2UXDJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 5
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxdJ00
5FLXU 3J80U 1N34J 4B3SJ 4NEYA 4LFAJ 4YY3J 4KHPJ 4K0KJ 4DV7J 5LMNJ 5BR8J 3JAMU 4JI1J 1N36J 4LF7J 4DR5J 4DV3J 4LFCJ 3D3CJ 2UXBJ 5A2QU 5AJ3J 1N33J 1N32J 4B3RJ 4DV0J 4X65J 1XNRJ 4JI3J 2HHHJ 1XNQJ 4LF5J 4DR6J 2UU9J 4LF8J 4JI7J 3T1YJ 4B3MJ 4JI5J 2F4VJ 5LMUJ 3D3BJ 2E5LJ 4LF6J 1HNWJ 4LFBJ 1XMQJ 4DUZJ 2MQ8A 4X66J 5IWAJ 4JI4J 4DV1J 1I94J 4JYAJ 4B3TJ 2VQFJ 1J5EJ 3R2CJ 1XMOJ 1HNZJ 4DR4J 1FJGJ 3T1HJ 2MEWA 4V1Ak 1HR0J 2UUBJ 4OX9J 4JI8J 2UXCJ 2KL8A 3OTOJ 3J7AN 2UUCJ 5IT9U 4GKJJ 4DR1J 4DV6J 4GKKJ 4NXMJ 4KYZA 4JV5J 2UUAJ 4DR2J 4NXNJ 4YHHJ 2ZM6J 4HHUA 1IBKJ 4LF9J 4KY3A 4JI6J 4DV5J 4X62J 4JI0J 4DR7J 4DV4J 4AQYJ 3J81U 2KVQE 1IBLJ 4DR3J 4DUYJ 2MTLA 4JI2J 1HNXJ 4DV2J 2VQEJ 3IMQJ 4NEZA 3W1YC 4RJVA 4LF4J 4X64J 5LM7E 2UXDJ 3R2DJ 1IBMJ 4PWWA
chains in the Genus database with same CATH superfamily
1N34J 2PI5A 1FERA 2DHSA 1FFSB 1MLAA 3AB2B 1RE1B 3MM6B 2DNRA 1B0TA 3SZ2A 4UY8T 1QAJA 3RUBL 1N36F 1H72C 2W9BB 1XR5A 1JLAA 2FYXA 1SL2A 1C0TB 2R7OA 1SIWB 3FCHA 5AXMA 3J7YI 1LW0B 3AB4B 2DEJA 3M4XA 1X5TA 2Y1LB 3NBPB 3THVA 3HVWA 1JLGB 5IXUA 4KFBB 1CJKB 1SV5B 2AZ3A 3P4UB 2E5IA 3AA8A 3MM5B 3MM9A 1DQAA 3LWMA 3IAM9 2CFXA 4KPCA 3BSCA 4FF1A 2FY1A 5C2CA 3WHIA 3MMAA 3R5GA 1S1VA 3HHKA 1H2TZ 3I55S 3ZXWA 2HQDA 3QZ8A 4DL6A 3V4IB 4M8LA 2QJ3A 5ETMA 2RKIA 2WHOA 3U1MA 1LWFA 1UCNA 1HPZB 3V81A 5JMNA 2RDIA 2VG7B 4FXWA 3EXYA 3VHQA 3ZFVA 3AQOA 2HZVA 1RWVB 1O51A 1HW8A 1T3OA 3H90A 4CTAA 2F4VJ 1WHYA 1LWFB 2QRRA 4DSIA 3ZC4A 2Y9HA 4R5PA 4LFBJ 4LVNP 4CH1A 1XR7A 1XMQJ 4G3IA 4JYAF 1O5JA 5FIIA 5SZTA 4X66J 1Q7YT 2XS5A 1NJWA 1HNWF 2HBRB 2QL5B 1EQ0A 2E5LF 4DZDA 4W4MA 3H5YA 3D54A 1NJIT 4Q7AA 2CG4A 2MLZA 2Z58B 3G2XA 2OEJA 3MMAB 4UOCA 3K7RA 2VG5A 5DJBA 3R7NB 2AGOA 5A0YA 3TQEA 5KFKA 3PW5A 2RU9A 2KRRA 4IDKB 1Z2ZA 2B8PA 3ZTRA 2MB0B 1X0PA 1WOPA 3G82A 5JXSA 4IRKA 2R7QA 1QM9A 1V5IB 2LQBA 3H5SA 3I87A 3QGIA 1WSRA 4NLTA 4OZ2A 5CYJA 4ED0A 4ELUA 2OTJS 2MYFA 4ID5A 3LGMA 2YKAA 2GHPA 1ZETA 4NRTA 3D7SB 3GE9A 1YITS 1KN6A 4YMEA 2QIFA 2BKPA 3NG8A 3R97A 1WHXA 4L3KA 4C3KA 3AXMA 4DWIA 2UXCJ 1KOOA 2ZE2B 2UVVA 4DSJA 2ZH7A 3NCRA 4RW7A 2GX8A 4FDFA 4G1PA 1IUJA 3GJSB 2HHTA 2C3UA 2BJ9A 1OPIA 2ZH5A 3R5CA 3WDOA 1OJ4A 3V6DA 3AJDA 5H9EJ 4UZCA 3JSBA 3QWPA 1SL0A 1ACMB 1DARA 2LECA 1WHVA 3QFHA 3KUGA 2Y1JA 2I0XA 5B09A 4LREA 5D4PA 4TQSA 1CSJA 1URRA 2CPYA 1FJEB 4FYXB 2A3JA 4X62J 2ZWPA 4UT4A 3Q2SC 4Y2CA 2RU3A 3Q8PB 2J6TA 2VA2A 1Q82T 3OBIA 3PEHA 2WVCA 5IM0A 4NYPA 3DLHA 1YJ7A 1RA7A 3SCIE 1AFJA 2B56A 2IIHA 2EPIA 3LANA 2GIQA 2VQEF 2W1BA 5KT6A 3KLEB 3GV7B 2RS2A 4OI4A 4IFYB 2VBWA 5DQGA 1NNDA 3C8YA 1MSWD 1WF0A 1HD1A 4IH5A 3RBZA 1UAWA 2E9RX 4YHHF 1T05B 3LP0B 3PJWA 3K59A 5DGAA 1RAJA 3UI3A 1RI7A 3MCSA 1NUEA 3TEHB 2AGQA 1WELA 4H4KC 3VAJA 3GG1A 2GQCA 1YJVA 2FVSA 1Z2LA 4I56A 4Y3CA 2ZJRQ 3UPFA 2J6UA 3NMAA 4V19J 4ES1A 3MR3A 1U1QA 4F36A 1Q81T 3LAMA 1QE1A 4KKOA 1PKUA 3GFXA 5F8JA 1RT2A 3GR1A 2KI2A 1R89A 1DTQA 5FLXU 3J80U 4OZJA 5ETLA 4HDHA 3M2UA 2ILYA 1ZS6A 4JOUA 4F3OA 4DQRA 1UPMB 2EKYA 2HBZB 4P74A 3C6UA 2C2DA 3CWJA 3IM8A 1Q78A 1IKYA 5AXNA 1FT8A 2X3DA 2J5AA 3DDNA 2XCAA 3DXBA 2BKOA 2MKSA 3OSPA 3CC7S 3EVOA 2OPSB 3FCWA 3D1OA 2UVUA 5L39A 2B43A 2NUUG 2OJ3A 3M8QB 1TZ0A 2DH7A 3OV7A 3M1VA 1S57A 1XQIA 3TUZC 3TAPA 3DOKA 4CNZA 2B9WA 2HRYA 3MI7X 1U48A 2NPIA 1HWKA 1GTEA 3D5MA 5ETPA 4TY8B 8RUCA 3HULA 2CWXA 4I6AA 3M32A 4KE5A 2AJ4A 2D9OA 2Q6BA 1WUUA 4ZPWR 3O1LA 5D78A 1SC1B 4M5GA 1IKVA 2ZH2A 3R1LA 1RHJB 5KFVA 5GADU 2R8JA 5JVHQ 3LGNA 3I5BA 4L72B 4ITSA 2JX2A 2MPUA 3BEGB 4KHRA 4TQRA 3N0VA 1TKDA 2ZBCA 1QVGR 1M90T 2AYBA 1T03A 2DRDA 4UZBA 4EGLA 2KJVA 4KGVB 2VB6A 4ECXA 1RUSA 4DQPA 1V3ZA 3ZTOA 2ZC3A 1BLUA 2FLPA 4BWMA 2XLIA 2RHSB 5ETSA 1UJ5A 3M9NB 4IOAQ 4I6WA 2QA2A 2FLOA 1RU2A 2X3GA 3U02A 1CC7A 1FRJA 1YBUA 2DNKA 1O8BA 3ISNC 3KXDA 2M9KA 5AJ3F 3KK2A 3VZHA 4DUZJ 1S0VA 1HNIA 1SH2A 2WZ1A 1BE4A 3A8IA 5KG7A 1BXNA 3S01A 2AJFE 1H0HB 4RR5A 3SSSA 1CS4B 3NOGA 3WZ0A 2JFDA 2W2NP 3DLEA 3G6ES 2R7XA 1DQ8A 2HVZA 3CMES 3Q8SB 2DXDA 2FJEB 1Q8IA 4RNMA 3CJ0A 3MCNA 3NCPA 4FXVA 4YQWA 3OVSA 3RB6A 1X4HA 3O5TB 3IG1A 3R7SB 2WOMA 4WBFA 2MHEA 2F7VA 2IM1A 3CDAA 4V1Ak 4F25A 3PV8A 2JLFA 1VK8A 2HHHF 3M30A 4C3LA 2OMOA 2LMIA 5BYSA 4IQMA 4AFFA 3JSYA 4QIVA 3NGTA 3V4MA 3PRBA 3CCWA 4Q8EA 4CT9A 2B6AB 2LA4A 2Z8QA 1AUDA 2KTQA 5EWGA 1RT1B 4KV8A 4IH6A 1WF2A 4W98A 4KRWA 5B0FA 2UXCF 4O4GA 4RW9B 4D3GA 8ATCB 4C8OA 3B6BA 2E29A 2N3OA 4M5JA 1K1QA 1RAGB 3NS5A 4MMOA 3IFEA 5IQQA 5GADI 2R7UA 3OHAA 2C3OA 3DM2A 4YN3B 3UVJB 3T1HF 4PG6A 4DLGA 2CQCA 3A8JA 2D41A 2ZHAA 2EC2A 2FGCA 2JLGA 2VQFF 2WW8A 4M5KA 3T1AA 4LR8A 3H2LA 1TKTA 1VQMS 2E1MC 4KO0B 1VRTA 3OR2A 3QO9A 3WC0A 5J2MB 2YX1A 2Q66A 2D1CA 4GC6A 2P6TA 4USVA 4FXDA 4OZ5A 2MTLA 4JI2J 1O6XA 2DISA 5K8MA 1RTHA 1KLNA 2HRTA 1WC5A 3I56S 2UUCF 1VI7A 2DGXA 1EAYC 2AW0A 2W2MP 3QBCA 1RBAA 2FHMA 2OFHX 2B5JB 4AE5A 2R7TA 3IBWA 2CADA 2MGZB 1FXDA 1N54B 1VK3A 5FJ4A 2QGFB 4DQIA 3DOLB 1SH3A 2QX0A 3L7OA 4MK8A 4USJC 4C11A 1KQSR 4JI3F 3QRRA 1OSCA 2GIFA 2N4CA 2MHNA 1RQ0A 2KYZA 4GVBA 3JSMB 1QY7A 3MFIA 2R7SA 2CQHA 2DPJA 1C1BB 1ZPVA 3EGNA 1HW9A 4ZOSA 1E6YA 2QSFA 4M5DA 4RBVA 4MK9A 4NLXA 4ZPCA 4BC9A 4X62F 2ZHBA 4NCBA 4RWXA 4HACB 1S77D 4LFAJ 4KHPJ 3EGWB 1LW2B 4UTGA 5KFZA 1ROFA 5DM7Q 2V63A 4WF9Q 2P8IA 3HHLD 2BANB 3O44A 2NYHA 5DZ7A 4A48A 3MMCB 5CHCB 1TFWA 1TQLA 4CO2A 1CULA 5H1SV 2D69A 1KNZA 5KG0A 3QJPA 3PIOQ 2NYIA 4LBIA 2VJVA 4RW4B 4ZITA 2ZZMA 2EVZA 2BDPA 1UFWA 3NS7B 3R6GB 4MFBB 4NE9C 4P73A 5KT2A 3IWNC 2CJYB 2C2RA 1CLFA 5F3TA 4DQSA 4XPEA 1S97A 1IBCB 4F4KA 1S1UA 2C3YA 1ZM4A 2DNHA 1UVKA 3I0RB 4L3NA 4TU9A 3NGDA 3HP6A 1IKXA 1OYDA 3FQKA 2DKOB 1X4BA 4LRCA 4XDCA 3UWTA 2M70A 2LQ9A 2E1CA 1OY9A 3ZTQA 1HA1A 3KK3B 3T5JA 1OO0B 2R2TA 4ZA1A 3S7RA 4NL5A 4DR6F 1KWMA 1HMVB 1UTAA 2ZH1A 3HFKA 2VZ9A 4DFKA 3BN7A 1X4GA 3EZUA 3KHRA 1RT7A 4EFAC 3KYLA 4O3PA 1S49A 1KQKA 1U1KA 2JL9A 4DDFA 4NCGB 4ZHRA 2E7WA 2O66A 2ZFHA 3S6EA 2W9CB 1YIJS 1SKWA 3EMTA 2VV5A 3T1YJ 1G2EA 2HZCA 5LMUJ 2VA3A 3DLGB 2MZ1A 2C2EA 5D15A 4UOGA 2DNPA 2M7SA 3PW7A 2X1AA 1N5YB 3G6VA 4FPRA 2MQPA 3VAIA 4Q0BB 1UL3A 5E3AA 2K06A 1RTZA 2VPYB 1A9NB 4H4MB 1X4DA 3RRGA 2CIMA 4U96A 4NCGA 2YKMA 2UXBF 1HQ2A 1UJ4A 1FJCA 1W26A 1RT7B 1VISA 2GCFA 2I5JA 1NH7A 4R0EA 4WP9A 1HBUA 1REVB 4DN9A 4DPYA 1QJHA 2Y8YA 2VUGA 1FJGJ 4DCOB 3T1HJ 2FHKA 1DBDA 3GSIA 1VQLS 1H73A 2AEJA 3QRPA 1CG2A 2AYMA 3MECA 3UCZP 2QEXS 3DOMA 1SXLA 1JJCB 1RAEB 1HL6A 3Q8YA 4CP5A 1GT8A 2PT0A 1U25A 4YS2A 4ERDA 5F3ZA 4IKAA 2MQOA 3R3TA 5DLFA 1JNRB 1I51B 3TQ1A 5IV3A 5KFWA 3SFGA 5CCMA 3PRVA 3MUTP 4HT5A 3ZNJ1 2HNYA 4DX5A 3PIPQ 1D9FA 2HEKA 4DV1F 2YXLA 1M1KT 2A2DA 2F5GA 5HROB 2ZUAA 2MZTA 4HACA 2B9EA 4JI0J 1HWUA 3BO4A 1FCAA 2O01C 4ELTA 3ILLA 1X7VA 2H4WB 1E6YB 2DNQA 1LV5A 1SKSA 5I3QA 4KAIA 4TNOA 1UW4A 1XEZA 2JNJA 3M2VA 4URSA 3RRHA 1VIXA 3SV4A 4H4MA 4GVBB 4HHHA 2IVMA 1XTZA 2HVHA 2EFGA 3DOLA 5HQMA 1SL1A 4QWDA 1R27B 1PAUB 2BUNA 2MGZA 3C66A 3Q2TC 4PRFA 3CULA 3KNGA 1YGYA 2Z56B 3QAEA 4WYLA 5DDQC 4Q45A 4ICLA 2FGOA 4NMLA 2UV8G 3K0JA 1KVJA 3QRQA 4DX6A 4ZHRB 4O3NA 3KMQA 2CNKB 2JEFA 2CJQA 4P2SA 3ADAC 4QIGA 2J8AA 1VOMA 2V8GA 3A8EA 1TU0B 4B02A 2ZWOA 4WXOA 2BJ1A 2DTJA 1VQPS 3SSRA 1HMVA 4KC5A 1B99A 1T95A 1PG5B 3FQLA 1UJ6A 4ANDA 2D7SA 4NA2A 3AAWB 3AD9C 2PMZD 3PW4A 3TI0A 3OR1A 1U26A 4MKAA 2M8DB 2DGUA 3KK3A 2ZH4A 3DLBA 1RTJA 1NDPA 1JLQA 2VD3A 2BXJA 3TYTA 3O2IA 4ZVEA 1OMSA 1U0HA 2FJAB 2QA1A 3EJMA 4LFAF 2LDYA 1RAOA 2DGSA 1NSAA 4NLPA 1I3OB 2GA7A 1N36J 3PNIA 4K2XA 1WG4A 4O4GB 4JI2F 1SH0A 1RYSA 1AXQA 4NOHA 2AT1B 2M4MA 4N77A 4U8YA 3GR0A 5KFBA 1N48A 1FDAA 3MWBA 4P2MA 4MKVA 4NCAA 4LFBF 4LFCF 1H2VZ 1HD0A 2KHDA 5J2QB 1LKZA 2M3DA 2W4DA 3BBBA 2PE8A 1J5OA 1VLYA 2KKHA 2UP1A 4L6V3 2IFXA 4B3RJ 4DS5A 2EG2A 3P49B 3ICLA 4XAKA 4KBIA 4JI3J 3CJRA 3ZZTA 1RWNB 3P6YC 3M8WA 3MR7A 3B54A 1KVIA 2XYHB 3K58A 3PFEA 5DG7A 2QTWA 3MMJA 3VF0B 2ROGA 4NLWA 5A8WB 4ECRA 2MDAA 2IRUA 2DR8A 2EFVA 3MPWA 4I2QB 5F0UA 2RRAA 3RBDA 2DY9A 3KK1B 3W2VB 2CPZA 2MZSA 4GVLA 5A76A 3KJVA 1RYRA 1RDRA 2ZJPQ 3BO3A 2UXDF 1WC4A 1JXVA 2LEAA 4M1KA 1I94J 2Q3PA 2FVQA 2V9KA 2BACA 4KO0A 5HJXA 2VQFJ 3SQOP 1FKPB 1FE4A 4EUVA 2EG1A 2NPFA 4N5SA 2YNGB 1C1CB 3LOUA 3QNWB 4NPOA 4I68A 3FNNA 5M2RA 4A8OA 2QL9B 2R9LA 5C5JA 2W7OA 5HQLA 1IQZA 4OZ0A 1RKJA 2FJVA 4DV6F 1NK7A 2JSXA 4LR7A 3TVYA 4F4YA 4WZMA 2OSRA 2AX0A 2GGPB 3W9JA 1CJTA 2E7VA 4AXIA 3IRXB 2RQMA 1X9MA 1UVJA 3KNAA 4LIRA 2HYIB 1J27A 4PYDA 1ZOTA 1UEVA 3H20A 2HLTA 2K7JA 1JLEB 3RAXA 2HS4A 4DR2J 1KTQA 3TZWA 2ILZA 4WE1B 1C2PA 1VJQA 1IBKJ 1BQXA 3W3SA 4UF4A 3I9V9 4DV4F 4LRDA 3OVBA 3BBFA 3MF5A 4FZVA 1DTQB 4Y2AA 1RT2B 2YX4A 2EFOA 2MZRA 4JI6F 2KRBA 4OI2A 3ENWA 4K4TA 3MR5A 4IH7A 3CD5A 3DCAA 2Q6CA 1CS4A 3D6FB 1R8AA 3NOCA 1SJ1A 4QW8A 1RT3B 3D6TB 3DLJA 1UETA 4DX7A 4LVOP 1D1UA 4PAAA 3S1TA 3C19A 1RKIA 2H4YB 2KT2A 3QYYA 2AQ4A 3JTPA 4IG3A 4DL3A 4WP8A 3RRKA 2JEJA 2JDJA 4BS2A 3MEGA 5KFLA 5KFCA 3H40A 4X64J 3HVAA 2E66A 2B51A 4IYQA 4NYZA 4HH0A 1KR4A 3I0SB 1WI6A 3KHLA 1UA1A 1F3FA 4QYZJ 1VQYA 2WTFA 3UCGA 5I3UB 3HMJG 4PCQA 5CXTA 1F0XA 3UFCX 1U2CA 4DV0F 1S1XB 2HFOA 2VDHA 3CIZA 2ZOMA 3GMGA 3M32B 3FBCA 5A8RA 4CLZA 3VGVA 1MWYA 2ZOGA 3V6JA 1FO1A 8AT1B 4LF7J 3HSGA 2ZH8A 2L41A 3DU5A 3ITHB 4OYMA 2CQ2A 3QMQA 3GIRA 3RAMA 2YNFA 2XGQA 3KLVA 1UZDA 2UXBJ 5IOLA 4AD6A 1N32F 3OL8A 1NU4A 4HH1A 3CNQP 1S0MA 3C6UB 2OLWA 3TA1A 2F9DA 1Y3JA 1GTHA 3M2UB 2QL7B 5E3RA 2DBBA 5I3PA 4ID5B 5CA5A 3LUYA 1M0SA 1QE1B 2RMLA 1Q0NA 4N76A 2HHHJ 4LSLA 1XNQJ 4DOZA 1TL7B 2A6OA 2QYCA 1DRZA 5E33A 1HARA 4E98A 2OGUA 2HFVA 2FJWA 1H7XA 2HQ3A 1C4CA 3QT5A 3GJRB 4WK1A 4BCAA 3EICA 2J9DA 2BE2B 4GO5X 1RHRB 1RTJB 1L3TA 1T05A 2CAJA 5AT1B 3Q89A 2BRKA 3TEGA 3JXOA 4CLKA 1SC6A 5J2PB 4NXNF 3D0GE 2V4JB 5ETQA 3PYGA 1PYOB 4DV1J 3GFZA 5HI7A 2FLLA 1AT1B 2HS0A 1JXEA 2QE5A 2VPXB 3KDOA 3LTOA 1XMQF 4IR9A 4JYAJ 3V2UC 2VF3A 1NK4A 3KTQA 4IO1A 3G86A 4M63A 3SQGB 5IM0B 2ZD1B 2CPDA 2H54B 1M5KC 3PYFA 3R2CJ 1F5BA 3N6NA 2XC9A 2I1RA 1QUVA 3SXLA 2ZC4A 1VLOA 3V4IA 4OJ3A 3L09A 1HR0J 2UUBJ 3M8PB 1X5OA 5G0RA 1APSA 4O23A 2VL1A 1RBLA 2DH9A 3I4PA 2J9DE 2D74B 2GO8A 5KFAA 1NDLA 1HWLA 5L1LA 1VS3A 2UUCJ 1HBNB 1FK9B 1IWAA 3G9CA 3DLKA 2CUYA 4JI4F 2V4QA 2V2QA 3UDVA 3MM9B 4DUTA 3DXSX 5EN1A 2XTJP 4U9RA 1NB2A 4C97A 2MZQA 1NSQA 3D1QA 3OUYA 3FVYA 3CCMS 4LR9A 1VQNS 4L76A 3OJSA 3AOCA 2ZM6J 2CYYA 3NCQA 2W9BA 3MAHA 2HNYB 5F8IA 3JYTB 2AMCB 2OKQA 1CBKA 3QZ7A 4OX8A 3S8SA 3O3LA 4W90B 2B3TB 