQE 4NEZA 4DR5J 1N33J 4LF8J 4YHHJ 1N32J 2KL8A 5AJ3J 4DR7J 5A2QU 4DR3J 3J7AN 4LF7J 4LF4J 3J80U 4DUYJ 2HHHJ 5BR8J 4DV5J 4DUZJ 4DR1J 4X66J 4LF9J 5LM7E 4NXNJ 1HNWJ 2MEWA 4LFAJ 4RJVA 3W1YC 3R2CJ 1XMQJ 1HNXJ 5LMUJ 4JI0J 4DR4J 2UXBJ 4KYZA 4JYAJ 2VQEJ 2VQFJ 3R2DJ 4JV5J 3OTOJ 4JI7J 2UXDJ 5LMNJ 5IWAJ 4DV7J 1J5EJ 4DV6J 1HR0J 3J81U 4DV3J 1HNZJ 4JI4J 4B3RJ 4KY3A 2MTLA 2UU9J 4PWWA 5FLXU 4OX9J 4JI2J 4JI8J 1XNRJ 4X62J 4GKJJ 4JI6J 4DV4J 1IBKJ 4YY3J 3T1HJ 4B3TJ 4LF6J 1XMOJ 1FJGJ 4AQYJ 1N36J 1IBLJ 4DR6J 2E5LJ 4HHUA 4NXMJ
chains in the Genus database with same CATH superfamily
1S99A 1V6HA 2Z56B 4EO8A 3Q8UA 4FDFA 2GHVC 5GAGI 1XNQJ 2YQ3A 4DPYA 4LREA 2AEJA 3QAEA 3GZ7A 1TKZA 2YKQA 3R5AA 4J91A 2EW9A 3MZIA 4WKYA 3QIPB 3OVAA 1IWGA 1I1GA 3NS7B 1S1TA 2D3OR 1ZETA 1EAYC 1S7HA 3GJRB 3G71S 2XNQA 3DRSB 1IVZA 4NEYA 2IPOB 2VFSA 3M2UB 4WXWA 4BHQA 4DZDA 3RJMB 3QBCA 5I42B 1NZ8A 3GIJA 1DURA 2KJVA 3GR0A 4I7FA 2V8HA 2MQPA 4GKKJ 3SFUA 3MD3A 3CJQA 1YTYA 1Q5YA 5KFJA 1RXOB 4LFBJ 1ZZFA 2HHTA 1BC6A 4RNHA 2V63A 2V34A 2CJXB 5IT0A 5KFFA 3FEZA 2DNNA 4NLVA 1CPZA 2M3DA 1RCXB 2IAJB 4EEYA 4QR1A 3WX8A 1HFEL 5F41A 4JI2F 4Z7CA 1Y5NB 3I0RB 4I4BA 5AJ3J 2XEXA 3TAMB 2JX2A 5HJXA 4DLGA 2VQFF 1RADB 2ZHAA 2XS5A 4LF7J 1KBRA 1SUQB 3MMCB 1JLGB 4NXMF 1AW0A 3FK4A 4Y28C 4OI3A 1UJ6A 3DMJB 1FWKA 3ENVA 2Q6BA 3MM9A 4HH1A 1TK8A 2Y8YA 4UTGA 5A0YB 2W8KA 4LR9A 5BR8J 4Q44A 4DV5J 1U4BA 3R5GA 3KOAA 4EFAC 4DR1J 1G7CB 2BR0A 1NK6A 1HYSB 2X1GA 5CCMA 4WWSA 2B9EA 1IKXB 2FIUA 3A13A 1UW9A 4Z37A 3MR5A 2A3JA 3M6WA 4C0OC 2AJFE 3W9IA 1RAGB 5EWFA 3K5NA 3O1LA 4OHVA 3FBCA 3P49B 4FKYA 1OY8A 1X7VA 3HVWA 3F0NA 3GSDA 2MZ1A 3BZQA 5AE1A 3LOUA 1XR6A 2DGOA 3LP2A 3BPDA 4YB5A 3PRDA 2YWFA 3VGTA 1S57A 4ECTA 4ECVA 3E2EA 1ITPA 2AYMA 3C15A 2W24A 4FNHA 1OQ3A 2O01C 2QMWA 3K17A 2M5YA 4ICLB 5DDPC 2LECA 2E9TA 7FD1A 4LSZB 2Z2LA 2LDIA 1NK7A 4C3LA 2F63A 5HP1A 2DEJA 1X9SA 2LP4A 3QO9B 4AXJA 2HMIA 1TQLA 2AJ2A 1FA0A 2DIUA 2KKHA 2OEJA 3VHQA 1OMSA 1VCTA 3A3OB 3PYGA 3OL8A 1U49A 2IY5B 3M2RB 2C2OB 5IV3A 1IR1A 1XIQA 3FQKA 2M9KA 5J1PA 1FDAA 1UWBA 5T14A 4N47A 2GAGC 1DARA 2RMLA 4K4WA 4IYQA 1X4FA 3FBFA 2ZBRA 3C19A 4PZVA 3RB4A 1JJCB 1T9XA 4OZ1A 4MKAA 3M30A 3J7ZT 2ASYA 2H3EB 2XMJA 3V81A 3CPWR 5E3QA 3BKFA 3KG1A 4DBQA 1IKWA 2HVDA 2NXJA 2BV3A 4I64A 3T41A 5E3RA 4HKQA 2PDAA 3MR7A 3NOGA 2DH9A 2QX0A 3RW7A 2L41A 2EC2A 3BS9A 4DPTA 3MAAA 4V19X 1BQNB 3HF5A 4FXVA 1X60A 2OFGX 4GMKA 4F4XA 4WE1A 1KOHA 2KJWA 1SB6A 4NXMJ 3AH6A 5KAKA 4X66F 1SIZA 3NBPA 4ED0A 1C4AA 3PHTA 2XWYA 2XSFA 1KOOA 4OJHA 1RTZA 2E5LF 4JI3F 5J1EA 1UCNA 3H59A 2VG6A 1KTVA 4K8RA 1I94J 5IXUA 4M1KA 1LWEA 3SEOA 5KOWA 1JLFA 4FBUA 5AE2A 4USVA 2RIJA 3FCWA 5CYMB 5DGBA 4QWEA 5ADZA 1PCAA 2YX7A 4MK8A 3UDVA 2KFNA 4Y65A 5EX3A 2MQ8A 3CCTA 2CJKA 2UUCJ 4WF9Q 1GT8A 1T3OA 1CBKA 2J7UA 3U27A 2IJNA 1FRHA 2LXFA 3P96A 4MYUA 1N52B 1NHVA 4OHWA 1TELA 4J9MA 1UAWA 1N33F 1XK8A 3D6FB 4GKKF 2GMLA 1S9FA 2YWWA 4B02A 1AFJA 4IG0B 4B3OA 4B17A 4WK3A 5F8MA 4DSLA 5KFVA 4DXLA 5DLFA 4DL7A 3H25A 2H5JB 2N4DA 5A8KA 1S6PB 1FKOB 2HHQA 4ECWA 2ZWPA 2Y0BB 1V5IB 3ZXWA 2W8LA 1ZZNA 1RT6A 1YI2S 3IBCB 5HSPA 2AX1A 4ED2A 2YNFB 2L9NA 2FTRA 2V4JA 4AFFA 3EX7B 3DGVA 4ZPDA 2ZH8A 1RSCA 5KFUA 1EKSA 1GTEA 2MQLA 2NXUA 2VONA 2XMUA 4NZ7A 2FLNA 1N48A 3MMAA 2G0CA 2GGPA 1P6TA 2BJ9A 2RUSA 2DRBA 4AQYF 4JV2A 5CA5A 5CYQB 1PSDA 2B3TB 4YY3F 2KDOA 4CYUA 4IDKB 1R6YA 2LU1A 1RDRA 2DHSA 2XMKA 3AD7C 4DL5A 4LF9J 4F02A 2L9WA 3OL9A 3OLBA 2LQ9A 3DM2A 4Q7AA 2F65A 4UQGA 3FSXA 1N5VA 4HDGA 3V6DB 2ZWOA 2WSCC 3DRPA 1J5EF 2IYGA 1IQZA 1S0OA 1VC5A 4DFPA 3MF5A 4C7QA 1HQ2A 4A8MP 2BACA 3CJ8A 3KK1B 2BM1A 1LQ9A 3O3LA 4NCBA 2DNRA 2RILA 2W9AA 3H20A 3OTOJ 3AT1B 4JI7J 5FJ4A 2IAJA 1JK9B 2XWXA 3N01A 4DV3F 4C4WA 3CW2C 3CO0P 4EYIB 2J0WA 4A48A 4C0HA 5J1EB 3TJ8A 2E9RX 3M6UA 2BJ1A 4W4MA 5A8WB 3I96A 4EZ6A 2R3VA 2C2KB 3Q23A 2YQ0A 2AKWB 5DZ6A 3B54A 4L3KA 2J9EA 3KHHA 1L3TA 2NZ4A 2HHVA 4G65A 1Q5VA 4CH1A 3GFXA 2AJ4A 3MEKA 3NEKA 3MM9B 1M5HA 4ERDA 4B9VA 3EYZA 4M5HA 2QLWA 5THWA 1HNIB 2UP1A 4RNNA 3NGRA 4GVLA 5IQQA 3TJAA 5B7WA 2Q3PA 2B7BB 1NAQA 3L7UA 4ZMMA 4DR4F 1P9QC 1YLXA 3R7SB 4F36A 5KT7A 3HVTB 4C11B 3OSNA 3MM7B 1ZBTA 2DNHA 2A0FB 2FJBB 3C6TB 3DYAA 2WONA 3DLGB 4P2MA 5C25B 5LXYA 4K4SA 4L74A 4KC5A 2UUBF 3IO1A 4GO7X 1DJ0A 2FJVA 3V5RA 1UVKA 4J9NA 4CT9A 2CPEA 4OLPA 2N4CA 2J0SD 4ZVFA 3I31A 1J2VA 3VVUA 1CQMA 1HI0P 2J6UA 5D0GA 5IT9U 2YNIA 3DU6A 3MEDB 3HHLB 3RU0A 3W64A 1WEZA 3BSCA 4K7QA 2G4BA 1IBMJ 2F8HA 2ZZMA 2XMWA 1HWKA 3ZNJ1 1Q78A 1VMBA 3TI0A 3TARA 4LFCF 3JS9A 4I67A 3LPEA 2GVDB 2RKIA 2Y1LB 1C0TA 2HVZA 4YN3B 1RTIA 3LH2S 2E9ZA 3NAIA 2IVYA 3BSAA 5IS2A 4DQSA 1OSDA 1F9FA 4DN0A 3B4DA 3BGRB 2W2QP 1Z2LA 4DV7F 1UEUA 1WUUA 4HT5A 4ED6A 1X4HA 4B9LA 3THPA 3EWGA 4O3RA 2PFFB 3C16B 3M32B 4HT7A 5KFCA 4OL8A 1N6QA 3E01B 3F56A 2PFDA 3LO3A 4FZVA 2N7YA 3QPIA 4U95A 3EDQB 4ETXA 5KFKA 2YKNB 4JV1A 4NEZA 4QPXA 2BOPA 4O44B 1U2CA 2XZWA 4YMEA 1TL4A 1A6LA 3FRZA 2ZBIA 1MMLA 1S4EA 4N41A 3QJPA 5CD4H 2OPPA 3VAGA 3VAKA 1ZYQA 4ED3A 2HHWA 3G9CA 5L1IA 2JLGA 1NJZA 3HPOA 2MSTA 1CJVA 2XLKA 4DR7J 5AJ3F 3UFCX 4HTJA 4X62F 1SBRA 4IH5A 3UN2A 1SJFA 3PO4A 1FE4A 1VOMA 3IM8A 2A2DA 3NMAA 5KG5A 1VJQA 1FERA 4ZA1A 2VBZA 2DGTA 3SSSA 3CXCR 3BSNA 4P2SA 4DR6F 4TN2A 2PA3A 1UPPA 2ZH4A 1BD6A 2M0GB 3BYPA 1AT1B 5IQ6A 1KONA 1IXKA 4A8SA 3OVSA 2KT2A 2DJWA 2XSJA 2O1PA 3M8QB 1IKYB 1XR5A 3V6HA 5BYQA 3UR0A 3T9NA 4KKOA 4ZN1A 4XPEA 3H2VE 4DEZA 1U1PA 3MCSA 2FJXA 3WC2A 4CO2A 1HNWJ 2QLFB 4NOHA 1SPBP 1J5OB 4X2BA 5D4LA 1T9TA 4TU8A 1F60B 4TU9A 3W2WB 3VGUA 1TP7A 1RHUB 4MK7A 2DNMA 3KUHA 4TU7A 2MQOA 4ECRA 1GXUA 2VPYB 4ZPVR 4ZIWA 4OYOA 2HFVA 3PM9A 1NSQA 1LXJA 4ECQA 2FVPA 2VOOA 5FLXY 1HBNA 2HGMA 3CJTA 1ZPVA 2FHJD 2LA6A 4K50A 1F0XA 3GJQB 4FYYB 3LWMA 4F4YA 1YHQS 1NJWA 2MGZA 3H5UA 2IMWP 2J0QD 4RUCA 4CCHA 3TQEA 1LV5A 4P71A 5L1LA 4RR5A 4ZDNA 3DHWC 2MSSA 4PG7A 3O5TB 5ETKA 5HJYA 3CCZA 5J2NA 1G2EA 1FKPB 1MWYA 4FNIA 4I56A 2CPJA 3HD2A 1TKTA 3EXCX 1SH2A 2QT7A 2E5GA 4WP3A 1C2PA 2VV5A 2DPIA 1HMVB 1NB2A 1VISA 3TUIC 3S01A 2VHGA 4O0NA 2B9WA 2RRBA 1QLNA 2FZKB 1KNZA 2UVUA 2NPFA 2MKIA 1HW9A 4UW2A 2HS4A 3KUEA 4ECYA 4JI7F 2OUGA 1CC7A 4H4OB 5D0HA 4XIUA 4PG6A 4M5JA 4ZP6A 4X62J 3I9ZA 2D7SA 4K4YA 3V4MA 4NRTA 2MY8A 1NK8A 3I4HX 4DPUA 3E01A 2R7XA 1Q82T 4OX7A 4D3GA 4PWDB 2RHSB 4QR2A 2CQPA 3LW5C 3EVWA 2IC3B 1CS4A 2IJRA 2VIHA 4AYBD 5DQGA 1TL1B 4LBHA 4USJC 5LJ3Y 4F3QA 4N7TA 2AMCB 4OHYA 4WU3A 3G8QA 3HHLD 1CJTB 5KFWA 1HW8A 2HFOA 2LVWA 2MZRA 3FKBA 3IA0A 4P6QA 2J9DA 3Q8YA 1YZ7A 3BQ0A 3NNHA 3MEEA 2HQFA 4I7FB 4OZ3A 1XC9A 3W5XA 1GX6A 1LW2A 4MMOA 2RHQB 5HBMB 3FFIB 4DV1J 2VC0A 1S72S 1SV5B 1I51B 4NMLA 5I3QA 3MAQA 1UKUA 2ZZNA 2DR8A 4ENOA 3VAFA 1UFWA 3RW6A 4LFCJ 2L9DA 3M8QA 4F25A 9RUBA 1LFPA 4WFAQ 2OSRA 5HVFA 4J9LA 1E6VA 1UEVA 2XS2A 3AA9A 5ETTA 3A8KA 1IJFB 4PKDB 1T03A 1RT5B 3GB0A 4QOTA 5IOLA 5K8OA 4X4SA 1TAQA 5D4OA 3BBFA 1XQIA 4EGLA 4X64J 4NLDA 2XO6A 2XGPA 1QSLA 4FVMA 3AD8C 1NLKL 2FC8A 3PCOB 3KLFA 4X4TA 4Q0BB 4TXSA 2GVDA 3LP0B 4MTPA 5K14B 3RZAA 2XTJP 1HWIA 4DX5A 3ISZA 3Q89A 1XBWA 2LEPA 4KH0B 1JNZB 2CPDA 1FJCA 4URQU 1PKUA 2UZAA 5L9NA 2XG8A 3TVZA 4M5LA 5DLGA 3M32A 1S49A 1MWQA 3OTEA 2RAQA 2HBYB 3DOKB 1MMNA 3AB4B 1FO1A 1X31C 3POTA 1VC0A 2XNRA 1HBMA 1UTAA 1S4FA 1ZM2A 1LWCB 2DB1A 2HNZA 3QSIA 3W2VA 5IM0A 3PZPA 4K4UA 2HSEB 1ZH5A 4ELTA 2CDRB 1NM2A 2HNDA 2CVIA 2LCWA 4X66J 1X9WA 1M5OC 4Y2AA 3W1YC 4DV5F 1J27A 2AWZA 1TV6A 3AAWB 4USUA 1DTQB 4LRCA 1FFGB 2ASLA 5E3AA 1QVFR 2QA2A 1F5CA 4A8XA 5LXRA 3L7OA 4I0WA 3D6HB 3OPKA 4ID8A 5DM6Q 2I1RA 3HO1A 1GK8A 2B7CB 2IJFA 3U02A 2RF2A 1Y5IB 4L6V3 4LRBA 4NA2A 2D3O1 2DNKA 3DI6B 5MAOA 2F9DA 3AXMA 3HKZD 3QWUA 2YH0A 1RU1A 1JLAB 3ZC4A 4WYLA 4OJ3A 3KLEA 4OX8A 4DCJB 2CQIA 3AODA 3M2VA 4ANDA 2RQKA 3CCRS 2JVOA 3TQ1A 4HTIA 5ETPA 1FWLA 4HLBA 3DOLB 2OGUA 4PPZA 4GVBB 3M6XA 4KY3A 4YOEA 1FT8A 2XHWA 2MTLA 1R27B 3BGOP 5IC6B 3TJ9A 3MAHA 1NHUA 2W2NP 3WC0A 4KGKA 1Q7YT 2M52A 2WAQD 2IA6A 3BN7A 3CUNA 1FF2A 3CJ0A 3KFWX 4A46A 1KEKA 4C2MA 4K4TA 4HYKA 2XCPA 1RT5A 2AT1B 1T0TV 3M2VB 3UI3A 1M1GA 3LGMA 3SSRA 4EMDA 2HMIB 1R7IA 4IG0A 1WF2A 2D74B 5LOQA 3HZEA 2GVZB 1REVB 1I5OB 3EZUA 2UU9J 3MDFA 1JXEA 1MU2A 3KLHB 3GCXP 3NP5A 2CQ4A 2Y1IA 2RRAA 1JLBB 1FVQA 2GJFA 4NASA 1RWPB 3Q0AA 2C2ZB 4ES2A 4AXIA 2J7KA 3OFFA 2UXBJ 1R0AB 1RWXB 1Y10A 2B43A 2L3MA 4HL9A 4DR1F 4IQXA 2UXCF 3G2XA 4ZVRB 3TOQA 4XTTA 3UCGA 4DOZA 3MR6A 2QTWA 2ZM6J 4ZPCA 4ELUA 1D0EA 4NYPA 1FK9B 1LEOA 4RW6A 4HR2A 5KG4A 3JSBA 4AUKA 4UZBA 1KQKA 3GV7B 1FKPA 1PC5A 1H74A 4B3SF 3HM9A 3PYDA 2AJ1A 2XZTB 5M2UA 3KLGB 3GJTB 3UVJB 4OZ0A 2UUWA 3GONA 3KHRA 4B3SJ 2XI2A 3W2VB 5IM0B 2N7CA 1N34J 2BZ2A 3DGPB 3X1LB 2G2ZA 4MIAA 4WIQA 2ZKUA 2YNHB 3NRBA 3SXLA 2XGQA 3HJFA 2COLA 2Z30B 4DQIA 1B7FA 2J76E 8ATCB 4C8OA 2GJIA 3EPGA 1I94F 2MZSA 1EQMA 1U1LA 1KC8T 1KLMB 4IFVA 2AHOB 3UPFA 5RUBA 3QSYB 4V19J 1VQMS 3HHDA 2JHEA 1P1TA 3KK1A 1GMWD 1K8AT 1HQUA 1NBEB 2K1RB 2YKMA 4C8LA 4ZITA 4DV0F 1NK4A 2HNZB 5HK4A 3O6QA 4ALZA 2QRRA 3DOMA 4W90B 1N33J 2IDLA 4USIA 3CWJA 5JXSA 4O4GB 5H1SV 2E1PA 4B3RF 3EMTA 3LALA 2WB1D 2QA1A 1M1KT 1FTCA 1NSKL 3PTWA 4OMFG 2VQEF 1NK9A 3IBWA 1NKCA 4KT0C 1U26A 3A8IA 1YBUA 1M5SA 3P45B 3WQPA 1RU2A 4ED7A 4TQSA 2OJ3A 2B4OA 4BLGA 1EZZB 4DPXA 3C46A 2YBVA 3D6MB 4G1QA 4K2XA 2V2VA 5DQIA 4DV6F 2VASA 3OL6A 4H4KA 2JLFA 1FESA 2HHHJ 1U7LA 2K8GA 2MKHA 4M5NA 3ISND 3T5KA 4FYDA 4LFAJ 1LWFA 1E6YB 2JJ4D 1C1BA 2CIMA 3ELHA 2QFIA 1KVJA 2XULA 4FS2A 4QU7A 4FYWB 3PW5A 3O44A 3ADAC 5A8WA 2ATLA 1OYDA 4X4QA 2CNKB 3G82B 2EFOA 2HEKA 4QWBA 4C9DA 3I4PA 2FQQB 2D9OA 3HDSA 4QCLA 3KLVA 4IUFA 3PIPQ 2QL9B 3M8PA 3JQKA 4NL5A 4QQBA 1X4GA 3HSZA 5IV4A 2UXDJ 1D9DA 2V2ZA 3BO2A 3FMWA 4DR7F 2D3ZA 2AZ3A 1WDDA 2GO8A 3CJ5A 4G1IA 1C1BB 4Q43A 1IBCB 1NSPA 2ASJA 1UA0A 5KT4A 2OO4A 4ED1A 2ACMA 4X4VA 2HW3A 5HVGA 3GFYA 4K5RA 4KIAA 3QLHA 5U47A 4KBIA 3LP1B 3A3NB 3W7BA 1S1XB 3GG1A 3EM1A 4ZOSA 1AUDA 2CJBA 1H0HB 1U1OA 2AIRB 1TL1A 1B7YB 2V8DA 1Q8IA 1KSPA 3MHYA 1N0UA 1RLCL 2CPHA 2X7IA 2XSJB 1SC3B 3BKUA 5DZ7A 4MT1A 3UN5A 3EE3A 4X4NA 2H1YA 3AB2B 3AQOA 3ZTRA 2CZ9A 2JOQA 1D09B 4H4MA 1MMDA 4Z2XA 1D3WA 2HURA 5C42A 5K8PA 1S10A 2HQIA 3M9OB 3QT5A 1TTHB 3QAUA 3MM6A 2PSZA 2ZUGA 1DQAA 3FGVA 3H2UB 2ASDA 2UVWA 2GZOA 4N8OA 5ETOA 5DDRC 1HBUA 3DDKA 2IM2A 2VZ9A 3FZ2A 4LT6A 1BE4A 2DTJA 1U6FA 1HBNB 1SH3A 1RHKB 1F6TA 3LP2B 2CG4A 4OI4A 2OD4A 1NK5A 1Y00A 4E98A 4LFBF 2OPRB 1K9MT 1O8BA 1Y11A 3VGSA 2DGXA 3CJRA 2LKZA 2AZ1A 4RWXA 3CCSS 4DSKA 1RZMA 4CLKA 1UVMA 4UOFA 1DY3A 