2UXDK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxdK00
4CVNE 1N34K 2UXBK 5LL6Z 2UUCK 4JI8K 5AJ3K 3OTOK 2VQEK 4DR3K 4LF6K 1N33K 1FJGK 2UU9K 4NXMK 4GKJK 3J7AP 4LF9K 4V19S 1IBKK 1HR0K 4B3SK 4YHHK 4DR7K 4DV2K 2ZM6K 4JI1K 4LFBK 4DR4K 1N32K 5BR8K 3J80O 4DV5K 4LF8K 1IBLK 4JI3K 1XNRK 4LF7K 4JI4K 4JI6K 4CW7B 2HHHK 4DV3K 4B3TK 4LFAK 4OX9K 1J5EK 4JV5K 4LFCK 3J7YP 1N36K 4JI5K 1XMQK 4X66K 2UXCK 1XNQK 2UXDK 5LMNK 4X65K 2UUAK 1I94K 5IT9O 4DV6K 4DUZK 5A2QO 1HNWK 4LF5K 1XMOK 4DV7K 3T1YK 2VQFK 4LF4K 4DUYK 4KHPK 4AQYK 4DV0K 4X62K 4DR2K 4DR1K 2E5LK 4JI2K 5FLXO 2F4VK 4YY3K 4DR5K 3T1HK 4K0KK 1IBMK 4B3MK 4NXNK 4X64K 1HNXK 4B3RK 5IWAK 1HNZK 4JI7K 4DV1K 3JAMO 3J81O 4JI0K 4JYAK 4DV4K 4GKKK 5LMUK 2UUBK 4DR6K
chains in the Genus database with same CATH superfamily
3QFPA 1VSFA 1KAZA 5LL6Z 1D4XA 4CJ3A 5AJ3K 3U9ZA 3UKRA 2FBVA 2E20A 2YNFA 2P9SA 5M1NA 3C95A 4JHDA 3VERA 3CXCM 4H0PA 1WAFA 1QQCA 1YAGA 2KFZA 1IV0A 1K6YA 4CI6A 2QWNA 1N8RO 2G8HA 3AGRA 3KKSA 1HYVA 3RMCA 4OPKA 2YHBA 4WFNL 3CIPA 4MLEA 1JCFA 4B9MA 5EY4A 2B5JA 3WT0A 4CEBA 1BWFO 1RT3A 3LM2A 1SAZA 1XC3A 1ITGA 1NMNA 3QNNA 3SV4A 1IO2A 4YOUA 1VHXA 4XIUA 4QAGA 1NGCA 1WNSA 5C42A 4CFDA 4A2AA 3K5NA 3VQ7A 4FJ9A 4IOCL 3WXKA 1Z25A 1J54A 2GX9A 1FW6A 3ENOA 3QNOA 1KXPA 3KLIA 5BR9A 4O55A 2OYQA 3I0RA 2OZSA 4DR1K 3VPZA 1VQ5N 1HX1A 2KKZA 1WBBA 5GINA 4M3TA 3SJJA 1GOBA 3DLEA 3T1AA 3OS2A 1CZ9A 4X64K 5BREA 1L3UA 2YNIA 2IS3A 2DFEA 1TKZA 1C0FA 3DRPA 3CG7A 2NLXA 4CJFA 3AA3A 4DV4K 5AQZA 4CD1A 3I8BA 3QICA 1TYQA 2P9SB 1J6ZA 3K5OA 5C0YA 3AA5X 3PUFA 3SK3A 4B1WB 2G8WA 1ASVA 1R0AA 4HHTA 4E7LA 1QQOA 1VRTA 3FLCO 2XY7A 4FLYA 1IKXA 2A41A 3QMLA 3H6EA 4KFBA 3K9KA 1NGGA 4BE2A 3BF1A 4HCCA 1JXBA 3FFIA 5JLHA 3NH1A 2P9PA 4E19A 4NO7A 4EFHA 4Q5VA 4DV5K 4H5WA 5F1XA 3PX4A 3KTQA 4F9OA 5LJWA 4AF1A 