3M2RA 1B0PA 4AQYJ 4O3SA 4KH0B 1D09B 2AV5A 5ETTA 1HBNA 4I1TA 2C1EB 3TANA 4LRAA 1FTRA 1RWKB 4OHWA 3MAAB 5EX3A 3LA0A 1R8BA 1S4EA 2YH0A 1NHKL 4JP8A 5F8MA 1WC1A 1GAOA 2CVIA 3TOQA 4DN0A 2K3IA 1S0NA 3RBEA 1F9FA 4A8MP 2MSTA 1REVA 2QZ8A 5CCLA 2XMWA 1YRUA 3SQGA 4I64A 2CNOB 2LP4A 4Y2IA 3V5RA 4MYUA 3ENQA 1JJ2R 3QIPA 2QN6B 2HQFA 5K8OA 1HPZA 3V81B 2VG6B 4URGA 4OV1A 2A18A 4L74A 2V4JA 1VQ5S 3DRSA 3I9ZA 3CPWR 4Q0BA 3POTA 1T9WA 3CCSS 4F2RA 1N33F 4PABA 4CLYA 1TKXB 3BO2A 1DZ5A 3CD0A 3IBFB 1B64A 1Y9OA 1KP6A 1EP4B 1P1TA 1TV6B 4C2MA 2P9GA 3CJ3A 1WEXA 2DPIA 1CQMA 4I69A 3THPA 3NNCA 3T6JA 1CPZA 1Y10A 3SDEB 2W9CA 4K4VA 3FMBA 4FP9A 5BR8J 2W2PP 2IJNA 3HHDA 4Q2MA 1S6QA 5KG6A 2BYCA 4QIFA 1PILA 3CMAS 2G0IA 3A3NB 1GK8A 2HG4A 3VZIA 5KFJA 4RU2A 4ANCA 4LUBA 5C42A 2W7PA 5GVQA 3RBXA 4A8QA 1NAQA 4Z37A 5HL7Q 2VONA 1SJQA 3KLFB 2L9DA 3ILJA 3CCRS 1C4AA 3MD3A 3LPEA 3ZZOA 1AB8A 3ZO7A 2YNFB 2XZWA 3FJ2A 5KG4A 4ATNA 4X64F 4BDPA 4H4OA 2PA8D 2V2KA 1A0OB 3TNVA 5H9EK 1KKHA 1TUWA 2XHWA 2IM0A 3J81j 1ZH5A 1HQEB 2HK2A 4PXBA 3KMSA 4MFBA 1Y3KA 2ZBPA 4G6VB 2UU9J 3PKMA 3SEOA 1WC6A 3DRXA 3CCTA 3H25A 2ZNZA 1CULB 3IWLA 5ETVA 3VAHA 1U8SA 2NSCA 4CI0B 5G4DA 2NUHA 5EX0A 1MNEA 2HNDA 1R0AA 1D9AA 5HSPA 5KFEA 5C24B 3OLAA 4ZVUB 2CPXA 1J2VA 2HBYB 3Q8VA 2FJXA 1Y0HA 1CVJA 2ABYA 4R8UA 1NH8A 3G8QA 4ZPDA 4JI4J 2KM8C 1HKAA 3SCJE 4C8MA 4RPFA 3NGRA 3P5TL 3F56A 3JSMA 2YH1A 1N6QA 4YR2A 4WP3A 5K14B 1I6JA 4OL8A 1CJVA 5L1JA 1NK6A 1YRTA 2CQ3A 4DG1A 1XMOJ 3MPYA 4HTIA 2ZM6F 4OYAA 2IMOA 1RCOB 2J0QD 4DR4J 4TYAA 4CYUB 1ZBTA 2LQ5A 3A8KA 2ZHOA 3DGPB 1DLOB 2YNHB 4Q5VA 3MFHA 3AXKA 3CE8A 3H2VE 1TL1B 4RO0A 3SI8A 1Q95G 5CD4A 4U7UD 1FJGF 5F0WA 5H9FJ 3OTOJ 2G4BA 1LWCA 4ZLPA 5FD1A 2NXUA 4U67Q 3E01A 3QO9B 2IVFB 1EETB 4FS2A 1TKTB 4USHA 2BW7A 4CO5A 1T9UA 5KFDA 2C22A 2ATLA 2I38A 1NMEB 1EX8A 2RB7A 1WHWA 3LQVA 4HLBA 2MKYA 2HQGA 4HR2A 4OZLA 1YG0A 1RLDA 4ZVQB 4NXNJ 3GP9A 5L1IA 1U1LA 1I5OB 3EGZA 4LF9J 1TMJA 2MQMA 1S9FA 4FS1A 3KLIB 4DU8A 1MROB 3T9NA 4WKRA 2DB1A 5EWFA 1CJTB 1UKUA 2V68A 2ZUGA 3L7PA 3MOZA 2W4CA 1FI4A 4P7VA 3PKYA 3GV8B 1L5UA 2NLWA 2OD4A 2HURA 3FEXB 3BQ2A 4DV2F 2DHXA 2V8DA 5A6PA 2LDIA 1FRIA 2D3ZA 4USKA 4ZVHA 3UD5A 2HQCA 4RNFA 2ADCA 1DJ0A 2HWHA 2KT3A 4WIQA 2KFZA 2P6SA 2VQEJ 1C1CA 5IFMA 1MMDA 4WXWA 5DZ6A 3EPIA 3LP1A 2DY1A 3K5PA 4J90A 4F0KA 4Z2XA 3NLCA 3PX6A 2V94A 4RNHA 2I2YA 2VFVA 3NAIA 4NMXA 1KFSA 4ZPVR 5KTQA 2XLKA 3R8YA 3QT7A 3R7BB 4OIXA 2JVOA 4PPDA 2J0XA 3TA0A 4B3RF 1TUGB 2XO6A 4EU0A 3CD7A 5BJRA 5HMXA 4CDIA 3R1HA 1TK5A 3HSDA 5T7LA 1XJWB 3NNHA 4I2QA 4ED8A 4DMZA 2J9CA 2JRSA 4X65F 4A8XA 3TAMA 5I42B 3CDWA 5E7OB 3EM1A 1JXLA 1VBKA 2PEBA 1WWHA 2ZKTA 4OHXA 2XY7A 2DCLA 4TY9A 2RDDA 2LQ8A 1ZPWX 2VPZB 2EI5A 4IOBA 3KLGA 3H42A 2R7VA 3HVTB 1KQGB 4UUWA 1IWGA 2OIHA 3DRPB 3H0PA 2QMUB 2JC0A 2VFRA 2XWXA 1KTVA 1WKLA 4X4TA 3GCWP 4FYWB 4KR0B 4M5LA 2QA4S 2M2BA 2OPQB 1P6TA 2WBMA 4ZVFA 2N3LA 2ALYB 5D3GA 2MJUA 3KJQB 5J1EA 4CM2A 2CZ4A 5IWAF 2R7RA 4H4KA 4KB7A 4DV0J 5J2NB 2PI4A 3HJFA 1DFDA 1XERA 1UZHA 1UFKA 3SIPB 2M8HA 1CEZA 1WDDA 4FYVB 2IYGA 3GJQB 1CQNA 3HFVA 1IM6A 1G7CB 2BV3A 3D9BA 2GJ2A 4OZNA 2BR0A 4DR6J 2LEBA 2EK1A 5KFGA 4CLWA 4DL5A 2RE1A 4ZVGA 1T7PA 1TL3A 1RP5A 2L9WA 1LK5A 2OELA 2VBYA 3D6HB 4UQTA 3ZZ0A 3OW2R 3ZZUA 1HYSA 2AZ1A 5LXRA 1NZ8A 4LF6J 1PJ5A 2DXEA 2DNNA 4ZP9A 2C2ZB 4L73A 2OPRA 1HNWJ 2DGQA 5L8RC 4ECYA 3GU0A 1U0SA 1Q5YA 3HFZB 4AT1B 2V34A 3BREA 4PG5A 4E2FB 1EETA 4CLPA 5GAGI 3RU0A 3ZTPA 3C6TB 3BKUA 1S12A 1SB6A 3O8WA 5B0CA 2WW4A 4Y2KA 1U6FA 2UVRA 1GQEA 4PWDB 4CLUA 2YNIA 4LBPA 3UN5A 2GVZB 3C2PA 4LSNB 1N56A 3FUYA 3PX4A 4B3OA 1RT6A 4DF8A 4WWSA 2K8GA 3IR7B 2LVWA 3K2YA 3VGSA 3ETMA 3OXGA 4B9SA 4DQQA 3CJQA 4EZ9A 1XNRF 2D9PA 2XGPA 2KXNB 1F5AA 2VFTA 2EBGA 1BD6A 1WG1A 4ZVTB 4OX9J 2KG1A 4MIWA 2RS8A 2ZDPA 2BJDA 1S9GA 2HMIB 2PO4A 1UVLA 2HFNA 3B4MA 5U47A 2XCPA 4X4QA 3HJVA 5KFIA 4OYZA 4EI2A 3PM9A 4N7TA 1JKHB 2IC3B 4TKTA 1FNMA 3OTEA 1S6UA 2ACYA 2IJFA 4P52A 1PIEA 3FRYA 3R27A 2U1AA 1W25A 6FDRA 4EO8A 3K5NA 3R5BA 4KPYA 5A8KB 4J9SA 2QLWA 4F7VA 3D66A 2H65B 3CJ8A 4QIEA 4ZLNA 1F2GA 1PBAA 1E6VB 3UN3A 3PHTA 5DETA 1S1WB 2DNZA 2E1PA 2C3MA 3PEJA 3JAMY 5K20B 3HXMA 2NCKL 3FZBA 3IR5B 4P6QA 4ZJQA 1N5SA 1NZAA 4DV4J 3NNAA 4NZ6A 5IC6B 3DOMB 3HZGA 4RW7B 4ZVSB 1O0PA 2XULA 4EEYA 2IAJB 1I1GA 3KUHA 2XMUA 3ZNUA 2QC3A 2WAQD 2HHUA 1Q8BA 5HN0A 3LH2S 3GJTB 2G13A 2F1FA 3RG6A 1LQ9A 4J37A 1EJ7L 1LEOA 3LP2B 1KFDA 2GHVC 2MLYA 3BKFA 3WIUA 5KOXA 2BQ3A 3G82B 2BQRA 3W1YC 4NA1A 5HO4A 4QWAA 2DCUB 3AOBA 2Z30B 2DITA 2GMHA 4P2FA 5A0YB 1ZTTA 2BZ2A 3CCZA 1FDNA 3BYRA 3QATA 4BLGA 3MZIA 2LKZA 3CUNA 2E9ZA 1BWEA 1FE0A 4MKBA 4F0HA 2CG8A 1WI8A 1HIYA 2E5GA 3CCJS 1BUXA 1Q8LA 3BN4A 3NAHA 2HHVA 2AJQA 4ED2A 1PYSB 3DLGA 3POTB 4P71A 4CCHA 4R5PB 3FC9A 1NB7A 3DU6A 1XWLA 4K59A 2DR9A 4ILRA 2E1AA 3NY0A 4Z7CA 3NP5A 2CRLA 1FDDA 5DRKA 1YJTA 1PC5A 3K5MA 5LSLA 4QBUA 1KS2A 1U1MA 1D9DA 3IGNA 4FVMA 1P27B 2BJ3A 3R5DA 1PCAA 2G2YA 1X4AA 2QLFB 3UDLA 1PSDA 5DQHA 4C0HA 2D3O1 3T19A 5GAHI 3IS9B 2IA6A 4OX7A 2Y0BB 1YBAA 1QD1A 4OYXA 1WG5A 3CCUS 4MAKA 1F1BB 1XMOF 2QLBB 5DS7A 1TK8A 1N32J 1M1HA 4HL9A 4JUZA 1FVQA 2PEHA 1VDHA 5LSOA 4F8RA 3IAS9 4OYOA 4JI7F 3MM5A 1FWPA 5CYQB 1ZAWA 2N82B 4GKJJ 2K3KA 4O3OA 5HMWA 3JYTA 2K2PA 2DO0A 4CO4A 2BANA 1DAXA 1C0TA 2AKWB 3R6LB 3BGFA 1JLAB 4IG0B 4QWCA 1FHTA 3MM8A 4UUXA 3OUYB 3G6YA 3K57A 2HIYA 4PUOA 2Y0SD 3TX0A 4A8YA 4EBCA 2BM0A 3I32A 3MM6A 4G1QB 1SC3B 3TA2A 4CQ1A 3NL0A 1R0CB 2DHHA 1S5ZA 1TL4A 2CQGA 2HHXA 3AQPA 2B0GA 3G6XA 1S7HA 3AODA 2O1PA 2FPHX 4C11B 4C98A 5HMYA 1SJRA 4KTQA 1QAYA 4PKDB 2XBPA 3J80Y 4J9QA 1J5EJ 4WFAQ 3M8PA 2B5JA 1BWVA 3HLUA 3I5AA 2FZGB 1P9QC 5G0RB 3L95X 1PC4A 3NGSA 4OHZA 2UU9F 1IVZA 4F67A 3EUNA 5EWEA 1T9YA 3ONQA 5D0EA 2HFUA 1BGXT 5HBMB 3UD3P 4QZVB 1R31A 4NLRA 5BYQA 4FBUA 3X1LB 1DY3A 1VRTB 3OR2B 4FKYA 4FYYB 1Q53A 3C15B 5GAHU 3PRDA 2GHWA 4RUCA 3MDFA 7AT1B 3HSZA 3AH6A 3E8OA 4OQJA 1MWZA 5BYRA 5DG8A 3VAFA 4DV6J 1Q79A 3C14B 2QA4G 2ASLA 3W5ZA 5LOQA 1HQUA 3B4DA 2YWWA 1R6YA 1U49A 6AT1B 2HKEA 1N52B 3QWUA 4DPXA 1VC0A 3DRYA 3OXLA 4ECZA 3MM7A 3NWRA 3JAMU 4RNOA 2JWNA 2JEIA 4X4NA 1KQFB 4ZDNA 3DRRB 3FFIB 1X9WA 1LWEA 4LSLB 4KV8B 1R7IA 5IT0A 1RA6A 4FNHA 2JEGA 4IOCQ 1VHFA 5D6GA 4B9LA 2F9JA 2YX7A 5J1EB 2EK6A 1IBLJ 2RVJA 4RW6B 1YRXA 5BR8F 3OXFA 2JH3A 4KH1B 1UFLA 4MKYA 4DR7F 2LYVA 1MN7A 2WBRA 5AE1A 3DHWC 3BF4A 4J9OA 5HVFA 2GW8A 4WFZA 2C2KB 3IG1B 3HVTA 2XLJA 2I9SA 4DCPB 2Q1LA 3ITHA 4FF2A 3HX9A 4F02A 4K5RA 1GX6A 2ATCB 2VBXA 3QT6A 3T41A 1HNXF 1EKRA 1NHVA 1KD1T 4RJVA 4LF4J 3AD7C 4CLFA 2WVFA 3K5LA 4DSLA 3W2WB 3I6PA 3VQSA 1N5QA 3CDUA 5A8RB 2FVCA 2BOAA 3A12A 3MMBA 5CD4H 5T7LB 3CIMA 2G0JA 2M0GB 4PXDA 3AFGA 3TUJC 4DPTA 4TU7A 4J9PA 2CQPA 1DURA 2WSEC 4LJMA 3M6XA 4B3SJ 2Z2YB 5DM6Q 1Z1ZA 1M5VC 3B78A 2YWGA 3BQ1A 1SKUB 2HWIA 1WEYA 2KJWA 3FGVA 5LMNJ 2D3OR 1N34F 2OEMA 2OP5A 3QSIA 4EO6A 2HPUA 1YKWA 4CLSA 2NXEA 5KT7A 2CNLB 1XBWA 3FBBA 4DV3J 2HGNA 4ZLJA 2AU0A 1S76D 1ZM9A 4JBCA 1IKVB 3BDEA 5DDRC 2F3JA 4N56A 2DR5A 2C3PA 3MMBB 2V8HA 1N0VC 1RT3A 5KFXA 2CDRB 2M5YA 4PZVA 1N33J 2AX1A 4Y2MA 5D77A 4FN5A 2RT3A 2CPIA 1KLMA 3SMZA 4ECTA 1DTTA 3RB3A 3FCVA 3W65A 3EX7B 1N8RT 1RTDB 1TL5A 4FVCA 2C2MB 2MY7A 1RHKB 2RF2A 1YJRA 1RWWB 3N5FA 4S0MA 3HPOA 2RUSA 3KJNB 2OPSA 3OQ2A 5KFPA 1SCJB 1RZMA 2CJAA 4X4PA 2J0WA 3SSQA 1S9EB 3MCOA 4ZIVA 2HRUA 1TTHB 3W8GA 4JI7J 3W7BA 5EDWA 4B3MJ 1U2RA 3OPKA 4DFJA 1PO6A 4OI3A 2L08A 4JI5J 4M94A 2PMWA 4K2JA 2HBQB 2W8KA 4B9TA 2GNKA 3D0HE 3E01B 1KLMB 3FEYB 5IWAJ 1LWEB 4C8KA 1W7WA 3F44A 2ZVIA 3VTIA 3DRRA 2DJWA 3FFIA 3QGHA 5THWA 2RQ4A 1HFEL 3UW1A 1JNZB 4DU7A 4ED3A 4B9NA 3D28A 3MM7B 1U1PA 2PGCA 2YNHA 4TYBA 2OAUA 2HHSA 1QSLA 1P8GA 2MQNA 4QPTA 4B3TF 3HK2A 3VGUA 2F63A 4RL1A 3I4HX 3CDEA 2C2NA 2YNGA 3C14A 4EYIB 1CJVB 1EQMA 1ZA1B 2XM3A 4HYKA 2H5JB 5F9NA 3KLEA 4USIA 2GMLA 4WU2A 1N6QB 1WC3A 4QYRA 3K8VA 1VQ9S 4DR1F 3G87A 1RCXB 1H38A 4XPCA 4J91A 2QV6A 1K44A 3GCXP 4OHVA 2BJ8A 3BM7A 3HT0A 1XC9A 3KK1A 4ZP7A 2YVSA 1FVSA 3D0IE 1SUQB 2MXYA 2BABA 3OL7A 4TXSA 4AUKA 4ES3A 3CJKB 1KVKA 5HLFB 3VR1A 3VALA 4NA3A 4OI1A 2MKIA 3FSYA 3W2WA 3BDPA 2VASA 5LL6d 3UNYA 1HBOA 1F9EB 2XHCA 4CO1A 4DL2A 1QTNB 2V50A 3PW0A 1RWOB 3KHGA 3GSDA 2GJFA 1KOHA 3BKTA 3GYXB 3IXQA 2OTLS 4J7CA 4LF9F 3SCKE 4KHPF 1R8PA 5AE3A 2OPPB 1C0UB 1NLKL 1QAXA 1F9HA 2V5HG 2BE7D 2F40A 2ZE2A 3NGKA 4DL0C 4QOTA 4DR3J 4ZVPB 1FWKA 5B0BA 3MM8B 2VKZG 2D3UA 1SQFA 2OUGA 2MLXA 1GH8A 5DLGA 1KEKA 3P8BB 3OSNA 3HKZD 3WX8A 3PYEA 1S6QB 2F65A 5LMNF 4DV2J 1H98A 1M5HA 1FX4A 3H8YA 3U7JA 2EEYA 3HDSA 2VFUA 4NEZA 3HHEA 3SDEA 3MURP 2DRAA 3ILOA 4FNIA 3WQPA 2BOPA 3VAKA 2XY5A 3F0NA 1L3KA 2F8EX 1RWXB 2W2OP 1RWUA 1EP4A 1WC0A 3GLJA 3M7VA 5E3CA 1IBMF 1T94A 4N41A 1BC6A 2O3DA 1S7IA 2DNGA 3GWCA 4WFXA 2I6WA 4BC7A 2RILA 3IS9A 3KG1A 2EC0A 1JIHA 2B4VA 1YDLA 1YVFA 4WPAA 2NS1B 2SXLA 2AJ2A 2QG9B 5K5MA 1T3NA 2OI2A 2V69A 3QGGA 1TFYA 4QIWD 4DV7J 2VG7A 1LWXA 1FD8A 4Y34A 4WCEQ 3OT9A 2KO1A 2AJ1A 2V67A 3FEZA 1KSPA 3DLLQ 3RW7A 2FHOB 2CKWA 1NSPA 3CDBA 2OHDA 2FVRA 1OY6A 4LFCJ 3B82A 3K5OA 1S99A 3GFHA 1ZA2B 4DEZA 3W61A 3MAAA 4QR0A 5RUBA 4Y0FA 1Z4UA 2JVRA 2DNOA 4D3HA 2JHEA 2FC8A 3ZZZA 3BYPA 5CABA 2J0SD 2NZCA 4XIUA 2HHWA 1JQGA 2GVDA 3EWGA 4PG4A 2IYIA 2HAFA 1QUPA 4XTTA 4X65J 2CQ4A 3BGRB 4BWJA 1YJNS 1XNRJ 2WVEA 5LXYA 4A8SA 1LXNA 5IC4B 4G1QA 5K8NA 1G6BA 1Q7LB 4YFUA 4YB7A 4ECUA 1L3VA 3TUPA 4LF8F 4LF5J 1RHQB 5LJ3Y 1K9MT 4PUOB 2AJ0A 4PYAA 1Q16B 3TJAA 1XIQA 2IMWP 3M05A 3HVRA 2UV8A 3IBCB 2HIQA 3DHXA 4Q43A 3D3BJ 1R43A 4PXEA 5HANA 1L3UA 5T41A 1WOSA 2MKCA 2HNZA 3BPDA 2POKA 3UQSA 4LRBA 1FK9A 1FWLA 1U2FA 2WB4A 1AYEA 3QFWA 4J5OA 3NS6A 1BQNB 3PHEA 5KFOA 1Y5LB 1VR6A 4TN2A 7FD1A 3HCXA 1YHQS 2J6SA 4QU6A 4HVZA 1L3SA 2YWHA 4HT7A 3M6WA 1YZ6A 2LU2A 2C42A 1FFGB 2HFZA 3WBZA 1YBTA 1MU2A 2RJZA 1JJ4A 1VQ8S 4NLDA 4DPUA 2P5VA 1X9SA 2XSJA 5F9LA 1TVRB 3I96A 1EARA 3MUVP 4DV5F 2JZ5A 2XNRA 1OY8A 2A0FB 2AF6A 2BJEA 3AT1B 4QJVA 4TLRA 3W9IA 1Q8KA 4HEA9 1REGX 1WF1A 1V3SA 1D3WA 1U8WA 1X8DA 1N5YA 4G1IA 2PDAA 2QSWA 2PSZA 2KVIA 4I6YA 4DR1J 1X5PA 2COLA 3GIMA 3QGPA 2CQBA 3UE2A 5HMZA 3BZQA 4KYZA 3W66A 4C48A 3Q0AA 3CVKA 2WONA 2HMIA 3PO5A 4LF4F 3K17A 2X7IA 4IR1A 4LSNA 1HHSA 3WIVA 4DFMA 4F4XA 2YQ0A 3RW6A 2WK4A 4NZ0A 3GQCA 3MUMP 2FB0A 2EWHA 3WC2A 1IR0A 1GEHA 4KY3A 1WJ9A 4Y00A 1Q86T 2R8HA 3LP2A 3RR8A 4QYZK 2LLZA 5CYMA 2EFNA 1PJ7A 1F2HA 1HWIA 2KVQE 3GB0A 3KG4A 1X31C 4K7QA 2HHPA 3BGLA 4A8KA 1IN0A 4NLGA 4DUYJ 5B0GA 3A3PB 2J76E 4OLOA 3MR2A 1HYSB 1KBRA 4OJGA 3LWLA 1LXJA 2CPHA 3CSKA 3P5BP 4B9VA 