2B4VA 3ZNUA 1LNQA 1XMBA 5JUMA 4U7CA 5DS7A 3MWBA 2OD6A 2WVFA 1FJEB 1NXIA 2J7WA 3H8YA 3UQSA 1FDDA 2BANB 2E5HA 2ZBPA 4B9TA 4WK1A 5IZHA 3G6YA 3TEGA 1XWLA 5KFPA 1ULRA 2BEFA 1Y4ZB 2ZHOA 3M6VA 1OWXA 1KTQA 4ZVGA 3AXKA 3MR3A 3MCNA 4WP9A 3PW4A 3OFGA 2HWIA 3TP2A 1DAXA 4HHHA 2UVVA 1FK9A 2MHEA 4RW6B 2AJ0A 2BRLA 1RBLA 1NZAA 2KVIA 3OFHA 3FEXB 4OIXA 2W4DA 3BREA 2V4JB 3ETOA 5E7OB 5GAHU 2R9LA 3RB3A 5K5MA 3D1OA 4PWUA 4OX6A 1F5BA 4WFNQ 2R7SA 1PGZA 3K5MA 3IFEA 5ETNA 2H65B 3EGWB 1LWCA 5CZXA 2H4YB 1BXNA 2MY7A 2PC6A 2AW0A 2GQ2A 3MPWA 3SIPB 1Q53A 4WE1B 2RU3A 2KFYA 3TX8A 3Q24A 2KL8A 1RT1A 2KI2A 1HHQA 3GG0A 1PBAA 2CPIA 5LMUF 4RO0A 3C14A 5J2NB 3DC2A 1QY7A 2RJZA 2GMHA 4F3OA 2DHHA 3FBBA 2DCUB 3T6BA 5B0FA 1TUWA 2GS8A 1B3TA 3NOCA 4MFBA 2XMMA 4K4VA 3KLGA 2E5IA 5K20B 4KJIA 2YY3A 4NZ0A 1VJWA 3UE2A 5J2MA 1X4CA 2X1BA 3R5BA 2C3OA 4KPCA 4JV0A 3NMRA 3VZHA 4RNFA 3U1NA 1H3DA 2Q6CA 4BWMA 5DG8A 1T3NA 2R8IA 4ZVQB 2ZOGA 2KTQA 3JYTB 1G4CA 4UT4A 1NPPA 1L3UA 3P5BP 1LKZA 4FPRA 5HMYA 3QO9A 1CULA 2WBRA 1P9YA 2MKSA 2ADBA 2ILZA 3R1HA 4NLGA 1UZHA 4TVAB 5GADI 1UMJA 3BN4A 2G9OA 4YS2A 1U2FA 1WKLA 3IGVA 2D41A 4DL3A 4RW9B 1IM6A 4FXWA 4NLRA 4DL0C 2FGOA 3CDWA 2E7XA 5K8MA 5HI7A 5SZTA 4DQRA 1YBAA 2F8MA 1RAJA 5LMNJ 5C2GA 2H5EA 2Z57B 1E6YA 5JVGQ 1APSA 1ZAWA 2PT0A 3MEEB 4LF8F 3OTBA 1RBAA 1WHXA 4NLXA 3W8GA 4WYWA 2QA4S 5F8IA 5DM7Q 4DL4A 1PBUA 2W2OP 2FC9A 1SCJB 5HVHA 1HNZJ 2APOA 4DUZF 1HQEB 2WB4A 1R3NA 2G2OA 3LAMA 1FFWB 4UUXA 3OFEA 3RR8A 3ISNC 1D1UA 3THVA 4NA3A 1SQEA 2HRUA 2ZOMA 2OPQB 4PQAA 4ZJOA 4TKTA 2QV6A 4R8UA 2R7RA 5CYQA 2XI3A 3UW1A 5A0YA 1H98A 3AHPA 3FC9A 3OW2R 4DV1F 2V67A 5KFMA 3SYZA 1T03B 1RAHB 1VQ4S 2BQRA 4BS2A 1NMEB 4O3PA 5KOXA 3P3DA 4OHZA 3R9LA 2CQ2A 2F1FA 3UVJA 1SV5A 2OMOA 2DIVA 2EBEA 4RWWA 5LSLA 5DG9A 1NU4A 1X5TA 2EK6A 2FHJA 2B5JB 3GLJA 1RWNB 3TVYA 1GXLA 2V6AA 3E3XA 3I56S 2LQ5A 3RBXA 4J9SA 2XY5A 2HGLA 5I3UA 2R7TA 2R7OA 4FVCA 3EGVA 1VIXA 1U09A 4X65J 3MOZA 3G8SA 1IM4A 3W62A 3KJVB 3GIKA 2ROPA 1B0PA 5DG7A 2HKEA 2FJAB 1YJUA 2ZHBA 1Z4UA 2G1HA 5AXKA 4ZK7M 3OJUA 1IQTA 4Q2LA 3UNYA 2A6OA 1IN0A 1P27B 2V9KA 3TWZA 4ECSA 3UDLA 1F2HA 3M8YA 4B3MJ 5GAEI 2KM8B 3IBFB 2OLWA 3S1TA 4CI0B 4UUWA 2XS7A 3NGUA 4Q2MA 2BVZA 1AUSL 2FPHX 4H4OA 1TV6B 1FD8A 4OZLA 2F4VJ 1FX4A 2ZH6A 2UUBJ 2DNYA 2ROEA 1NDCA 1NH7A 2B9XA 1RGVA 4TLRA 2QLJB 4ANEA 1O5JA 4CLUA 3BDPA 1JWWA 3VV2B 3OVBA 4J9PA 1VQ6S 3IRWP 3AOBA 1UWAA 2H9ZA 1HBUB 2JZ5A 2XBPA 4GC7A 2VBYA 4FF2A 1YRUA 1U02A 2R7WA 3K57A 2WVDA 3MM8A 4CO3A 1K47A 1YWXA 3TYTA 3WX4A 2SXLA 2ZD1A 3KLIA 4EWTA 4DR5J 3JSRA 1S1WB 1YZ6A 4YHHJ 4OV1A 4LF8J 1N32J 2YWGA 1RLDA 3OR2A 4L76A 3NKYA 3RYLA 4QYZK 2F4FA 5KFOA 2W7OA 2IM0A 1KFDA 3PFEA 3Q2TC 4MK9A 4Y2MA 2BJDA 2RT3A 3RRKA 2YXLA 1Q79A 1WC0A 4ED4A 3HHKA 2MXYA 5F8HA 2H51B 4OX9F 3FFIA 4GVBA 2I6WA 1WORA 3D7SB 5IC4B 2G0JA 9ATCB 2FVSA 1MWZA 4U6PA 1QAJA 4A8QA 2OEMA 4MH8A 3MEGA 4C3MA 2K2PA 3KG0A 1RT7A 3ZO7A 3SSQA 2LYVA 3K2YA 4O3NA 4NWBA 4ELVA 2ADCA 1X5PA 2HIQA 1GFWB 1VBZA 2Y0SD 1YITS 2X3GA 4DSFA 1RTHB 1H2VZ 3VGVA 5A8RA 4FN5A 5HQ8A 1KP6A 2K3IA 1MU2B 1SC6A 4XK8C 3KLHA 5KG6A 1QAYA 3VQSA 2BE7D 5E0OA 4PQUB 1M5PC 1N5TA 2DRDA 3TNVA 2KZZA 4CWBA 1HQUB 2K1RA 2YKMB 3LP0A 5K14A 5KFYA 5M2PA 4X4PA 3QRQA 1JLEB 3H4BA 1OYEA 1MROA 2OAUA 5IT9Y 1TKXA 4ZP7A 4DV7J 2CPZA 4LJMA 3EUNA 2HLUA 4LR8A 4ED8A 2YNIB 5C7PA 2P6SA 2VG6B 4OYAA 5EWEA 2YWEA 1EETB 1K1QA 3N79A 3N6MA 2R42A 2KHCA 4EBCA 2YKAA 1VFJA 3EGNA 2GHWA 3TUJC 3A3PB 4PQUA 5HANA 4JI4J 1OS5A 2ROGA 2KXNB 1HBMB 4URSA 1WF0A 2Q79A 2HAIA 2ZBQA 2E1AA 1S9EA 4KR0B 3OLAA 2F5GA 3JSYA 2M88A 3MGJA 2R2TA 4OX9J 3PHEA 2HGNA 2C2RA 3CDUA 3BV8A 1WEXA 5I4MA 3CCQS 2O3DA 4KPYA 2MMYA 5HP1B 1NPRA 1UPMB 2BOAA 4C97A 1WF1A 5F0WA 1H38A 4JI6J 1HNWF 3RG6A 5KFLA 3TO8A 3W8PA 3CMAS 2WOMB 2BDPA 1OQ6A 5KG7A 1H2UX 3NGDA 4F50A 1BWEA 3DDIA 3SCJE 4Q0BA 1NDPA 2R8JA 1IJEB 1TL5A 5BYSA 1IR0A 2OIHA 3IN5A 1HARA 1YG0A 5KG0A 1YRXA 2IFXA 1Q0NA 4AL6A 3CB4A 3OHBA 2VFRA 4UF4A 2MQNA 2FZGB 5HROB 3LF0A 3NGTA 1PC4A 4B9SA 2GO9A 4Y34A 3IMQJ 2DK2A 1LK7A 4F2RA 3W5ZA 4V1Ak 5E5NA 3M8SA 1YBTA 3POTB 2DRAA 4U8YA 2IC3A 4KHMA 1VK8A 2WONB 3DLGA 3NGKA 1BQNA 1RWVB 1UEKA 4CZCA 2NREA 4DU7A 3GPAA 3S7RA 1S9GB 5B0BA 4MIWA 1F9HA 2HHPA 3NGSA 2WZ1A 1S7IA 1VRTB 2KB2A 3N5FA 3BR9A 1KQGB 2XLJA 4KHPF 6AT1B 2UV8A 3IRXB 4ATNA 2Y1JA 1WC5A 2BQUA 3Q8QB 5CCLA 1QJHA 2AEFA 3MXHP 3BGFA 1PAUB 1HI1A 4ZS6A 4RUAA 3N0VA 4PAAA 3OTOF 3IAS9 4DL6A 4LSLB 1V3ZA 1D8ZA 3KWMA 4YP3A 3K5PA 1XNRF 3NNCA 3ENQA 4EI2A 2W9BA 3KK2A 3BO3A 1BQMB 1RT7B 5L9XA 1AB8A 1TMMA 2VOPA 3CJSA 4RUBA 2U1AA 3HHLC 2LU2A 1LWFB 3UWTA 3G8TA 4F4KA 4FXDA 3PFOA 2IYIA 3HMJG 1VRUA 1HNVB 1Z1ZA 1NEEA 2YWKA 3HLUA 2A2CA 3D66A 4PUOB 2PI5A 4HH0A 1RT2A 2YX4A 1FWPA 4DSJA 1RACB 4RBVA 4CP5A 4DR2F 1ZTTA 1JKHB 1RHQB 2E1RA 2F8EX 2C3MA 2VL1A 2IDEA 5HMWA 4O3SA 2L08A 4ZPTR 1K0VA 3L4BC 2HAFA 3WDOA 1ICEB 1N88A 2VPZB 4M8LA 4DUZJ 3JB9k 4UY85 2V2KA 2XZDB 1T94A 2CG8A 4ILMA 2XYPB 4GO5X 2ZDOA 2LEBA 1JLAA 3NXZA 1RP5A 2ERRA 3MFIA 2DH7A 2HHHF 4NRUA 3D0IE 5KG1A 2CUYA 4YUDA 2I5JA 4E8UA 3CDBA 5F9NA 5CXTA 1RKIA 4WIIA 3DXBA 3DRRA 3FBEA 1M0SA 1VQYA 3DLJA 2MLXA 3DYAB 3DLKB 3OR1A 2W01A 4CNYA 3H4DA 2VJUA 1HQEA 2LXIA 1S1XA 5E41A 4ER8A 3SMZA 4WFBQ 1UJ5A 5A2QY 3DDNA 1ZPWX 4J9QA 3K5OA 3DXSX 1PO6A 3R2DJ 3MEGB 3CF5Q 5I3UB 4B08A 1NPKA 2RDJA 1HNIA 4EBDA 2EC0A 1O6XA 2CFXA 2WHOA 3CT9A 2MZQA 4OYZA 1URNA 1HPZA 5LL6d 1U47A 1G1XA 2HHXA 2ZJQQ 2HHSA 2OELA 4AT1B 4LQ9A 1WEYA 1VIOA 2BKOA 1Q1KA 4F4ZA 5MLCV 4F4WA 2KRBA 3T1AA 2V0NA 4FBTA 1RAFB 2BYCA 2RKIB 4NYZA 3BJYA 1RBOB 3HULA 4XO0A 3QATA 1SQGA 5GAHI 1FVSA 2ZC4A 4DMZA 1Q86T 1U6BA 2EFGA 5KG3A 1Z2ZA 2KYXA 2NUHA 2GX8A 4WCEQ 3EZ5A 2B56A 3C66A 1DZ5A 1UFKA 2HBZB 1YJNS 2E1CA 1N56A 1UA1A 4TLQA 4F2SA 3MMJA 3TRGA 3PACA 5I3PA 2AX0A 3IM9A 2AD9A 1RT4A 2EK1A 2FHKA 2GQCA 3GYNA 3ITHB 3J7YU 3GYXB 3TA2A 1UZDA 1DTTA 1U0SA 2ZKTA 3QT7A 5GMEA 5KFGA 2YQ1A 3DLKA 3OR1B 2WVCA 1S6PA 2CZVC 3I5BA 5DRKA 4CM2A 3M9MB 4AQYJ 1VDHA 1FJGJ 3A12A 3CDEA 4PXCA 2JEJA 4LFAF 1QE1A 2P8IA 2DGWA 2EXUA 4MAKA 2AEMA 3P6YC 3C14B 3CJ4A 4P7TA 3W9JA 2ZH2A 4UY8T 2ZH9A 4C3KA 1BMQB 4FPIA 3ZZYA 2HNYA 2YPYA 1LXNA 4CH7A 1VI7A 2DXDA 2BA9A 1A7GE 3N28A 4ZVHA 1DTTB 4WZMA 1YKWA 3RUBL 3R8YA 3W66A 2V94A 4JI5J 2W2MP 3R5JB 3HKWA 2O5DA 5KFQA 4QWCA 1XNQF 1QM9A 3R5DA 4DV2J 3H5XA 2NXEA 1SI9A 4JI1J 2DHXA 2EPIA 5H9FJ 1PYTA 1BQMA 1YK9A 1S0NA 1UVJA 5BXIA 2QSFA 3VVTA 4DG1B 1NKEA 2HYIB 3BB5A 4Q5VA 1VBKA 3CCJS 1ZA1B 3KMQA 3T19A 1FNXH 1UL3A 2HRTA 4J9UE 1S59A 3MR2A 3DKDA 3VF0B 5IWAF 4PXDA 1GEHA 1ZM3A 3JQMA 4LVNP 2HS3A 4QIVA 4QIFA 5KFNA 1KQSR 3UN3A 5C25A 4JBCA 4P75A 1RE1B 1S6OA 4QIEA 3MMBA 2YNGB 4O23A 1QE1B 4W98A 3R6LB 1RYSA 2FVQA 3W3SA 2GNKA 2ZFHA 4QWAA 3L95X 2HFSA 3IRXA 3M4XA 4JI0F 1YSJA 1YJ9S 4UQTA 1YRTA 4CH0S 1Q8KA 2DPJA 1KD1T 3N6NA 4NLTA 3CDAA 3Q83A 1F5AA 3WIUA 4J9OA 1JIHA 2QFJA 4P73A 5H9EJ 1KDNA 4ZJQA 4YB7A 1TK5A 2A18A 3PXGa 4C8MA 3IGNA 2MQQA 1RCOB 4PG5A 3I0SB 3GP9A 2HFNA 4ZCKA 4ES3A 3CD5A 1V9OA 2ZM6F 1F2GA 3AOAA 3KHLA 3D6TB 3PX6A 2W9BB 2AGOA 3ONQA 1MN9A 1V3RA 3OTDA 3OR2B 3T3FA 3U7JA 2O66A 4H4MB 1RHRB 1HI8A 1KVIA 1FCAA 2LMIA 1GMWA 3BM7A 4I2QB 3NS6A 3R5CA 1VQPS 1XMQJ 1IKVA 2DHGA 4TY8A 1RI7A 1RT2B 3AY0A 2QN6B 4YB6A 1FRJA 4C11A 2GV1A 3OUYA 4JI0J 5KFBA 1EQ0A 3JQJA 1FXLA 4JYAJ 3DOLA 1SH0A 2KZMA 3C8YA 2DNOA 4HHJA 1Y0HA 4OYMA 1FKOA 2OHDA 2W7AA 4C8YA 4JV5J 1MNEA 1WI8A 2CJYB 3JSMA 3MPDA 4ZVTB 5GAGU 4CDIA 1V3SA 4NA1A 5DGAA 3RAXA 2MKJA 3C3LA 5IWAJ 3PG9A 5C42B 3RR7A 1HR0J 4CO0A 3ETMA 1P1LA 2CPYA 1WJ9A 2EI5A 1S1VA 2C3UA 2GW8A 2VD3A 3ENAA 3OHAA 3HCXA 2YH1A 1JXLA 1WTBA 3I32A 3HFKA 2OI2A 1RISA 2V8PA 3CD7A 4IFYB 4CQ1A 4F26A 5GAEU 2NPIA 2WW8A 5SUHA 1F3VA 1G3OA 3DMJA 1H72C 1LOUA 4O4RA 3R1LA 2DR9A 2DNLA 1UW4A 4P2FA 1LW0A 2FGCA 1RAEB 4KSEB 4DUTA 2D9PA 1S6UA 2CNNB 2GCFA 4K2JA 3UD5A 1MW7A 4OZNA 4YB1P 1XNRJ 4GKJJ 1T05B 1JJHA 2PE8A 2F7VA 2VPXB 3MPYA 2X1AA 3QMQA 5BR8F 1OO0B 4QWDA 2OKQA 4LMZA 4KAIA 2C22A 2H5IB 5A8KB 5GMDA 3CC4S 5G0RA 3GTYX 1R0BG 1L3KA 3P5TL 3QWPA 4C48A 2ZNYA 4PCQA 5J2QA 3MMBB 3Q86A 1IWAA 1NSAA 4DX6A 4NXNF 4OZ2A 4RUHA 1NJYA 4CLSA 4I2PA 4A8YA 2PA8D 1HD1A 4YQWA 1U6ZA 2B0GA 3QZ8A 1JB0C 1CJKB 3R6GB 4J37A 1TAUA 1ZA2B 3QLHB 3RAMA 4LUBA 4G1QB 4OYBA 1N8RT 4H54A 1WKKA 4JI3J 2PGCA 1ZS6A 1W2IA 4JP8A 3M2RA 2IRXA 3KYLA 2MJNA 4ETZA 4CLZA 2WSEC 3FCVA 1VYAA 2DGSA 3HSGA 4KGZB 2NCKL 2C1EB 2JVRA 1KR4A 5KFHA 3KK2B 1IBMF 1HD0A 4I6WA 2RS2A 3NCPA 2FYXA 2GJ2A 2POKA 3LGNA 4U96A 3ZTSA 5F8LA 1WHWA 5CQGA 3V6JA 1HL6A 3PRBA 3DRRB 5CZVA 4JI1F 3HFZB 2MJUA 1K1SA 2G1DA 3G82A 2BANA 4Y00A 2HK2A 2H48B 2KVQE 2P6TA 4F4AA 3GIIA 4DV2F 1O51A 1H7XA 1X4EA 3HT0A 1FD2A 1U8WA 2RSQA 3MM7A 3N6LA 5F8GA 1NJXA 6FD1A 2V8GA 1QDUB 1HIYA 1PYSB 3RTVA 1MROB 1D9FA 2G2YA 4PEOA 1FTRA 3HSJA 4LF2A 3W61A 4CM0A 2VF3A 2EFPA 4OHXA 2ZH5A 5A2QU 4KV8A 2BKNA 2NXCA 2Z4PA 2HWTA 3VZIA 1NH8A 2G13A 1CJKA 4DX8H 5KT2A 4IRCA 3EICA 2HFUA 1HMVA 2PMWA 4GRSA 2B51A 2EFNA 2YKPA 5F9LA 1FRKA 1SQFA 3W60A 4KTQA 5H9FK 1NCLA 3QT6A 2P5VA 2DR5A 2HWHA 5HAOA 3SV4A 3ZZOA 1AA1B 3SZ2A 2KH9A 5HQMA 4QU6A 1WG5A 1T11A 1ZM9A 4HVZA 4TYAA 3W5YA 2AYBA 2YTCA 2R2SA 2W1BA 4RNOA 4KB7A 2E66A 4RJVA 2VG5A 4ZHRB 1DFDA 3GQCA 4NCAA 2CQ3A 2XC9A 5I42A 1VQLS 2ABYA 4JYAF 4OI2A 4WTOB 1EETA 1RTJB 1RQ0A 4DCPB 3D4JA 2XMAA 2AV5A 2ZEJA 3LP1A 1XMQF 2VC1A 4M5DB 5JMNA 3CIZA 1K0TA 4DPOA 3V6KA 2Z2YB 1EP4B 2KHDA 3V4IB 5ITHA 1JJ4A 2R8KA 1XJWB 2VUGA 3HP6A 3CIMA 4D3HA 2GMJA 2R4FA 1HHTP 5H9EK 4ZVPB 4DZ6A 1J5EJ 3PYFA 2NZCA 4OYXA 5FDLA 3CJKB 5T7LA 1IKVB 3HHNB 4LRFA 1NRKA 2VFUA 4J9VA 4ES1A 4A8FA 2ZZTA 1QD1A 2B6AA 3R27A 4I6YA 4QIWD 3PX0A 4DI6A 4CLWA 2E7VA 2XY7A 4M5IA 1VQSA 2W4CA 3TAQA 1ZTWA 3NNAA 1F3FA 3B8HA 5FLXU 4C98A 8RUCA 2GC8A 4PYAA 2B5JA 1TKXB 1TR0A 4U67Q 4BC9A 2RS8A 1NB7A 2IM1A 1S6QB 4AL7A 4H4KC 2HZVA 3A1YG 3DM2B 2HQ3A 1R8HA 2OPSA 4DR5F 1SL1A 1A9NB 1BGXT 2YVSA 3MCMA 2QYCA 4IFVB 4Y3CA 3H5YA 5C2CA 4IFYA 3DRPB 4IOAQ 1OIAA 2NSBA 1WTFA 3FSYA 1SVDA 4DCOB 3QZ7A 2FLLA 1B0TA 1BQXA 4ID5A 1N36J 2CNLB 1R8BA 3ET6A 4IQMA 4WBFA 1EJ7L 3B78A 2CXEA 1L3VA 4CO1A 2Y1RI 4RL1A 1WSRA 2DVIA 2RVJA 1L5UA 4O4GA 3AJDA 2CQDA 3PY8A 1FHTA 5KFAA 5B0AA 1A0OB 5F0UA 4NLWA 3D3CJ 1W2BR 2VBWA 3M9NB 3TANA 3UNGC 2PO4A 3ENWA 4ZP8A 3FSIA 4DHVA 3CCWA 4XAKA 3MTJA 4O44A 2NUUG 3T1YF 2DY9A 1FXRA 5B08A 1T7PA 3VAMA 4OJ1A 1KLNA 3PW0A 3KDOA 4DS5A 4YR3A 1R8AA 2IHR1 2QJ3A 3O8WA 4KKOB 5M2RA 4LF5J 3LGHA 1OSCA 2FJEB 4R5PA 3F44A 4I2QA 4ZVOB 1R0CB 4KHPJ 1N5YA 2DEIA 4GC6A 