3SPYA 1GLBG 3VQBA 1A5XA 1ILYA 1LWFA 3SQ2A 5AZIB 5BRHA 3PY8A 1WUAA 4H03B 4FLZA 1QZ5A 3D7EO 4X65K 4ELVA 2UUAK 1RDBA 4KV8A 5DMRA 1DKGD 3AGKA 1HJRA 3K5LA 3M8QA 3P1GA 3QB0A 3C0BA 2HNZA 3NHGA 4FPBA 4JN4A 4UY8O 1NJZA 1ATRA 4B9VA 2VG7A 3CJBA 4JS4A 5AFUH 2GBZA 5FDLA 3DLLL 1TK5A 4OPAA 4FM2A 3I33A 2HSTA 5FLXO 2PFUA 1VSMA 1EKEA 1X3MA 2VGNA 3EE8A 3H3OB 1IKYA 4DTRA 1TL1A 1VSHA 2X6SA 4BR7A 3EL2A 1RDDA 3VEXA 1A5WA 3CCQN 4DFPA 5IWAK 1HNZK 3AA4A 4O4GA 2OANA 4DG1A 4FZYA 3HT3A 4NCAA 3CCSN 4IKFA 1E4GT 2OPQA 3V6DA 5E84A 3QEPA 4JKGA 3O1BA 3OYIA 3QIOA 4MLHA 2QA4N 2UUBK 4FL9A 5FPMA 4BC5A 2VWBA 3VGKA 3SCXA 2BTFA 4OLAA 4ELTA 3AO4A 4GY2B 2P9PB 1RDWX 3VQAA 4DU1A 3MX5A 3I55N 3ZSWA 2E4LA 3ENHA 4FLUA 3K2PA 1BA1A 3AVFA 1NKBA 1BCOA 4M3RA 4FM1A 2PBDA 1T05A 3J8AA 2NRHA 2A3ZA 3L4QA 4F4KA 3AO2A 4IOXA 2XY5A 4NCGA 3ZSZA 2HF3A 3EKUA 3ULEB 4PKHA 5ADXA 5H1SQ 1IH7A 1M90O 2UXDK 3A5MC 3P4IA 5FRNA 4DLGA 4IXCA 5AQXA 3SQ1A 3HPOA 3OYNA 1J53A 1S1VA 5SZTA 3AVIA 5GIOA 2VGMA 3AY9A 1RTJA 3CM6A 3ITHA 3JYTA 3U4LA 1ASWA 3O4WA 3UIQA 2E5LK 2QWLA 2FF3B 3D6RA 3U3YA 3MXIA 4E1JA 2QTDA 4FYDA 3CMEN 4JEPA 1HRHA 4A61A 1NJYA 3QLHA 2RN2A 1D9DA 3VQ4A 2JWLA 1X1PA 2F8TA 4FWLA 3M5RA 3ZT2A 4JD2B 4JI0K 4E7JA 2P9IA 4BRQA 2IOCA 2XO7A 1BI4B 1YJWN 1VQMN 2ASMA 4DB3A 1IKVA 1JLCA 5KRSA 1S1UA 4HVJA 1RT1A 1ASUA 1RDUA 1RT7A 1HKCA 4DQQA 4CHYA 4IJNA 2EHGA 3K0SA 4CFBA 2VQEK 4IG3A 1UA1A 4K8ZA 3WQTA 1YTUA 1SL1A 4K8XA 4Z4CA 4B9QA 2H3GX 4V19S 1IBKK 2BDPA 2GUPA 5AQNA 3DLGA 4I2PA 4CJEA 2E2OA 3QESA 1T7PA 1Q86O 1T3VA 4GV6A 2O4IA 2ZD1A 3CPEA 3L4IA 2HOEA 4AHSA 3V9XA 4DQPA 3LDPA 5ADXH 4CW7B 2VG6A 3ZSYA 4O5BA 4LFAK 1Q9YA 3OYAA 1BU6O 4N56A 3S41A 4IOAL 2GEMA 2FSJA 2PYJA 5AQHA 5EVZA 5HLFA 2Y1IA 3IS9A 1K8KA 3RR8A 1VQ8N 3T7ZA 3R1XA 3A5OC 4LSLA 1S6PA 4C8LA 3DOKA 1YJNN 4MDAA 4AHVA 