1TL3B 1U09A 2OFGX 3A4TA 5A2QY 4EBDA 1RISA 3ENVA 4P72A 2ROEA 4ZIWA 1RHUB 2JOQA 3Q8QB 2N4DA 3BSAA 2A1BA 1K1SA 5KG1A 1ELOA 3UR3C 2VODA 2ZEJA 2Z4PA 5A8KA 2R2SA 5LM7E 5JVGQ 5D3GB 5HATA 1S1XA 2F4FA 3T9ZA 5HP1B 2OPQA 3LALA 2GMJA 4LT6A 4M5NA 4OI6A 5AXLA 5KOWA 1ZYQA 2J7KA 4ANEA 1WSVA 4IFVA 1NJZA 1W2IA 1FNXH 4MK7A 3M8ZA 3MPUB 5KT4A 2XZDB 4CLLA 2KG0A 3EZ5A 1JX4A 1UVNA 1HNVB 2DNLA 1GX5A 3F41A 4GRSA 5F8HA 5KG5A 2XMAA 3KLHA 2PMHA 2CXEA 3DMJB 5D8HB 3MPDA 4ETZA 2W01A 4B9MA 4PQUA 1FEHA 1FRXA 1T9VA 2GAHC 2R3VA 2VKRA 3DC2A 4I0WA 4P75A 4IG3B 3ET6A 4UOFA 1YSJA 5B0AA 3KJFB 3UNGC 2AYEA 3TARA 4JV2A 3AA9A 1NCLA 3W63A 1RT6B 4F3QA 1NHUA 3I31A 2HZAA 4NLVA 5IZHA 3PW2A 1FKOA 5A2QU 3RR7A 2ALZA 3CEDA 4PWDA 2ZZTA 4XDDA 4YB5A 4YUDA 2IVYA 3C6TA 2Z57B 2RUGA 3T5KA 2B7BB 4LF1A 1YI2S 4I67A 4E8UA 4J9MA 1JLFA 4KJIA 1VQSA 1AFIA 1LFPA 5AE2A 3BB5A 1TR0A 1RSCA 2GQQA 4N8OA 4Q2LA 5J1PA 1EIYB 2CPFA 2F4VF 2GFFA 2IDLA 2QYGA 3LAKA 1VC5A 2N7CA 4DLEA 3OFFA 5F8NA 3Q83A 2BMBA 3OHBA 4JI1F 3SCLE 1V9OA 2QO3A 1RT1A 3OL6A 2GGPA 3QIDA 2G1DA 4IQXA 1MROA 3QT8A 5T14A 1QVFR 2B6AA 1H6KX 2IA0A 3QPIA 3ETOA 4DXLA 3IP0A 2HGMA 2E44A 3R5AA 4WJBA 1ULRA 1WORA 4KGZB 2V6AA 5JJBA 2EBEA 3U1LA 3ZZRA 4CNYA 4EMDA 3PX0A 1S6PB 2EFPA 3MGJA 2WOMB 3E3XA 3DKDA 2XEXA 1HNZJ 2DGTA 3N6LA 3JTOA 3CJTA 2MEWA 4C7QA 2RQCA 3KOAA 2BVZA 4O3QA 2DNMA 2W8LA 1LWCB 2LEPA 2GC8A 2DIUA 2W7AA 4GMKA 4DHVA 2KHCA 1VYAA 2PA3A 3IA0A 1FKOB 3HI9A 2C2OB 3DYAA 4J9RA 5C25B 5IT9U 2XMKA 2LCWA 2MMYA 4Q8FA 4CYUA 1VFJA 4F4AA 3EVMA 4UQGA 2KU7A 4ETXA 5L1KA 2KN4A 1RJJA 2ASYA 3VAMA 5A8WA 3OFHA 2W24A 2BBEA 4X66F 4DG1B 3OJUA 5B7WA 3O6QA 1SJ4P 2XI2A 2IHR1 3M8SA 1WKKA 1H3DA 2XMJA 3DMJA 4A4JA 1DQ9A 3KLHB 1VQ6S 4A47A 1T03B 2VPWB 2DVIA 4B3SF 1YJWS 1WTFA 1NEEA 3KKFA 2X1FA 4IFVB 1OPZA 4O44A 4IO9Q 4ZK7M 4DSKA 3A3OB 3HZEA 3DDKA 4WYWA 1R0AB 3GIJA 1JLCB 4P10A 2QFIA 1XK8A 5J2QA 5HP1A 4ZCKA 3BGUA 1HWJA 4NXMF 5AXKA 5B0EA 4DV3F 2NZ4A 2KXFA 2ROPA 1WEZA 5GAGU 3DOKB 3MCMA 1QTMA 2DGVA 2V8PA 3MAQA 3F73A 2ASJA 3M8QA 2VC0A 3PTWA 3UO0A 5DDOC 3IMQJ 1Y5NB 1GNKA 1SQGA 3PCOB 2GAGC 3SYZA 4C8ZA 1U0HB 5DO2A 3GILA 2CPJA 3MEDA 2IY5B 2LFVA 2M88A 5D4LA 4X2BA 3CCVS 3DN9A 2DT9A 3SV3A 3KLFA 4AXJA 2UXDJ 1AW0A 3M9OB 4CH7A 1NK0A 1D8ZA 3EGVA 1NPPA 1JLFB 1ZM2A 2XYGB 3ULHA 3ZTSA 2YWKA 2UZAA 2CNNB 4TVAB 1ZTWA 2G9OA 4ZPBA 1VBZA 2GZOA 3PYDA 1QSYA 2YKPA 3K8WA 3THTA 4RLEA 4B3MF 5D4NA 4JI5F 4K0KJ 5D4OA 3R9LA 5KG3A 4C8LA 4OLPA 2ZH6A 1KRPA 1ZAXA 1NPKA 4OV6A 3FDSA 1DLOA 5E41A 3BJYA 4DR5J 2A6MA 4V19X 3LP0A 2RD5C 2J9EA 4E0DA 1VCTA 3TUIC 2RQKA 4RKUC 1RWMB 4Y65A 3HHLA 1VMBA 3BQ0A 2A10A 2RSQA 4J9KA 4R0JA 5B0DA 4DCJB 4CZCA 3VCDA 3M2VB 3FBEA 1KONA 3L9ZA 4OJHA 1VHIA 2V2ZA 3JQKA 1JMTA 1FF2A 1TVRA 3T6BA 5B08A 3JQMA 2LA6A 3ILIA 5K9FA 2PIIA 2JJ4D 4B08A 2CZ9A 3MOJB 4UOHA 1IR1A 3Q86A 4U7UK 3X3UA 4I7FA 5GMDA 3E2EA 4BHQA 3CD6S 2HHQA 5H9FK 2YBVA 1WNEA 2V9WA 3DI6B 1IR2A 2GJIA 3VWSA 1FX2A 4ZN3A 1I94F 3M2RB 1RAAB 5ITHA 2HNZB 4TU8A 2GO9A 2IRYA 3MECB 4P7TA 2CJ9A 2DEIA 2CZVC 2PN6A 3AD8C 4LRFA 3OL9A 2FLNA 1D8YA 2N7YA 3R5JB 4USTA 2XB2D 2GS8A 4F3MA 1CJUB 5E3QA 1B70B 2DH8A 2R2RA 2HVIA 5CYMB 4CIOA 2DGOA 2L48A 3W5XA 2I5JB 3BR9A 3VGTA 4U6PA 1NKEA 4DR3F 1XN9A 3D2WA 2J7WA 3PG9A 5GMEA 4EBEA 3W8PA 3HHNB 1NK5A 4IDKA 2UVWA 1TELA 3GIKA 3HD1A 1ZZFA 2GVDB 4O3RA 2DR7A 4ILLA 4QR2A 2FJDB 2ZITA 9ATCB 2WONB 2BA9A 3BV8A 3G8SA 3E51A 4CT8A 1P1LA 4K4XA 1S48A 1VBYA 3C3LA 1VIOA 3J7YU 4NXMJ 3KWMA 4FPIA 5HVHA 2GIRA 3DRSB 2Z2LA 1IQTA 5J1NA 3CT9A 4DSFA 2VG6A 2ZD1A 1HI1A 3N5BA 4CTAB 3TZXA 1NKBA 4QU7A 4JV5J 3QIPB 2ZKUA 1SJFA 4USWA 1NK9A 2O5DA 4C8YA 3D4JA 2V4RA 1R3NA 4FKXA 1VQOS 3ZZYA 2X1BA 2CJBA 3D6MB 4ER8A 3HSJA 3TVKA 1SJ3P 1HI8A 1K73T 2KFNA 1XMBA 3AJ2A 1S10A 4KHMA 2BE2A 2IPOB 2YKQA 1IKXB 4LIWA 2BQUA 2YPYA 4NYOA 4X4RA 3TAQA 4B9UA 4IRDA 2P9EA 4ZCLA 3JTNA 3RYLA 3OTDA 3C46A 2H48B 4ZS6A 3HHLC 3TX8A 4ED6A 2Z2ZA 2HFSA 4RW4A 3IC1A 4JV0A 2JC1A 4WKYA 1JLGA 1QLNA 3NMRA 4K50A 3NBPA 2NQPA 2DO4A 3MMCA 4HHJA 3V6HA 1QAIA 3FKBA 4YR0A 4QWEA 2EW9A 2IRXA 3FK4A 3J81Y 1MG7A 4WZQA 1AUSL 4X4SA 2AP6A 4NRUA 4U8VA 5L9XA 1FFWB 1IBMJ 4OZ3A 4PWWA 2KT5A 4PG8A 4ILMA 2XO7A 3DLKB 1R8CA 1TAUA 1S1TA 4CM0A 3DI6A 4O0IA 3CCLS 3T3FA 1OQ6A 2VJUA 5LJ5Y 3J7Z5 4JI1J 4C6AA 1RXOB 1RT4A 1OYEA 1RAFB 1MMLA 1SUQA 1U7LA 2P9CA 3H59A 5M2UA 4F4WA 4OYIA 1RTHB 3LF0A 4ZLLA 3BS9A 3N79A 3MXHP 1T9XA 3FMWA 3PJ9A 3DFEA 1MN9A 1T0TV 2ADBA 4EZ6A 1JK9B 3AHPA 3I0SA 2LU1A 3TRGA 2XG8A 4YY3F 3MEGB 5J2PA 3HHLB 5HJYA 2FTRA 1RB0A 4RW8B 2HLUA 4MTPA 1M5PC 2R8KA 2XI3A 4YEAA 4DX8H 5M2PA 2DIVA 1TKZB 1MMNA 4C9DA 1WKJA 4PG7A 2NSBA 3LPYA 4OJ1A 2ZJQQ 2FZKB 2LXUA 4A8FA 2B9XA 1UW9A 1KHVA 4ZCMA 1S59A 5CZXA 2YTCA 4RU9A 4F26A 1TL7A 3M8YA 4ELVA 1IJFB 1QDUB 4Y6IA 1ICEB 3HF5A 4K4YA 3T1YF 3TW0A 3FSIA 2E5LJ 2Y8WA 1YZ7A 3UDEA 3Q8UA 4A8WA 3OTCA 4ZVRB 2KM8B 2ZVSA 2VC1A 3CJSA 3LGHA 2CQ0A 3G8TA 2MJNA 3M30B 4ZP8A 1U47A 2FUG9 1HI0P 4K4SA 2AIRB 1B7FA 2GV1A 1H2UX 4WE1A 2FJBB 4ENOA 4OMFG 2OPPA 3VVUA 3IRWP 3BBCA 4DF4A 1JLEA 5CQGA 2AD9A 4M5IA 7FDRA 1A7GE 4FYDA 2Q79A 2APOA 2RF2B 1NK8A 4K5SA 4KIAA 1NRKA 2V8VA 4J9VA 1DTTB 3K89A 4NX9A 4WFBQ 4YOEA 4C0OC 4YP3A 1S72S 1M5SA 1TUVA 3ISND 4HDGA 5F41A 1KHWA 1BQMA 4MT1A 4JI8J 2KH9A 1UA0A 3GPAA 3U27A 1Y00A 2MQLA 4OX9F 3QSYB 1JLCA 1GXLA 4B17A 3OTOF 2CA9A 1M5OC 1RLCL 4KQZA 2BRLA 2W25A 4DPOA 5I3UA 3BSOA 5GMKa 4NASA 4C3MA 5MAOA 2ZH9A 2ZBQA 5KFFA 4DL7A 1N0UA 3L3CA 1FKAF 5DQIA 1FKPA 4C0BA 1OS5A 2PC6A 2NR0A 3GG0A 4X4VA 3G96A 3TVZA 4WFYA 4F2SA 4DL4A 2MKJA 1G1XA 1RAHB 1RGVA 3HD2A 4ECVA 1V5VA 1EKSA 1AA1B 3C16B 4BBYA 1U02A 2AGPA 2R8IA 3DYAB 2LXIA 2BKNA 4ZN1A 5HVGA 1KC8T 1ZM3A 3QLHA 4I4BA 1H7WA 3VV2B 4ES2A 1NPRA 1WACA 1N4LA 1IJEB 3GTYX 1SQEA 3DDIA 4ED5A 2DHAA 2H51B 2M52A 1FDBA 1Y11A 3PVXA 3H2UB 1X60A 2XWYA 2DYAA 4LF2A 4OZ1A 3UCUP 4NLQA 3U1NA 4DFPA 4OI0A 3PFOA 4WU3A 2CVEA 1S9EA 4KSEB 3MEEB 4OYBA 1YJUA 2B4OA 1NDCA 5ETKA 1NSKL 3RJMB 3RAQA 4AL5A 5EHHA 3UDCA 3R2DJ 2CDQA 4I2PB 2AYGA 2MY8A 2MQQA 2NXCA 4HI2A 4DUYF 4HKQA 3IRXA 3MPVA 3GONA 3W62A 4JI0F 3TZZA 3LW5C 1SBRA 4YY3J 1U24A 2IJRA 2YPZA 3A1YG 5DGBA 5L9NA 2MZJA 3RZAA 3OLBA 3N01A 1SKRA 2IBKA 2XMTA 1TKZA 3US5A 2KFYA 3IM9A 3MR6A 1VJWA 4WK3A 3ELHA 3JQJA 4IFYA 2FHJD 3TJ9A 2WSFC 3C15A 3FRZA 3TJ8A 3W9HA 3FBFA 4U95A 1YTYA 4OHYA 1GXTA 1WOOA 5IQ6A 2VFSA 2YY3A 4X4OA 1GFWB 5L46A 3ZZPA 4MIBA 4RBTA 5DDPC 1B4SA 1BHNA 1X4FA 3N28A 3KJVB 3CJ2A 3W2VA 3MTKA 3GIIA 2UUTA 1RT4B 3SFUA 3CMQA 1S79A 4CRJA 5LMUF 1LOUA 2OO4A 2IBOA 4AYBD 1B0VA 3ET6B 4OFZA 1X4EA 3TZYA 4YB1P 1S6OA 2DK2A 2V0NA 3IN5A 4F50A 4DUZF 4PQUB 5DG9A 3KHHA 2LQJA 2CPEA 1EZZB 1FRLA 2B4PA 4RUBA 3V6DB 3RB0A 4F04B 1HNVA 3QAUA 1JB0C 1OSDA 1OIAA 2DGWA 2WB1D 4JV5F 4YDXA 2LXFA 3AY0A 3BGOP 3HT3A 2X51A 3TWZA 2IDEA 3Q22A 5HROA 3BSNA 1K0VA 1J5OB 1FXRA 3CC4S 4IG0A 4RUAA 2YWFA 1RTIA 4ZPAA 4RW6A 4DR4F 3Q8RB 2EKNA 2XS2A 2HSEB 4WIIA 2FHJA 3TP2A 5CYQA 5HQ8A 3H5UA 5LT5A 4RZRA 4YDDB 1RK8A 1UVIA 1FRMA 2VH7A 1UEUA 1YX2A 3H5XA 1N5TA 4KGXB 5E5NA 1HBMB 2WSCC 3LO3A 2WVDA 2XS7A 5MLCV 1SPBP 2KL8A 2XYPB 5FLXY 1JLQB 1F6TA 1T02A 3IGVA 5SUHA 1EB0A 1HQUB 1P9YA 1TP7A 4U7CA 3J7ZT 1PGZA 2J8SA 3OR1B 3IR6B 2FDNA 1FJ7A 1F60B 2BM1A 4JV1A 1GMUA 2Z0GA 3H98A 4J9UE 1UP1A 4ZJOA 5FDLB 5KFQA 1TMMA 1YWXA 2ZBIA 1K0TA 5ETRA 2CJKA 1J5EF 2VIHA 4K8RA 1NM2A 4N8NA 5IV4A 1T11A 1IBKF 2HK3A 3CO0P 2UUAJ 2KDOA 3VQTA 1HNZF 1M1GA 5HK4A 4MYTA 4RWWA 1FTCA 4KGKA 3RGIA 1R0BG 1GMVA 2H5IB 3D67A 2BE9B 1YQHA 3CXCR 3PY8A 4ICLB 2DHGA 4AQYF 4K4ZA 3RTVA 2YWEA 3UR0A 5E3PA 2BW2A 5CZVA 4IRCA 3J7A1 2B7CB 4MIAA 3CB4A 2W9AA 3J81U 1NXIA 2R7WA 4ED4A 1NBEB 1PBUA 2ZBRA 1UEKA 3JS9A 2K1RA 3N9UC 2KB2A 1VRUB 3EPGA 2RRNA 4K4WA 2B4UA 5BXIA 5D0GA 4O4RA 1CJKA 1SV5A 1X5SA 2A2CA 4KFBA 1NJXA 3EVWA 4H54A 1LW0A 2AHOB 3KFWX 1CJUA 5D0RA 5KFHA 5KAKA 1MU2B 5K8PA 2XMVA 2RDJA 4QCLA 2IAJA 5IT9Y 3CF5Q 4YR3A 4WFNQ 4DJBA 3PO4A 3ISZA 4M95A 3N6MA 1Y5IB 4J9NA 3H4BA 4DZ6A 3B8HA 3GYGA 1BQNA 4P2XA 3I0RA 1RT5A 4ZKAA 1S1UB 2DD8S 4MJKA 2QT7A 1RT5B 4QWBA 4UY85 4NEYA 2CQIA 1ZZNA 1E6VA 1UMJA 1XR6A 5KT3A 3I82A 1U4BA 1Q4RA 1JLBB 2E1RA 3OD2A 4CH0S 4N47A 4DS4A 4I7FB 4QR1A 2V2VA 3GYNA 4QPXA 1F3VA 2ZDOA 3CC2S 4K0KF 5E2QA 4ZVOB 1LW2A 3CCQS 4ECQA 1HBUB 3KUEA 1TAQA 1PJ6A 5KFRA 2H5EA 4LF7F 4ZCIA 4DR5F 3TR5A 4JB8B 1C1BA 3D3CJ 3V6KA 3BGRA 4USUA 2YKMB 4GKKJ 3WX4A 1FXLA 1VRUA 1KDNA 2G2OA 5AJ3J 1WDTA 2CQDA 2K1RB 4QQBA 1WD6A 2XNQA 1FEEA 1UPPA 3AJ1A 1X0FA 4DPWA 3H4DA 1GMWD 1V6HA 2O67A 1XNQF 4P9SA 2FQQB 1AROP 1PAEX 5ETOA 3W64A 4ZJLA 2JLEA 3GFYA 4HI1A 4ZP6A 4EWTA 2XMMA 1VBXA 4Y28C 4FF4A 2DRBA 4B3OB 1K47A 2GVZA 1JWWA 2YNIB 1D0EA 2NREA 2G2ZA 2FC9A 2E5HA 4NWBA 2H1YA 1NO8A 1HR0F 2UUBF 3EYZA 4KGMA 1BMQB 3GZ7A 2ERRA 3MD1A 1VQ7S 3M6UA 5FDLA 4PR6A 3NGUA 5D0HA 1FNOA 2OPRB 3W5YA 2MSSA 3A13A 2VU5A 3CGIA 3FZ2A 4LF6F 2ZZNA 2W2QP 3KG0A 4F0MA 4ZMMA 2DXFA 2YKNB 5KFSA 3DM2B 4B3TJ 3MEDB 5KFUA 3MHYA 2G1HA 2L9NA 3IWXA 3DGVA 4URQU 1HBMA 1VC6A 5ETNA 4FF3A 1WTBA 3PR5B 1S1WA 1UVMA 1VRQC 4Z7YA 1G4CA 2FY8A 3CJ5A 5GAEU 3ENAA 5A6WA 3JSRA 1VGYA 4M5HA 4PXCA 2KXHA 4MH8A 2OMLA 1RTIB 4LQ3A 1UWBA 1RWPB 1NDKA 2F8HA 5LSRA 3HM9A 4J9LA 1K8AT 3J7AN 1EHWA 5KFNA 1ZAVA 5L38A 3FSXA 1U45A 1JKHA 1OWXA 2IC3A 4O44B 3P45B 3DRPA 4M5DB 2QFJA 1C0UA 4LBHA 3IO1A 4GKJF 1S9GB 1MWQA 4ED7A 3N4WA 1IKWB 1AZSB 3L7UA 3P3DA 4EYHB 1FA0A 1HBOB 2B9YA 1PYTA 2CWKA 3BH7B 3UN2A 4YHHJ 5KFTA 2Y1IA 2QMWA 2QMXA 4CWBA 2X1GA 5KG2A 5I42A 4ECWA 4JI6J 4NI2B 3CJKA 5HLFA 1W2BR 2R8GA 3VAGA 1HNIB 1N88A 2PFDA 3M6VA 5F8GA 5C25A 4NLYA 2P2CB 1RACB 2OH2A 2RIJA 2WRMA 4KT0C 3PDNA 2HS3A 3NEKA 2HQIA 5I4MA 2Y1RI 2FIUA 4XO0A 5J2MA 3GV5B 4GO7X 4NLOA 2IM2A 2JFKA 2VOOA 3PZPA 2FVPA 2RNEA 5C7PA 2QLJB 1S4FA 2I8EA 2J7UA 2VICA 3G71S 4AL6A 5CH7B 1S6PA 1UWAA 3OFGA 1Y7PA 2U2FA 3OTBA 3UVJA 4A46A 4CO3A 4G65A 4ZPTR 4NLSA 4O0NA 5C2GA 4GC7A 4W92B 1JJHA 2H3EB 2KZZA 1TK0A 1R8HA 3CJ4A 3AOAA 5KT5A 2UUAF 2ASDA 3DNCA 1YJ9S 5GAEI 4RW9A 4NLUA 1GMWA 3MTJA 4LSZB 3M1VB 4Q44A 4ED1A 2Q43A 3VVTA 1SI9A 4F4ZA 2ZOFA 5J2NA 2KYXA 1U1OA 4C4WA 4DV7F 1U1RA 2XSFA 2RHQB 4I2PA 3I5CA 3T5HA 1NJYA 2VDIA 1ITPA 2NXNA 1F5CA 3EE3A 2MKKA 3MEEA 4OX6A 1IKYB 1BY9A 2OEKA 1Q5VA 3L4BC 3OFEA 2E9TA 1FRHA 3EZOA 4NZ7A 1FESA 3BPSP 3H7HB 2HAIA 3D1HA 1OQ3A 1SC4B 2UUWA 4RX6A 1H74A 4UW2A 3KLGB 2BX6A 3NKYA 2FD2A 2HGLA 4PWUA 3CTRA 3PR4A 4KKOB 3CW2C 2F8MA 9RUBA 1RTDA 2HW3A 1B7YB 2XY6A 3DLEB 2KZMA 3TAMB 2IM3A 2B8QA 3PJXA 3QLHB 4M5MA 5EUHA 2RRBA 4QW9A 1TL1A 3T5LA 3RB4A 1T8EA 2K7KA 3DGPA 2G0CA 3QJLA 3C16A 1HHTP 3KK2B 4NI2A 4RUHA 5ADZA 1B3TA 1YK9A 4CO0A 2BEFA 4RNNA 2OSQA 5IT4A 4C8NA 1DHMA 2HWTA 4IUFA 4LF8J 4L75A 1IKWA 1AZSA 3UD4P 3LP1B 2EFQA 2GQ2A 5HAOA 1GXUA 3EXCX 4PQAA 2WVBA 3JB9k 3PXGa 3D68A 4R8UB 4PEOA 4PPZA 2MQ8A 3BH6B 2ZH3A 5C24A 2YQ1A 1VQ4S 2RH3A 4X4UA 1UWBB 2DR6A 2ACMA 2R42A 3HKWA 3MEKA 5EGYA 4TY8A 3OVAA 3Q23A 4GKKF 1BQMB 1Y4ZB 2YKOA 3NWGA 4OYPA 4WTYA 1LNQA 3M8RA 3EDQB 2R2UA 4LF5F 1IXKA 2L3MA 4X84A 3NXZA 1VQKS 2RAQA 3KLIA 3KDNA 3SBMA 2AWZA 3EDRB 2OD6A 3QQCD 1U6ZA 4H4OB 3HO1A 2HVEA 2EXUA 4ECSA 2AEFA 1RADB 1YLXA 2H9ZA 2YKNA 3BR8A 3CO9A 1X4CA 3CCES 2NXJA 2W4PA 2PFFB 2VHGA 6FD1A 2Y3YA 2MKHA 4WTOB 1LK7A 1QSSA 5C42B 1R6VA 1RHMB 2QLXA 1Q1KA 4ID8A 1U6BA 4RBUA 1SIZA 4OYWA 1T9TA 4DR2F 4HTJA 2XQCA 3G4SS 5KFMA 4FBTA 5IS2A 2CQ1A 2R4FA 1HLWA 4K4UA 3W60A 1A6LA 2ZNYA 4EK2A 1RBOB 2XZTB 2VG5B 4HHUA 2Z2MA 5JUMA 1RU1A 2CJXB 1U1NA 4DV5J 1TV6A 2WCXA 1RABB 1RAIB 4TLQA 4CLTA 1TKXA 4JI8F 4DR7J 3TO8A 4LMZA 4RW8A 1FRKA 5K14A 5E0OA 1CC8A 2C28A 2DNYA 4DBQA 2BJ7A 3M9MB 5F8LA 2VBZA 3PACA 5CAAA 1HHQA 1LFWA 1V3RA 4ALZA 4AL7A 4DSEA 1NKCA 4YB6A 2YQ3A 1IM4A 4R25A 1S0OA 1IBLF 2HVDA 5HBMA 1SVDA 5KFYA 1HNXJ 3QJJA 2XSJB 4LQ9A 4XK8C 4USMA 2VOPA 1N5VA 3Q24A 2HNDB 2RKIB 2E7XA 2FZCB 4DI6A 2PD1A 1JLBA 1S1VB 1URNA 1MW7A 3NRBA 1HQEA 2AEMA 1S1TB 3P96A 2E5JA 1FD2A 1G3OA