3M8WA 2ZC3A 1EX8A 2YWHA 1S12A 2J8SA 4Q45A 3HVTA 2JRSA 1GX5A 1REGX 5J2PB 4K4XA 2JEIA 3KK3B 1Y7PA 1EIYB 2JH3A 1AZSA 1JLQA 3D2WA 1IBKF 2DKOB 2ZUAA 1JJ2R 2OTLS 3G87A 4L75A 4DR3J 3SCKE 1U25A 3KTQA 2B6AB 2NS1B 3QFWA 5KT6A 4CIOA 2YKNA 1KN6A 2KN4A 4Y2KA 1JLFB 3PEHA 3CCES 5KT5A 3PV8A 1XEZA 1P8GA 4I1TA 4CRJA 4Y2CA 2ZVSA 3GV5B 3B6BA 4IG3B 5ETSA 3GV8B 2EFVA 1JMTA 1B70B 2P9CA 3PJXA 1E6VB 2V2QA 2HRYA 2O67A 2BUNA 3M30B 4ICLA 4TY9A 2CQHA 2XHCA 5T41A 4N8NA 5D3GB 2DR7A 1RAOA 2NYHA 4F3MA 1PIEA 3BEGB 2R2UA 4CO5A 2H54B 4MFBB 1HNXJ 2AGPA 1U1NA 3PR4A 2FY8A 4DR4J 3QGIA 1JLBA 1SC4B 3Q8VA 4Q8FA 1C0UB 3ZZRA 3PW7A 4LBIA 5J2PA 2PIIA 4FYXB 3LQVA 4L3NA 5D0EA 2UVRA 1UVLA 5D6GA 1WDTA 4OZ5A 5KFTA 3TEHB 4RW4A 1JLCB 3HHEA 2XM3A 1K73T 2HNYB 3NLCA 2LQBA 2IVFB 1U0HA 2I5JB 3SQOP 5A8RB 4CNZA 3UO0A 4NMXA 3CJ3A 5FIIA 2QLBB 4PG8A 2ZE2A 4PG4A 3DLHA 2BXJA 2OFHX 3M7VA 3SDEA 3U1LA 3U1MA 1Y3KA 1VR6A 3JTOA 3JSMB 3AJ1A 1CQNA 4PWWA 3RBEA 1UVIA 4USWA 3DCAA 2F40A 2X51A 2Z2MA 4DDFA 3HT3A 3OSPA 1VQ7S 2AGQA 2RQMA 1R0AA 1CJTA 3CSKA 3KLEB 2LEAA 1AROP 2EEYA 2I9SA 4KFBA 4O0IA 3IR6B 1WHVA 4N77A 3THTA 4AE5A 4IRKA 3TA0A 4IH7A 3BQ2A 3ILJA 2CJQA 3G6VA 3MUVP 2HK3A 2ZH3A 1IBKJ 3KXDA 4LBPA 3VQTA 3T1HJ 2KFZA 2VODA 4RLEA 2EG2A 2DBBA 5ETVA 4DFMA 4Y2IA 2FJWA 1DQ9A 3KJQB 4M94A 3K58A 2A6MA 1C1CB 5CD4A 4IO9Q 2E5LJ 2RB7A 1PYOB 4CT8A 2QC3A 4OYIA 4EK2A 1RB0A 4LF9F 1O0PA 2JFDA 5ETMA 4LQ3A 2YNFA 4QW9A 3PRVA 5LT5A 4KFBB 2VFVA 3DU5A 4PYDA 3IR7B 4YR2A 3V81B 1YJWS 3VWSA 1U45A 1RYRA 1FDNA 3GR1A 4NCGB 1HNVA 3D54A 5DJBA 2FB0A 3Q2SC 1SJ3P 4PUOA 2F9JA 2EBGA 1SKUB 3HSDA 5C5JA 2DO0A 4HDHA 2D3UA 2B8PA 2BJ8A 1GNKA 4M5GA 3D28A 2V50A 4RW8A 4NLPA 3TVKA 3K5LA 1TUGB 2ZJPQ 1S97A 2CA9A 2HFZA 2MPUA 4RPFA 2NLWA 1RT1B 1HNZF 3M8RA 4Y0FA 1L3SA 2VA2A 4W92B 1CJVB 2AP6A 1NJIT 3QJJA 1RAAB 2BE2A 2HG4A 1CULB 3CNQP 2JWNA 3ITHA 2W2PP 3QYYA 2WOMA 4DWIA 1M90T 4B3MF 2V5HG 3H5SA 2CPXA 1RT3A 5KFSA 5KFEA 3CCMS 3HK2A 1VRTA 1FI4A 1R31A 4LSNA 3L7PA 4XDDA 5AXLA 3LWLA 1C1CA 1HR0F 4N76A 2BE9B 2EG1A 3M2UA 4ZPWR 5L38A 3Q8RB 4FS1A 3F73A 1YIJS 3CGIA 3V2UC 2I2YA 5D8HB 2I8EA 1VHIA 1T9UA 5EX0A 1QSSA 3T5HA 5D3GA 2VG5B 1S1UB 3MM5B 4ZHRA 1RJJA 2GIFA 2QA4G 3BSOA 4JV5F 4LF4J 7FDRA 1N5SA 1VLYA 3J80U 1UETA 4EU0A 3K0JA 3TZXA 2BW7A 1XR7A 3IP0A 4M95A 3P4UB 2BBEA 1DRZA 2FLPA 2J6SA 5AE3A 2R7UA 2H4WB 4LSNB 1ELOA 2IMOA 2KT5A 2RF2B 3MPUB 1RTIB 3KDNA 5LM7E 2E7WA 2BMBA 4NXNJ 3PVXA 3K8WA 3AJ2A 2RQ4A 4ZCLA 4QW8A 4FF3A 1N5QA 3R2CJ 4CO4A 4KE5A 1FRMA 1RT4B 3MCOA 1JXVA 4M63A 3IXQA 3EJMA 4C8ZA 1KLMA 5LMUJ 1CS4B 1TUVA 3A4TA 2VPWB 3QIDA 4RNMA 5C24B 3I87A 2K3KA 1CG2A 3AA8A 3CE8A 1QTNB 5IFMA 2IRUA 4ECUA 2VQFJ 4UOCA 1IKYA 4OJGA 4ECXA 3DLBA 3FVYA 3ULHA 1W25A 4WFXA 2DH8A 2QLXA 2QL5B 1CLFA 4J9RA 4USTA 1GTHA 4RBTA 4F67A 4DSIA 1VK3A 2DYAA 3J81U 2J9CA 3NCRA 2D1CA 3BH6B 5LMNF 3RB0A 1WSVA 2J8AA 1AYEA 1VHFA 4C8KA 1LWXA 2M4MA 2VDIA 4OI1A 1TKDA 5GADU 2NQPA 1HBOA 1TVRB 1FDBA 2FZCB 3DRSA 1TL7B 5HMZA 5CABA 2B4UA 5HLFB 4DF8A 5F3ZA 2DXFA 3M05A 2WVBA 6FDRA 3K89A 1FNOA 4ZN3A 4IG3A 4YHHF 2CJAA 3QJLA 1N32F 4JI8J 3W63A 3RRHA 2VFTA 1WHYA 1X4BA 4NI2A 1IKXA 3PYEA 5HN0A 2K06A 1U24A 2AYGA 3BBCA 1T02A 3FQLA 4KQZA 3WBZA 1X0PA 3BYRA 2PMZD 1RTHA 2UV8G 3E8OA 2VKZG 5L1JA 2DNGA 1QSYA 4ECZA 3H98A 4B3TJ 1HLWA 2F4VF 2XLIA 3IS9A 4G6VB 2VA3A 1SL0A 1KQFB 1VQKS 2UUAF 3JTNA 1EP4A 3HFVA 3V4IA 1HWUA 2BABA 2MGZB 4X4UA 4WPAA 3TA1A 3UD3P 1WG4A 2B9YA 1FX2A 3TAMA 2R8GA 2RNEA 4K0KJ 2OPSB 2WSFC 4OFZA 4ILLA 1SC1B 4KGMA 1N34F 4IOBA 2Z0GA 5KG2A 1WKJA 3D3BJ 3BDEA 3BKTA 3I82A 5F3TA 1N5YB 1FJGF 2DR6A 1FFSB 5JJBA 1TKTB 4LR7A 3SQGA 3UCUP 1VC6A 3C2PA 3IS9B 4QR0A 2ZE2B 3IG1B 2V69A 2M2BA 4OQJA 1S0VA 3BR8A 1OY6A 4DSEA 2KRRA 1CEZA 4R0EA 4OV6A 1X5SA 1WACA 1X4DA 1Q81T 2UXCJ 4ZLLA 2DNQA 4HACB 2OMLA 4NI2B 4O3OA 5DDQC 2UUAJ 3FRYA 3KJVA 3KNGA 2W7PA 2M7SA 2GHPA 3D9BA 3L09A 4QYRA 4CLTA 1T9VA 1S5ZA 4B3TF 3M8ZA 3WIVA 1AFIA 1JLGA 3GU0A 5K8NA 5C24A 4WU2A 2I0XA 1C4CA 2RU9A 1HWJA 3EVMA 3NG8A 1I3OB 1KFSA 2C2MB 1MSWD 1PAEX 4B9MA 1JLEA 3LAKA 2DGQA 3ZZTA 2QO3A 3T5LA 1XMOF 3AD9C 1S76D 3QFHA 4CLLA 4JI8F 1D8YA 2RUGA 3R97A 3NBPB 2IBOA 4MKVA 4NX9A 4N5SA 4ITSA 2BE2B 4IR1A 4S0MA 4GKJF 4WJBA 3OQ2A 5GVQA 4DL2A 4JI6F 4BBYA 3W9HA 4C0BA 4PXBA 4OZJA 4JUZA 2LXUA 1B0VA 3AFGA 4CLFA 5IT4A 2IIHA 4WKRA 2WTFA 2EVZA 1U1QA 4G3IA 1UVNA 2BKPA 3FEYB 3VCDA 1ZOTA 3MM8B 3MPVA 1SIWB 1WOSA 1BLUA 3KK3A 2A1BA 5L46A 5EGYA 3NL0A 1C0TB 4YEAA 4JI4F 5EDWA 2PD1A 3ILIA 1Q4RA 2DISA 3SCLE 4KV8B 1TL3B 4A4JA 5KFXA 2DGVA 4DQQA 4LRDA 5D78A 4J7CA 3FCHA 2KO1A 3C6UA 5DDOC 1CJUA 1I6JA 2FY1A 3C6TA 3KMSA 5EN1A 3MAAB 1EB0A 4NLQA 2WRMA 3FUYA 2KU7A 1FRLA 2RDIA 3GJSB 3H90A 4P72A 2CRLA 2XO7A 4B9NA 1MLAA 1XERA 1NUEA 4IDKA 4XPCA 1NDLA 1FNMA 2ZD1B 3KLIB 4IOCQ 3DOMB 4F0MA 4L73A 4P9SA 3MTKA 5D4PA 2MZTA 2CPFA 2DCLA 1NHKL 3PJWA 5DQHA 3J7Z5 3CD6S 1T05A 1RTJA 1CSJA 3ILOA 3GILA 4NPOA 1VRUB 2C2DA 2OP5A 5AT1B 5CYMA 4EZ9A 3RBDA 1WD6A 3I5AA 5B09A 1RHJB 5KFZA 2DGUA 4PABA 4DFJA 1TFWA 3H7HB 2BX6A 1Y9OA 3ET6B 3CTRA 1DHMA 3ZTOA 2FVRA 1RWOB 1K44A 4HI1A 3OT9A 2C42A 4NLUA 1JX4A 2HVIA 1GAOA 3CULA 1U0HB 4Z7YA 1VQNS 3N9UC 5L8RC 2C2NA 1RA7A 4K59A 2HBRB 2AYEA 1N6QB 2DHAA 4B3OB 2QL7B 1N0VC 2V8VA 3UDCA 1X8DA 2LA4A 4E2FB 3PR5B 1CJUB 2Z58B 2PI4A 4TNOA 4TQRA 4MKYA 2JLEA 2OPQA 3PIOQ 3VALA 1QUPA 3DLLQ 4ZJLA 3OXLA 4WXOA 3CMQA 1NKBA 3IC1A 3J81j 4DQPA 4LRAA 2CYYA 1DLOA 3D5MA 3Q8SB 1NO8A 4ZP9A 2KXFA 2JNJA 3LTOA 4NLYA 3OTCA 1WELA 3GE9A 2VB6A 2JSXA 1URRA 1M5KC 3W65A 4HI2A 2MYFA 1FRXA 2RDDA 3KNAA 4ZLNA 3EXYA 2VBXA 4DV0J 3BGUA 3D1QA 1Y5LB 1GMVA 2DD8S 4K5SA 2V9WA 5KT3A 5B0GA 3VAIA 3BO4A 4UOGA 2R7VA 3F41A 3X3UA 4C6AA 1ZAVA 3UDEA 3QRRA 1ROFA 3PX4A 3H0PA 4YDDB 2V4QA 4JI5F 1S79A 4NLOA 4RW7A 5A6PA 1YJRA 3L3CA 3TZYA 3HJVA 1AXQA 2R8HA 2HHUA 2K7KA 2CADA 1H2TZ 1S77D 1H6KX 4I69A 2MLYA 1QVGR 4PRFA 2LQ8A 3LANA 1WOOA 4DR2J 3HXMA 1C0UA 3FZBA 4ED5A 3J81Y 3MURP 3BPSP 8AT1B 2EKNA 2HZCA 5J2MB 3GCWP 2GQQA 5D15A 2P9GA 4LF6F 2FHOB 4LF1A 3OUYB 3PKYA 4USKA 1UP1A 3TZWA 2XCAA 1SJ4P 1RA6A 5HL7Q 3BGRA 3T5JA 2W25A 2FDNA 4P52A 4DV4F 1YDLA 1YQHA 2GIRA 1T9WA 2XMTA 1U1MA 2BJ7A 4OLOA 4WTYA 3CCLS 1RTDA 2AQ4A 5L39A 3QGPA 3DHXA 5HBMA 3SQGB 3SI8A 1FE0A 5A76A 1S1TB 3DN9A 2CQ0A 3KJNB 4QZVB 5B0EA 2WVEA 4R8UB 2MKCA 4RZRA 4QYZJ 3MUMP 2OEKA 4RU9A 5KFIA 4WFZA 2VU5A 2ZNZA 3DRXA 4OYWA 1EHWA 3I9V9 1NDKA 3CMES 1Y3JA 3SFGA 2V68A 2AU0A 4MIBA 2QYGA 4HACA 2KG0A 1VS3A 1OY9A 1WI6A 1GXTA 4MYTA 1S1VB 3JAMY 3RAQA 1VQ9S 2CQGA 1YVFA 2C3PA 3J80Y 2JEGA 4IH6A 2MKYA 2C28A 1RWKB 4KYZA 3GSIA 2MLZA 4AD6A 2VG7A 1GH8A 1SJRA 2WK4A 1S9EB 3PW2A 4G1PA 2GIQA 1PJ6A 3N4WA 1N54B 4NE9C 1FKAF 4AL5A 1CC8A 5ETQA 3I6PA 3NS5A 2ALZA 1KHWA 3KUGA 2RQCA 2UU9F 4DV6J 3CC2S 4ZIVA 4NCGA 5A6WA 1IUJA 1BUXA 2PN6A 2WBMA 4C8NA 1S0MA 4TY8B 4Y6IA 2LFVA 5FD1A 1IKWB 1WC1A 2PEBA 3QIPA 3ZZ0A 3RRGA 3G6XA 3DLEA 3G4SS 4Q8EA 3EDRB 3SV3A 2ZH7A 1S9GA 3JXOA 4DLEA 1SKSA 1YJ7A 3K59A 3OJSA 4B3RJ 4DR3F 4EYHB 3M8PB 2YNHA 1VBYA 3OL7A 3FDSA 3J7A1 1Q95G 2HQDA 5E2QA 3CCUS 1HYSA 1T8EA 1M5VC 3EGZA 5T7LB 4B9UA 5HROA 4DV4J 4ZLPA 2EFQA 1U1KA 3VAJA 1RWUA 1LW2B 4U7UD 3P8BB 3T6JA 3C6UB 2X1FA 2ZVIA 1FRIA 2KYZA 1FXDA 1SL2A 4FYVB 5HLFA 2HBQB 3IAM9 1IBLJ 1SKRA 4X65F 4YDXA 4RBUA 2ZJRQ 4BC7A 1G6BA 3C15B 3T1HF 3I0RA 1SKWA 3LA0A 1ACMB 3GIMA 1S6QA 2IA0A 4KO0A 4LF4F 4FF4A 3IWLA 4KRWA 4PXEA 3ZTPA 1RUSA 2R2RA 3QGGA 1QAXA 2QMUB 3CVKA 3CJKA 2YKOA 4X84A 4DS4A 3T1YJ 1HKAA 2RE1A 1REVA 3L9ZA 1WC4A 3R3TA 3R7NB 3CC7S 1WNEA 4OYPA 2OH2A 2ALYB 2W9CB 4ID5B 3EZOA 3TAPA 3S6EA 4JOUA 1RKJA 4WZQA 4BWJA 4LSLA 4K0KF 1HA1A 1T9YA 3OBIA 2MHNA 5EUHA 2OPRA 3HX9A 4OI6A 2VJVA 2J0XA 2HVEA 2MZJA 1KKHA 2XMVA 3ZZUA 4KO0B 4X64F 3VTIA 4A8KA 2Y8WA 2XYHB 3D1HA 1M1HA 1RK8A 2J6TA 3BH7B 1VLOA 4P7VA 3G96A 1H7WA 4HEA9 2MQMA 3K8VA 1N36F 2OTJS 2DITA 2IRYA 2Z2ZA 1SUQA 3MMCA 2GVZA 3RGIA 4X4OA 2VG7B 3CO9A 5E3PA 3UR3C 3D68A 3HD1A 1WC6A 4M5KA 1SXLA 3O2IA 5D0RA 3CCVS 5KFRA 1CVJA 4QIGA 2GA7A 4XDCA 1RABB 1XN9A 4CYUB 2UXBF 4NLSA 3SCIE 3WHIA 4A8OA 4ZCMA 2MB0B 1F1BB 3PJ9A 2W4PA 5FDLB 5BJRA 4MJKA 5D4NA 4ZVUB 1R89A 4DPWA 3ZFVA 1Q8LA 3HVAA 3NY0A 3IR5B 1TU0B 4DUYJ 1TL7A 4USHA 2MDAA 4I68A 3SDEB 4M5DA 1U48A 1WC3A 2EKYA 5G4DA 2JEFA 5E3CA 3DFEA 2C2EA 1RHMB 3G86A 2UUTA 1SJ1A 1YX2A 4KHRA 2NXNA 5DETA 5LSRA 4UOHA 4RW7B 2CJ9A 2MEWA 1U2RA 2JC0A 1IBLF 4IO1A 1ZM4A 3GWCA 4F7VA 5B0DA 2DXEA 2N3OA 2CKWA 3B4MA 3ZZPA 4X4RA 3B82A 2CDQA 2DNPA 3MMAB 1NNDA 2EWHA 3ICLA 2XB2D 1KVKA 2LQJA 2ZBCA 1VRQC 4FP9A 2WW4A 4N56A 4LIWA 2FD2A 3ZTQA 3BQ1A 5ETLA 3OXFA 3JTPA 3TW0A 1X4AA 4KGXB 2X3DA 1R8PA 5CHCB 1S48A 1RT6B 4IR9A 3QT8A 5HATA 3CJ2A 1SJQA 2R7QA 2HQGA 2N82B 2BJEA 1R8CA 2B4PA 2QIFA 2ZH1A 1BWVA 5E33A 4CLYA 2NYIA 4FF1A 1U8SA 2QGFB 3HHLA 4BCAA 3MUTP 2Z8QA 3UD4P 2QSWA 2Y3YA 3EPIA 3AOCA 3DOKA 3WZ0A 1U1RA 2D69A 4F0KA 3R7BB 2RH3A 4KH1B 2FUG9 3E51A 2IM3A 5J2QB 3GYGA 3DNCA 4NYOA 5CAAA 1R43A 3VAHA 1OJ4A 2XQCA 4DUYF 5F8JA 2F3JA 3MFHA 4RW4B 5CH7B 4O3QA 4USMA 4I2PB 4DG1A 3Q22A 2C3YA 2GFFA 3QGHA 5JVHQ 5B0CA 1TMJA 1KRPA 1DTQA 2YPZA 5AXNA 4QPTA 4A8WA 4DN9A 5HMXA 2LLZA 4U9RA 5GMKa 1RT3B 1WG1A 4UZCA 1XMOJ 2VDHA 1Q16B 2RD5C 3K7RA 1LW0B 1X0FA 2DNZA 2VKRA 1PG5B 1V5VA 2BW2A 2XYGB 2YNGA 2KG1A 4RW9A 4F04B 3KHGA 4LIRA 4DR6J 2P2CB 1FJ7A 3M1VA 3DI6A 3IWXA 4RU2A 1X5OA 4PPDA 2VICA 2HPUA 4U7UK 2CQ1A 3G6ES 2QEXS 2IBKA 4RKUC 3VR1A 2Q66A 2A10A 2UUCF 3PNIA 4ZPAA 2QE5A 3C16A 1PJ5A 2ATCB 2KXHA 2E1MC 5CYJA 3GFZA 3KKFA 2GGPB 1LFWA 3OV7A 1BY9A 2DO4A 3FJ2A 4P74A 3PDNA 5LJ5Y 2JDJA 3BF4A 1W7WA 5G0RB 2NR0A 2Q1LA 2M8HA 3JAMU 2QMXA 2FVCA 4R0JA 1KHVA 3MECA 4QBUA 1B64A 1WWHA 1B99A 1OPZA 3KJFB 3LPYA 4P10A 2Q43A 3H2LA 5EWGA 3HZGA 2UXDF 2JFKA 3I5CA 4IRDA 2RRNA 1AZSB 1JLQB 2HQCA 2J5AA 2VH7A 2BRKA 3N5BA 1YGYA 2YX1A 4FKXA 2HIYA 5DO2A 5J1NA 3ZZZA 2ZOFA 4K4ZA 4F0HA 3BBBA 2MKKA 3MEDA 2KM8C 4EBEA 1LWEB 5HQLA 5KTQA 2CVEA 4CTAB 2E29A 2GAHC 4J9KA 2DY1A 2J9DE 4ZKAA 1X9MA 3DRYA 1RTDB 2W9CA 5AXMA 1RWWB 3GIRA 3HVRA 3PKMA 3IG1A 2E5JA 1QAIA 2CWKA 3TUZC 2N3LA 1R6VA 4J90A 2DT9A 2HLTA 3DGPA 3CD0A 3I0SA 3J7YI 2E44A 1GMUA 3NWRA 4CLPA 3A8EA 5KFDA 4QJVA 2FJDB 3PEJA 1JLCA 3QRPA 5D77A 4ANCA 1DLOB 1HPZB 2IVMA 1XTZA 4MKBA 1TL3A 1H73A 4J5OA 1QUVA 4ZVSB 1F9EB 4DJBA 4F8RA 3NWGA 3J7AN 4URGA 1TFYA 5F8NA 3W2WA 3TX0A 3KLFB 1PILA 2PEHA 3HI9A 1DBDA 1YJTA 2CWXA 1PJ7A 3PO5A 3A8JA 5K9FA 3TUPA 3T9ZA 5L1KA 1UWBB 1VQOS 4A47A 1UJ4A 2KT3A 2QZ8A 2Y9HA 2AJQA 2QG9B 4KGVB 4NZ6A 5EHHA 4DF4A 2M8DB 4BDPA 2FLOA 4TYBA 1WOPA 1S1UA 3MM5A 4WFYA 4ZVEA 4EUVA 4DX7A 1QTMA 3MI7X 1TZ0A 3RBZA 4DU8A 4JB8B 3MD1A 4P2XA 1ZAXA 3SBMA 2CQCA 2BJ3A 1HHSA 2CNOB 1HNXF 4RX6A 1JQGA 2AF6A 1JNRB 3DLEB 3FMBA 1JKHA 1T95A 3US5A 2HZAA 1MG7A 2CZ4A 5BYRA 3UCZP 3RB6A 2B8QA 2JL9A 3FNNA 1EARA 2VQEJ 5HO4A 5ETRA 1J5OA 2HNDB 2JC1A 2K7JA 2ZITA 3GFHA 3MOJB 4M5MA 3KG4A 2G0IA 4ILRA 2PMHA 2ZDPA 2ILYA 4YFUA 1VQ5S 2WCXA 3CEDA 4E0DA 4PWDA 1MN7A 1BHNA 3BGLA 3OD2A 4YR0A 3MM6B 1GQEA 1B4SA 3V6DA 3IWNC 4DV3J 2I38A 1D9AA 1RWMB 2HS0A 1FEEA 3AQPA 1FEHA 2OSQA 3GMGA 1VGYA 3OXGA 4I6AA 4ZPBA 3H40A 5LSOA 4IKAA 2P9EA 4LVOP 3TR5A 1VBXA 4LF7F 4RW8B 2XY6A 1Q7LB 3Q8PB 2BQ3A 4L72B 1VQ8S 4R25A 3QNWB 2V4RA 1DQ8A 2CQBA 3EVOA 3D0GE 2LDYA 1TK0A 1LK5A 1YJVA 1KS2A 3M1VB 4JI2J 4R5PB 7AT1B 1KWMA 2U2FA 1W26A 4ZLJA 2HVHA 3TZZA 3LUYA 2FHMA 1NK0A 3S8SA 3JYTA 4PR6A 4CTAA 1OPIA 2CAJA 1HBOB 1TVRA 1TKZB 3QQCD 4EO6A 4YY3J 3D0HE 4LF6J 4WP8A 4ZCIA 1RAIB 1HWLA 1Q8BA 3NAHA 2NSCA 1EKRA 2OPPB 3NCQA 4DFKA 1S1WA 4HHUA 3I55S 3H42A 2L48A 3ILLA 3MECB 3D67A 4LF5F 1UFLA 4U8VA 4OI0A 1N4LA 2ACYA 1IR2A 2BM0A 2M70A