4CF1A 4JAXA 3RVCA 3CQXA 1I94K 3MX2A 4NYNA 2X78A 3S3NA 2E1YA 3QETA 3PSIA 1RTIA 4F2SA 5KPRA 4WCEL 2FSNA 2I7NA 2YHAA 4K25A 4KH4A 4B9UA 3UKUA 1C0UA 1HKBA 4CZMA 2QXLA 2ZQBA 2GELA 5BPLA 1B9FA 4FCYA 3K5MA 3VF6A 4CHPA 3LZJA 1GLCG 4CJUA 4WQ5C 5I42A 2P9IB 3VQPA 1T6CA 4LSNA 4DFMA 4BY9C 5AQPA 4ILGB 3DXKA 1ESVA 5BN9A 3O5BA 4YFUA 4CF0A 4DKWA 1HPMA 4CEEA 3JAMO 3CERA 4PL8A 5T7BA 2YNHA 4EHTA 4N47A 3TU5A 3OYJA 3L3UA 3HXMA 1U04A 1VSLA 3VEVA 4IEEA 2WONA 4BGAA 3KVGA 4CBXA 3GOIA 4CVNE 2UXBK 3C7NA 4BG8A 3V9UA 3HPHA 4BRHA 4IDKA 3A8YA 1C6VA 2NRZA 4CZKA 3OTOK 3H08A 3KK2A 4JKCA 4DFKA 5AQYA 1UAXA 3NVKA 2ZE2A 2Q31A 1QTMA 3CJ7A 3MEDA 4JS5A 3AVMA 3NAEA 1SS6A 5GIPA 4E0DA 1K8KB 3U6FA 2JGUA 3J80O 4FLVA 3KK3A 4GVEA 3OYHA 2DPNA 4NYFA 4DCHA 3HVRA 3NGIA 4KH5A 3NMUA 3LZIA 3MK6A 3NVMA 3O9UA 4B08A 5C2FA 2NRTA 1XI1A 5J2QA 3OYEA 3IG1A 3UKUB 4BRCA 4OGCA 4BR2A 5AQMA 1DGKN 3E9LA 1T6DA 4N41A 1HQEA 3OYCA 1N6QA 4CK2A 4DTPA 1QHAA 4FJKA 1HMVA 3WNFA 4CESA 1JLBA 4RW7A 2JWKA 1VQON 3NH2A 3CJCA 2I7PA 4H0OA 4KH6A 3OHRA 3BZKA 3DXKB 3LP1A 4BDPA 1UWBA 4I2QA 3DRRA 5AQRA 4AM7A 4DV0K 1NK8A 4J2AA 4XH1A 4CGIA 3O3FA 3R8EA 5AQIA 3E9OA 3OJSA 1S6QA 3MN6A 4CIFA 4FW2A 2F4VK 3H45C 4H8KA 1SUQA 4DR5K 3OW2M 4GNIA 2AP1A 1NK9A 1IBMK 2GV9A 4W5NA 2FBTA 1RBUA 4PY5A 3KWGA 1ZBLA 4HCBA 4FOIA 4B1YB 1YXQA 3G6EN 1G15A 1BQNA 2WC9A 5AQUA 2KW4A 4JYAK 3HRGA 2ZGYA 4AILC 3MEEA 4B1ZA 2ASOA 3KHYA 4LY7A 4BC3A 1WSEA 4E3SA 4CHQA 3CJ1A 1XUPO 1HJOA 4ISEA 5CHIA 1HYSA 4IO9L 2ETJA 3F9MA 2FC0A 3KZBA 5CR4A 3PV8A 3CF5L 1HNIA 5JMVA 1FJGK 4JK8A 3MWTA 3J7AP 1WSGA 1HR0K 4M3WA 1J5OA 1HYZA 3HPGA 2NRVA 1YIJN 4DR7K 3LPTA 4A5BA 4JRPA 1VQ7N 4DU4A 2IIRA 1RTHA 1KD1O 3CQYA 3VENA 4DLEA 4FWSA 1JCGA 2ATQA 3SBGA 3THXB 2ITGA 3WQUA 3SUOA 1IJJA 3CCRN 3NGZA 3HM8A 1QSYA 5KQDA 1CZAN 4GVMA 4IDHA 4ILJA 1BDGA 