chains in the Genus database with same CATH topology
5FLXU 3J80U 1N34J 4B3SJ 4NEYA 4LFAJ 4YY3J 4KHPJ 4K0KJ 4DV7J 5LMNJ 5BR8J 3JAMU 4JI1J 1N36J 4LF7J 4DR5J 4DV3J 4LFCJ 3D3CJ 2UXBJ 5A2QU 5AJ3J 1N33J 1N32J 4B3RJ 4DV0J 4X65J 1XNRJ 4JI3J 2HHHJ 1XNQJ 4LF5J 4DR6J 2UU9J 4LF8J 4JI7J 3T1YJ 4B3MJ 4JI5J 2F4VJ 5LMUJ 3D3BJ 2E5LJ 4LF6J 1HNWJ 4LFBJ 1XMQJ 4DUZJ 2MQ8A 4X66J 5IWAJ 4JI4J 4DV1J 1I94J 4JYAJ 4B3TJ 2VQFJ 1J5EJ 3R2CJ 1XMOJ 1HNZJ 4DR4J 1FJGJ 3T1HJ 2MEWA 4V1Ak 1HR0J 2UUBJ 4OX9J 4JI8J 2UXCJ 2KL8A 3OTOJ 3J7AN 2UUCJ 5IT9U 4GKJJ 4DR1J 4DV6J 4GKKJ 4NXMJ 4KYZA 4JV5J 2UUAJ 4DR2J 4NXNJ 4YHHJ 2ZM6J 4HHUA 1IBKJ 4LF9J 4KY3A 4JI6J 4DV5J 4X62J 4JI0J 4DR7J 4DV4J 4AQYJ 3J81U 2KVQE 1IBLJ 4DR3J 4DUYJ 2MTLA 4JI2J 1HNXJ 4DV2J 2VQEJ 3IMQJ 4NEZA 3W1YC 4RJVA 4LF4J 4X64J 5LM7E 2UXDJ 3R2DJ 1IBMJ 4PWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX U;  3J80 U;  1N34 J;  4B3S J;  4NEY A;  4LFA J;  4YY3 J;  4KHP J;  4K0K J;  4DV7 J;  5LMN J;  5BR8 J;  3JAM U;  4JI1 J;  1N36 J;  4LF7 J;  4DR5 J;  4DV3 J;  4LFC J;  3D3C J;  2UXB J;  5A2Q U;  5AJ3 J;  1N33 J;  1N32 J;  4B3R J;  4DV0 J;  4X65 J;  1XNR J;  4JI3 J;  2HHH J;  1XNQ J;  4LF5 J;  4DR6 J;  2UU9 J;  4LF8 J;  4JI7 J;  3T1Y J;  4B3M J;  4JI5 J;  2F4V J;  5LMU J;  3D3B J;  2E5L J;  4LF6 J;  1HNW J;  4LFB J;  1XMQ J;  4DUZ J;  2MQ8 A;  4X66 J;  5IWA J;  4JI4 J;  4DV1 J;  1I94 J;  4JYA J;  4B3T J;  2VQF J;  1J5E J;  3R2C J;  1XMO J;  1HNZ J;  4DR4 J;  1FJG J;  3T1H J;  2MEW A;  4V1A k;  1HR0 J;  2UUB J;  4OX9 J;  4JI8 J;  2UXC J;  2KL8 A;  3OTO J;  3J7A N;  2UUC J;  5IT9 U;  4GKJ J;  4DR1 J;  4DV6 J;  4GKK J;  4NXM J;  4KYZ A;  4JV5 J;  2UUA J;  4DR2 J;  4NXN J;  4YHH J;  2ZM6 J;  4HHU A;  1IBK J;  4LF9 J;  4KY3 A;  4JI6 J;  4DV5 J;  4X62 J;  4JI0 J;  4DR7 J;  4DV4 J;  4AQY J;  3J81 U;  2KVQ E;  1IBL J;  4DR3 J;  4DUY J;  2MTL A;  4JI2 J;  1HNX J;  4DV2 J;  2VQE J;  3IMQ J;  4NEZ A;  3W1Y C;  4RJV A;  4LF4 J;  4X64 J;  5LM7 E;  2UXD J;  3R2D J;  1IBM J;  4PWW A; 
#chains in the Genus database with same CATH topology
 1N34 J;  2PI5 A;  1FER A;  2DHS A;  1FFS B;  1MLA A;  3AB2 B;  1RE1 B;  3MM6 B;  2DNR A;  1B0T A;  3SZ2 A;  4UY8 T;  1QAJ A;  3RUB L;  1N36 F;  1H72 C;  2W9B B;  1XR5 A;  1JLA A;  2FYX A;  1SL2 A;  1C0T B;  2R7O A;  1SIW B;  3FCH A;  5AXM A;  3J7Y I;  1LW0 B;  3AB4 B;  2DEJ A;  3M4X A;  1X5T A;  2Y1L B;  3NBP B;  3THV A;  3HVW A;  1JLG B;  5IXU A;  4KFB B;  1CJK B;  1SV5 B;  2AZ3 A;  3P4U B;  2E5I A;  3AA8 A;  3MM5 B;  3MM9 A;  1DQA A;  3LWM A;  3IAM 9;  2CFX A;  4KPC A;  3BSC A;  4FF1 A;  2FY1 A;  5C2C A;  3WHI A;  3MMA A;  3R5G A;  1S1V A;  3HHK A;  1H2T Z;  3I55 S;  3ZXW A;  2HQD A;  3QZ8 A;  4DL6 A;  3V4I B;  4M8L A;  2QJ3 A;  5ETM A;  2RKI A;  2WHO A;  3U1M A;  1LWF A;  1UCN A;  1HPZ B;  3V81 A;  5JMN A;  2RDI A;  2VG7 B;  4FXW A;  3EXY A;  3VHQ A;  3ZFV A;  3AQO A;  2HZV A;  1RWV B;  1O51 A;  1HW8 A;  1T3O A;  3H90 A;  4CTA A;  2F4V J;  1WHY A;  1LWF B;  2QRR A;  4DSI A;  3ZC4 A;  2Y9H A;  4R5P A;  4LFB J;  4LVN P;  4CH1 A;  1XR7 A;  1XMQ J;  4G3I A;  4JYA F;  1O5J A;  5FII A;  5SZT A;  4X66 J;  1Q7Y T;  2XS5 A;  1NJW A;  1HNW F;  2HBR B;  2QL5 B;  1EQ0 A;  2E5L F;  4DZD A;  4W4M A;  3H5Y A;  3D54 A;  1NJI T;  4Q7A A;  2CG4 A;  2MLZ A;  2Z58 B;  3G2X A;  2OEJ A;  3MMA B;  4UOC A;  3K7R A;  2VG5 A;  5DJB A;  3R7N B;  2AGO A;  5A0Y A;  3TQE A;  5KFK A;  3PW5 A;  2RU9 A;  2KRR A;  4IDK B;  1Z2Z A;  2B8P A;  3ZTR A;  2MB0 B;  1X0P A;  1WOP A;  3G82 A;  5JXS A;  4IRK A;  2R7Q A;  1QM9 A;  1V5I B;  2LQB A;  3H5S A;  3I87 A;  3QGI A;  1WSR A;  4NLT A;  4OZ2 A;  5CYJ A;  4ED0 A;  4ELU A;  2OTJ S;  2MYF A;  4ID5 A;  3LGM A;  2YKA A;  2GHP A;  1ZET A;  4NRT A;  3D7S B;  3GE9 A;  1YIT S;  1KN6 A;  4YME A;  2QIF A;  2BKP A;  3NG8 A;  3R97 A;  1WHX A;  4L3K A;  4C3K A;  3AXM A;  4DWI A;  2UXC J;  1KOO A;  2ZE2 B;  2UVV A;  4DSJ A;  2ZH7 A;  3NCR A;  4RW7 A;  2GX8 A;  4FDF A;  4G1P A;  1IUJ A;  3GJS B;  2HHT A;  2C3U A;  2BJ9 A;  1OPI A;  2ZH5 A;  3R5C A;  3WDO A;  1OJ4 A;  3V6D A;  3AJD A;  5H9E J;  4UZC A;  3JSB A;  3QWP A;  1SL0 A;  1ACM B;  1DAR A;  2LEC A;  1WHV A;  3QFH A;  3KUG A;  2Y1J A;  2I0X A;  5B09 A;  4LRE A;  5D4P A;  4TQS A;  1CSJ A;  1URR A;  2CPY A;  1FJE B;  4FYX B;  2A3J A;  4X62 J;  2ZWP A;  4UT4 A;  3Q2S C;  4Y2C A;  2RU3 A;  3Q8P B;  2J6T A;  2VA2 A;  1Q82 T;  3OBI A;  3PEH A;  2WVC A;  5IM0 A;  4NYP A;  3DLH A;  1YJ7 A;  1RA7 A;  3SCI E;  1AFJ A;  2B56 A;  2IIH A;  2EPI A;  3LAN A;  2GIQ A;  2VQE F;  2W1B A;  5KT6 A;  3KLE B;  3GV7 B;  2RS2 A;  4OI4 A;  4IFY B;  2VBW A;  5DQG A;  1NND A;  3C8Y A;  1MSW D;  1WF0 A;  1HD1 A;  4IH5 A;  3RBZ A;  1UAW A;  2E9R X;  4YHH F;  1T05 B;  3LP0 B;  3PJW A;  3K59 A;  5DGA A;  1RAJ A;  3UI3 A;  1RI7 A;  3MCS A;  1NUE A;  3TEH B;  2AGQ A;  1WEL A;  4H4K C;  3VAJ A;  3GG1 A;  2GQC A;  1YJV A;  2FVS A;  1Z2L A;  4I56 A;  4Y3C A;  2ZJR Q;  3UPF A;  2J6U A;  3NMA A;  4V19 J;  4ES1 A;  3MR3 A;  1U1Q A;  4F36 A;  1Q81 T;  3LAM A;  1QE1 A;  4KKO A;  1PKU A;  3GFX A;  5F8J A;  1RT2 A;  3GR1 A;  2KI2 A;  1R89 A;  1DTQ A;  5FLX U;  3J80 U;  4OZJ A;  5ETL A;  4HDH A;  3M2U A;  2ILY A;  1ZS6 A;  4JOU A;  4F3O A;  4DQR A;  1UPM B;  2EKY A;  2HBZ B;  4P74 A;  3C6U A;  2C2D A;  3CWJ A;  3IM8 A;  1Q78 A;  1IKY A;  5AXN A;  1FT8 A;  2X3D A;  2J5A A;  3DDN A;  2XCA A;  3DXB A;  2BKO A;  2MKS A;  3OSP A;  3CC7 S;  3EVO A;  2OPS B;  3FCW A;  3D1O A;  2UVU A;  5L39 A;  2B43 A;  2NUU G;  2OJ3 A;  3M8Q B;  1TZ0 A;  2DH7 A;  3OV7 A;  3M1V A;  1S57 A;  1XQI A;  3TUZ C;  3TAP A;  3DOK A;  4CNZ A;  2B9W A;  2HRY A;  3MI7 X;  1U48 A;  2NPI A;  1HWK A;  1GTE A;  3D5M A;  5ETP A;  4TY8 B;  8RUC A;  3HUL A;  2CWX A;  4I6A A;  3M32 A;  4KE5 A;  2AJ4 A;  2D9O A;  2Q6B A;  1WUU A;  4ZPW R;  3O1L A;  5D78 A;  1SC1 B;  4M5G A;  1IKV A;  2ZH2 A;  3R1L A;  1RHJ B;  5KFV A;  5GAD U;  2R8J A;  5JVH Q;  3LGN A;  3I5B A;  4L72 B;  4ITS A;  2JX2 A;  2MPU A;  3BEG B;  4KHR A;  4TQR A;  3N0V A;  1TKD A;  2ZBC A;  1QVG R;  1M90 T;  2AYB A;  1T03 A;  2DRD A;  4UZB A;  4EGL A;  2KJV A;  4KGV B;  2VB6 A;  4ECX A;  1RUS A;  4DQP A;  1V3Z A;  3ZTO A;  2ZC3 A;  1BLU A;  2FLP A;  4BWM A;  2XLI A;  2RHS B;  5ETS A;  1UJ5 A;  3M9N B;  4IOA Q;  4I6W A;  2QA2 A;  2FLO A;  1RU2 A;  2X3G A;  3U02 A;  1CC7 A;  1FRJ A;  1YBU A;  2DNK A;  1O8B A;  3ISN C;  3KXD A;  2M9K A;  5AJ3 F;  3KK2 A;  3VZH A;  4DUZ J;  1S0V A;  1HNI A;  1SH2 A;  2WZ1 A;  1BE4 A;  3A8I A;  5KG7 A;  1BXN A;  3S01 A;  2AJF E;  1H0H B;  4RR5 A;  3SSS A;  1CS4 B;  3NOG A;  3WZ0 A;  2JFD A;  2W2N P;  3DLE A;  3G6E S;  2R7X A;  1DQ8 A;  2HVZ A;  3CME S;  3Q8S B;  2DXD A;  2FJE B;  1Q8I A;  4RNM A;  3CJ0 A;  3MCN A;  3NCP A;  4FXV A;  4YQW A;  3OVS A;  3RB6 A;  1X4H A;  3O5T B;  3IG1 A;  3R7S B;  2WOM A;  4WBF A;  2MHE A;  2F7V A;  2IM1 A;  3CDA A;  4V1A k;  4F25 A;  3PV8 A;  2JLF A;  1VK8 A;  2HHH F;  3M30 A;  4C3L A;  2OMO A;  2LMI A;  5BYS A;  4IQM A;  4AFF A;  3JSY A;  4QIV A;  3NGT A;  3V4M A;  3PRB A;  3CCW A;  4Q8E A;  4CT9 A;  2B6A B;  2LA4 A;  2Z8Q A;  1AUD A;  2KTQ A;  5EWG A;  1RT1 B;  4KV8 A;  4IH6 A;  1WF2 A;  4W98 A;  4KRW A;  5B0F A;  2UXC F;  4O4G A;  4RW9 B;  4D3G A;  8ATC B;  4C8O A;  3B6B A;  2E29 A;  2N3O A;  4M5J A;  1K1Q A;  1RAG B;  3NS5 A;  4MMO A;  3IFE A;  5IQQ A;  5GAD I;  2R7U A;  3OHA A;  2C3O A;  3DM2 A;  4YN3 B;  3UVJ B;  3T1H F;  4PG6 A;  4DLG A;  2CQC A;  3A8J A;  2D41 A;  2ZHA A;  2EC2 A;  2FGC A;  2JLG A;  2VQF F;  2WW8 A;  4M5K A;  3T1A A;  4LR8 A;  3H2L A;  1TKT A;  1VQM S;  2E1M C;  4KO0 B;  1VRT A;  3OR2 A;  3QO9 A;  3WC0 A;  5J2M B;  2YX1 A;  2Q66 A;  2D1C A;  4GC6 A;  2P6T A;  4USV A;  4FXD A;  4OZ5 A;  2MTL A;  4JI2 J;  1O6X A;  2DIS A;  5K8M A;  1RTH A;  1KLN A;  2HRT A;  1WC5 A;  3I56 S;  2UUC F;  1VI7 A;  2DGX A;  1EAY C;  2AW0 A;  2W2M P;  3QBC A;  1RBA A;  2FHM A;  2OFH X;  2B5J B;  4AE5 A;  2R7T A;  3IBW A;  2CAD A;  2MGZ B;  1FXD A;  1N54 B;  1VK3 A;  5FJ4 A;  2QGF B;  4DQI A;  3DOL B;  1SH3 A;  2QX0 A;  3L7O A;  4MK8 A;  4USJ C;  4C11 A;  1KQS R;  4JI3 F;  3QRR A;  1OSC A;  2GIF A;  2N4C A;  2MHN A;  1RQ0 A;  2KYZ A;  4GVB A;  3JSM B;  1QY7 A;  3MFI A;  2R7S A;  2CQH A;  2DPJ A;  1C1B B;  1ZPV A;  3EGN A;  1HW9 A;  4ZOS A;  1E6Y A;  2QSF A;  4M5D A;  4RBV A;  4MK9 A;  4NLX A;  4ZPC A;  4BC9 A;  4X62 F;  2ZHB A;  4NCB A;  4RWX A;  4HAC B;  1S77 D;  4LFA J;  4KHP J;  3EGW B;  1LW2 B;  4UTG A;  5KFZ A;  1ROF A;  5DM7 Q;  2V63 A;  4WF9 Q;  2P8I A;  3HHL D;  2BAN B;  3O44 A;  2NYH A;  5DZ7 A;  4A48 A;  3MMC B;  5CHC B;  1TFW A;  1TQL A;  4CO2 A;  1CUL A;  5H1S V;  2D69 A;  1KNZ A;  5KG0 A;  3QJP A;  3PIO Q;  2NYI A;  4LBI A;  2VJV A;  4RW4 B;  4ZIT A;  2ZZM A;  2EVZ A;  2BDP A;  1UFW A;  3NS7 B;  3R6G B;  4MFB B;  4NE9 C;  4P73 A;  5KT2 A;  3IWN C;  2CJY B;  2C2R A;  1CLF A;  5F3T A;  4DQS A;  4XPE A;  1S97 A;  1IBC B;  4F4K A;  1S1U A;  2C3Y A;  1ZM4 A;  2DNH