chains in the Genus database with same CATH topology
4K0KJ 2ZM6J 3D3CJ 5IT9U 4X65J 3T1YJ 1XNQJ 3D3BJ 3IMQJ 1I94J 4V1Ak 4JI5J 4DV1J 1IBMJ 4DV0J 4B3SJ 4JI3J 2MQ8A 4LFCJ 1N34J 3JAMU 2UUCJ 4DV2J 4B3MJ 4NEYA 4JI1J 4LF5J 2UXCJ 4GKKJ 2UUAJ 2F4VJ 2UUBJ 4KHPJ 4X64J 4DR2J 4LFBJ 2KVQE 4NEZA 4DR5J 1N33J 4LF8J 4YHHJ 1N32J 2KL8A 5AJ3J 4DR7J 5A2QU 4DR3J 3J7AN 4LF7J 4LF4J 3J80U 4DUYJ 2HHHJ 5BR8J 4DV5J 4DUZJ 4DR1J 4X66J 4LF9J 5LM7E 4NXNJ 1HNWJ 2MEWA 4LFAJ 4RJVA 3W1YC 3R2CJ 1XMQJ 1HNXJ 5LMUJ 4JI0J 4DR4J 2UXBJ 4KYZA 4JYAJ 2VQEJ 2VQFJ 3R2DJ 4JV5J 3OTOJ 4JI7J 2UXDJ 5LMNJ 5IWAJ 4DV7J 1J5EJ 4DV6J 1HR0J 3J81U 4DV3J 1HNZJ 4JI4J 4B3RJ 4KY3A 2MTLA 2UU9J 4PWWA 5FLXU 4OX9J 4JI2J 4JI8J 1XNRJ 4X62J 4GKJJ 4JI6J 4DV4J 1IBKJ 4YY3J 3T1HJ 4B3TJ 4LF6J 1XMOJ 1FJGJ 4AQYJ 1N36J 1IBLJ 4DR6J 2E5LJ 4HHUA 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K J;  2ZM6 J;  3D3C J;  5IT9 U;  4X65 J;  3T1Y J;  1XNQ J;  3D3B J;  3IMQ J;  1I94 J;  4V1A k;  4JI5 J;  4DV1 J;  1IBM J;  4DV0 J;  4B3S J;  4JI3 J;  2MQ8 A;  4LFC J;  1N34 J;  3JAM U;  2UUC J;  4DV2 J;  4B3M J;  4NEY A;  4JI1 J;  4LF5 J;  2UXC J;  4GKK J;  2UUA J;  2F4V J;  2UUB J;  4KHP J;  4X64 J;  4DR2 J;  4LFB J;  2KVQ E;  4NEZ A;  4DR5 J;  1N33 J;  4LF8 J;  4YHH J;  1N32 J;  2KL8 A;  5AJ3 J;  4DR7 J;  5A2Q U;  4DR3 J;  3J7A N;  4LF7 J;  4LF4 J;  3J80 U;  4DUY J;  2HHH J;  5BR8 J;  4DV5 J;  4DUZ J;  4DR1 J;  4X66 J;  4LF9 J;  5LM7 E;  4NXN J;  1HNW J;  2MEW A;  4LFA J;  4RJV A;  3W1Y C;  3R2C J;  1XMQ J;  1HNX J;  5LMU J;  4JI0 J;  4DR4 J;  2UXB J;  4KYZ A;  4JYA J;  2VQE J;  2VQF J;  3R2D J;  4JV5 J;  3OTO J;  4JI7 J;  2UXD J;  5LMN J;  5IWA J;  4DV7 J;  1J5E J;  4DV6 J;  1HR0 J;  3J81 U;  4DV3 J;  1HNZ J;  4JI4 J;  4B3R J;  4KY3 A;  2MTL A;  2UU9 J;  4PWW A;  5FLX U;  4OX9 J;  4JI2 J;  4JI8 J;  1XNR J;  4X62 J;  4GKJ J;  4JI6 J;  4DV4 J;  1IBK J;  4YY3 J;  3T1H J;  4B3T J;  4LF6 J;  1XMO J;  1FJG J;  4AQY J;  1N36 J;  1IBL J;  4DR6 J;  2E5L J;  4HHU A;  4NXM J; 
#chains in the Genus database with same CATH topology
 1S99 A;  1V6H A;  2Z56 B;  4EO8 A;  3Q8U A;  4FDF A;  2GHV C;  5GAG I;  1XNQ J;  2YQ3 A;  4DPY A;  4LRE A;  2AEJ A;  3QAE A;  3GZ7 A;  1TKZ A;  2YKQ A;  3R5A A;  4J91 A;  2EW9 A;  3MZI A;  4WKY A;  3QIP B;  3OVA A;  1IWG A;  1I1G A;  3NS7 B;  1S1T A;  2D3O R;  1ZET A;  1EAY C;  1S7H A;  3GJR B;  3G71 S;  2XNQ A;  3DRS B;  1IVZ A;  4NEY A;  2IPO B;  2VFS A;  3M2U B;  4WXW A;  4BHQ A;  4DZD A;  3RJM B;  3QBC A;  5I42 B;  1NZ8 A;  3GIJ A;  1DUR A;  2KJV A;  3GR0 A;  4I7F A;  2V8H A;  2MQP A;  4GKK J;  3SFU A;  3MD3 A;  3CJQ A;  1YTY A;  1Q5Y A;  5KFJ A;  1RXO B;  4LFB J;  1ZZF A;  2HHT A;  1BC6 A;  4RNH A;  2V63 A;  2V34 A;  2CJX B;  5IT0 A;  5KFF A;  3FEZ A;  2DNN A;  4NLV A;  1CPZ A;  2M3D A;  1RCX B;  2IAJ B;  4EEY A;  4QR1 A;  3WX8 A;  1HFE L;  5F41 A;  4JI2 F;  4Z7C A;  1Y5N B;  3I0R B;  4I4B A;  5AJ3 J;  2XEX A;  3TAM B;  2JX2 A;  5HJX A;  4DLG A;  2VQF F;  1RAD B;  2ZHA A;  2XS5 A;  4LF7 J;  1KBR A;  1SUQ B;  3MMC B;  1JLG B;  4NXM F;  1AW0 A;  3FK4 A;  4Y28 C;  4OI3 A;  1UJ6 A;  3DMJ B;  1FWK A;  3ENV A;  2Q6B A;  3MM9 A;  4HH1 A;  1TK8 A;  2Y8Y A;  4UTG A;  5A0Y B;  2W8K A;  4LR9 A;  5BR8 J;  4Q44 A;  4DV5 J;  1U4B A;  3R5G A;  3KOA A;  4EFA C;  4DR1 J;  1G7C B;  2BR0 A;  1NK6 A;  1HYS B;  2X1G A;  5CCM A;  4WWS A;  2B9E A;  1IKX B;  2FIU A;  3A13 A;  1UW9 A;  4Z37 A;  3MR5 A;  2A3J A;  3M6W A;  4C0O C;  2AJF E;  3W9I A;  1RAG B;  5EWF A;  3K5N A;  3O1L A;  4OHV A;  3FBC A;  3P49 B;  4FKY A;  1OY8 A;  1X7V A;  3HVW A;  3F0N A;  3GSD A;  2MZ1 A;  3BZQ A;  5AE1 A;  3LOU A;  1XR6 A;  2DGO A;  3LP2 A;  3BPD A;  4YB5 A;  3PRD A;  2YWF A;  3VGT A;  1S57 A;  4ECT A;  4ECV A;  3E2E A;  1ITP A;  2AYM A;  3C15 A;  2W24 A;  4FNH A;  1OQ3 A;  2O01 C;  2QMW A;  3K17 A;  2M5Y A;  4ICL B;  5DDP C;  2LEC A;  2E9T A;  7FD1 A;  4LSZ B;  2Z2L A;  2LDI A;  1NK7 A;  4C3L A;  2F63 A;  5HP1 A;  2DEJ A;  1X9S A;  2LP4 A;  3QO9 B;  4AXJ A;  2HMI A;  1TQL A;  2AJ2 A;  1FA0 A;  2DIU A;  2KKH A;  2OEJ A;  3VHQ A;  1OMS A;  1VCT A;  3A3O B;  3PYG A;  3OL8 A;  1U49 A;  2IY5 B;  3M2R B;  2C2O B;  5IV3 A;  1IR1 A;  1XIQ A;  3FQK A;  2M9K A;  5J1P A;  1FDA A;  1UWB A;  5T14 A;  4N47 A;  2GAG C;  1DAR A;  2RML A;  4K4W A;  4IYQ A;  1X4F A;  3FBF A;  2ZBR A;  3C19 A;  4PZV A;  3RB4 A;  1JJC B;  1T9X A;  4OZ1 A;  4MKA A;  3M30 A;  3J7Z T;  2ASY A;  2H3E B;  2XMJ A;  3V81 A;  3CPW R;  5E3Q A;  3BKF A;  3KG1 A;  4DBQ A;  1IKW A;  2HVD A;  2NXJ A;  2BV3 A;  4I64 A;  3T41 A;  5E3R A;  4HKQ A;  2PDA A;  3MR7 A;  3NOG A;  2DH9 A;  2QX0 A;  3RW7 A;  2L41 A;  2EC2 A;  3BS9 A;  4DPT A;  3MAA A;  4V19 X;  1BQN B;  3HF5 A;  4FXV A;  1X60 A;  2OFG X;  4GMK A;  4F4X A;  4WE1 A;  1KOH A;  2KJW A;  1SB6 A;  4NXM J;  3AH6 A;  5KAK A;  4X66 F;  1SIZ A;  3NBP A;  4ED0 A;  1C4A A;  3PHT A;  2XWY A;  2XSF A;  1KOO A;  4OJH A;  1RTZ A;  2E5L F;  4JI3 F;  5J1E A;  1UCN A;  3H59 A;  2VG6 A;  1KTV A;  4K8R A;  1I94 J;  5IXU A;  4M1K A;  1LWE A;  3SEO A;  5KOW A;  1JLF A;  4FBU A;  5AE2 A;  4USV A;  2RIJ A;  3FCW A;  5CYM B;  5DGB A;  4QWE A;  5ADZ A;  1PCA A;  2YX7 A;  4MK8 A;  3UDV A;  2KFN A;  4Y65 A;  5EX3 A;  2MQ8 A;  3CCT A;  2CJK A;  2UUC J;  4WF9 Q;  1GT8 A;  1T3O A;  1CBK A;  2J7U A;  3U27 A;  2IJN A;  1FRH A;  2LXF A;  3P96 A;  4MYU A;  1N52 B;  1NHV A;  4OHW A;  1TEL A;  4J9M A;  1UAW A;  1N33 F;  1XK8 A;  3D6F B;  4GKK F;  2GML A;  1S9F A;  2YWW A;  4B02 A;  1AFJ A;  4IG0 B;  4B3O A;  4B17 A;  4WK3 A;  5F8M A;  4DSL A;  5KFV A;  4DXL A;  5DLF A;  4DL7 A;  3H25 A;  2H5J B;  2N4D A;  5A8K A;  1S6P B;  1FKO B;  2HHQ A;  4ECW A;  2ZWP A;  2Y0B B;  1V5I B;  3ZXW A;  2W8L A;  1ZZN A;  1RT6 A;  1YI2 S;  3IBC B;  5HSP A;  2AX1 A;  4ED2 A;  2YNF B;  2L9N A;  2FTR A;  2V4J A;  4AFF A;  3EX7 B;  3DGV A;  4ZPD A;  2ZH8 A;  1RSC A;  5KFU A;  1EKS A;  1GTE A;  2MQL A;  2NXU A;  2VON A;  2XMU A;  4NZ7 A;  2FLN A;  1N48 A;  3MMA A;  2G0C A;  2GGP A;  1P6T A;  2BJ9 A;  2RUS A;  2DRB A;  4AQY F;  4JV2 A;  5CA5 A;  5CYQ B;  1PSD A;  2B3T B;  4YY3 F;  2KDO A;  4CYU A;  4IDK B;  1R6Y A;  2LU1 A;  1RDR A;  2DHS A;  2XMK A;  3AD7 C;  4DL5 A;  4LF9 J;  4F02 A;  2L9W A;  3OL9 A;  3OLB A;  2LQ9 A;  3DM2 A;  4Q7A A;  2F65 A;  4UQG A;  3FSX A;  1N5V A;  4HDG A;  3V6D B;  2ZWO A;  2WSC C;  3DRP A;  1J5E F;  2IYG A;  1IQZ A;  1S0O A;  1VC5 A;  4DFP A;  3MF5 A;  4C7Q A;  1HQ2 A;  4A8M P;  2BAC A;  3CJ8 A;  3KK1 B;  2BM1 A;  1LQ9 A;  3O3L A;  4NCB A;  2DNR A;  2RIL A;  2W9A A;  3H20 A;  3OTO J;  3AT1 B;  4JI7 J;  5FJ4 A;  2IAJ A;  1JK9 B;  2XWX A;  3N01 A;  4DV3 F;  4C4W A;  3CW2 C;  3CO0 P;  4EYI B;  2J0W A;  4A48 A;  4C0H A;  5J1E B;  3TJ8 A;  2E9R X;  3M6U A;  2BJ1 A;  4W4M A;  5A8W B;  3I96 A;  4EZ6 A;  2R3V A;  2C2K B;  3Q23 A;  2YQ0 A;  2AKW B;  5DZ6 A;  3B54 A;  4L3K A;  2J9E A;  3KHH A;  1L3T A;  2NZ4 A;  2HHV A;  4G65 A;  1Q5V A;  4CH1 A;  3GFX A;  2AJ4 A;  3MEK A;  3NEK A;  3MM9 B;  1M5H A;  4ERD A;  4B9V A;  3EYZ A;  4M5H A;  2QLW A;  5THW A;  1HNI B;  2UP1 A;  4RNN A;  3NGR A;  4GVL A;  5IQQ A;  3TJA A;  5B7W A;  2Q3P A;  2B7B B;  1NAQ A;  3L7U A;  4ZMM A;  4DR4 F;  1P9Q C;  1YLX A;  3R7S B;  4F36 A;  5KT7 A;  3HVT B;  4C11 B;  3OSN A;  3MM7 B;  1ZBT A;  2DNH A;  2A0F B;  2FJB B;  3C6T B;  3DYA A;  2WON A;  3DLG B;  4P2M A;  5C25 B;  5LXY A;  4K4S A;  4L74 A;  4KC5 A;  2UUB F;  3IO1 A;  4GO7 X;  1DJ0 A;  2FJV A;  3V5R A;  1UVK A;  4J9N A;  4CT9 A;  2CPE A;  4OLP A;  2N4C A;  2J0S D;  4ZVF A;  3I31 A;  1J2V A;  3VVU A;  1CQM A;  1HI0 P;  2J6U A;  5D0G A;  5IT9 U;  2YNI A;  3DU6 A;  3MED B;  3HHL B;  3RU0 A;  3W64 A;  1WEZ A;  3BSC A;  4K7Q A;  2G4B A;  1IBM J;  2F8H A;  2ZZM A;  2XMW A;  1HWK A;  3ZNJ 1;  1Q78 A;  1VMB A;  3TI0 A;  3TAR A;  4LFC F;  3JS9 A;  4I67 A;  3LPE A;  2GVD B;  2RKI A;  2Y1L B;  1C0T A;  2HVZ A;  4YN3 B;  1RTI A;  3LH2 S;  2E9Z A;  3NAI A;  2IVY A;  3BSA A;  5IS2 A;  4DQS A;  1OSD A;  1F9F A;  4DN0 A;  3B4D A;  3BGR B;  2W2Q P;  1Z2L A;  4DV7 F;  1UEU A;  1WUU A;  4HT5 A;  4ED6 A;  1X4H A;  4B9L A;  3THP A;  3EWG A;  4O3R A;  2PFF B;  3C16 B;  3M32 B;  4HT7 A;  5KFC A;  4OL8 A;  1N6Q A;  3E01 B;  3F56 A;  2PFD A;  3LO3 A;  4FZV A;  2N7Y A;  3QPI A;  4U95 A;  3EDQ B;  4ETX A;  5KFK A;  2YKN B;  4JV1 A;  4NEZ A;  4QPX A;  2BOP A;  4O44 B;  1U2C A;  2XZW A;  4YME A;  1TL4 A;  1A6L A;  3FRZ A;  2ZBI A;  1MML A;  1S4E A;  4N41 A;  3QJP A;  5CD4 H;  2OPP A;  3VAG A;  3VAK A;  1ZYQ A;  4ED3 A;  2HHW A;  3G9C A;  5L1I A;  2JLG A;  1NJZ A;  3HPO A;  2MST A;  1CJV A;  2XLK A;  4DR7 J;  5AJ3 F;  3UFC X;  4HTJ A;  4X62 F;  1SBR A;  4IH5 A;  3UN2 A;  1SJF A;  3PO4 A;  1FE4 A;  1VOM A;  3IM8 A;  2A2D A;  3NMA A;  5KG5 A;  1VJQ A;  1FER A;  4ZA1 A;  2VBZ A;  2DGT A;  3SSS A;  3CXC R;  3BSN A;  4P2S A;  4DR6 F;  4TN2 A;  2PA3 A;  1UPP A;  2ZH4 A;  1BD6 A;  2M0G B;  3BYP A;  1AT1 B;  5IQ6 A;  1KON A;  1IXK A;  4A8S A;  3OVS A;  2KT2 A;  2DJW A;  2XSJ A;  2O1P A;  3M8Q B;  1IKY B;  1XR5 A;  3V6H A;  5BYQ A;  3UR0 A;  3T9N A;  4KKO A;  4ZN1 A;  4XPE A;  3H2V E;  4DEZ A;  1U1P A;  3MCS