4M7YA 5EX5A 4XEIA 3P5JA 4X66K 3GG4A 4HUEA 3BF3A 3HO1A 4JK9A 4WQ5A 2UXCK 2V51B 5KTQA 1SKRA 1VSKA 1YI2N 2P5OA 2YKMA 4RW8A 2HHTA 1FK9A 1JLGA 3C6AA 1XMOK 1NGAA 4OVLA 3IMXA 2HW3A 3OYLA 1TK0A 1MDUB 2E1ZA 4RWTA 3QEIA 3SUPA 4A57A 3QFUA 2E8AA 4DSEA 3DLHA 3MXMA 4EAHD 3VF2A 5GAEP 4R79A 3VESA 3WNHA 2W41A 3MDQA 4FK0A 1X9JA 3KK1A 4U7BA 1WBDA 4IFVA 2D1KA 3KLGA 2IGIA 2E88A 1DT9A 3VTIA 3OS0A 3T69A 3H3NO 5CY4A 3QO9A 5HRPA 2D4WA 5EOYA 5AZIA 3ZX2A 1EP4A 3O9TA 1O13A 3QDKA 4CBUA 4RW6A 4F2RA 1EX4A 1U49A 3VGLA 2W6LA 3EYZA 4FJ7A 1N5YA 3TR8A 3CCMN 4YOTA 3M8SA 2O8DA 4FJJA 2KZMA 3V9WA 4NCBA 2O8CB 3TAMA 1C1BA 4ILHA 1XC9A 4A2BA 2DTUA 5AFUA 5M1OA 1CXUA 4CGJA 4A59A 3CCJN 4C23A 1NK6A 1OH5A 1ZXOA 4KB0A 4I7FA 1S1XA 1YUWA 5FPDA 1Y64A 4EZ9A 2P9NA 2E6LA 3D0PA 5BPMA 3TTDA 5AQQA 4HTUA 3W3DA 3NH0A 3IFRA 4DQ8A 2FBXA 3CQ8A 4H0YB 2CGKA 2F9WA 1KC8O 1X9MA 4RTFD 2GUIA 4JI3K 3FZLA 1T8EA 4CHOA 4BRLA 4CK1A 4KHUA 3LDQA 1F21A 2FLOA 4WFAL 4I9LA 2P9KB 1YHQN 4H5TA 4PA1A 5LMNK 2QXFA 1IG8A 4H0XB 1ZBUA 4HUGA 4GMJB 5M1FA 3RMAA 1KFDA 1BO5O 4NLCA 1KRPA 5EXWA 5KPTA 2AA4A 1GLJO 3BP8A 3CCLN 4FWMA 1YVNA 4CHNA 3L2UA 2W6KA 2HBLA 4BR0A 3LM9A 4CJLA 3LWLA 4FJHA 1YVUA 1I39A 3JSMA 4MQ3A 3BDPA 1ZBSA 2NRRA 4C8MA 4WE1A 1GLLO 2HVHA 3L2VA 3N4QA 2HBJA 4K0KK 2O8DB 2YHYA 3MCAB 4BDYA 3ULEA 4B3RK 3U9DA 1BUPA 3EN9A 4YOWA 3J81O 4CJWA 4BRIA 2Q3SA 5CYQA 3SPZA 1NK4A 1RNHA 3NDKA 4J2BA 1MWKA 2FXUA 1HPZA 3NBPA 5AQGA 2HHUA 3VQQA 1RBTA 2P9NB 1CLQA 4A62A 4WF9L 4FWRA 1OH8A 3HBTA 4KI4A 3NF8A 3K57A 3G4SN 2HHQA 3THYB 4DTMA 3WEEA 3CC7N 4XH5A 3F2KA 4N76A 1H1VA 3VA3A 1VAZA 3SUNA 2A1SA 1CXQA 1MWMA 3A5LC 2Q0UA 4DV2K 2G8FA 4EP4A 3WNEA 3VETA 4JI1K 4OPHA 4PKGA 3TSPA 2QKKA 3MMVA 4DTJA 3KIOA 4CJ4A 1JCEA 1CZBA 3CCUN 2HHHK 3FZMA 4JD2A 3WXLA 1OH6A 3SBTA 3QERA 4ZHRA 1NGDA 4JV5K 4FJIA 4H5VA 