A;  1UVK A;  3I0R B;  4L3N A;  4TU9 A;  3NGD A;  3HP6 A;  1IKX A;  1OYD A;  3FQK A;  2DKO B;  1X4B A;  4LRC A;  4XDC A;  3UWT A;  2M70 A;  2LQ9 A;  2E1C A;  1OY9 A;  3ZTQ A;  1HA1 A;  3KK3 B;  3T5J A;  1OO0 B;  2R2T A;  4ZA1 A;  3S7R A;  4NL5 A;  4DR6 F;  1KWM A;  1HMV B;  1UTA A;  2ZH1 A;  3HFK A;  2VZ9 A;  4DFK A;  3BN7 A;  1X4G A;  3EZU A;  3KHR A;  1RT7 A;  4EFA C;  3KYL A;  4O3P A;  1S49 A;  1KQK A;  1U1K A;  2JL9 A;  4DDF A;  4NCG B;  4ZHR A;  2E7W A;  2O66 A;  2ZFH A;  3S6E A;  2W9C B;  1YIJ S;  1SKW A;  3EMT A;  2VV5 A;  3T1Y J;  1G2E A;  2HZC A;  5LMU J;  2VA3 A;  3DLG B;  2MZ1 A;  2C2E A;  5D15 A;  4UOG A;  2DNP A;  2M7S A;  3PW7 A;  2X1A A;  1N5Y B;  3G6V A;  4FPR A;  2MQP A;  3VAI A;  4Q0B B;  1UL3 A;  5E3A A;  2K06 A;  1RTZ A;  2VPY B;  1A9N B;  4H4M B;  1X4D A;  3RRG A;  2CIM A;  4U96 A;  4NCG A;  2YKM A;  2UXB F;  1HQ2 A;  1UJ4 A;  1FJC A;  1W26 A;  1RT7 B;  1VIS A;  2GCF A;  2I5J A;  1NH7 A;  4R0E A;  4WP9 A;  1HBU A;  1REV B;  4DN9 A;  4DPY A;  1QJH A;  2Y8Y A;  2VUG A;  1FJG J;  4DCO B;  3T1H J;  2FHK A;  1DBD A;  3GSI A;  1VQL S;  1H73 A;  2AEJ A;  3QRP A;  1CG2 A;  2AYM A;  3MEC A;  3UCZ P;  2QEX S;  3DOM A;  1SXL A;  1JJC B;  1RAE B;  1HL6 A;  3Q8Y A;  4CP5 A;  1GT8 A;  2PT0 A;  1U25 A;  4YS2 A;  4ERD A;  5F3Z A;  4IKA A;  2MQO A;  3R3T A;  5DLF A;  1JNR B;  1I51 B;  3TQ1 A;  5IV3 A;  5KFW A;  3SFG A;  5CCM A;  3PRV A;  3MUT P;  4HT5 A;  3ZNJ 1;  2HNY A;  4DX5 A;  3PIP Q;  1D9F A;  2HEK A;  4DV1 F;  2YXL A;  1M1K T;  2A2D A;  2F5G A;  5HRO B;  2ZUA A;  2MZT A;  4HAC A;  2B9E A;  4JI0 J;  1HWU A;  3BO4 A;  1FCA A;  2O01 C;  4ELT A;  3ILL A;  1X7V A;  2H4W B;  1E6Y B;  2DNQ A;  1LV5 A;  1SKS A;  5I3Q A;  4KAI A;  4TNO A;  1UW4 A;  1XEZ A;  2JNJ A;  3M2V A;  4URS A;  3RRH A;  1VIX A;  3SV4 A;  4H4M A;  4GVB B;  4HHH A;  2IVM A;  1XTZ A;  2HVH A;  2EFG A;  3DOL A;  5HQM A;  1SL1 A;  4QWD A;  1R27 B;  1PAU B;  2BUN A;  2MGZ A;  3C66 A;  3Q2T C;  4PRF A;  3CUL A;  3KNG A;  1YGY A;  2Z56 B;  3QAE A;  4WYL A;  5DDQ C;  4Q45 A;  4ICL A;  2FGO A;  4NML A;  2UV8 G;  3K0J A;  1KVJ A;  3QRQ A;  4DX6 A;  4ZHR B;  4O3N A;  3KMQ A;  2CNK B;  2JEF A;  2CJQ A;  4P2S A;  3ADA C;  4QIG A;  2J8A A;  1VOM A;  2V8G A;  3A8E A;  1TU0 B;  4B02 A;  2ZWO A;  4WXO A;  2BJ1 A;  2DTJ A;  1VQP S;  3SSR A;  1HMV A;  4KC5 A;  1B99 A;  1T95 A;  1PG5 B;  3FQL A;  1UJ6 A;  4AND A;  2D7S A;  4NA2 A;  3AAW B;  3AD9 C;  2PMZ D;  3PW4 A;  3TI0 A;  3OR1 A;  1U26 A;  4MKA A;  2M8D B;  2DGU A;  3KK3 A;  2ZH4 A;  3DLB A;  1RTJ A;  1NDP A;  1JLQ A;  2VD3 A;  2BXJ A;  3TYT A;  3O2I A;  4ZVE A;  1OMS A;  1U0H A;  2FJA B;  2QA1 A;  3EJM A;  4LFA F;  2LDY A;  1RAO A;  2DGS A;  1NSA A;  4NLP A;  1I3O B;  2GA7 A;  1N36 J;  3PNI A;  4K2X A;  1WG4 A;  4O4G B;  4JI2 F;  1SH0 A;  1RYS A;  1AXQ A;  4NOH A;  2AT1 B;  2M4M A;  4N77 A;  4U8Y A;  3GR0 A;  5KFB A;  1N48 A;  1FDA A;  3MWB A;  4P2M A;  4MKV A;  4NCA A;  4LFB F;  4LFC F;  1H2V Z;  1HD0 A;  2KHD A;  5J2Q B;  1LKZ A;  2M3D A;  2W4D A;  3BBB A;  2PE8 A;  1J5O A;  1VLY A;  2KKH A;  2UP1 A;  4L6V 3;  2IFX A;  4B3R J;  4DS5 A;  2EG2 A;  3P49 B;  3ICL A;  4XAK A;  4KBI A;  4JI3 J;  3CJR A;  3ZZT A;  1RWN B;  3P6Y C;  3M8W A;  3MR7 A;  3B54 A;  1KVI A;  2XYH B;  3K58 A;  3PFE A;  5DG7 A;  2QTW A;  3MMJ A;  3VF0 B;  2ROG A;  4NLW A;  5A8W B;  4ECR A;  2MDA A;  2IRU A;  2DR8 A;  2EFV A;  3MPW A;  4I2Q B;  5F0U A;  2RRA A;  3RBD A;  2DY9 A;  3KK1 B;  3W2V B;  2CPZ A;  2MZS A;  4GVL A;  5A76 A;  3KJV A;  1RYR A;  1RDR A;  2ZJP Q;  3BO3 A;  2UXD F;  1WC4 A;  1JXV A;  2LEA A;  4M1K A;  1I94 J;  2Q3P A;  2FVQ A;  2V9K A;  2BAC A;  4KO0 A;  5HJX A;  2VQF J;  3SQO P;  1FKP B;  1FE4 A;  4EUV A;  2EG1 A;  2NPF A;  4N5S A;  2YNG B;  1C1C B;  3LOU A;  3QNW B;  4NPO A;  4I68 A;  3FNN A;  5M2R A;  4A8O A;  2QL9 B;  2R9L A;  5C5J A;  2W7O A;  5HQL A;  1IQZ A;  4OZ0 A;  1RKJ A;  2FJV A;  4DV6 F;  1NK7 A;  2JSX A;  4LR7 A;  3TVY A;  4F4Y A;  4WZM A;  2OSR A;  2AX0 A;  2GGP B;  3W9J A;  1CJT A;  2E7V A;  4AXI A;  3IRX B;  2RQM A;  1X9M A;  1UVJ A;  3KNA A;  4LIR A;  2HYI B;  1J27 A;  4PYD A;  1ZOT A;  1UEV A;  3H20 A;  2HLT A;  2K7J A;  1JLE B;  3RAX A;  2HS4 A;  4DR2 J;  1KTQ A;  3TZW A;  2ILZ A;  4WE1 B;  1C2P A;  1VJQ A;  1IBK J;  1BQX A;  3W3S A;  4UF4 A;  3I9V 9;  4DV4 F;  4LRD A;  3OVB A;  3BBF A;  3MF5 A;  4FZV A;  1DTQ B;  4Y2A A;  1RT2 B;  2YX4 A;  2EFO A;  2MZR A;  4JI6 F;  2KRB A;  4OI2 A;  3ENW A;  4K4T A;  3MR5 A;  4IH7 A;  3CD5 A;  3DCA A;  2Q6C A;  1CS4 A;  3D6F B;  1R8A A;  3NOC A;  1SJ1 A;  4QW8 A;  1RT3 B;  3D6T B;  3DLJ A;  1UET A;  4DX7 A;  4LVO P;  1D1U A;  4PAA A;  3S1T A;  3C19 A;  1RKI A;  2H4Y B;  2KT2 A;  3QYY A;  2AQ4 A;  3JTP A;  4IG3 A;  4DL3 A;  4WP8 A;  3RRK A;  2JEJ A;  2JDJ A;  4BS2 A;  3MEG A;  5KFL A;  5KFC A;  3H40 A;  4X64 J;  3HVA A;  2E66 A;  2B51 A;  4IYQ A;  4NYZ A;  4HH0 A;  1KR4 A;  3I0S B;  1WI6 A;  3KHL A;  1UA1 A;  1F3F A;  4QYZ J;  1VQY A;  2WTF A;  3UCG A;  5I3U B;  3HMJ G;  4PCQ A;  5CXT A;  1F0X A;  3UFC X;  1U2C A;  4DV0 F;  1S1X B;  2HFO A;  2VDH A;  3CIZ A;  2ZOM A;  3GMG A;  3M32 B;  3FBC A;  5A8R A;  4CLZ A;  3VGV A;  1MWY A;  2ZOG A;  3V6J A;  1FO1 A;  8AT1 B;  4LF7 J;  3HSG A;  2ZH8 A;  2L41 A;  3DU5 A;  3ITH B;  4OYM A;  2CQ2 A;  3QMQ A;  3GIR A;  3RAM A;  2YNF A;  2XGQ A;  3KLV A;  1UZD A;  2UXB J;  5IOL A;  4AD6 A;  1N32 F;  3OL8 A;  1NU4 A;  4HH1 A;  3CNQ P;  1S0M A;  3C6U B;  2OLW A;  3TA1 A;  2F9D A;  1Y3J A;  1GTH A;  3M2U B;  2QL7 B;  5E3R A;  2DBB A;  5I3P A;  4ID5 B;  5CA5 A;  3LUY A;  1M0S A;  1QE1 B;  2RML A;  1Q0N A;  4N76 A;  2HHH J;  4LSL A;  1XNQ J;  4DOZ A;  1TL7 B;  2A6O A;  2QYC A;  1DRZ A;  5E33 A;  1HAR A;  4E98 A;  2OGU A;  2HFV A;  2FJW A;  1H7X A;  2HQ3 A;  1C4C A;  3QT5 A;  3GJR B;  4WK1 A;  4BCA A;  3EIC A;  2J9D A;  2BE2 B;  4GO5 X;  1RHR B;  1RTJ B;  1L3T A;  1T05 A;  2CAJ A;  5AT1 B;  3Q89 A;  2BRK A;  3TEG A;  3JXO A;  4CLK A;  1SC6 A;  5J2P B;  4NXN F;  3D0G E;  2V4J B;  5ETQ A;  3PYG A;  1PYO B;  4DV1 J;  3GFZ A;  5HI7 A;  2FLL A;  1AT1 B;  2HS0 A;  1JXE A;  2QE5 A;  2VPX B;  3KDO A;  3LTO A;  1XMQ F;  4IR9 A;  4JYA J;  3V2U C;  2VF3 A;  1NK4 A;  3KTQ A;  4IO1 A;  3G86 A;  4M63 A;  3SQG B;  5IM0 B;  2ZD1 B;  2CPD A;  2H54 B;  1M5K C;  3PYF A;  3R2C J;  1F5B A;  3N6N A;  2XC9 A;  2I1R A;  1QUV A;  3SXL A;  2ZC4 A;  1VLO A;  3V4I A;  4OJ3 A;  3L09 A;  1HR0 J;  2UUB J;  3M8P B;  1X5O A;  5G0R A;  1APS A;  4O23 A;  2VL1 A;  1RBL A;  2DH9 A;  3I4P A;  2J9D E;  2D74 B;  2GO8 A;  5KFA A;  1NDL A;  1HWL A;  5L1L A;  1VS3 A;  2UUC J;  1HBN B;  1FK9 B;  1IWA A;  3G9C A;  3DLK A;  2CUY A;  4JI4 F;  2V4Q A;  2V2Q A;  3UDV A;  3MM9 B;  4DUT A;  3DXS X;  5EN1 A;  2XTJ P;  4U9R A;  1NB2 A;  4C97 A;  2MZQ A;  1NSQ A;  3D1Q A;  3OUY A;  3FVY A;  3CCM S;  4LR9 A;  1VQN S;  4L76 A;  3OJS A;  3AOC A;  2ZM6 J;  2CYY A;  3NCQ A;  2W9B A;  3MAH A;  2HNY B;  5F8I A;  3JYT B;  2AMC B;  2OKQ A;  1CBK A;  3QZ7 A;  4OX8 A;  3S8S A;  3O3L A;  4W90 B;  2B3T B;  3M2R A;  1B0P A;  4AQY J;  4O3S A;  4KH0 B;  1D09 B;  2AV5 A;  5ETT A;  1HBN A;  4I1T A;  2C1E B;  3TAN A;  4LRA A;  1FTR A;  1RWK B;  4OHW A;  3MAA B;  5EX3 A;  3LA0 A;  1R8B A;  1S4E A;  2YH0 A;  1NHK L;  4JP8 A;  5F8M A;  1WC1 A;  1GAO A;  2CVI A;  3TOQ A;  4DN0 A;  2K3I A;  1S0N A;  3RBE A;  1F9F A;  4A8M P;  2MST A;  1REV A;  2QZ8 A;  5CCL A;  2XMW A;  1YRU A;  3SQG A;  4I64 A;  2CNO B;  2LP4 A;  4Y2I A;  3V5R A;  4MYU A;  3ENQ A;  1JJ2 R;  3QIP A;  2QN6 B;  2HQF A;  5K8O A;  1HPZ A;  3V81 B;  2VG6 B;  4URG A;  4OV1 A;  2A18 A;  4L74 A;  2V4J A;  1VQ5 S;  3DRS A;  3I9Z A;  3CPW R;  4Q0B A;  3POT A;  1T9W A;  3CCS S;  4F2R A;  1N33 F;  4PAB A;  4CLY A;  1TKX B;  3BO2 A;  1DZ5 A;  3CD0 A;  3IBF B;  1B64 A;  1Y9O A;  1KP6 A;  1EP4 B;  1P1T A;  1TV6 B;  4C2M A;  2P9G A;  3CJ3 A;  1WEX A;  2DPI A;  1CQM A;  4I69 A;  3THP A;  3NNC A;  3T6J A;  1CPZ A;  1Y10 A;  3SDE B;  2W9C A;  4K4V A;  3FMB A;  4FP9 A;  5BR8 J;  2W2P P;  2IJN A;  3HHD A;  4Q2M A;  1S6Q A;  5KG6 A;  2BYC A;  4QIF A;  1PIL A;  3CMA S;  2G0I A;  3A3N B;  1GK8 A;  2HG4 A;  3VZI A;  5KFJ A;  4RU2 A;  4ANC A;  4LUB A;  5C42 A;  2W7P A;  5GVQ A;  3RBX A;  4A8Q A;  1NAQ A;  4Z37 A;  5HL7 Q;  2VON A;  1SJQ A;  3KLF B;  2L9D A;  3ILJ A;  3CCR S;  1C4A A;  3MD3 A;  3LPE A;  3ZZO A;  1AB8 A;  3ZO7 A;  2YNF B;  2XZW A;  3FJ2 A;  5KG4 A;  4ATN A;  4X64 F;  4BDP A;  4H4O A;  2PA8 D;  2V2K A;  1A0O B;  3TNV A;  5H9E K;  1KKH A;  1TUW A;  2XHW A;  2IM0 A;  3J81 j;  1ZH5 A;  1HQE B;  2HK2 A;  4PXB A;  3KMS A;  4MFB A;  1Y3K A;  2ZBP A;  4G6V B;  2UU9 J;  3PKM A;  3SEO A;  1WC6 A;  3DRX A;  3CCT A;  3H25 A;  2ZNZ A;  1CUL B;  3IWL A;  5ETV A;  3VAH A;  1U8S A;  2NSC A;  4CI0 B;  5G4D A;  2NUH A;  5EX0 A;  1MNE A;  2HND A;  1R0A A;  1D9A A;  5HSP A;  5KFE A;  5C24 B;  3OLA A;  4ZVU B;  2CPX A;  1J2V A;  2HBY B;  3Q8V A;  2FJX A;  1Y0H A;  1CVJ A;  2ABY A;  4R8U A;  1NH8 A;  3G8Q A;  4ZPD A;  4JI4 J;  2KM8 C;  1HKA A;  3SCJ E;  4C8M A;  4RPF A;  3NGR A;  3P5T L;  3F56 A;  3JSM A;  2YH1 A;  1N6Q A;  4YR2 A;  4WP3 A;  5K14 B;  1I6J A;  4OL8 A;  1CJV A;  5L1J A;  1NK6 A;  1YRT A;  2CQ3 A;  4DG1 A;  1XMO J;  3MPY A;  4HTI A;  2ZM6 F;  4OYA A;  2IMO A;  1RCO B;  2J0Q D;  4DR4 J;  4TYA A;  4CYU B;  1ZBT A;  2LQ5 A;  3A8K A;  2ZHO A;  3DGP B;  1DLO B;  2YNH B;  4Q5V A;  3MFH A;  3AXK A;  3CE8 A;  3H2V E;  1TL1 B;  4RO0 A;  3SI8 A;  1Q95 G;  5CD4 A;  4U7U D;  1FJG F;  5F0W A;  5H9F J;  3OTO J;  2G4B A;  1LWC A;  4ZLP A;  5FD1 A;  2NXU A;  4U67 Q;  3E01 A;  3QO9 B;  2IVF B;  1EET B;  4FS2 A;  1TKT B;  4USH A;  2BW7 A;  4CO5 A;  1T9U A;  5KFD A;  2C22 A;  2ATL A;  2I38 A;  1NME B;  1EX8 A;  2RB7 A;  1WHW A;  3LQV A;  4HLB A;  2MKY A;  2HQG A;  4HR2 A;  4OZL A;  1YG0 A;  1RLD A;  4ZVQ B;  4NXN J;  3GP9 A;  5L1I A;  1U1L A;  1I5O B;  3EGZ A;  4LF9 J;  1TMJ A;  2MQM A;  1S9F A;  4FS1 A;  3KLI B;  4DU8 A;  1MRO B;  3T9N A;  4WKR A;  2DB1 A;  5EWF A;  1CJT B;  1UKU A;  2V68 A;  2ZUG A;  3L7P A;  3MOZ A;  2W4C A;  1FI4 A;  4P7V A;  3PKY A;  3GV8 B;  1L5U A;  2NLW A;  2OD4 A;  2HUR A;  3FEX B;  3BQ2 A;  4DV2 F;  2DHX A;  2V8D A;  5A6P A;  2LDI A;  1FRI A;  2D3Z