A;  2FJX A;  3WC2 A;  4CO2 A;  1HNW J;  2QLF B;  4NOH A;  1SPB P;  1J5O B;  4X2B A;  5D4L A;  1T9T A;  4TU8 A;  1F60 B;  4TU9 A;  3W2W B;  3VGU A;  1TP7 A;  1RHU B;  4MK7 A;  2DNM A;  3KUH A;  4TU7 A;  2MQO A;  4ECR A;  1GXU A;  2VPY B;  4ZPV R;  4ZIW A;  4OYO A;  2HFV A;  3PM9 A;  1NSQ A;  1LXJ A;  4ECQ A;  2FVP A;  2VOO A;  5FLX Y;  1HBN A;  2HGM A;  3CJT A;  1ZPV A;  2FHJ D;  2LA6 A;  4K50 A;  1F0X A;  3GJQ B;  4FYY B;  3LWM A;  4F4Y A;  1YHQ S;  1NJW A;  2MGZ A;  3H5U A;  2IMW P;  2J0Q D;  4RUC A;  4CCH A;  3TQE A;  1LV5 A;  4P71 A;  5L1L A;  4RR5 A;  4ZDN A;  3DHW C;  2MSS A;  4PG7 A;  3O5T B;  5ETK A;  5HJY A;  3CCZ A;  5J2N A;  1G2E A;  1FKP B;  1MWY A;  4FNI A;  4I56 A;  2CPJ A;  3HD2 A;  1TKT A;  3EXC X;  1SH2 A;  2QT7 A;  2E5G A;  4WP3 A;  1C2P A;  2VV5 A;  2DPI A;  1HMV B;  1NB2 A;  1VIS A;  3TUI C;  3S01 A;  2VHG A;  4O0N A;  2B9W A;  2RRB A;  1QLN A;  2FZK B;  1KNZ A;  2UVU A;  2NPF A;  2MKI A;  1HW9 A;  4UW2 A;  2HS4 A;  3KUE A;  4ECY A;  4JI7 F;  2OUG A;  1CC7 A;  4H4O B;  5D0H A;  4XIU A;  4PG6 A;  4M5J A;  4ZP6 A;  4X62 J;  3I9Z A;  2D7S A;  4K4Y A;  3V4M A;  4NRT A;  2MY8 A;  1NK8 A;  3I4H X;  4DPU A;  3E01 A;  2R7X A;  1Q82 T;  4OX7 A;  4D3G A;  4PWD B;  2RHS B;  4QR2 A;  2CQP A;  3LW5 C;  3EVW A;  2IC3 B;  1CS4 A;  2IJR A;  2VIH A;  4AYB D;  5DQG A;  1TL1 B;  4LBH A;  4USJ C;  5LJ3 Y;  4F3Q A;  4N7T A;  2AMC B;  4OHY A;  4WU3 A;  3G8Q A;  3HHL D;  1CJT B;  5KFW A;  1HW8 A;  2HFO A;  2LVW A;  2MZR A;  3FKB A;  3IA0 A;  4P6Q A;  2J9D A;  3Q8Y A;  1YZ7 A;  3BQ0 A;  3NNH A;  3MEE A;  2HQF A;  4I7F B;  4OZ3 A;  1XC9 A;  3W5X A;  1GX6 A;  1LW2 A;  4MMO A;  2RHQ B;  5HBM B;  3FFI B;  4DV1 J;  2VC0 A;  1S72 S;  1SV5 B;  1I51 B;  4NML A;  5I3Q A;  3MAQ A;  1UKU A;  2ZZN A;  2DR8 A;  4ENO A;  3VAF A;  1UFW A;  3RW6 A;  4LFC J;  2L9D A;  3M8Q A;  4F25 A;  9RUB A;  1LFP A;  4WFA Q;  2OSR A;  5HVF A;  4J9L A;  1E6V A;  1UEV A;  2XS2 A;  3AA9 A;  5ETT A;  3A8K A;  1IJF B;  4PKD B;  1T03 A;  1RT5 B;  3GB0 A;  4QOT A;  5IOL A;  5K8O A;  4X4S A;  1TAQ A;  5D4O A;  3BBF A;  1XQI A;  4EGL A;  4X64 J;  4NLD A;  2XO6 A;  2XGP A;  1QSL A;  4FVM A;  3AD8 C;  1NLK L;  2FC8 A;  3PCO B;  3KLF A;  4X4T A;  4Q0B B;  4TXS A;  2GVD A;  3LP0 B;  4MTP A;  5K14 B;  3RZA A;  2XTJ P;  1HWI A;  4DX5 A;  3ISZ A;  3Q89 A;  1XBW A;  2LEP A;  4KH0 B;  1JNZ B;  2CPD A;  1FJC A;  4URQ U;  1PKU A;  2UZA A;  5L9N A;  2XG8 A;  3TVZ A;  4M5L A;  5DLG A;  3M32 A;  1S49 A;  1MWQ A;  3OTE A;  2RAQ A;  2HBY B;  3DOK B;  1MMN A;  3AB4 B;  1FO1 A;  1X31 C;  3POT A;  1VC0 A;  2XNR A;  1HBM A;  1UTA A;  1S4F A;  1ZM2 A;  1LWC B;  2DB1 A;  2HNZ A;  3QSI A;  3W2V A;  5IM0 A;  3PZP A;  4K4U A;  2HSE B;  1ZH5 A;  4ELT A;  2CDR B;  1NM2 A;  2HND A;  2CVI A;  2LCW A;  4X66 J;  1X9W A;  1M5O C;  4Y2A A;  3W1Y C;  4DV5 F;  1J27 A;  2AWZ A;  1TV6 A;  3AAW B;  4USU A;  1DTQ B;  4LRC A;  1FFG B;  2ASL A;  5E3A A;  1QVF R;  2QA2 A;  1F5C A;  4A8X A;  5LXR A;  3L7O A;  4I0W A;  3D6H B;  3OPK A;  4ID8 A;  5DM6 Q;  2I1R A;  3HO1 A;  1GK8 A;  2B7C B;  2IJF A;  3U02 A;  2RF2 A;  1Y5I B;  4L6V 3;  4LRB A;  4NA2 A;  2D3O 1;  2DNK A;  3DI6 B;  5MAO A;  2F9D A;  3AXM A;  3HKZ D;  3QWU A;  2YH0 A;  1RU1 A;  1JLA B;  3ZC4 A;  4WYL A;  4OJ3 A;  3KLE A;  4OX8 A;  4DCJ B;  2CQI A;  3AOD A;  3M2V A;  4AND A;  2RQK A;  3CCR S;  2JVO A;  3TQ1 A;  4HTI A;  5ETP A;  1FWL A;  4HLB A;  3DOL B;  2OGU A;  4PPZ A;  4GVB B;  3M6X A;  4KY3 A;  4YOE A;  1FT8 A;  2XHW A;  2MTL A;  1R27 B;  3BGO P;  5IC6 B;  3TJ9 A;  3MAH A;  1NHU A;  2W2N P;  3WC0 A;  4KGK A;  1Q7Y T;  2M52 A;  2WAQ D;  2IA6 A;  3BN7 A;  3CUN A;  1FF2 A;  3CJ0 A;  3KFW X;  4A46 A;  1KEK A;  4C2M A;  4K4T A;  4HYK A;  2XCP A;  1RT5 A;  2AT1 B;  1T0T V;  3M2V B;  3UI3 A;  1M1G A;  3LGM A;  3SSR A;  4EMD A;  2HMI B;  1R7I A;  4IG0 A;  1WF2 A;  2D74 B;  5LOQ A;  3HZE A;  2GVZ B;  1REV B;  1I5O B;  3EZU A;  2UU9 J;  3MDF A;  1JXE A;  1MU2 A;  3KLH B;  3GCX P;  3NP5 A;  2CQ4 A;  2Y1I A;  2RRA A;  1JLB B;  1FVQ A;  2GJF A;  4NAS A;  1RWP B;  3Q0A A;  2C2Z B;  4ES2 A;  4AXI A;  2J7K A;  3OFF A;  2UXB J;  1R0A B;  1RWX B;  1Y10 A;  2B43 A;  2L3M A;  4HL9 A;  4DR1 F;  4IQX A;  2UXC F;  3G2X A;  4ZVR B;  3TOQ A;  4XTT A;  3UCG A;  4DOZ A;  3MR6 A;  2QTW A;  2ZM6 J;  4ZPC A;  4ELU A;  1D0E A;  4NYP A;  1FK9 B;  1LEO A;  4RW6 A;  4HR2 A;  5KG4 A;  3JSB A;  4AUK A;  4UZB A;  1KQK A;  3GV7 B;  1FKP A;  1PC5 A;  1H74 A;  4B3S F;  3HM9 A;  3PYD A;  2AJ1 A;  2XZT B;  5M2U A;  3KLG B;  3GJT B;  3UVJ B;  4OZ0 A;  2UUW A;  3GON A;  3KHR A;  4B3S J;  2XI2 A;  3W2V B;  5IM0 B;  2N7C A;  1N34 J;  2BZ2 A;  3DGP B;  3X1L B;  2G2Z A;  4MIA A;  4WIQ A;  2ZKU A;  2YNH B;  3NRB A;  3SXL A;  2XGQ A;  3HJF A;  2COL A;  2Z30 B;  4DQI A;  1B7F A;  2J76 E;  8ATC B;  4C8O A;  2GJI A;  3EPG A;  1I94 F;  2MZS A;  1EQM A;  1U1L A;  1KC8 T;  1KLM B;  4IFV A;  2AHO B;  3UPF A;  5RUB A;  3QSY B;  4V19 J;  1VQM S;  3HHD A;  2JHE A;  1P1T A;  3KK1 A;  1GMW D;  1K8A T;  1HQU A;  1NBE B;  2K1R B;  2YKM A;  4C8L A;  4ZIT A;  4DV0 F;  1NK4 A;  2HNZ B;  5HK4 A;  3O6Q A;  4ALZ A;  2QRR A;  3DOM A;  4W90 B;  1N33 J;  2IDL A;  4USI A;  3CWJ A;  5JXS A;  4O4G B;  5H1S V;  2E1P A;  4B3R F;  3EMT A;  3LAL A;  2WB1 D;  2QA1 A;  1M1K T;  1FTC A;  1NSK L;  3PTW A;  4OMF G;  2VQE F;  1NK9 A;  3IBW A;  1NKC A;  4KT0 C;  1U26 A;  3A8I A;  1YBU A;  1M5S A;  3P45 B;  3WQP A;  1RU2 A;  4ED7 A;  4TQS A;  2OJ3 A;  2B4O A;  4BLG A;  1EZZ B;  4DPX A;  3C46 A;  2YBV A;  3D6M B;  4G1Q A;  4K2X A;  2V2V A;  5DQI A;  4DV6 F;  2VAS A;  3OL6 A;  4H4K A;  2JLF A;  1FES A;  2HHH J;  1U7L A;  2K8G A;  2MKH A;  4M5N A;  3ISN D;  3T5K A;  4FYD A;  4LFA J;  1LWF A;  1E6Y B;  2JJ4 D;  1C1B A;  2CIM A;  3ELH A;  2QFI A;  1KVJ A;  2XUL A;  4FS2 A;  4QU7 A;  4FYW B;  3PW5 A;  3O44 A;  3ADA C;  5A8W A;  2ATL A;  1OYD A;  4X4Q A;  2CNK B;  3G82 B;  2EFO A;  2HEK A;  4QWB A;  4C9D A;  3I4P A;  2FQQ B;  2D9O A;  3HDS A;  4QCL A;  3KLV A;  4IUF A;  3PIP Q;  2QL9 B;  3M8P A;  3JQK A;  4NL5 A;  4QQB A;  1X4G A;  3HSZ A;  5IV4 A;  2UXD J;  1D9D A;  2V2Z A;  3BO2 A;  3FMW A;  4DR7 F;  2D3Z A;  2AZ3 A;  1WDD A;  2GO8 A;  3CJ5 A;  4G1I A;  1C1B B;  4Q43 A;  1IBC B;  1NSP A;  2ASJ A;  1UA0 A;  5KT4 A;  2OO4 A;  4ED1 A;  2ACM A;  4X4V A;  2HW3 A;  5HVG A;  3GFY A;  4K5R A;  4KIA A;  3QLH A;  5U47 A;  4KBI A;  3LP1 B;  3A3N B;  3W7B A;  1S1X B;  3GG1 A;  3EM1 A;  4ZOS A;  1AUD A;  2CJB A;  1H0H B;  1U1O A;  2AIR B;  1TL1 A;  1B7Y B;  2V8D A;  1Q8I A;  1KSP A;  3MHY A;  1N0U A;  1RLC L;  2CPH A;  2X7I A;  2XSJ B;  1SC3 B;  3BKU A;  5DZ7 A;  4MT1 A;  3UN5 A;  3EE3 A;  4X4N A;  2H1Y A;  3AB2 B;  3AQO A;  3ZTR A;  2CZ9 A;  2JOQ A;  1D09 B;  4H4M A;  1MMD A;  4Z2X A;  1D3W A;  2HUR A;  5C42 A;  5K8P A;  1S10 A;  2HQI A;  3M9O B;  3QT5 A;  1TTH B;  3QAU A;  3MM6 A;  2PSZ A;  2ZUG A;  1DQA A;  3FGV A;  3H2U B;  2ASD A;  2UVW A;  2GZO A;  4N8O A;  5ETO A;  5DDR C;  1HBU A;  3DDK A;  2IM2 A;  2VZ9 A;  3FZ2 A;  4LT6 A;  1BE4 A;  2DTJ A;  1U6F A;  1HBN B;  1SH3 A;  1RHK B;  1F6T A;  3LP2 B;  2CG4 A;  4OI4 A;  2OD4 A;  1NK5 A;  1Y00 A;  4E98 A;  4LFB F;  2OPR B;  1K9M T;  1O8B A;  1Y11 A;  3VGS A;  2DGX A;  3CJR A;  2LKZ A;  2AZ1 A;  4RWX A;  3CCS S;  4DSK A;  1RZM A;  4CLK A;  1UVM A;  4UOF A;  1DY3 A;  2B4V A;  3ZNU A;  1LNQ A;  1XMB A;  5JUM A;  4U7C A;  5DS7 A;  3MWB A;  2OD6 A;  2WVF A;  1FJE B;  1NXI A;  2J7W A;  3H8Y A;  3UQS A;  1FDD A;  2BAN B;  2E5H A;  2ZBP A;  4B9T A;  4WK1 A;  5IZH A;  3G6Y A;  3TEG A;  1XWL A;  5KFP A;  1ULR A;  2BEF A;  1Y4Z B;  2ZHO A;  3M6V A;  1OWX A;  1KTQ A;  4ZVG A;  3AXK A;  3MR3 A;  3MCN A;  4WP9 A;  3PW4 A;  3OFG A;  2HWI A;  3TP2 A;  1DAX A;  4HHH A;  2UVV A;  1FK9 A;  2MHE A;  4RW6 B;  2AJ0 A;  2BRL A;  1RBL A;  1NZA A;  2KVI A;  3OFH A;  3FEX B;  4OIX A;  2W4D A;  3BRE A;  2V4J B;  3ETO A;  5E7O B;  5GAH U;  2R9L A;  3RB3 A;  5K5M A;  3D1O A;  4PWU A;  4OX6 A;  1F5B A;  4WFN Q;  2R7S A;  1PGZ A;  3K5M A;  3IFE A;  5ETN A;  2H65 B;  3EGW B;  1LWC A;  5CZX A;  2H4Y B;  1BXN A;  2MY7 A;  2PC6 A;  2AW0 A;  2GQ2 A;  3MPW A;  3SIP B;  1Q53 A;  4WE1 B;  2RU3 A;  2KFY A;  3TX8 A;  3Q24 A;  2KL8 A;  1RT1 A;  2KI2 A;  1HHQ A;  3GG0 A;  1PBA A;  2CPI A;  5LMU F;  4RO0 A;  3C14 A;  5J2N B;  3DC2 A;  1QY7 A;  2RJZ A;  2GMH A;  4F3O A;  2DHH A;  3FBB A;  2DCU B;  3T6B A;  5B0F A;  1TUW A;  2GS8 A;  1B3T A;  3NOC A;  4MFB A;  2XMM A;  4K4V A;  3KLG A;  2E5I A;  5K20 B;  4KJI A;  2YY3 A;  4NZ0 A;  1VJW A;  3UE2 A;  5J2M A;  1X4C A;  2X1B A;  3R5B A;  2C3O A;  4KPC A;  4JV0 A;  3NMR A;  3VZH A;  4RNF A;  3U1N A;  1H3D A;  2Q6C A;  4BWM A;  5DG8 A;  1T3N A;  2R8I A;  4ZVQ B;  2ZOG A;  2KTQ A;  3JYT B;  1G4C A;  4UT4 A;  1NPP A;  1L3U A;  3P5B P;  1LKZ A;  4FPR A;  5HMY A;  3QO9 A;  1CUL A;  2WBR A;  1P9Y A;  2MKS A;  2ADB A;  2ILZ A;  3R1H A;  4NLG A;  1UZH A;  4TVA B;  5GAD I;  1UMJ A;  3BN4 A;  2G9O A;  4YS2 A;  1U2F A;  1WKL A;  3IGV A;  2D41 A;  4DL3 A;  4RW9 B;  1IM6 A;  4FXW A;  4NLR A;  4DL0 C;  2FGO A;  3CDW A;  2E7X A;  5K8M A;  5HI7 A;  5SZT A;  4DQR A;  1YBA A;  2F8M A;  1RAJ A;  5LMN J;  5C2G A;  2H5E A;  2Z57 B;  1E6Y A;  5JVG Q;  1APS A;  1ZAW A;  2PT0 A;  3MEE B;  4LF8 F;  3OTB A;  1RBA A;  1WHX A;  4NLX A;  3W8G A;  4WYW A;  2QA4 S;  5F8I A;  5DM7 Q;  4DL4 A;  1PBU A;  2W2O P;  2FC9 A;  1SCJ B;  5HVH A;  1HNZ J;  2APO A;  4DUZ F;  1HQE B;  2WB4 A;  1R3N A;  2G2O A;  3LAM A;  1FFW B;  4UUX A;  3OFE A;  3RR8 A;  3ISN C;  1D1U A;  3THV A;  4NA3 A;  1SQE A;  2HRU A;  2ZOM A;  2OPQ B;  4PQA A;  4ZJO A;  4TKT A;  2QV6 A;  4R8U A;  2R7R A;  5CYQ A;  2XI3 A;  3UW1 A;  5A0Y A;  1H98 A;  3AHP A;  3FC9 A;  3OW2 R;  4DV1 F;  2V67 A;  5KFM A;  3SYZ A;  1T03 B;  1RAH B;  1VQ4 S;  2BQR A;  4BS2 A;  1NME B;  4O3P A;  5KOX A;  3P3D A;  4OHZ A;  3R9L A;  2CQ2 A;  2F1F A;  3UVJ A;  1SV5 A;  2OMO A;  2DIV A;  2EBE A;  4RWW A;  5LSL A;  5DG9 A;  1NU4 A;  1X5T A;  2EK6 A;  2FHJ A;  2B5J B;  3GLJ A;  1RWN B;  3TVY A;  1GXL A;  2V6A A;  3E3X A;  3I56 S;  2LQ5 A;  3RBX A;  4J9S A;  2XY5 A;  2HGL A;  5I3U A;  2R7T A;  2R7O A;  4FVC A;  3EGV A;  1VIX A;  1U09 