A;  4USK A;  4ZVH A;  3UD5 A;  2HQC A;  4RNF A;  2ADC A;  1DJ0 A;  2HWH A;  2KT3 A;  4WIQ A;  2KFZ A;  2P6S A;  2VQE J;  1C1C A;  5IFM A;  1MMD A;  4WXW A;  5DZ6 A;  3EPI A;  3LP1 A;  2DY1 A;  3K5P A;  4J90 A;  4F0K A;  4Z2X A;  3NLC A;  3PX6 A;  2V94 A;  4RNH A;  2I2Y A;  2VFV A;  3NAI A;  4NMX A;  1KFS A;  4ZPV R;  5KTQ A;  2XLK A;  3R8Y A;  3QT7 A;  3R7B B;  4OIX A;  2JVO A;  4PPD A;  2J0X A;  3TA0 A;  4B3R F;  1TUG B;  2XO6 A;  4EU0 A;  3CD7 A;  5BJR A;  5HMX A;  4CDI A;  3R1H A;  1TK5 A;  3HSD A;  5T7L A;  1XJW B;  3NNH A;  4I2Q A;  4ED8 A;  4DMZ A;  2J9C A;  2JRS A;  4X65 F;  4A8X A;  3TAM A;  5I42 B;  3CDW A;  5E7O B;  3EM1 A;  1JXL A;  1VBK A;  2PEB A;  1WWH A;  2ZKT A;  4OHX A;  2XY7 A;  2DCL A;  4TY9 A;  2RDD A;  2LQ8 A;  1ZPW X;  2VPZ B;  2EI5 A;  4IOB A;  3KLG A;  3H42 A;  2R7V A;  3HVT B;  1KQG B;  4UUW A;  1IWG A;  2OIH A;  3DRP B;  3H0P A;  2QMU B;  2JC0 A;  2VFR A;  2XWX A;  1KTV A;  1WKL A;  4X4T A;  3GCW P;  4FYW B;  4KR0 B;  4M5L A;  2QA4 S;  2M2B A;  2OPQ B;  1P6T A;  2WBM A;  4ZVF A;  2N3L A;  2ALY B;  5D3G A;  2MJU A;  3KJQ B;  5J1E A;  4CM2 A;  2CZ4 A;  5IWA F;  2R7R A;  4H4K A;  4KB7 A;  4DV0 J;  5J2N B;  2PI4 A;  3HJF A;  1DFD A;  1XER A;  1UZH A;  1UFK A;  3SIP B;  2M8H A;  1CEZ A;  1WDD A;  4FYV B;  2IYG A;  3GJQ B;  1CQN A;  3HFV A;  1IM6 A;  1G7C B;  2BV3 A;  3D9B A;  2GJ2 A;  4OZN A;  2BR0 A;  4DR6 J;  2LEB A;  2EK1 A;  5KFG A;  4CLW A;  4DL5 A;  2RE1 A;  4ZVG A;  1T7P A;  1TL3 A;  1RP5 A;  2L9W A;  1LK5 A;  2OEL A;  2VBY A;  3D6H B;  4UQT A;  3ZZ0 A;  3OW2 R;  3ZZU A;  1HYS A;  2AZ1 A;  5LXR A;  1NZ8 A;  4LF6 J;  1PJ5 A;  2DXE A;  2DNN A;  4ZP9 A;  2C2Z B;  4L73 A;  2OPR A;  1HNW J;  2DGQ A;  5L8R C;  4ECY A;  3GU0 A;  1U0S A;  1Q5Y A;  3HFZ B;  4AT1 B;  2V34 A;  3BRE A;  4PG5 A;  4E2F B;  1EET A;  4CLP A;  5GAG I;  3RU0 A;  3ZTP A;  3C6T B;  3BKU A;  1S12 A;  1SB6 A;  3O8W A;  5B0C A;  2WW4 A;  4Y2K A;  1U6F A;  2UVR A;  1GQE A;  4PWD B;  4CLU A;  2YNI A;  4LBP A;  3UN5 A;  2GVZ B;  3C2P A;  4LSN B;  1N56 A;  3FUY A;  3PX4 A;  4B3O A;  1RT6 A;  4DF8 A;  4WWS A;  2K8G A;  3IR7 B;  2LVW A;  3K2Y A;  3VGS A;  3ETM A;  3OXG A;  4B9S A;  4DQQ A;  3CJQ A;  4EZ9 A;  1XNR F;  2D9P A;  2XGP A;  2KXN B;  1F5A A;  2VFT A;  2EBG A;  1BD6 A;  1WG1 A;  4ZVT B;  4OX9 J;  2KG1 A;  4MIW A;  2RS8 A;  2ZDP A;  2BJD A;  1S9G A;  2HMI B;  2PO4 A;  1UVL A;  2HFN A;  3B4M A;  5U47 A;  2XCP A;  4X4Q A;  3HJV A;  5KFI A;  4OYZ A;  4EI2 A;  3PM9 A;  4N7T A;  1JKH B;  2IC3 B;  4TKT A;  1FNM A;  3OTE A;  1S6U A;  2ACY A;  2IJF A;  4P52 A;  1PIE A;  3FRY A;  3R27 A;  2U1A A;  1W25 A;  6FDR A;  4EO8 A;  3K5N A;  3R5B A;  4KPY A;  5A8K B;  4J9S A;  2QLW A;  4F7V A;  3D66 A;  2H65 B;  3CJ8 A;  4QIE A;  4ZLN A;  1F2G A;  1PBA A;  1E6V B;  3UN3 A;  3PHT A;  5DET A;  1S1W B;  2DNZ A;  2E1P A;  2C3M A;  3PEJ A;  3JAM Y;  5K20 B;  3HXM A;  2NCK L;  3FZB A;  3IR5 B;  4P6Q A;  4ZJQ A;  1N5S A;  1NZA A;  4DV4 J;  3NNA A;  4NZ6 A;  5IC6 B;  3DOM B;  3HZG A;  4RW7 B;  4ZVS B;  1O0P A;  2XUL A;  4EEY A;  2IAJ B;  1I1G A;  3KUH A;  2XMU A;  3ZNU A;  2QC3 A;  2WAQ D;  2HHU A;  1Q8B A;  5HN0 A;  3LH2 S;  3GJT B;  2G13 A;  2F1F A;  3RG6 A;  1LQ9 A;  4J37 A;  1EJ7 L;  1LEO A;  3LP2 B;  1KFD A;  2GHV C;  2MLY A;  3BKF A;  3WIU A;  5KOX A;  2BQ3 A;  3G82 B;  2BQR A;  3W1Y C;  4NA1 A;  5HO4 A;  4QWA A;  2DCU B;  3AOB A;  2Z30 B;  2DIT A;  2GMH A;  4P2F A;  5A0Y B;  1ZTT A;  2BZ2 A;  3CCZ A;  1FDN A;  3BYR A;  3QAT A;  4BLG A;  3MZI A;  2LKZ A;  3CUN A;  2E9Z A;  1BWE A;  1FE0 A;  4MKB A;  4F0H A;  2CG8 A;  1WI8 A;  1HIY A;  2E5G A;  3CCJ S;  1BUX A;  1Q8L A;  3BN4 A;  3NAH A;  2HHV A;  2AJQ A;  4ED2 A;  1PYS B;  3DLG A;  3POT B;  4P71 A;  4CCH A;  4R5P B;  3FC9 A;  1NB7 A;  3DU6 A;  1XWL A;  4K59 A;  2DR9 A;  4ILR A;  2E1A A;  3NY0 A;  4Z7C A;  3NP5 A;  2CRL A;  1FDD A;  5DRK A;  1YJT A;  1PC5 A;  3K5M A;  5LSL A;  4QBU A;  1KS2 A;  1U1M A;  1D9D A;  3IGN A;  4FVM A;  1P27 B;  2BJ3 A;  3R5D A;  1PCA A;  2G2Y A;  1X4A A;  2QLF B;  3UDL A;  1PSD A;  5DQH A;  4C0H A;  2D3O 1;  3T19 A;  5GAH I;  3IS9 B;  2IA6 A;  4OX7 A;  2Y0B B;  1YBA A;  1QD1 A;  4OYX A;  1WG5 A;  3CCU S;  4MAK A;  1F1B B;  1XMO F;  2QLB B;  5DS7 A;  1TK8 A;  1N32 J;  1M1H A;  4HL9 A;  4JUZ A;  1FVQ A;  2PEH A;  1VDH A;  5LSO A;  4F8R A;  3IAS 9;  4OYO A;  4JI7 F;  3MM5 A;  1FWP A;  5CYQ B;  1ZAW A;  2N82 B;  4GKJ J;  2K3K A;  4O3O A;  5HMW A;  3JYT A;  2K2P A;  2DO0 A;  4CO4 A;  2BAN A;  1DAX A;  1C0T A;  2AKW B;  3R6L B;  3BGF A;  1JLA B;  4IG0 B;  4QWC A;  1FHT A;  3MM8 A;  4UUX A;  3OUY B;  3G6Y A;  3K57 A;  2HIY A;  4PUO A;  2Y0S D;  3TX0 A;  4A8Y A;  4EBC A;  2BM0 A;  3I32 A;  3MM6 A;  4G1Q B;  1SC3 B;  3TA2 A;  4CQ1 A;  3NL0 A;  1R0C B;  2DHH A;  1S5Z A;  1TL4 A;  2CQG A;  2HHX A;  3AQP A;  2B0G A;  3G6X A;  1S7H A;  3AOD A;  2O1P A;  2FPH X;  4C11 B;  4C98 A;  5HMY A;  1SJR A;  4KTQ A;  1QAY A;  4PKD B;  2XBP A;  3J80 Y;  4J9Q A;  1J5E J;  4WFA Q;  3M8P A;  2B5J A;  1BWV A;  3HLU A;  3I5A A;  2FZG B;  1P9Q C;  5G0R B;  3L95 X;  1PC4 A;  3NGS A;  4OHZ A;  2UU9 F;  1IVZ A;  4F67 A;  3EUN A;  5EWE A;  1T9Y A;  3ONQ A;  5D0E A;  2HFU A;  1BGX T;  5HBM B;  3UD3 P;  4QZV B;  1R31 A;  4NLR A;  5BYQ A;  4FBU A;  3X1L B;  1DY3 A;  1VRT B;  3OR2 B;  4FKY A;  4FYY B;  1Q53 A;  3C15 B;  5GAH U;  3PRD A;  2GHW A;  4RUC A;  3MDF A;  7AT1 B;  3HSZ A;  3AH6 A;  3E8O A;  4OQJ A;  1MWZ A;  5BYR A;  5DG8 A;  3VAF A;  4DV6 J;  1Q79 A;  3C14 B;  2QA4 G;  2ASL A;  3W5Z A;  5LOQ A;  1HQU A;  3B4D A;  2YWW A;  1R6Y A;  1U49 A;  6AT1 B;  2HKE A;  1N52 B;  3QWU A;  4DPX A;  1VC0 A;  3DRY A;  3OXL A;  4ECZ A;  3MM7 A;  3NWR A;  3JAM U;  4RNO A;  2JWN A;  2JEI A;  4X4N A;  1KQF B;  4ZDN A;  3DRR B;  3FFI B;  1X9W A;  1LWE A;  4LSL B;  4KV8 B;  1R7I A;  5IT0 A;  1RA6 A;  4FNH A;  2JEG A;  4IOC Q;  1VHF A;  5D6G A;  4B9L A;  2F9J A;  2YX7 A;  5J1E B;  2EK6 A;  1IBL J;  2RVJ A;  4RW6 B;  1YRX A;  5BR8 F;  3OXF A;  2JH3 A;  4KH1 B;  1UFL A;  4MKY A;  4DR7 F;  2LYV A;  1MN7 A;  2WBR A;  5AE1 A;  3DHW C;  3BF4 A;  4J9O A;  5HVF A;  2GW8 A;  4WFZ A;  2C2K B;  3IG1 B;  3HVT A;  2XLJ A;  2I9S A;  4DCP B;  2Q1L A;  3ITH A;  4FF2 A;  3HX9 A;  4F02 A;  4K5R A;  1GX6 A;  2ATC B;  2VBX A;  3QT6 A;  3T41 A;  1HNX F;  1EKR A;  1NHV A;  1KD1 T;  4RJV A;  4LF4 J;  3AD7 C;  4CLF A;  2WVF A;  3K5L A;  4DSL A;  3W2W B;  3I6P A;  3VQS A;  1N5Q A;  3CDU A;  5A8R B;  2FVC A;  2BOA A;  3A12 A;  3MMB A;  5CD4 H;  5T7L B;  3CIM A;  2G0J A;  2M0G B;  4PXD A;  3AFG A;  3TUJ C;  4DPT A;  4TU7 A;  4J9P A;  2CQP A;  1DUR A;  2WSE C;  4LJM A;  3M6X A;  4B3S J;  2Z2Y B;  5DM6 Q;  1Z1Z A;  1M5V C;  3B78 A;  2YWG A;  3BQ1 A;  1SKU B;  2HWI A;  1WEY A;  2KJW A;  3FGV A;  5LMN J;  2D3O R;  1N34 F;  2OEM A;  2OP5 A;  3QSI A;  4EO6 A;  2HPU A;  1YKW A;  4CLS A;  2NXE A;  5KT7 A;  2CNL B;  1XBW A;  3FBB A;  4DV3 J;  2HGN A;  4ZLJ A;  2AU0 A;  1S76 D;  1ZM9 A;  4JBC A;  1IKV B;  3BDE A;  5DDR C;  2F3J A;  4N56 A;  2DR5 A;  2C3P A;  3MMB B;  2V8H A;  1N0V C;  1RT3 A;  5KFX A;  2CDR B;  2M5Y A;  4PZV A;  1N33 J;  2AX1 A;  4Y2M A;  5D77 A;  4FN5 A;  2RT3 A;  2CPI A;  1KLM A;  3SMZ A;  4ECT A;  1DTT A;  3RB3 A;  3FCV A;  3W65 A;  3EX7 B;  1N8R T;  1RTD B;  1TL5 A;  4FVC A;  2C2M B;  2MY7 A;  1RHK B;  2RF2 A;  1YJR A;  1RWW B;  3N5F A;  4S0M A;  3HPO A;  2RUS A;  3KJN B;  2OPS A;  3OQ2 A;  5KFP A;  1SCJ B;  1RZM A;  2CJA A;  4X4P A;  2J0W A;  3SSQ A;  1S9E B;  3MCO A;  4ZIV A;  2HRU A;  1TTH B;  3W8G A;  4JI7 J;  3W7B A;  5EDW A;  4B3M J;  1U2R A;  3OPK A;  4DFJ A;  1PO6 A;  4OI3 A;  2L08 A;  4JI5 J;  4M94 A;  2PMW A;  4K2J A;  2HBQ B;  2W8K A;  4B9T A;  2GNK A;  3D0H E;  3E01 B;  1KLM B;  3FEY B;  5IWA J;  1LWE B;  4C8K A;  1W7W A;  3F44 A;  2ZVI A;  3VTI A;  3DRR A;  2DJW A;  3FFI A;  3QGH A;  5THW A;  2RQ4 A;  1HFE L;  3UW1 A;  1JNZ B;  4DU7 A;  4ED3 A;  4B9N A;  3D28 A;  3MM7 B;  1U1P A;  2PGC A;  2YNH A;  4TYB A;  2OAU A;  2HHS A;  1QSL A;  1P8G A;  2MQN A;  4QPT A;  4B3T F;  3HK2 A;  3VGU A;  2F63 A;  4RL1 A;  3I4H X;  3CDE A;  2C2N A;  2YNG A;  3C14 A;  4EYI B;  1CJV B;  1EQM A;  1ZA1 B;  2XM3 A;  4HYK A;  2H5J B;  5F9N A;  3KLE A;  4USI A;  2GML A;  4WU2 A;  1N6Q B;  1WC3 A;  4QYR A;  3K8V A;  1VQ9 S;  4DR1 F;  3G87 A;  1RCX B;  1H38 A;  4XPC A;  4J91 A;  2QV6 A;  1K44 A;  3GCX P;  4OHV A;  2BJ8 A;  3BM7 A;  3HT0 A;  1XC9 A;  3KK1 A;  4ZP7 A;  2YVS A;  1FVS A;  3D0I E;  1SUQ B;  2MXY A;  2BAB A;  3OL7 A;  4TXS A;  4AUK A;  4ES3 A;  3CJK B;  1KVK A;  5HLF B;  3VR1 A;  3VAL A;  4NA3 A;  4OI1 A;  2MKI A;  3FSY A;  3W2W A;  3BDP A;  2VAS A;  5LL6 d;  3UNY A;  1HBO A;  1F9E B;  2XHC A;  4CO1 A;  4DL2 A;  1QTN B;  2V50 A;  3PW0 A;  1RWO B;  3KHG A;  3GSD A;  2GJF A;  1KOH A;  3BKT A;  3GYX B;  3IXQ A;  2OTL S;  4J7C A;  4LF9 F;  3SCK E;  4KHP F;  1R8P A;  5AE3 A;  2OPP B;  1C0U B;  1NLK L;  1QAX A;  1F9H A;  2V5H G;  2BE7 D;  2F40 A;  2ZE2 A;  3NGK A;  4DL0 C;  4QOT A;  4DR3 J;  4ZVP B;  1FWK A;  5B0B A;  3MM8 B;  2VKZ G;  2D3U A;  1SQF A;  2OUG A;  2MLX A;  1GH8 A;  5DLG A;  1KEK A;  3P8B B;  3OSN A;  3HKZ D;  3WX8 A;  3PYE A;  1S6Q B;  2F65 A;  5LMN F;  4DV2 J;  1H98 A;  1M5H A;  1FX4 A;  3H8Y A;  3U7J A;  2EEY A;  3HDS A;  2VFU A;  4NEZ A;  3HHE A;  3SDE A;  3MUR P;  2DRA A;  3ILO A;  4FNI A;  3WQP A;  2BOP A;  3VAK A;  2XY5 A;  3F0N A;  1L3K A;  2F8E X;  1RWX B;  2W2O P;  1RWU A;  1EP4 A;  1WC0 A;  3GLJ A;  3M7V A;  5E3C A;  1IBM F;  1T94 A;  4N41 A;  1BC6 A;  2O3D A;  1S7I A;  2DNG A;  3GWC A;  4WFX A;  2I6W A;  4BC7 A;  2RIL A;  3IS9 A;  3KG1 A;  2EC0 A;  1JIH A;  2B4V A;  1YDL A;  1YVF A;  4WPA A;  2NS1 B;  2SXL A;  2AJ2 A;  2QG9 B;  5K5M A;  1T3N A;  2OI2 A;  2V69 A;  3QGG A;  1TFY A;  4QIW D;  4DV7 J;  2VG7 A;  1LWX A;  1FD8 A;  4Y34 A;  4WCE Q;  3OT9 A;  2KO1 A;  2AJ1 A;  2V67 A;  3FEZ A;  1KSP A;  3DLL Q;  3RW7 A;  2FHO B;  2CKW A;  1NSP A;  3CDB A;  2OHD A;  2FVR A;  1OY6 A;  4LFC J;  3B82 A;  3K5O A;  1S99 A;  3GFH A;  1ZA2 B;  4DEZ A;  3W61 A;  3MAA A;  4QR0 A;  5RUB A;  4Y0F A;  1Z4U A;  2JVR A;  2DNO A;  4D3H A;  2JHE A;  2FC8 A;  3ZZZ A;  3BYP A;  5CAB A;  2J0S D;  2NZC A;  4XIU A;  2HHW A;  1JQG A;  2GVD A;  3EWG A;  4PG4 A;  2IYI A;  2HAF A;  1QUP A;  4XTT A;  4X65 J;  2CQ4 A;  3BGR B;  4BWJ A;  1YJN S;  1XNR J;  2WVE A;  5LXY A;  4A8S A;  1LXN A;  5IC4 B;  4G1Q A;  5K8N A;  1G6B A;  1Q7L B;  4YFU A;  4YB7 A;  4ECU A;  1L3V A;  3TUP A;  4LF8 F;  4LF5 J;  1RHQ B;  5LJ3 Y;  1K9M T;  4PUO B;  2AJ0 A;  4PYA A;  1Q16 B;  3TJA A;  1XIQ A;  2IMW P;  3M05 A;  3HVR A;  2UV8 A;  3IBC B;  2HIQ A;  3DHX A;  4Q43 A;  3D3B J;  1R43 A;  4PXE A;  5HAN A;  1L3U A;  5T41 A;  1WOS A;  2MKC A;  2HNZ A;  3BPD A;  2POK A;  3UQS A;  4LRB A;  1FK9 A;  1FWL A;  1U2F A;  2WB4 A;  1AYE A;  3QFW A;  4J5O A;  3NS6 A;  1BQN B;  3PHE A;  5KFO A;  1Y5L B;  1VR6 A;  4TN2 A;  7FD1 A;  3HCX A;  1YHQ S;  2J6S A;  4QU6 A;  4HVZ A;  1L3S A;  2YWH A;  4HT7 A;  3M6W A;  1YZ6 A;  2LU2 A;  2C42 A;  1FFG B;  2HFZ A;  3WBZ A;  1YBT A;  1MU2 A;  2RJZ A;  1JJ4 A;  1VQ8 S;  4NLD A;  4DPU A;  2P5V A;  1X9S A;  2XSJ A;  5F9L A;  1TVR B;  3I96 A;  1EAR A;  3MUV P;  4DV5 F;  2JZ5 A;  2XNR A;  1OY8 A;  2A0F B;  2AF6 A;  2BJE A;  3AT1 B;  4QJV A;  4TLR A;  3W9I A;  1Q8K A;  4HEA 9;  1REG X;  1WF1 A;  1V3S A;  1D3W A;  1U8W A;  1X8D A;  1N5Y A;  4G1I A;  2PDA A;  2QSW A;  2PSZ A;  2KVI A;  4I6Y A;  4DR1 J;  1X5P A;  2COL A;  3GIM A;  3QGP A;  2CQB A;  3UE2 A;  5HMZ A;  3BZQ A;  4KYZ A;  3W66 A;  4C48 A;  3Q0A A;  3CVK A;  2WON A;  2HMI A;  3PO5 A;  4LF4 F;  3K17 A;  2X7I A;  4IR1 A;  4LSN A;  1HHS A;  3WIV A;  4DFM A;  4F4X A;  2YQ0 A;  3RW6 A;  2WK4 A;  4NZ0 A;  3GQC A;  3MUM P;  2FB0 A;  2EWH A;  3WC2 A;  1IR0 A;  1GEH A;  4KY3 A;  1WJ9 A;  4Y00 A;  1Q86 T;  2R8H A;  3LP2 A;  3RR8 A;  4QYZ K;  2LLZ A;  5CYM A;  2EFN A;  1PJ7 A;  1F2H A;  1HWI A;  2KVQ E;  3GB0 A;  3KG4 A;  1X31 C;  4K7Q A;  2HHP A;  3BGL A;  4A8K A;  1IN0 A;  4NLG A;  4DUY J;  5B0G A;  3A3P B;  2J76 E;  4OLO A;  3MR2 A;  1HYS B;  1KBR A;  4OJG A;  3LWL A;  1LXJ A;  2CPH A;  3CSK A;  3P5B P;  4B9V A;  1TL3 B;  1U09 A;  2OFG X;  3A4T A;  5A2Q Y;  4EBD A;  1RIS A;  3ENV A;  4P72 A;  2ROE A;  4ZIW A;  1RHU B;  2JOQ A;  3Q8Q B;  2N4D A;  3BSA A;  2A1B A;  1K1S A;  5KG1 A;  1ELO A;  3UR3 C;  2VOD A;  2ZEJ A;  2Z4P A;  5A8K A;  2R2S A;  5LM7 E;  5JVG Q;  5D3G B;  5HAT A;  1S1X A;  2F4F A;  3T9Z A;  5HP1 B;  2OPQ A;  3LAL A;  2GMJ A;  4LT6 A;  4M5N A;  4OI6 A;  5AXL A;  5KOW A;  1ZYQ A;  2J7K A;  4ANE A;  1WSV A;  4IFV A;  1NJZ A;  1W2I A;  1FNX H;  4MK7 A;  3M8Z A;  3MPU B;  5KT4 A;  2XZD B;  4CLL A;  2KG0 A;  3EZ5 A;  1JX4 A;  1UVN A;  1HNV B;  2DNL A;  1GX5 A;  3F41 A;  4GRS A;  5F8H A;  5KG5 A;  2XMA A;  3KLH A;  2PMH A;  2CXE A;  3DMJ B;  5D8H B;  3MPD A;  4ETZ A;  2W01 A;  4B9M A;  4PQU A;  1FEH A;  1FRX A;  1T9V A;  2GAH C;  2R3V A;  2VKR A;  3DC2 A;  4I0W A;  4P75 A;  4IG3 B;  3ET6 A;  4UOF A;  1YSJ A;  5B0A A;  3KJF B;  3UNG C;  2AYE A;  3TAR A;  4JV2 A;  3AA9 A;  1NCL A;  3W63 A;  1RT6 B;  4F3Q A;  1NHU A;  3I31 A;  2HZA A;  4NLV A;  5IZH A;  3PW2 A;  1FKO A;  5A2Q U;  3RR7 A;  2ALZ A;  3CED A;  4PWD A;  2ZZT A;  4XDD A;  4YB5 A;  4YUD A;  2IVY A;  3C6T A;  2Z57 B;  2RUG A;  3T5K A;  2B7B B;  4LF1 A;  1YI2 S;  4I67 A;  4E8U A;  4J9M A;  1JLF A;  4KJI A;  1VQS A;  1AFI A;  1LFP A;  5AE2 A;  3BB5 A;  1TR0 A;  1RSC A;  2GQQ A;  4N8O A;  4Q2L A;  5J1P A;  1EIY B;  2CPF A;  2F4V F;  2GFF A;  2IDL A;  2QYG A;  3LAK A;  1VC5 A;  2N7C A;  4DLE A;  3OFF A;  5F8N A;  3Q83 A;  2BMB A;  3OHB A;  4JI1 F;  3SCL E;  1V9O A;  2QO3 A;  1RT1 A;  3OL6 A;  2GGP A;  3QID A;  2G1D A;  4IQX A;  1MRO A;  3QT8 A;  5T14 A;  1QVF R;  2B6A A;  1H6K X;  2IA0 A;  3QPI A;  3ETO A;  4DXL A;  3IP0 A;  2HGM A;  2E44 A;  3R5A A;  4WJB A;  1ULR A;  1WOR A;  4KGZ B;  2V6A A;  5JJB A;  2EBE A;  3U1L A;  3ZZR A;  4CNY A;  4EMD A;  3PX0 A;  1S6P B;  2EFP A;  3MGJ A;  2WOM B;  3E3X A;  3DKD A;  2XEX A;  1HNZ J;  2DGT A;  3N6L A;  3JTO A;  3CJT A;  2MEW A;  4C7Q A;  2RQC A;  3KOA A;  2BVZ A;  4O3Q A;  2DNM A;  2W8L A;  1LWC B;  2LEP A;  2GC8 A;  2DIU A;  2W7A A;  4GMK A;  4DHV A;  2KHC A;  1VYA A;  2PA3 A;  3IA0 A;  1FKO B;  3HI9 A;  2C2O B;  3DYA A;  4J9R A;  5C25 B;  5IT9 U;  2XMK A;  2LCW A;  2MMY A;  4Q8F A;  4CYU A;  1VFJ A;  4F4A A;  3EVM A;  4UQG A;  2KU7 A;  4ETX A;  5L1K A;  2KN4 A;  1RJJ A;  2ASY A;  3VAM A;  5A8W A;  3OFH A;  2W24 A;  2BBE A;  4X66 F;  4DG1 B;  3OJU A;  5B7W A;  3O6Q A;  1SJ4 P;  2XI2 A;  2IHR 1;  3M8S A;  1WKK A;  1H3D A;  2XMJ A;  3DMJ A;  4A4J A;  1DQ9 A;  3KLH B;  1VQ6 S;  4A47 A;  1T03 B;  2VPW B;  2DVI A;  4B3S F;  1YJW S;  1WTF A;  1NEE A;  3KKF A;  2X1F A;  4IFV B;  1OPZ A;  4O44 A;  4IO9 Q;  4ZK7 M;  4DSK A;  3A3O B;  3HZE A;  3DDK A;  4WYW A;  1R0A B;  3GIJ A;  1JLC B;  4P10 A;  2QFI A;  1XK8 A;  5J2Q A;  5HP1 A;  4ZCK A;  3BGU A;  1HWJ A;  4NXM F;  5AXK A;  5B0E A;  4DV3 F;  2NZ4 A;  2KXF A;  2ROP A;  1WEZ A;  5GAG U;  3DOK B;  3MCM A;  1QTM A;  2DGV A;  2V8P A;  3MAQ A;  3F73 A;  2ASJ A;  3M8Q A;  2VC0 A;  3PTW A;  3UO0 A;  5DDO C;  3IMQ J;  1Y5N B;  1GNK A;  1SQG A;  3PCO B;  2GAG C;  3SYZ A;  4C8Z A;  1U0H B;  5DO2 A;  3GIL A;  2CPJ A;  3MED A;  2IY5 B;  2LFV A;  2M88 A;  5D4L A;  4X2B A;  3CCV S;  3DN9 A;  2DT9 A;  3SV3 A;  3KLF A;  4AXJ A;  2UXD J;  1AW0 A;  3M9O B;  4CH7 A;  1NK0 A;  1D8Z A;  3EGV A;  1NPP A;  1JLF B;  1ZM2 A;  2XYG B;  3ULH A;  3ZTS A;  2YWK A;  2UZA A;  2CNN B;  4TVA B;  1ZTW A;  2G9O A;  4ZPB A;  1VBZ A;  2GZO A;  3PYD A;  1QSY A;  2YKP A;  3K8W A;  3THT A;  4RLE A;  4B3M F;  5D4N A;  4JI5 F;  4K0K J;  5D4O A;  3R9L A;  5KG3 A;  4C8L A;  4OLP A;  2ZH6 A;  1KRP A;  1ZAX A;  1NPK A;  4OV6 A;  3FDS A;  1DLO A;  5E41 A;  3BJY A;  4DR5 J;  2A6M A;  4V19 X;  3LP0 A;  2RD5 C;  2J9E A;  4E0D A;  1VCT A;  3TUI C;  2RQK A;  4RKU C;  1RWM B;  4Y65 A;  3HHL A;  1VMB A;  3BQ0 A;  2A10 A;  2RSQ A;  4J9K A;  4R0J A;  5B0D A;  4DCJ B;  4CZC A;  3VCD A;  3M2V B;  3FBE A;  1KON A;  3L9Z A;  4OJH A;  1VHI A;  2V2Z A;  3JQK A;  1JMT A;  1FF2 A;  1TVR A;  3T6B A;  5B08 A;  3JQM A;  2LA6 A;  3ILI A;  5K9F A;  2PII A;  2JJ4 D;  4B08 A;  2CZ9 A;  3MOJ B;  4UOH A;  1IR1 A;  3Q86 A;  4U7U K;  3X3U A;  4I7F A;  5GMD A;  3E2E A;  4BHQ A;  3CD6 S;  2HHQ A;  5H9F K;  2YBV A;  1WNE A;  2V9W A;  3DI6 B;  1IR2 A;  2GJI A;  3VWS A;  1FX2 A;  4ZN3 A;  1I94 F;  3M2R B;  1RAA B;  5ITH A;  2HNZ B;  4TU8 A;  2GO9 A;  2IRY A;  3MEC B;  4P7T A;  2CJ9 A;  2DEI A;  2CZV C;  2PN6 A;  3AD8 C;  4LRF A;  3OL9 A;  2FLN A;  1D8Y A;  2N7Y A;  3R5J B;  4UST A;  2XB2 D;  2GS8 A;  4F3M A;  1CJU B;  5E3Q A;  1B70 B;  2DH8 A;  2R2R A;  2HVI A;  5CYM B;  4CIO A;  2DGO A;  2L48 A;  3W5X A;  2I5J B;  3BR9 A;  3VGT A;  4U6P A;  1NKE A;  4DR3 F;  1XN9 A;  3D2W A;  2J7W A;  3PG9 A;  5GME A;  4EBE A;  3W8P A;  3HHN B;  1NK5 A;  4IDK A;  2UVW A;  1TEL A;  3GIK A;  3HD1 A;  1ZZF A;  2GVD B;  4O3R A;  2DR7 A;  4ILL A;  4QR2 A;  2FJD B;  2ZIT A;  9ATC B;  2WON B;  2BA9 A;  3BV8 A;  3G8S A;  3E51 A;  4CT8 A;  1P1L A;  4K4X A;  1S48 A;  1VBY A;  3C3L A;  1VIO A;  3J7Y U;  4NXM J;  3KWM A;  4FPI A;  5HVH A;  2GIR A;  3DRS B;  2Z2L A;  1IQT A;  5J1N A;  3CT9 A;  4DSF A;  2VG6 A;  2ZD1 A;  1HI1 A;  3N5B A;  4CTA B;  3TZX A;  1NKB A;  4QU7 A;  4JV5 J;  3QIP B;  2ZKU A;  1SJF A;  4USW A;  1NK9 A;  2O5D A;  4C8Y A;  3D4J A;  2V4R A;  1R3N A;  4FKX A;  1VQO S;  3ZZY A;  2X1B A;  2CJB A;  3D6M B;  4ER8 A;  3HSJ A;  3TVK A;  1SJ3 P;  1HI8 A;  1K73 T;  2KFN A;  1XMB A;  3AJ2 A;  1S10 A;  4KHM A;  2BE2 A;  2IPO B;  2YKQ A;  1IKX B;  4LIW A;  2BQU A;  2YPY A;  4NYO A;  4X4R A;  3TAQ A;  4B9U A;  4IRD A;  2P9E A;  4ZCL A;  3JTN A;  3RYL A;  3OTD A;  3C46 A;  2H48 B;  4ZS6 A;  3HHL C;  3TX8 A;  4ED6 A;  2Z2Z A;  2HFS A;  4RW4 A;  3IC1 A;  4JV0 A;  2JC1 A;  4WKY A;  1JLG A;  1QLN A;  3NMR A;  4K50 A;  3NBP A;  2NQP A;  2DO4 A;  3MMC A;  4HHJ A;  3V6H A;  1QAI A;  3FKB A;  4YR0 A;  4QWE A;  2EW9 A;  2IRX A;  3FK4 A;  3J81 Y;  1MG7 A;  4WZQ A;  1AUS L;  4X4S A;  2AP6 A;  4NRU A;  4U8V A;  5L9X A;  1FFW B;  1IBM J;  4OZ3 A;  4PWW A;  2KT5 A;  4PG8 A;  4ILM A;  2XO7 A;  3DLK B;  1R8C A;  1TAU A;  1S1T A;  4CM0 A;  3DI6 A;  4O0I A;  3CCL S;  3T3F A;  1OQ6 A;  2VJU A;  5LJ5 Y;  3J7Z 5;  4JI1 J;  4C6A A;  1RXO B;  1RT4 A;  1OYE A;  1RAF B;  1MML A;  1SUQ A;  1U7L A;  2P9C A;  3H59 A;  5M2U A;  4F4W A;  4OYI A;  1RTH B;  3LF0 A;  4ZLL A;  3BS9 A;  3N79 A;  3MXH P;  1T9X A;  3FMW A;  3PJ9 A;  3DFE A;  1MN9 A;  1T0T V;  2ADB A;  4EZ6 A;  1JK9 B;  3AHP A;  3I0S A;  2LU1 A;  3TRG A;  2XG8 A;  4YY3 F;  3MEG B;  5J2P A;  3HHL B;  5HJY A;  2FTR A;  1RB0 A;  4RW8 B;  2HLU A;  4MTP A;  1M5P C;  2R8K A;  2XI3 A;  4YEA A;  4DX8 H;  5M2P A;  2DIV A;  1TKZ B;  1MMN A;  4C9D A;  1WKJ A;  4PG7 A;  2NSB A;  3LPY A;  4OJ1 A;  2ZJQ Q;  2FZK B;  2LXU A;  4A8F A;  2B9X A;  1UW9 A;  1KHV A;  4ZCM A;  1S59 A;  5CZX A;  2YTC A;  4RU9 A;  4F26 A;  1TL7 A;  3M8Y A;  4ELV A;  1IJF B;  1QDU B;  4Y6I A;  1ICE B;  3HF5 A;  4K4Y A;  3T1Y F;  3TW0 A;  3FSI A;  2E5L J;  2Y8W A;  1YZ7 A;  3UDE A;  3Q8U A;  4A8W A;  3OTC A;  4ZVR B;  2KM8 B;  2ZVS A;  2VC1 A;  3CJS A;  3LGH A;  2CQ0 A;  3G8T A;  2MJN A;  3M30 B;  4ZP8 A;  1U47 A;  2FUG 9;  1HI0 P;  4K4S A;  2AIR B;  1B7F A;  2GV1 A;  1H2U X;  4WE1 A;  2FJB B;  4ENO A;  4OMF G;  2OPP A;  3VVU A;  3IRW P;  3BBC A;  4DF4 A;  1JLE A;  5CQG A;  2AD9 A;  4M5I A;  7FDR A;  1A7G E;  4FYD A;  2Q79 A;  2APO A;  2RF2 B;  1NK8 A;  4K5S A;  4KIA A;  1NRK A;  2V8V A;  4J9V A;  1DTT B;  3K89 A;  4NX9 A;  4WFB Q;  4YOE A;  4C0O C;  4YP3 A;  1S72 S;  1M5S A;  1TUV A;  3ISN D;  4HDG A;  5F41 A;  1KHW A;  1BQM A;  4MT1 A;  4JI8 J;  2KH9 A;  1UA0 A;  3GPA A;  3U27 A;  1Y00 A;  2MQL A;  4OX9 F;  3QSY B;  1JLC A;  1GXL A;  4B17 A;  3OTO F;  2CA9 A;  1M5O C;  1RLC L;  4KQZ A;  2BRL A;  2W25 A;  4DPO A;  5I3U A;  3BSO A;  5GMK a;  4NAS A;  4C3M A;  5MAO A;  2ZH9 A;  2ZBQ A;  5KFF A;  4DL7 A;  1N0U A;  3L3C A;  1FKA F;  5DQI A;  1FKP A;  4C0B A;  1OS5 A;  2PC6 A;  2NR0 A;  3GG0 A;  4X4V A;  3G96 A;  3TVZ A;  4WFY A;  4F2S A;  4DL4 A;  2MKJ A;  1G1X A;  1RAH B;  1RGV A;  3HD2 A;  4ECV A;  1V5V A;  1EKS A;  1AA1 B;  3C16 B;  4BBY A;  1U02 A;  2AGP A;  2R8I A;  3DYA B;  2LXI A;  2BKN A;  4ZN1 A;  5HVG A;  1KC8 T;  1ZM3 A;  3QLH A;  4I4B A;  1H7W A;  3VV2 B;  