A;  4X65 J;  3MOZ A;  3G8S A;  1IM4 A;  3W62 A;  3KJV B;  3GIK A;  2ROP A;  1B0P A;  5DG7 A;  2HKE A;  2FJA B;  1YJU A;  2ZHB A;  1Z4U A;  2G1H A;  5AXK A;  4ZK7 M;  3OJU A;  1IQT A;  4Q2L A;  3UNY A;  2A6O A;  1IN0 A;  1P27 B;  2V9K A;  3TWZ A;  4ECS A;  3UDL A;  1F2H A;  3M8Y A;  4B3M J;  5GAE I;  2KM8 B;  3IBF B;  2OLW A;  3S1T A;  4CI0 B;  4UUW A;  2XS7 A;  3NGU A;  4Q2M A;  2BVZ A;  1AUS L;  2FPH X;  4H4O A;  1TV6 B;  1FD8 A;  4OZL A;  2F4V J;  1FX4 A;  2ZH6 A;  2UUB J;  2DNY A;  2ROE A;  1NDC A;  1NH7 A;  2B9X A;  1RGV A;  4TLR A;  2QLJ B;  4ANE A;  1O5J A;  4CLU A;  3BDP A;  1JWW A;  3VV2 B;  3OVB A;  4J9P A;  1VQ6 S;  3IRW P;  3AOB A;  1UWA A;  2H9Z A;  1HBU B;  2JZ5 A;  2XBP A;  4GC7 A;  2VBY A;  4FF2 A;  1YRU A;  1U02 A;  2R7W A;  3K57 A;  2WVD A;  3MM8 A;  4CO3 A;  1K47 A;  1YWX A;  3TYT A;  3WX4 A;  2SXL A;  2ZD1 A;  3KLI A;  4EWT A;  4DR5 J;  3JSR A;  1S1W B;  1YZ6 A;  4YHH J;  4OV1 A;  4LF8 J;  1N32 J;  2YWG A;  1RLD A;  3OR2 A;  4L76 A;  3NKY A;  3RYL A;  4QYZ K;  2F4F A;  5KFO A;  2W7O A;  2IM0 A;  1KFD A;  3PFE A;  3Q2T C;  4MK9 A;  4Y2M A;  2BJD A;  2RT3 A;  3RRK A;  2YXL A;  1Q79 A;  1WC0 A;  4ED4 A;  3HHK A;  2MXY A;  5F8H A;  2H51 B;  4OX9 F;  3FFI A;  4GVB A;  2I6W A;  1WOR A;  3D7S B;  5IC4 B;  2G0J A;  9ATC B;  2FVS A;  1MWZ A;  4U6P A;  1QAJ A;  4A8Q A;  2OEM A;  4MH8 A;  3MEG A;  4C3M A;  2K2P A;  3KG0 A;  1RT7 A;  3ZO7 A;  3SSQ A;  2LYV A;  3K2Y A;  4O3N A;  4NWB A;  4ELV A;  2ADC A;  1X5P A;  2HIQ A;  1GFW B;  1VBZ A;  2Y0S D;  1YIT S;  2X3G A;  4DSF A;  1RTH B;  1H2V Z;  3VGV A;  5A8R A;  4FN5 A;  5HQ8 A;  1KP6 A;  2K3I A;  1MU2 B;  1SC6 A;  4XK8 C;  3KLH A;  5KG6 A;  1QAY A;  3VQS A;  2BE7 D;  5E0O A;  4PQU B;  1M5P C;  1N5T A;  2DRD A;  3TNV A;  2KZZ A;  4CWB A;  1HQU B;  2K1R A;  2YKM B;  3LP0 A;  5K14 A;  5KFY A;  5M2P A;  4X4P A;  3QRQ A;  1JLE B;  3H4B A;  1OYE A;  1MRO A;  2OAU A;  5IT9 Y;  1TKX A;  4ZP7 A;  4DV7 J;  2CPZ A;  4LJM A;  3EUN A;  2HLU A;  4LR8 A;  4ED8 A;  2YNI B;  5C7P A;  2P6S A;  2VG6 B;  4OYA A;  5EWE A;  2YWE A;  1EET B;  1K1Q A;  3N79 A;  3N6M A;  2R42 A;  2KHC A;  4EBC A;  2YKA A;  1VFJ A;  3EGN A;  2GHW A;  3TUJ C;  3A3P B;  4PQU A;  5HAN A;  4JI4 J;  1OS5 A;  2ROG A;  2KXN B;  1HBM B;  4URS A;  1WF0 A;  2Q79 A;  2HAI A;  2ZBQ A;  2E1A A;  1S9E A;  4KR0 B;  3OLA A;  2F5G A;  3JSY A;  2M88 A;  3MGJ A;  2R2T A;  4OX9 J;  3PHE A;  2HGN A;  2C2R A;  3CDU A;  3BV8 A;  1WEX A;  5I4M A;  3CCQ S;  2O3D A;  4KPY A;  2MMY A;  5HP1 B;  1NPR A;  1UPM B;  2BOA A;  4C97 A;  1WF1 A;  5F0W A;  1H38 A;  4JI6 J;  1HNW F;  3RG6 A;  5KFL A;  3TO8 A;  3W8P A;  3CMA S;  2WOM B;  2BDP A;  1OQ6 A;  5KG7 A;  1H2U X;  3NGD A;  4F50 A;  1BWE A;  3DDI A;  3SCJ E;  4Q0B A;  1NDP A;  2R8J A;  1IJE B;  1TL5 A;  5BYS A;  1IR0 A;  2OIH A;  3IN5 A;  1HAR A;  1YG0 A;  5KG0 A;  1YRX A;  2IFX A;  1Q0N A;  4AL6 A;  3CB4 A;  3OHB A;  2VFR A;  4UF4 A;  2MQN A;  2FZG B;  5HRO B;  3LF0 A;  3NGT A;  1PC4 A;  4B9S A;  2GO9 A;  4Y34 A;  3IMQ J;  2DK2 A;  1LK7 A;  4F2R A;  3W5Z A;  4V1A k;  5E5N A;  3M8S A;  1YBT A;  3POT B;  2DRA A;  4U8Y A;  2IC3 A;  4KHM A;  1VK8 A;  2WON B;  3DLG A;  3NGK A;  1BQN A;  1RWV B;  1UEK A;  4CZC A;  2NRE A;  4DU7 A;  3GPA A;  3S7R A;  1S9G B;  5B0B A;  4MIW A;  1F9H A;  2HHP A;  3NGS A;  2WZ1 A;  1S7I A;  1VRT B;  2KB2 A;  3N5F A;  3BR9 A;  1KQG B;  2XLJ A;  4KHP F;  6AT1 B;  2UV8 A;  3IRX B;  4ATN A;  2Y1J A;  1WC5 A;  2BQU A;  3Q8Q B;  5CCL A;  1QJH A;  2AEF A;  3MXH P;  3BGF A;  1PAU B;  1HI1 A;  4ZS6 A;  4RUA A;  3N0V A;  4PAA A;  3OTO F;  3IAS 9;  4DL6 A;  4LSL B;  1V3Z A;  1D8Z A;  3KWM A;  4YP3 A;  3K5P A;  1XNR F;  3NNC A;  3ENQ A;  4EI2 A;  2W9B A;  3KK2 A;  3BO3 A;  1BQM B;  1RT7 B;  5L9X A;  1AB8 A;  1TMM A;  2VOP A;  3CJS A;  4RUB A;  2U1A A;  3HHL C;  2LU2 A;  1LWF B;  3UWT A;  3G8T A;  4F4K A;  4FXD A;  3PFO A;  2IYI A;  3HMJ G;  1VRU A;  1HNV B;  1Z1Z A;  1NEE A;  2YWK A;  3HLU A;  2A2C A;  3D66 A;  4PUO B;  2PI5 A;  4HH0 A;  1RT2 A;  2YX4 A;  1FWP A;  4DSJ A;  1RAC B;  4RBV A;  4CP5 A;  4DR2 F;  1ZTT A;  1JKH B;  1RHQ B;  2E1R A;  2F8E X;  2C3M A;  2VL1 A;  2IDE A;  5HMW A;  4O3S A;  2L08 A;  4ZPT R;  1K0V A;  3L4B C;  2HAF A;  3WDO A;  1ICE B;  1N88 A;  2VPZ B;  4M8L A;  4DUZ J;  3JB9 k;  4UY8 5;  2V2K A;  2XZD B;  1T94 A;  2CG8 A;  4ILM A;  2XYP B;  4GO5 X;  2ZDO A;  2LEB A;  1JLA A;  3NXZ A;  1RP5 A;  2ERR A;  3MFI A;  2DH7 A;  2HHH F;  4NRU A;  3D0I E;  5KG1 A;  2CUY A;  4YUD A;  2I5J A;  4E8U A;  3CDB A;  5F9N A;  5CXT A;  1RKI A;  4WII A;  3DXB A;  3DRR A;  3FBE A;  1M0S A;  1VQY A;  3DLJ A;  2MLX A;  3DYA B;  3DLK B;  3OR1 A;  2W01 A;  4CNY A;  3H4D A;  2VJU A;  1HQE A;  2LXI A;  1S1X A;  5E41 A;  4ER8 A;  3SMZ A;  4WFB Q;  1UJ5 A;  5A2Q Y;  3DDN A;  1ZPW X;  4J9Q A;  3K5O A;  3DXS X;  1PO6 A;  3R2D J;  3MEG B;  3CF5 Q;  5I3U B;  4B08 A;  1NPK A;  2RDJ A;  1HNI A;  4EBD A;  2EC0 A;  1O6X A;  2CFX A;  2WHO A;  3CT9 A;  2MZQ A;  4OYZ A;  1URN A;  1HPZ A;  5LL6 d;  1U47 A;  1G1X A;  2HHX A;  2ZJQ Q;  2HHS A;  2OEL A;  4AT1 B;  4LQ9 A;  1WEY A;  1VIO A;  2BKO A;  1Q1K A;  4F4Z A;  5MLC V;  4F4W A;  2KRB A;  3T1A A;  2V0N A;  4FBT A;  1RAF B;  2BYC A;  2RKI B;  4NYZ A;  3BJY A;  1RBO B;  3HUL A;  4XO0 A;  3QAT A;  1SQG A;  5GAH I;  1FVS A;  2ZC4 A;  4DMZ A;  1Q86 T;  1U6B A;  2EFG A;  5KG3 A;  1Z2Z A;  2KYX A;  2NUH A;  2GX8 A;  4WCE Q;  3EZ5 A;  2B56 A;  3C66 A;  1DZ5 A;  1UFK A;  2HBZ B;  1YJN S;  2E1C A;  1N56 A;  1UA1 A;  4TLQ A;  4F2S A;  3MMJ A;  3TRG A;  3PAC A;  5I3P A;  2AX0 A;  3IM9 A;  2AD9 A;  1RT4 A;  2EK1 A;  2FHK A;  2GQC A;  3GYN A;  3ITH B;  3J7Y U;  3GYX B;  3TA2 A;  1UZD A;  1DTT A;  1U0S A;  2ZKT A;  3QT7 A;  5GME A;  5KFG A;  2YQ1 A;  3DLK A;  3OR1 B;  2WVC A;  1S6P A;  2CZV C;  3I5B A;  5DRK A;  4CM2 A;  3M9M B;  4AQY J;  1VDH A;  1FJG J;  3A12 A;  3CDE A;  4PXC A;  2JEJ A;  4LFA F;  1QE1 A;  2P8I A;  2DGW A;  2EXU A;  4MAK A;  2AEM A;  3P6Y C;  3C14 B;  3CJ4 A;  4P7T A;  3W9J A;  2ZH2 A;  4UY8 T;  2ZH9 A;  4C3K A;  1BMQ B;  4FPI A;  3ZZY A;  2HNY A;  2YPY A;  1LXN A;  4CH7 A;  1VI7 A;  2DXD A;  2BA9 A;  1A7G E;  3N28 A;  4ZVH A;  1DTT B;  4WZM A;  1YKW A;  3RUB L;  3R8Y A;  3W66 A;  2V94 A;  4JI5 J;  2W2M P;  3R5J B;  3HKW A;  2O5D A;  5KFQ A;  4QWC A;  1XNQ F;  1QM9 A;  3R5D A;  4DV2 J;  3H5X A;  2NXE A;  1SI9 A;  4JI1 J;  2DHX A;  2EPI A;  5H9F J;  1PYT A;  1BQM A;  1YK9 A;  1S0N A;  1UVJ A;  5BXI A;  2QSF A;  3VVT A;  4DG1 B;  1NKE A;  2HYI B;  3BB5 A;  4Q5V A;  1VBK A;  3CCJ S;  1ZA1 B;  3KMQ A;  3T19 A;  1FNX H;  1UL3 A;  2HRT A;  4J9U E;  1S59 A;  3MR2 A;  3DKD A;  3VF0 B;  5IWA F;  4PXD A;  1GEH A;  1ZM3 A;  3JQM A;  4LVN P;  2HS3 A;  4QIV A;  4QIF A;  5KFN A;  1KQS R;  3UN3 A;  5C25 A;  4JBC A;  4P75 A;  1RE1 B;  1S6O A;  4QIE A;  3MMB A;  2YNG B;  4O23 A;  1QE1 B;  4W98 A;  3R6L B;  1RYS A;  2FVQ A;  3W3S A;  2GNK A;  2ZFH A;  4QWA A;  3L95 X;  2HFS A;  3IRX A;  3M4X A;  4JI0 F;  1YSJ A;  1YJ9 S;  4UQT A;  1YRT A;  4CH0 S;  1Q8K A;  2DPJ A;  1KD1 T;  3N6N A;  4NLT A;  3CDA A;  3Q83 A;  1F5A A;  3WIU A;  4J9O A;  1JIH A;  2QFJ A;  4P73 A;  5H9E J;  1KDN A;  4ZJQ A;  4YB7 A;  1TK5 A;  2A18 A;  3PXG a;  4C8M A;  3IGN A;  2MQQ A;  1RCO B;  4PG5 A;  3I0S B;  3GP9 A;  2HFN A;  4ZCK A;  4ES3 A;  3CD5 A;  1V9O A;  2ZM6 F;  1F2G A;  3AOA A;  3KHL A;  3D6T B;  3PX6 A;  2W9B B;  2AGO A;  3ONQ A;  1MN9 A;  1V3R A;  3OTD A;  3OR2 B;  3T3F A;  3U7J A;  2O66 A;  4H4M B;  1RHR B;  1HI8 A;  1KVI A;  1FCA A;  2LMI A;  1GMW A;  3BM7 A;  4I2Q B;  3NS6 A;  3R5C A;  1VQP S;  1XMQ J;  1IKV A;  2DHG A;  4TY8 A;  1RI7 A;  1RT2 B;  3AY0 A;  2QN6 B;  4YB6 A;  1FRJ A;  4C11 A;  2GV1 A;  3OUY A;  4JI0 J;  5KFB A;  1EQ0 A;  3JQJ A;  1FXL A;  4JYA J;  3DOL A;  1SH0 A;  2KZM A;  3C8Y A;  2DNO A;  4HHJ A;  1Y0H A;  4OYM A;  1FKO A;  2OHD A;  2W7A A;  4C8Y A;  4JV5 J;  1MNE A;  1WI8 A;  2CJY B;  3JSM A;  3MPD A;  4ZVT B;  5GAG U;  4CDI A;  1V3S A;  4NA1 A;  5DGA A;  3RAX A;  2MKJ A;  3C3L A;  5IWA J;  3PG9 A;  5C42 B;  3RR7 A;  1HR0 J;  4CO0 A;  3ETM A;  1P1L A;  2CPY A;  1WJ9 A;  2EI5 A;  1S1V A;  2C3U A;  2GW8 A;  2VD3 A;  3ENA A;  3OHA A;  3HCX A;  2YH1 A;  1JXL A;  1WTB A;  3I32 A;  3HFK A;  2OI2 A;  1RIS A;  2V8P A;  3CD7 A;  4IFY B;  4CQ1 A;  4F26 A;  5GAE U;  2NPI A;  2WW8 A;  5SUH A;  1F3V A;  1G3O A;  3DMJ A;  1H72 C;  1LOU A;  4O4R A;  3R1L A;  2DR9 A;  2DNL A;  1UW4 A;  4P2F A;  1LW0 A;  2FGC A;  1RAE B;  4KSE B;  4DUT A;  2D9P A;  1S6U A;  2CNN B;  2GCF A;  4K2J A;  3UD5 A;  1MW7 A;  4OZN A;  4YB1 P;  1XNR J;  4GKJ J;  1T05 B;  1JJH A;  2PE8 A;  2F7V A;  2VPX B;  3MPY A;  2X1A A;  3QMQ A;  5BR8 F;  1OO0 B;  4QWD A;  2OKQ A;  4LMZ A;  4KAI A;  2C22 A;  2H5I B;  5A8K B;  5GMD A;  3CC4 S;  5G0R A;  3GTY X;  1R0B G;  1L3K A;  3P5T L;  3QWP A;  4C48 A;  2ZNY A;  4PCQ A;  5J2Q A;  3MMB B;  3Q86 A;  1IWA A;  1NSA A;  4DX6 A;  4NXN F;  4OZ2 A;  4RUH A;  1NJY A;  4CLS A;  4I2P A;  4A8Y A;  2PA8 D;  1HD1 A;  4YQW A;  1U6Z A;  2B0G A;  3QZ8 A;  1JB0 C;  1CJK B;  3R6G B;  4J37 A;  1TAU A;  1ZA2 B;  3QLH B;  3RAM A;  4LUB A;  4G1Q B;  4OYB A;  1N8R T;  4H54 A;  1WKK A;  4JI3 J;  2PGC A;  1ZS6 A;  1W2I A;  4JP8 A;  3M2R A;  2IRX A;  3KYL A;  2MJN A;  4ETZ A;  4CLZ A;  2WSE C;  3FCV A;  1VYA A;  2DGS A;  3HSG A;  4KGZ B;  2NCK L;  2C1E B;  2JVR A;  1KR4 A;  5KFH A;  3KK2 B;  1IBM F;  1HD0 A;  4I6W A;  2RS2 A;  3NCP A;  2FYX A;  2GJ2 A;  2POK A;  3LGN A;  4U96 A;  3ZTS A;  5F8L A;  1WHW A;  5CQG A;  3V6J A;  1HL6 A;  3PRB A;  3DRR B;  5CZV A;  4JI1 F;  3HFZ B;  2MJU A;  1K1S A;  2G1D A;  3G82 A;  2BAN A;  4Y00 A;  2HK2 A;  2H48 B;  2KVQ E;  2P6T A;  4F4A A;  3GII A;  4DV2 F;  1O51 A;  1H7X A;  1X4E A;  3HT0 A;  1FD2 A;  1U8W A;  2RSQ A;  3MM7 A;  3N6L A;  5F8G A;  1NJX A;  6FD1 A;  2V8G A;  1QDU B;  1HIY A;  1PYS B;  3RTV A;  1MRO B;  1D9F A;  2G2Y A;  4PEO A;  1FTR A;  3HSJ A;  4LF2 A;  3W61 A;  4CM0 A;  2VF3 A;  2EFP A;  4OHX A;  2ZH5 A;  5A2Q U;  4KV8 A;  2BKN A;  2NXC A;  2Z4P A;  2HWT A;  3VZI A;  1NH8 A;  2G13 A;  1CJK A;  4DX8 H;  5KT2 A;  4IRC A;  3EIC A;  2HFU A;  1HMV A;  2PMW A;  4GRS A;  2B51 