4ES2 A;  1NPR A;  1WAC A;  1N4L A;  1IJE B;  3GTY X;  1SQE A;  3DDI A;  4ED5 A;  2DHA A;  2H51 B;  2M52 A;  1FDB A;  1Y11 A;  3PVX A;  3H2U B;  1X60 A;  2XWY A;  2DYA A;  4LF2 A;  4OZ1 A;  3UCU P;  4NLQ A;  3U1N A;  4DFP A;  4OI0 A;  3PFO A;  4WU3 A;  2CVE A;  1S9E A;  4KSE B;  3MEE B;  4OYB A;  1YJU A;  2B4O A;  1NDC A;  5ETK A;  1NSK L;  3RJM B;  3RAQ A;  4AL5 A;  5EHH A;  3UDC A;  3R2D J;  2CDQ A;  4I2P B;  2AYG A;  2MY8 A;  2MQQ A;  2NXC A;  4HI2 A;  4DUY F;  4HKQ A;  3IRX A;  3MPV A;  3GON A;  3W62 A;  4JI0 F;  3TZZ A;  3LW5 C;  1SBR A;  4YY3 J;  1U24 A;  2IJR A;  2YPZ A;  3A1Y G;  5DGB A;  5L9N A;  2MZJ A;  3RZA A;  3OLB A;  3N01 A;  1SKR A;  2IBK A;  2XMT A;  1TKZ A;  3US5 A;  2KFY A;  3IM9 A;  3MR6 A;  1VJW A;  4WK3 A;  3ELH A;  3JQJ A;  4IFY A;  2FHJ D;  3TJ9 A;  2WSF C;  3C15 A;  3FRZ A;  3TJ8 A;  3W9H A;  3FBF A;  4U95 A;  1YTY A;  4OHY A;  1GXT A;  1WOO A;  5IQ6 A;  2VFS A;  2YY3 A;  4X4O A;  1GFW B;  5L46 A;  3ZZP A;  4MIB A;  4RBT A;  5DDP C;  1B4S A;  1BHN A;  1X4F A;  3N28 A;  3KJV B;  3CJ2 A;  3W2V A;  3MTK A;  3GII A;  2UUT A;  1RT4 B;  3SFU A;  3CMQ A;  1S79 A;  4CRJ A;  5LMU F;  1LOU A;  2OO4 A;  2IBO A;  4AYB D;  1B0V A;  3ET6 B;  4OFZ A;  1X4E A;  3TZY A;  4YB1 P;  1S6O A;  2DK2 A;  2V0N A;  3IN5 A;  4F50 A;  4DUZ F;  4PQU B;  5DG9 A;  3KHH A;  2LQJ A;  2CPE A;  1EZZ B;  1FRL A;  2B4P A;  4RUB A;  3V6D B;  3RB0 A;  4F04 B;  1HNV A;  3QAU A;  1JB0 C;  1OSD A;  1OIA A;  2DGW A;  2WB1 D;  4JV5 F;  4YDX A;  2LXF A;  3AY0 A;  3BGO P;  3HT3 A;  2X51 A;  3TWZ A;  2IDE A;  3Q22 A;  5HRO A;  3BSN A;  1K0V A;  1J5O B;  1FXR A;  3CC4 S;  4IG0 A;  4RUA A;  2YWF A;  1RTI A;  4ZPA A;  4RW6 A;  4DR4 F;  3Q8R B;  2EKN A;  2XS2 A;  2HSE B;  4WII A;  2FHJ A;  3TP2 A;  5CYQ A;  5HQ8 A;  3H5U A;  5LT5 A;  4RZR A;  4YDD B;  1RK8 A;  1UVI A;  1FRM A;  2VH7 A;  1UEU A;  1YX2 A;  3H5X A;  1N5T A;  4KGX B;  5E5N A;  1HBM B;  2WSC C;  3LO3 A;  2WVD A;  2XS7 A;  5MLC V;  1SPB P;  2KL8 A;  2XYP B;  5FLX Y;  1JLQ B;  1F6T A;  1T02 A;  3IGV A;  5SUH A;  1EB0 A;  1HQU B;  1P9Y A;  1TP7 A;  4U7C A;  3J7Z T;  1PGZ A;  2J8S A;  3OR1 B;  3IR6 B;  2FDN A;  1FJ7 A;  1F60 B;  2BM1 A;  4JV1 A;  1GMU A;  2Z0G A;  3H98 A;  4J9U E;  1UP1 A;  4ZJO A;  5FDL B;  5KFQ A;  1TMM A;  1YWX A;  2ZBI A;  1K0T A;  5ETR A;  2CJK A;  1J5E F;  2VIH A;  4K8R A;  1NM2 A;  4N8N A;  5IV4 A;  1T11 A;  1IBK F;  2HK3 A;  3CO0 P;  2UUA J;  2KDO A;  3VQT A;  1HNZ F;  1M1G A;  5HK4 A;  4MYT A;  4RWW A;  1FTC A;  4KGK A;  3RGI A;  1R0B G;  1GMV A;  2H5I B;  3D67 A;  2BE9 B;  1YQH A;  3CXC R;  3PY8 A;  4ICL B;  2DHG A;  4AQY F;  4K4Z A;  3RTV A;  2YWE A;  3UR0 A;  5E3P A;  2BW2 A;  5CZV A;  4IRC A;  3J7A 1;  2B7C B;  4MIA A;  3CB4 A;  2W9A A;  3J81 U;  1NXI A;  2R7W A;  4ED4 A;  1NBE B;  1PBU A;  2ZBR A;  1UEK A;  3JS9 A;  2K1R A;  3N9U C;  2KB2 A;  1VRU B;  3EPG A;  2RRN A;  4K4W A;  2B4U A;  5BXI A;  5D0G A;  4O4R A;  1CJK A;  1SV5 A;  1X5S A;  2A2C A;  4KFB A;  1NJX A;  3EVW A;  4H54 A;  1LW0 A;  2AHO B;  3KFW X;  1CJU A;  5D0R A;  5KFH A;  5KAK A;  1MU2 B;  5K8P A;  2XMV A;  2RDJ A;  4QCL A;  2IAJ A;  5IT9 Y;  3CF5 Q;  4YR3 A;  4WFN Q;  4DJB A;  3PO4 A;  3ISZ A;  4M95 A;  3N6M A;  1Y5I B;  4J9N A;  3H4B A;  4DZ6 A;  3B8H A;  3GYG A;  1BQN A;  4P2X A;  3I0R A;  1RT5 A;  4ZKA A;  1S1U B;  2DD8 S;  4MJK A;  2QT7 A;  1RT5 B;  4QWB A;  4UY8 5;  4NEY A;  2CQI A;  1ZZN A;  1E6V A;  1UMJ A;  1XR6 A;  5KT3 A;  3I82 A;  1U4B A;  1Q4R A;  1JLB B;  2E1R A;  3OD2 A;  4CH0 S;  4N47 A;  4DS4 A;  4I7F B;  4QR1 A;  2V2V A;  3GYN A;  4QPX A;  1F3V A;  2ZDO A;  3CC2 S;  4K0K F;  5E2Q A;  4ZVO B;  1LW2 A;  3CCQ S;  4ECQ A;  1HBU B;  3KUE A;  1TAQ A;  1PJ6 A;  5KFR A;  2H5E A;  4LF7 F;  4ZCI A;  4DR5 F;  3TR5 A;  4JB8 B;  1C1B A;  3D3C J;  3V6K A;  3BGR A;  4USU A;  2YKM B;  4GKK J;  3WX4 A;  1FXL A;  1VRU A;  1KDN A;  2G2O A;  5AJ3 J;  1WDT A;  2CQD A;  2K1R B;  4QQB A;  1WD6 A;  2XNQ A;  1FEE A;  1UPP A;  3AJ1 A;  1X0F A;  4DPW A;  3H4D A;  1GMW D;  1V6H A;  2O67 A;  1XNQ F;  4P9S A;  2FQQ B;  1ARO P;  1PAE X;  5ETO A;  3W64 A;  4ZJL A;  2JLE A;  3GFY A;  4HI1 A;  4ZP6 A;  4EWT A;  2XMM A;  1VBX A;  4Y28 C;  4FF4 A;  2DRB A;  4B3O B;  1K47 A;  2GVZ A;  1JWW A;  2YNI B;  1D0E A;  2NRE A;  2G2Z A;  2FC9 A;  2E5H A;  4NWB A;  2H1Y A;  1NO8 A;  1HR0 F;  2UUB F;  3EYZ A;  4KGM A;  1BMQ B;  3GZ7 A;  2ERR A;  3MD1 A;  1VQ7 S;  3M6U A;  5FDL A;  4PR6 A;  3NGU A;  5D0H A;  1FNO A;  2OPR B;  3W5Y A;  2MSS A;  3A13 A;  2VU5 A;  3CGI A;  3FZ2 A;  4LF6 F;  2ZZN A;  2W2Q P;  3KG0 A;  4F0M A;  4ZMM A;  2DXF A;  2YKN B;  5KFS A;  3DM2 B;  4B3T J;  3MED B;  5KFU A;  3MHY A;  2G1H A;  2L9N A;  3IWX A;  3DGV A;  4URQ U;  1HBM A;  1VC6 A;  5ETN A;  4FF3 A;  1WTB A;  3PR5 B;  1S1W A;  1UVM A;  1VRQ C;  4Z7Y A;  1G4C A;  2FY8 A;  3CJ5 A;  5GAE U;  3ENA A;  5A6W A;  3JSR A;  1VGY A;  4M5H A;  4PXC A;  2KXH A;  4MH8 A;  2OML A;  1RTI B;  4LQ3 A;  1UWB A;  1RWP B;  1NDK A;  2F8H A;  5LSR A;  3HM9 A;  4J9L A;  1K8A T;  3J7A N;  1EHW A;  5KFN A;  1ZAV A;  5L38 A;  3FSX A;  1U45 A;  1JKH A;  1OWX A;  2IC3 A;  4O44 B;  3P45 B;  3DRP A;  4M5D B;  2QFJ A;  1C0U A;  4LBH A;  3IO1 A;  4GKJ F;  1S9G B;  1MWQ A;  4ED7 A;  3N4W A;  1IKW B;  1AZS B;  3L7U A;  3P3D A;  4EYH B;  1FA0 A;  1HBO B;  2B9Y A;  1PYT A;  2CWK A;  3BH7 B;  3UN2 A;  4YHH J;  5KFT A;  2Y1I A;  2QMW A;  2QMX A;  4CWB A;  2X1G A;  5KG2 A;  5I42 A;  4ECW A;  4JI6 J;  4NI2 B;  3CJK A;  5HLF A;  1W2B R;  2R8G A;  3VAG A;  1HNI B;  1N88 A;  2PFD A;  3M6V A;  5F8G A;  5C25 A;  4NLY A;  2P2C B;  1RAC B;  2OH2 A;  2RIJ A;  2WRM A;  4KT0 C;  3PDN A;  2HS3 A;  3NEK A;  2HQI A;  5I4M A;  2Y1R I;  2FIU A;  4XO0 A;  5J2M A;  3GV5 B;  4GO7 X;  4NLO A;  2IM2 A;  2JFK A;  2VOO A;  3PZP A;  2FVP A;  2RNE A;  5C7P A;  2QLJ B;  1S4F A;  2I8E A;  2J7U A;  2VIC A;  3G71 S;  4AL6 A;  5CH7 B;  1S6P A;  1UWA A;  3OFG A;  1Y7P A;  2U2F A;  3OTB A;  3UVJ A;  4A46 A;  4CO3 A;  4G65 A;  4ZPT R;  4NLS A;  4O0N A;  5C2G A;  4GC7 A;  4W92 B;  1JJH A;  2H3E B;  2KZZ A;  1TK0 A;  1R8H A;  3CJ4 A;  3AOA A;  5KT5 A;  2UUA F;  2ASD A;  3DNC A;  1YJ9 S;  5GAE I;  4RW9 A;  4NLU A;  1GMW A;  3MTJ A;  4LSZ B;  3M1V B;  4Q44 A;  4ED1 A;  2Q43 A;  3VVT A;  1SI9 A;  4F4Z A;  2ZOF A;  5J2N A;  2KYX A;  1U1O A;  4C4W A;  4DV7 F;  1U1R A;  2XSF A;  2RHQ B;  4I2P A;  3I5C A;  3T5H A;  1NJY A;  2VDI A;  1ITP A;  2NXN A;  1F5C A;  3EE3 A;  2MKK A;  3MEE A;  4OX6 A;  1IKY B;  1BY9 A;  2OEK A;  1Q5V A;  3L4B C;  3OFE A;  2E9T A;  1FRH A;  3EZO A;  4NZ7 A;  1FES A;  3BPS P;  3H7H B;  2HAI A;  3D1H A;  1OQ3 A;  1SC4 B;  2UUW A;  4RX6 A;  1H74 A;  4UW2 A;  3KLG B;  2BX6 A;  3NKY A;  2FD2 A;  2HGL A;  4PWU A;  3CTR A;  3PR4 A;  4KKO B;  3CW2 C;  2F8M A;  9RUB A;  1RTD A;  2HW3 A;  1B7Y B;  2XY6 A;  3DLE B;  2KZM A;  3TAM B;  2IM3 A;  2B8Q A;  3PJX A;  3QLH B;  4M5M A;  5EUH A;  2RRB A;  4QW9 A;  1TL1 A;  3T5L A;  3RB4 A;  1T8E A;  2K7K A;  3DGP A;  2G0C A;  3QJL A;  3C16 A;  1HHT P;  3KK2 B;  4NI2 A;  4RUH A;  5ADZ A;  1B3T A;  1YK9 A;  4CO0 A;  2BEF A;  4RNN A;  2OSQ A;  5IT4 A;  4C8N A;  1DHM A;  2HWT A;  4IUF A;  4LF8 J;  4L75 A;  1IKW A;  1AZS A;  3UD4 P;  3LP1 B;  2EFQ A;  2GQ2 A;  5HAO A;  1GXU A;  3EXC X;  4PQA A;  2WVB A;  3JB9 k;  3PXG a;  3D68 A;  4R8U B;  4PEO A;  4PPZ A;  2MQ8 A;  3BH6 B;  2ZH3 A;  5C24 A;  2YQ1 A;  1VQ4 S;  2RH3 A;  4X4U A;  1UWB B;  2DR6 A;  2ACM A;  2R42 A;  3HKW A;  3MEK A;  5EGY A;  4TY8 A;  3OVA A;  3Q23 A;  4GKK F;  1BQM B;  1Y4Z B;  2YKO A;  3NWG A;  4OYP A;  4WTY A;  1LNQ A;  3M8R A;  3EDQ B;  2R2U A;  4LF5 F;  1IXK A;  2L3M A;  4X84 A;  3NXZ A;  1VQK S;  2RAQ A;  3KLI A;  3KDN A;  3SBM A;  2AWZ A;  3EDR B;  2OD6 A;  3QQC D;  1U6Z A;  4H4O B;  3HO1 A;  2HVE A;  2EXU A;  4ECS A;  2AEF A;  1RAD B;  1YLX A;  2H9Z A;  2YKN A;  3BR8 A;  3CO9 A;  1X4C A;  3CCE S;  2NXJ A;  2W4P A;  2PFF B;  2VHG A;  6FD1 A;  2Y3Y A;  2MKH A;  4WTO B;  1LK7 A;  1QSS A;  5C42 B;  1R6V A;  1RHM B;  2QLX A;  1Q1K A;  4ID8 A;  1U6B A;  4RBU A;  1SIZ A;  4OYW A;  1T9T A;  4DR2 F;  4HTJ A;  2XQC A;  3G4S S;  5KFM A;  4FBT A;  5IS2 A;  2CQ1 A;  2R4F A;  1HLW A;  4K4U A;  3W60 A;  1A6L A;  2ZNY A;  4EK2 A;  1RBO B;  2XZT B;  2VG5 B;  4HHU A;  2Z2M A;  5JUM A;  1RU1 A;  2CJX B;  1U1N A;  4DV5 J;  1TV6 A;  2WCX A;  1RAB B;  1RAI B;  4TLQ A;  4CLT A;  1TKX A;  4JI8 F;  4DR7 J;  3TO8 A;  4LMZ A;  4RW8 A;  1FRK A;  5K14 A;  5E0O A;  1CC8 A;  2C28 A;  2DNY A;  4DBQ A;  2BJ7 A;  3M9M B;  5F8L A;  2VBZ A;  3PAC A;  5CAA A;  1HHQ A;  1LFW A;  1V3R A;  4ALZ A;  4AL7 A;  4DSE A;  1NKC A;  4YB6 A;  2YQ3 A;  1IM4 A;  4R25 A;  1S0O A;  1IBL F;  2HVD A;  5HBM A;  1SVD A;  5KFY A;  1HNX J;  3QJJ A;  2XSJ B;  4LQ9 A;  4XK8 C;  4USM A;  2VOP A;  1N5V A;  3Q24 A;  2HND B;  2RKI B;  2E7X A;  2FZC B;  4DI6 A;  2PD1 A;  1JLB A;  1S1V B;  1URN A;  1MW7 A;  3NRB A;  1HQE A;  2AEM A;  1S1T B;  3P96 A;  2E5J A;  1FD2 A;  1G3O A; 
#chains in the Genus database with same CATH homology
 5FLX U;  3J80 U;  1N34 J;  4B3S J;  4NEY A;  4LFA J;  4YY3 J;  4KHP J;  4K0K J;  4DV7 J;  5LMN J;  5BR8 J;  3JAM U;  4JI1 J;  1N36 J;  4LF7 J;  4DR5 J;  4DV3 J;  4LFC J;  3D3C J;  2UXB J;  5A2Q U;  5AJ3 J;  1N33 J;  1N32 J;  4B3R J;  4DV0 J;  4X65 J;  1XNR J;  4JI3 J;  2HHH J;  1XNQ J;  4LF5 J;  4DR6 J;  2UU9 J;  4LF8 J;  4JI7 J;  3T1Y J;  4B3M J;  4JI5 J;  2F4V J;  5LMU J;  3D3B J;  2E5L J;  4LF6 J;  1HNW J;  4LFB J;  1XMQ J;  4DUZ J;  2MQ8 A;  4X66 J;  5IWA J;  4JI4 J;  4DV1 J;  1I94 J;  4JYA J;  4B3T J;  2VQF J;  1J5E J;  3R2C J;  1XMO J;  1HNZ J;  4DR4 J;  1FJG J;  3T1H J;  2MEW A;  4V1A k;  1HR0 J;  2UUB J;  4OX9 J;  4JI8 J;  2UXC J;  2KL8 A;  3OTO J;  3J7A N;  2UUC J;  5IT9 U;  4GKJ J;  4DR1 J;  4DV6 J;  4GKK J;  4NXM J;  4KYZ A;  4JV5 J;  2UUA J;  4DR2 J;  4NXN J;  4YHH J;  2ZM6 J;  4HHU A;  1IBK J;  4LF9 J;  4KY3 A;  4JI6 J;  4DV5 J;  4X62 J;  4JI0 J;  4DR7 J;  4DV4 J;  4AQY J;  3J81 U;  2KVQ E;  1IBL J;  4DR3 J;  4DUY J;  2MTL A;  4JI2 J;  1HNX J;  4DV2 J;  2VQE J;  3IMQ J;  4NEZ A;  3W1Y C;  4RJV A;  4LF4 J;  4X64 J;  5LM7 E;  2UXD J;  3R2D J;  1IBM J;  4PWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...