A;  2EFN A;  2YKP A;  5F9L A;  1FRK A;  1SQF A;  3W60 A;  4KTQ A;  5H9F K;  1NCL A;  3QT6 A;  2P5V A;  2DR5 A;  2HWH A;  5HAO A;  3SV4 A;  3ZZO A;  1AA1 B;  3SZ2 A;  2KH9 A;  5HQM A;  4QU6 A;  1WG5 A;  1T11 A;  1ZM9 A;  4HVZ A;  4TYA A;  3W5Y A;  2AYB A;  2YTC A;  2R2S A;  2W1B A;  4RNO A;  4KB7 A;  2E66 A;  4RJV A;  2VG5 A;  4ZHR B;  1DFD A;  3GQC A;  4NCA A;  2CQ3 A;  2XC9 A;  5I42 A;  1VQL S;  2ABY A;  4JYA F;  4OI2 A;  4WTO B;  1EET A;  1RTJ B;  1RQ0 A;  4DCP B;  3D4J A;  2XMA A;  2AV5 A;  2ZEJ A;  3LP1 A;  1XMQ F;  2VC1 A;  4M5D B;  5JMN A;  3CIZ A;  1K0T A;  4DPO A;  3V6K A;  2Z2Y B;  1EP4 B;  2KHD A;  3V4I B;  5ITH A;  1JJ4 A;  2R8K A;  1XJW B;  2VUG A;  3HP6 A;  3CIM A;  4D3H A;  2GMJ A;  2R4F A;  1HHT P;  5H9E K;  4ZVP B;  4DZ6 A;  1J5E J;  3PYF A;  2NZC A;  4OYX A;  5FDL A;  3CJK B;  5T7L A;  1IKV B;  3HHN B;  4LRF A;  1NRK A;  2VFU A;  4J9V A;  4ES1 A;  4A8F A;  2ZZT A;  1QD1 A;  2B6A A;  3R27 A;  4I6Y A;  4QIW D;  3PX0 A;  4DI6 A;  4CLW A;  2E7V A;  2XY7 A;  4M5I A;  1VQS A;  2W4C A;  3TAQ A;  1ZTW A;  3NNA A;  1F3F A;  3B8H A;  5FLX U;  4C98 A;  8RUC A;  2GC8 A;  4PYA A;  2B5J A;  1TKX B;  1TR0 A;  4U67 Q;  4BC9 A;  2RS8 A;  1NB7 A;  2IM1 A;  1S6Q B;  4AL7 A;  4H4K C;  2HZV A;  3A1Y G;  3DM2 B;  2HQ3 A;  1R8H A;  2OPS A;  4DR5 F;  1SL1 A;  1A9N B;  1BGX T;  2YVS A;  3MCM A;  2QYC A;  4IFV B;  4Y3C A;  3H5Y A;  5C2C A;  4IFY A;  3DRP B;  4IOA Q;  1OIA A;  2NSB A;  1WTF A;  3FSY A;  1SVD A;  4DCO B;  3QZ7 A;  2FLL A;  1B0T A;  1BQX A;  4ID5 A;  1N36 J;  2CNL B;  1R8B A;  3ET6 A;  4IQM A;  4WBF A;  1EJ7 L;  3B78 A;  2CXE A;  1L3V A;  4CO1 A;  2Y1R I;  4RL1 A;  1WSR A;  2DVI A;  2RVJ A;  1L5U A;  4O4G A;  3AJD A;  2CQD A;  3PY8 A;  1FHT A;  5KFA A;  5B0A A;  1A0O B;  5F0U A;  4NLW A;  3D3C J;  1W2B R;  2VBW A;  3M9N B;  3TAN A;  3UNG C;  2PO4 A;  3ENW A;  4ZP8 A;  3FSI A;  4DHV A;  3CCW A;  4XAK A;  3MTJ A;  4O44 A;  2NUU G;  3T1Y F;  2DY9 A;  1FXR A;  5B08 A;  1T7P A;  3VAM A;  4OJ1 A;  1KLN A;  3PW0 A;  3KDO A;  4DS5 A;  4YR3 A;  1R8A A;  2IHR 1;  2QJ3 A;  3O8W A;  4KKO B;  5M2R A;  4LF5 J;  3LGH A;  1OSC A;  2FJE B;  4R5P A;  3F44 A;  4I2Q A;  4ZVO B;  1R0C B;  4KHP J;  1N5Y A;  2DEI A;  4GC6 A;  3M8W A;  2ZC3 A;  1EX8 A;  2YWH A;  1S12 A;  2J8S A;  4Q45 A;  3HVT A;  2JRS A;  1GX5 A;  1REG X;  5J2P B;  4K4X A;  2JEI A;  3KK3 B;  1Y7P A;  1EIY B;  2JH3 A;  1AZS A;  1JLQ A;  3D2W A;  1IBK F;  2DKO B;  2ZUA A;  1JJ2 R;  2OTL S;  3G87 A;  4L75 A;  4DR3 J;  3SCK E;  1U25 A;  3KTQ A;  2B6A B;  2NS1 B;  3QFW A;  5KT6 A;  4CIO A;  2YKN A;  1KN6 A;  2KN4 A;  4Y2K A;  1JLF B;  3PEH A;  3CCE S;  5KT5 A;  3PV8 A;  1XEZ A;  1P8G A;  4I1T A;  4CRJ A;  4Y2C A;  2ZVS A;  3GV5 B;  3B6B A;  4IG3 B;  5ETS A;  3GV8 B;  2EFV A;  1JMT A;  1B70 B;  2P9C A;  3PJX A;  1E6V B;  2V2Q A;  2HRY A;  2O67 A;  2BUN A;  3M30 B;  4ICL A;  4TY9 A;  2CQH A;  2XHC A;  5T41 A;  4N8N A;  5D3G B;  2DR7 A;  1RAO A;  2NYH A;  4F3M A;  1PIE A;  3BEG B;  2R2U A;  4CO5 A;  2H54 B;  4MFB B;  1HNX J;  2AGP A;  1U1N A;  3PR4 A;  2FY8 A;  4DR4 J;  3QGI A;  1JLB A;  1SC4 B;  3Q8V A;  4Q8F A;  1C0U B;  3ZZR A;  3PW7 A;  4LBI A;  5J2P A;  2PII A;  4FYX B;  3LQV A;  4L3N A;  5D0E A;  2UVR A;  1UVL A;  5D6G A;  1WDT A;  4OZ5 A;  5KFT A;  3TEH B;  4RW4 A;  1JLC B;  3HHE A;  2XM3 A;  1K73 T;  2HNY B;  3NLC A;  2LQB A;  2IVF B;  1U0H A;  2I5J B;  3SQO P;  5A8R B;  4CNZ A;  3UO0 A;  4NMX A;  3CJ3 A;  5FII A;  2QLB B;  4PG8 A;  2ZE2 A;  4PG4 A;  3DLH A;  2BXJ A;  2OFH X;  3M7V A;  3SDE A;  3U1L A;  3U1M A;  1Y3K A;  1VR6 A;  3JTO A;  3JSM B;  3AJ1 A;  1CQN A;  4PWW A;  3RBE A;  1UVI A;  4USW A;  3DCA A;  2F40 A;  2X51 A;  2Z2M A;  4DDF A;  3HT3 A;  3OSP A;  1VQ7 S;  2AGQ A;  2RQM A;  1R0A A;  1CJT A;  3CSK A;  3KLE B;  2LEA A;  1ARO P;  2EEY A;  2I9S A;  4KFB A;  4O0I A;  3IR6 B;  1WHV A;  4N77 A;  3THT A;  4AE5 A;  4IRK A;  3TA0 A;  4IH7 A;  3BQ2 A;  3ILJ A;  2CJQ A;  3G6V A;  3MUV P;  2HK3 A;  2ZH3 A;  1IBK J;  3KXD A;  4LBP A;  3VQT A;  3T1H J;  2KFZ A;  2VOD A;  4RLE A;  2EG2 A;  2DBB A;  5ETV A;  4DFM A;  4Y2I A;  2FJW A;  1DQ9 A;  3KJQ B;  4M94 A;  3K58 A;  2A6M A;  1C1C B;  5CD4 A;  4IO9 Q;  2E5L J;  2RB7 A;  1PYO B;  4CT8 A;  2QC3 A;  4OYI A;  4EK2 A;  1RB0 A;  4LF9 F;  1O0P A;  2JFD A;  5ETM A;  4LQ3 A;  2YNF A;  4QW9 A;  3PRV A;  5LT5 A;  4KFB B;  2VFV A;  3DU5 A;  4PYD A;  3IR7 B;  4YR2 A;  3V81 B;  1YJW S;  3VWS A;  1U45 A;  1RYR A;  1FDN A;  3GR1 A;  4NCG B;  1HNV A;  3D54 A;  5DJB A;  2FB0 A;  3Q2S C;  1SJ3 P;  4PUO A;  2F9J A;  2EBG A;  1SKU B;  3HSD A;  5C5J A;  2DO0 A;  4HDH A;  2D3U A;  2B8P A;  2BJ8 A;  1GNK A;  4M5G A;  3D28 A;  2V50 A;  4RW8 A;  4NLP A;  3TVK A;  3K5L A;  1TUG B;  2ZJP Q;  1S97 A;  2CA9 A;  2HFZ A;  2MPU A;  4RPF A;  2NLW A;  1RT1 B;  1HNZ F;  3M8R A;  4Y0F A;  1L3S A;  2VA2 A;  4W92 B;  1CJV B;  2AP6 A;  1NJI T;  3QJJ A;  1RAA B;  2BE2 A;  2HG4 A;  1CUL B;  3CNQ P;  2JWN A;  3ITH A;  2W2P P;  3QYY A;  2WOM A;  4DWI A;  1M90 T;  4B3M F;  2V5H G;  3H5S A;  2CPX A;  1RT3 A;  5KFS A;  5KFE A;  3CCM S;  3HK2 A;  1VRT A;  1FI4 A;  1R31 A;  4LSN A;  3L7P A;  4XDD A;  5AXL A;  3LWL A;  1C1C A;  1HR0 F;  4N76 A;  2BE9 B;  2EG1 A;  3M2U A;  4ZPW R;  5L38 A;  3Q8R B;  4FS1 A;  3F73 A;  1YIJ S;  3CGI A;  3V2U C;  2I2Y A;  5D8H B;  2I8E A;  1VHI A;  1T9U A;  5EX0 A;  1QSS A;  3T5H A;  5D3G A;  2VG5 B;  1S1U B;  3MM5 B;  4ZHR A;  1RJJ A;  2GIF A;  2QA4 G;  3BSO A;  4JV5 F;  4LF4 J;  7FDR A;  1N5S A;  1VLY A;  3J80 U;  1UET A;  4EU0 A;  3K0J A;  3TZX A;  2BW7 A;  1XR7 A;  3IP0 A;  4M95 A;  3P4U B;  2BBE A;  1DRZ A;  2FLP A;  2J6S A;  5AE3 A;  2R7U A;  2H4W B;  4LSN B;  1ELO A;  2IMO A;  2KT5 A;  2RF2 B;  3MPU B;  1RTI B;  3KDN A;  5LM7 E;  2E7W A;  2BMB A;  4NXN J;  3PVX A;  3K8W A;  3AJ2 A;  2RQ4 A;  4ZCL A;  4QW8 A;  4FF3 A;  1N5Q A;  3R2C J;  4CO4 A;  4KE5 A;  1FRM A;  1RT4 B;  3MCO A;  1JXV A;  4M63 A;  3IXQ A;  3EJM A;  4C8Z A;  1KLM A;  5LMU J;  1CS4 B;  1TUV A;  3A4T A;  2VPW B;  3QID A;  4RNM A;  5C24 B;  3I87 A;  2K3K A;  1CG2 A;  3AA8 A;  3CE8 A;  1QTN B;  5IFM A;  2IRU A;  4ECU A;  2VQF J;  4UOC A;  1IKY A;  4OJG A;  4ECX A;  3DLB A;  3FVY A;  3ULH A;  1W25 A;  4WFX A;  2DH8 A;  2QLX A;  2QL5 B;  1CLF A;  4J9R A;  4UST A;  1GTH A;  4RBT A;  4F67 A;  4DSI A;  1VK3 A;  2DYA A;  3J81 U;  2J9C A;  3NCR A;  2D1C A;  3BH6 B;  5LMN F;  3RB0 A;  1WSV A;  2J8A A;  1AYE A;  1VHF A;  4C8K A;  1LWX A;  2M4M A;  2VDI A;  4OI1 A;  1TKD A;  5GAD U;  2NQP A;  1HBO A;  1TVR B;  1FDB A;  2FZC B;  3DRS A;  1TL7 B;  5HMZ A;  5CAB A;  2B4U A;  5HLF B;  4DF8 A;  5F3Z A;  2DXF A;  3M05 A;  2WVB A;  6FDR A;  3K89 A;  1FNO A;  4ZN3 A;  4IG3 A;  4YHH F;  2CJA A;  3QJL A;  1N32 F;  4JI8 J;  3W63 A;  3RRH A;  2VFT A;  1WHY A;  1X4B A;  4NI2 A;  1IKX A;  3PYE A;  5HN0 A;  2K06 A;  1U24 A;  2AYG A;  3BBC A;  1T02 A;  3FQL A;  4KQZ A;  3WBZ A;  1X0P A;  3BYR A;  2PMZ D;  1RTH A;  2UV8 G;  3E8O A;  2VKZ G;  5L1J A;  2DNG A;  1QSY A;  4ECZ A;  3H98 A;  4B3T J;  1HLW A;  2F4V F;  2XLI A;  3IS9 A;  4G6V B;  2VA3 A;  1SL0 A;  1KQF B;  1VQK S;  2UUA F;  3JTN A;  1EP4 A;  3HFV A;  3V4I A;  1HWU A;  2BAB A;  2MGZ B;  4X4U A;  4WPA A;  3TA1 A;  3UD3 P;  1WG4 A;  2B9Y A;  1FX2 A;  3TAM A;  2R8G A;  2RNE A;  4K0K J;  2OPS B;  2WSF C;  4OFZ A;  4ILL A;  1SC1 B;  4KGM A;  1N34 F;  4IOB A;  2Z0G A;  5KG2 A;  1WKJ A;  3D3B J;  3BDE A;  3BKT A;  3I82 A;  5F3T A;  1N5Y B;  1FJG F;  2DR6 A;  1FFS B;  5JJB A;  1TKT B;  4LR7 A;  3SQG A;  3UCU P;  1VC6 A;  3C2P A;  3IS9 B;  4QR0 A;  2ZE2 B;  3IG1 B;  2V69 A;  2M2B A;  4OQJ A;  1S0V A;  3BR8 A;  1OY6 A;  4DSE A;  2KRR A;  1CEZ A;  4R0E A;  4OV6 A;  1X5S A;  1WAC A;  1X4D A;  1Q81 T;  2UXC J;  4ZLL A;  2DNQ A;  4HAC B;  2OML A;  4NI2 B;  4O3O A;  5DDQ C;  2UUA J;  3FRY A;  3KJV A;  3KNG A;  2W7P A;  2M7S A;  2GHP A;  3D9B A;  3L09 A;  4QYR A;  4CLT A;  1T9V A;  1S5Z A;  4B3T F;  3M8Z A;  3WIV A;  1AFI A;  1JLG A;  3GU0 A;  5K8N A;  5C24 A;  4WU2 A;  2I0X A;  1C4C A;  2RU9 A;  1HWJ A;  3EVM A;  3NG8 A;  1I3O B;  1KFS A;  2C2M B;  1MSW D;  1PAE X;  4B9M A;  1JLE A;  3LAK A;  2DGQ A;  3ZZT A;  2QO3 A;  3T5L A;  1XMO F;  3AD9 C;  1S76 D;  3QFH A;  4CLL A;  4JI8 F;  1D8Y A;  2RUG A;  3R97 A;  3NBP B;  2IBO A;  4MKV A;  4NX9 A;  4N5S A;  4ITS A;  2BE2 B;  4IR1 A;  4S0M A;  4GKJ F;  4WJB A;  3OQ2 A;  5GVQ A;  4DL2 A;  4JI6 F;  4BBY A;  3W9H A;  4C0B A;  4PXB A;  4OZJ A;  4JUZ A;  2LXU A;  1B0V A;  3AFG A;  4CLF A;  5IT4 A;  2IIH A;  4WKR A;  2WTF A;  2EVZ A;  1U1Q A;  4G3I A;  1UVN A;  2BKP A;  3FEY B;  3VCD A;  1ZOT A;  3MM8 B;  3MPV A;  1SIW B;  1WOS A;  1BLU A;  3KK3 A;  2A1B A;  5L46 A;  5EGY A;  3NL0 A;  1C0T B;  4YEA A;  4JI4 F;  5EDW A;  2PD1 A;  3ILI A;  1Q4R A;  2DIS A;  3SCL E;  4KV8 B;  1TL3 B;  4A4J A;  5KFX A;  2DGV A;  4DQQ A;  4LRD A;  5D78 A;  4J7C A;  3FCH A;  2KO1 A;  3C6U A;  5DDO C;  1CJU A;  1I6J A;  2FY1 A;  3C6T A;  3KMS A;  5EN1 A;  3MAA B;  1EB0 A;  4NLQ A;  2WRM A;  3FUY A;  2KU7 A;  1FRL A;  2RDI A;  3GJS B;  3H90 A;  4P72 A;  2CRL A;  2XO7 A;  4B9N A;  1MLA A;  1XER A;  1NUE A;  4IDK A;  4XPC A;  1NDL A;  1FNM A;  2ZD1 B;  3KLI B;  4IOC Q;  3DOM B;  4F0M A;  4L73 A;  4P9S A;  3MTK A;  5D4P A;  2MZT A;  2CPF A;  2DCL A;  1NHK L;  3PJW A;  5DQH A;  3J7Z 5;  3CD6 S;  1T05 A;  1RTJ A;  1CSJ A;  3ILO A;  3GIL A;  4NPO A;  1VRU B;  2C2D A;  2OP5 A;  5AT1 B;  5CYM A;  4EZ9 A;  3RBD A;  1WD6 A;  3I5A A;  5B09 A;  1RHJ B;  5KFZ A;  2DGU A;  4PAB A;  4DFJ A;  1TFW A;  3H7H B;  2BX6 A;  1Y9O A;  3ET6 B;  3CTR A;  1DHM A;  3ZTO A;  2FVR A;  1RWO B;  1K44 A;  4HI1 A;  3OT9 A;  2C42 A;  4NLU A;  1JX4 A;  2HVI A;  1GAO A;  3CUL A;  1U0H B;  4Z7Y A;  1VQN S;  3N9U C;  5L8R C;  2C2N A;  1RA7 A;  4K59 A;  2HBR B;  2AYE A;  1N6Q B;  2DHA A;  4B3O B;  2QL7 B;  1N0V C;  2V8V A;  3UDC A;  1X8D A;  2LA4 A;  4E2F B;  3PR5 B;  1CJU B;  2Z58 B;  2PI4 A;  4TNO A;  4TQR A;  4MKY A;  2JLE A;  2OPQ A;  3PIO Q;  3VAL A;  1QUP A;  3DLL Q;  4ZJL A;  3OXL A;  4WXO A;  3CMQ A;  1NKB A;  3IC1 A;  3J81 j;  4DQP A;  4LRA A;  2CYY A;  1DLO A;  3D5M A;  3Q8S B;  1NO8 A;  4ZP9 A;  2KXF A;  2JNJ A;  3LTO A;  4NLY A;  3OTC A;  1WEL A;  3GE9 A;  2VB6 A;  2JSX A;  1URR A;  1M5K C;  3W65 A;  4HI2 A;  2MYF A;  1FRX A;  2RDD A;  3KNA A;  4ZLN A;  3EXY A;  2VBX A;  4DV0 J;  3BGU A;  3D1Q A;  1Y5L B;  1GMV A;  2DD8 S;  4K5S A;  2V9W A;  5KT3 A;  5B0G A;  3VAI A;  3BO4 A;  4UOG A;  2R7V A;  3F41 A;  3X3U A;  4C6A A;  1ZAV A;  3UDE A;  3QRR A;  1ROF A;  3PX4 A;  3H0P A;  4YDD B;  2V4Q A;  4JI5 F;  1S79 A;  4NLO A;  4RW7 A;  5A6P A;  1YJR A;  3L3C A;  3TZY A;  3HJV A;  1AXQ A;  2R8H A;  2HHU A;  2K7K A;  2CAD A;  1H2T Z;  1S77 D;  1H6K X;  4I69 A;  2MLY A;  1QVG R;  4PRF A;  2LQ8 A;  3LAN A;  1WOO A;  4DR2 J;  3HXM A;  1C0U A;  3FZB A;  4ED5 A;  3J81 Y;  3MUR P;  3BPS P;  8AT1 B;  2EKN A;  2HZC A;  5J2M B;  3GCW P;  2GQQ A;  5D15 A;  2P9G A;  4LF6 F;  2FHO B;  4LF1 A;  3OUY B;  3PKY A;  4USK A;  1UP1 A;  3TZW A;  2XCA A;  1SJ4 P;  1RA6 A;  5HL7 Q;  3BGR A;  3T5J A;  2W25 A;  2FDN A;  4P52 A;  4DV4 F;  1YDL A;  1YQH A;  2GIR A;  1T9W A;  2XMT A;  1U1M A;  2BJ7 A;  4OLO A;  4WTY A;  3CCL S;  1RTD A;  2AQ4 A;  5L39 A;  3QGP A;  3DHX A;  5HBM A;  3SQG B;  3SI8 A;  1FE0 A;  5A76 A;  1S1T B;  3DN9 A;  2CQ0 A;  3KJN B;  4QZV B;  5B0E A;  2WVE A;  4R8U B;  2MKC A;  4RZR A;  4QYZ J;  3MUM P;  2OEK A;  4RU9 A;  5KFI A;  4WFZ A;  2VU5 A;  2ZNZ A;  3DRX A;  4OYW A;  1EHW A;  3I9V 9;  1NDK A;  3CME S;  1Y3J A;  3SFG A;  2V68 A;  2AU0 A;  4MIB A;  2QYG A;  4HAC A;  2KG0 A;  1VS3 A;  1OY9 A;  1WI6 A;  1GXT A;  4MYT A;  1S1V B;  3JAM Y;  3RAQ A;  1VQ9 S;  2CQG A;  1YVF A;  2C3P A;  3J80 Y;  2JEG A;  4IH6 A;  2MKY A;  2C28 A;  1RWK B;  4KYZ A;  3GSI A;  2MLZ A;  4AD6 A;  2VG7 A;  1GH8 A;  1SJR A;  2WK4 A;  1S9E B;  3PW2 A;  4G1P A;  2GIQ A;  1PJ6 A;  3N4W A;  1N54 B;  4NE9 C;  1FKA F;  4AL5 A;  1CC8 A;  5ETQ A;  3I6P A;  3NS5 A;  2ALZ A;  1KHW A;  3KUG A;  2RQC A;  2UU9 F;  4DV6 J;  3CC2 S;  4ZIV A;  4NCG A;  5A6W A;  1IUJ A;  1BUX A;  2PN6 A;  2WBM A;  4C8N A;  1S0M A;  4TY8 B;  4Y6I A;  2LFV A;  5FD1 A;  1IKW B;  1WC1 A;  2PEB A;  3QIP A;  3ZZ0 A;  3RRG A;  3G6X A;  3DLE A;  3G4S S;  4Q8E A;  3EDR B;  3SV3 A;  2ZH7 A;  1S9G A;  3JXO A;  4DLE A;  1SKS A;  1YJ7 A;  3K59 A;  3OJS A;  4B3R J;  4DR3 F;  4EYH B;  3M8P B;  2YNH A;  1VBY A;  3OL7 A;  3FDS A;  3J7A 1;  1Q95 G;  2HQD A;  5E2Q A;  3CCU S;  1HYS A;  1T8E A;  1M5V C;  3EGZ A;  5T7L B;  4B9U A;  5HRO A;  4DV4 J;  4ZLP A;  2EFQ A;  1U1K A;  3VAJ A;  1RWU A;  1LW2 B;  4U7U D;  3P8B B;  3T6J A;  3C6U B;  2X1F A;  2ZVI A;  1FRI A;  2KYZ A;  1FXD A;  1SL2 A;  4FYV B;  5HLF A;  2HBQ B;  3IAM 9;  1IBL J;  1SKR A;  4X65 F;  4YDX A;  4RBU A;  2ZJR Q;  4BC7 A;  1G6B A;  3C15 B;  3T1H F;  3I0R A;  1SKW A;  3LA0 A;  1ACM B;  3GIM A;  1S6Q A;  2IA0 A;  4KO0 A;  4LF4 F;  4FF4 A;  3IWL A;  4KRW A;  4PXE A;  3ZTP A;  1RUS A;  2R2R A;  3QGG A;  1QAX A;  2QMU B;  3CVK A;  3CJK A;  2YKO A;  4X84 A;  4DS4 A;  3T1Y J;  1HKA A;  2RE1 A;  1REV A;  3L9Z A;  1WC4 A;  3R3T A;  3R7N B;  3CC7 S;  1WNE A;  4OYP A;  2OH2 A;  2ALY B;  2W9C B;  4ID5 B;  3EZO A;  3TAP A;  3S6E A;  4JOU A;  1RKJ A;  4WZQ A;  4BWJ A;  4LSL A;  4K0K F;  1HA1 A;  1T9Y A;  3OBI A;  2MHN A;  5EUH A;  2OPR A;  3HX9 A;  4OI6 A;  2VJV A;  2J0X A;  2HVE A;  2MZJ A;  1KKH A;  2XMV A;  3ZZU A;  4KO0 B;  4X64 F;  3VTI A;  4A8K A;  2Y8W A;  2XYH B;  3D1H A;  1M1H A;  1RK8 A;  2J6T A;  3BH7 B;  1VLO A;  4P7V A;  3G96 A;  1H7W A;  4HEA 9;  2MQM A;  3K8V A;  1N36 F;  2OTJ S;  2DIT A;  2IRY A;  2Z2Z A;  1SUQ A;  3MMC A;  2GVZ A;  3RGI A;  4X4O A;  2VG7 B;  3CO9 A;  5E3P A;  3UR3 C;  3D68 A;  3HD1 A;  1WC6 A;  4M5K A;  1SXL A;  3O2I A;  5D0R A;  3CCV S;  5KFR A;  1CVJ A;  4QIG A;  2GA7 A;  4XDC A;  1RAB B;  1XN9 A;  4CYU B;  2UXB F;  4NLS A;  3SCI E;  3WHI A;  4A8O A;  4ZCM A;  2MB0 B;  1F1B B;  3PJ9 A;  2W4P A;  5FDL B;  5BJR A;  4MJK A;  5D4N A;  4ZVU B;  1R89 A;  4DPW A;  3ZFV A;  1Q8L A;  3HVA A;  3NY0 A;  3IR5 B;  1TU0 B;  4DUY J;  1TL7 A;  4USH A;  2MDA A;  4I68 A;  3SDE B;  4M5D A;  1U48 A;  1WC3 A;  2EKY A;  5G4D A;  2JEF A;  5E3C A;  3DFE A;  2C2E A;  1RHM B;  3G86 A;  2UUT A;  1SJ1 A;  1YX2 A;  4KHR A;  2NXN A;  5DET A;  5LSR A;  4UOH A;  4RW7 B;  2CJ9 A;  2MEW A;  1U2R A;  2JC0 A;  1IBL F;  4IO1 A;  1ZM4 A;  3GWC A;  4F7V A;  5B0D A;  2DXE A;  2N3O A;  2CKW A;  3B4M A;  3ZZP A;  4X4R A;  3B82 A;  2CDQ A;  2DNP A;  3MMA B;  1NND A;  2EWH A;  3ICL A;  2XB2 D;  1KVK A;  2LQJ A;  2ZBC A;  1VRQ C;  4FP9 A;  2WW4 A;  4N56 A;  4LIW A;  2FD2 A;  3ZTQ A;  3BQ1 A;  5ETL A;  3OXF A;  3JTP A;  3TW0 A;  1X4A A;  4KGX B;  2X3D A;  1R8P A;  5CHC B;  1S48 A;  1RT6 B;  4IR9 A;  3QT8 A;  5HAT A;  3CJ2 A;  1SJQ A;  2R7Q A;  2HQG A;  2N82 B;  2BJE A;  1R8C A;  2B4P A;  2QIF A;  2ZH1 A;  1BWV A;  5E33 A;  4CLY A;  2NYI A;  4FF1 A;  1U8S A;  2QGF B;  3HHL A;  4BCA A;  3MUT P;  2Z8Q A;  3UD4 P;  2QSW A;  2Y3Y A;  3EPI A;  3AOC A;  3DOK A;  3WZ0 A;  1U1R A;  2D69 A;  4F0K A;  3R7B B;  2RH3 A;  4KH1 B;  2FUG 9;  3E51 A;  2IM3 A;  5J2Q B;  3GYG A;  3DNC A;  4NYO A;  5CAA A;  1R43 A;  3VAH A;  1OJ4 A;  2XQC A;  4DUY F;  5F8J A;  2F3J A;  3MFH A;  4RW4 B;  5CH7 B;  4O3Q A;  4USM A;  4I2P B;  4DG1 A;  3Q22 A;  2C3Y A;  2GFF A;  3QGH A;  5JVH Q;  5B0C A;  1TMJ A;  1KRP A;  1DTQ A;  2YPZ A;  5AXN A;  4QPT A;  4A8W A;  4DN9 A;  5HMX A;  2LLZ A;  4U9R A;  5GMK a;  1RT3 B;  1WG1 A;  4UZC A;  1XMO J;  2VDH A;  1Q16 B;  2RD5 C;  3K7R A;  1LW0 B;  1X0F A;  2DNZ A;  2VKR A;  1PG5 B;  1V5V A;  2BW2 A;  2XYG B;  2YNG A;  2KG1 A;  4RW9 A;  4F04 B;  3KHG A;  4LIR A;  4DR6 J;  2P2C B;  1FJ7 A;  3M1V A;  3DI6 A;  3IWX A;  4RU2 A;  1X5O A;  4PPD A;  2VIC A;  2HPU A;  4U7U K;  2CQ1 A;  3G6E S;  2QEX S;  2IBK A;  4RKU C;  3VR1 A;  2Q66 A;  2A10 A;  2UUC F;  3PNI A;  4ZPA A;  2QE5 A;  3C16 A;  1PJ5 A;  2ATC B;  2KXH A;  2E1M C;  5CYJ A;  3GFZ A;  3KKF A;  2GGP B;  1LFW A;  3OV7 A;  1BY9 A;  2DO4 A;  3FJ2 A;  4P74 A;  3PDN A;  5LJ5 Y;  2JDJ A;  3BF4 A;  1W7W A;  5G0R B;  2NR0 A;  2Q1L A;  2M8H A;  3JAM U;  2QMX A;  2FVC A;  4R0J A;  1KHV A;  3MEC A;  4QBU A;  1B64 A;  1WWH A;  1B99 A;  1OPZ A;  3KJF B;  3LPY A;  4P10 A;  2Q43 A;  3H2L A;  5EWG A;  3HZG A;  2UXD F;  2JFK A;  3I5C A;  4IRD A;  2RRN A;  1AZS B;  1JLQ B;  2HQC A;  2J5A A;  2VH7 A;  2BRK A;  3N5B A;  1YGY A;  2YX1 A;  4FKX A;  2HIY A;  5DO2 A;  5J1N A;  3ZZZ A;  2ZOF A;  4K4Z A;  4F0H A;  3BBB A;  2MKK A;  3MED A;  2KM8 C;  4EBE A;  1LWE B;  5HQL A;  5KTQ A;  2CVE A;  4CTA B;  2E29 A;  2GAH C;  4J9K A;  2DY1 A;  2J9D E;  4ZKA A;  1X9M A;  3DRY A;  1RTD B;  2W9C A;  5AXM A;  1RWW B;  3GIR A;  3HVR A;  3PKM A;  3IG1 A;  2E5J A;  1QAI A;  2CWK A;  3TUZ C;  2N3L A;  1R6V A;  4J90 A;  2DT9 A;  2HLT A;  3DGP A;  3CD0 A;  3I0S A;  3J7Y I;  2E44 A;  1GMU A;  3NWR A;  4CLP A;  3A8E A;  5KFD A;  4QJV A;  2FJD B;  3PEJ A;  1JLC A;  3QRP A;  5D77 A;  4ANC A;  1DLO B;  1HPZ B;  2IVM A;  1XTZ A;  4MKB A;  1TL3 A;  1H73 A;  4J5O A;  1QUV A;  4ZVS B;  1F9E B;  4DJB A;  4F8R A;  3NWG A;  3J7A N;  4URG A;  1TFY A;  5F8N A;  3W2W A;  3TX0 A;  3KLF B;  1PIL A;  2PEH A;  3HI9 A;  1DBD A;  1YJT A;  2CWX A;  1PJ7 A;  3PO5 A;  3A8J A;  5K9F A;  3TUP A;  3T9Z A;  5L1K A;  1UWB B;  1VQO S;  4A47 A;  1UJ4 A;  2KT3 A;  2QZ8 A;  2Y9H A;  2AJQ A;  2QG9 B;  4KGV B;  4NZ6 A;  5EHH A;  4DF4 A;  2M8D B;  4BDP A;  2FLO A;  4TYB A;  1WOP A;  1S1U A;  3MM5 A;  4WFY A;  4ZVE A;  4EUV A;  4DX7 A;  1QTM A;  3MI7 X;  1TZ0 A;  3RBZ A;  4DU8 A;  4JB8 B;  3MD1 A;  4P2X A;  1ZAX A;  3SBM A;  2CQC A;  2BJ3 A;  1HHS A;  2CNO B;  1HNX F;  4RX6 A;  1JQG A;  2AF6 A;  1JNR B;  3DLE B;  3FMB A;  1JKH A;  1T95 A;  3US5 A;  2HZA A;  1MG7 A;  2CZ4 A;  5BYR A;  3UCZ P;  3RB6 A;  2B8Q A;  2JL9 A;  3FNN A;  1EAR A;  2VQE J;  5HO4 A;  5ETR A;  1J5O A;  2HND B;  2JC1 A;  2K7J A;  2ZIT A;  3GFH A;  3MOJ B;  4M5M A;  3KG4 A;  2G0I A;  4ILR A;  2PMH A;  2ZDP A;  2ILY A;  4YFU A;  1VQ5 S;  2WCX A;  3CED A;  4E0D A;  4PWD A;  1MN7 A;  1BHN A;  3BGL A;  3OD2 A;  4YR0 A;  3MM6 B;  1GQE A;  1B4S A;  3V6D A;  3IWN C;  4DV3 J;  2I38 A;  1D9A A;  1RWM B;  2HS0 A;  1FEE A;  3AQP A;  1FEH A;  2OSQ A;  3GMG A;  1VGY A;  3OXG A;  4I6A A;  4ZPB A;  3H40 A;  5LSO A;  4IKA A;  2P9E A;  4LVO P;  3TR5 A;  1VBX A;  4LF7 F;  4RW8 B;  2XY6 A;  1Q7L B;  3Q8P B;  2BQ3 A;  4L72 B;  1VQ8 S;  4R25 A;  3QNW B;  2V4R A;  1DQ8 A;  2CQB A;  3EVO A;  3D0G E;  2LDY A;  1TK0 A;  1LK5 A;  1YJV A;  1KS2 A;  3M1V B;  4JI2 J;  4R5P B;  7AT1 B;  1KWM A;  2U2F A;  1W26 A;  4ZLJ A;  2HVH A;  3TZZ A;  3LUY A;  2FHM A;  1NK0 A;  3S8S A;  3JYT A;  4PR6 A;  4CTA A;  1OPI A;  2CAJ A;  1HBO B;  1TVR A;  1TKZ B;  3QQC D;  4EO6 A;  4YY3 J;  3D0H E;  4LF6 J;  4WP8 A;  4ZCI A;  1RAI B;  1HWL A;  1Q8B A;  3NAH A;  2NSC A;  1EKR A;  2OPP B;  3NCQ A;  4DFK A;  1S1W A;  4HHU A;  3I55 S;  3H42 A;  2L48 A;  3ILL A;  3MEC B;  3D67 A;  4LF5 F;  1UFL A;  4U8V A;  4OI0 A;  1N4L A;  2ACY A;  1IR2 A;  2BM0 A;  2M70 A; 
#chains in the Genus database with same CATH homology
 4K0K J;  2ZM6 J;  3D3C J;  5IT9 U;  4X65 J;  3T1Y J;  1XNQ J;  3D3B J;  3IMQ J;  1I94 J;  4V1A k;  4JI5 J;  4DV1 J;  1IBM J;  4DV0 J;  4B3S J;  4JI3 J;  2MQ8 A;  4LFC J;  1N34 J;  3JAM U;  2UUC J;  4DV2 J;  4B3M J;  4NEY A;  4JI1 J;  4LF5 J;  2UXC J;  4GKK J;  2UUA J;  2F4V J;  2UUB J;  4KHP J;  4X64 J;  4DR2 J;  4LFB J;  2KVQ E;  4NEZ A;  4DR5 J;  1N33 J;  4LF8 J;  4YHH J;  1N32 J;  2KL8 A;  5AJ3 J;  4DR7 J;  5A2Q U;  4DR3 J;  3J7A N;  4LF7 J;  4LF4 J;  3J80 U;  4DUY J;  2HHH J;  5BR8 J;  4DV5 J;  4DUZ J;  4DR1 J;  4X66 J;  4LF9 J;  5LM7 E;  4NXN J;  1HNW J;  2MEW A;  4LFA J;  4RJV A;  3W1Y C;  3R2C J;  1XMQ J;  1HNX J;  5LMU J;  4JI0 J;  4DR4 J;  2UXB J;  4KYZ A;  4JYA J;  2VQE J;  2VQF J;  3R2D J;  4JV5 J;  3OTO J;  4JI7 J;  2UXD J;  5LMN J;  5IWA J;  4DV7 J;  1J5E J;  4DV6 J;  1HR0 J;  3J81 U;  4DV3 J;  1HNZ J;  4JI4 J;  4B3R J;  4KY3 A;  2MTL A;  2UU9 J;  4PWW A;  5FLX U;  4OX9 J;  4JI2 J;  4JI8 J;  1XNR J;  4X62 J;  4GKJ J;  4JI6 J;  4DV4 J;  1IBK J;  4YY3 J;  3T1H J;  4B3T J;  4LF6 J;  1XMO J;  1FJG J;  4AQY J;  1N36 J;  1IBL J;  4DR6 J;  2E5L J;  4HHU A;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...