3CJ9A 1JLAA 1BI4A 3S3OA 1QE1A 5J2PA 3MWPA 2X74A 3OYGA 2QW9A 3HM9A 4BRNA 2WBNA 4OJRA 3AO5A 4BR9A 5CZ2A 5IT9O 1LWEA 5FROA 4DV6K 5BN8A 1RBRA 2HMPA 1NGJA 5DK5A 4KPYA 4KHYA 5M1PA 4LD0A 1RGIA 1ATSA 4LF4K 2KFNA 3AVBA 3P83D 3ZT4A 1LAVA 4CJ5A 2A42A 4BROA 4CECA 3VOVA 4DUYK 5GAGP 1D8YA 2WOMA 4FJGA 4OKJA 3SJHA 3RRGA 1BISA 3HOSA 1Q7YO 1UA0A 3H1VX 5HBMA 2A40A 3M3ZA 5J1EA 4Z4EA 3PX0A 2RE2A 3U3GA 1FKOA 4B3MK 3KD1E 4NXNK 5M1KA 4E7IA 2QI2A 2QM1A 1OH7A 3MXJA 4I9QA 3OJUA 1M1KO 4JKBA 4HWIA 1VSIA 3R9PA 5AQKA 3WEEB 5GADP 3CFRA 4J8FA 4PQUA 4IFYA 3SAGA 4CE9A 2IVPA 2F7TA 5BRDA 2J4RA 2VWJA 2WFBA 1VQNN 3AARA 4CEAA 3CCEN 1NLVA 3C94A 2ZJQL 4DU3A 4K43A 3DLKA 1VK0A 3HJFA 2O8FB 1WN7A 1BGXT 3OYKA 3ULDA 4M3ZA 3WXIA 3NE6A 1YT3A 2KQ2A 2GWKA 3VQ5A 3WNGA 1GOAA 3VEWA 5KGXA 4OO1J 3LP0A 2ZF5O 2HBKA 1V4SA 3LP2A 3HP9A 1N32K 4FWKA 3TAFA 1TV6A 2JLEA 3CFOA 3H46O 2ASPA 3VQDA 2NZTA 3RTVA 3ENBA 3PIOL 5E41A 4FW1A 3HVTA 1J5EK 1KAXA 3CC2N 1RFQA 5DM7L 5AZJB 3TAGA 3IUCA 3TI0A 4B9SA 3QEXA 3ZLJA 1VSEA 1DLOA 3E01A 3M8RA 3A0IX 3J7ZO 4BRPA 2CGLA 1TKDA 2P5GA 1BIZA 4FZXC 4QCLA 1NWKA 3TSUA 2ZGZA 1Q8IA 4K41A 1QSLA 4KO0A 2A6AA 1VQ4N 4BWMA 4IZ9A 2IC3A 4MDBA 4DSKA 4AHUA 4Y1CA 3V1OA 4BRDA 3RWUA 4KHPK 4X62K 2NRWA 4F8RA 3QEVA 3QEWA 1FKPA 1NGHA 3RMDA 5AQTA 3I8DA 3ZSXA 5BRFA 4DQRA 4CCHA 3ZETB 4O8KA 1KVAA 1Q81O 2VYPA 3SZ2A 4NB4A 2YHXA 5C15A 1U48A 5AQFA 2HMIA 4Z94A 4L3QA 2HBMA 1C1AA 2XHBA 5KPZA 4KBOA 4JKAA 4BRKA 1RDCA 3CMAN 4PL7A 1DTQA 4QOZB 2R7YA 1NG9A 4ICLA 1QVGM 2O8BA 2HHWA 1ZYQA 4HUFA 1N34K 1ZBIA 4QS7A 2GWJA 1J9AA 2VWKA 3ZX3A 3FZKA 3T3FA 3AV9A 3SI6A 3C65A 3OBYA 4CIEA 4MO4A 3D2FB 1EXQA 4L8RB 4CK3A 3RSEB 4LF9K 1TGOA 2W40A 4FWNA 1VQLN 4JNEA 4DMNA 1OVYA 1RT4A 4JKFA 4CZFA 3EKSA 4LF8K 4CEFA 4DTXA 1C0MA 4CBWA 2G8UA 4DQSA 1DTTA 3TAEA 2Q2RA 3HYFA 3J7YP 3NFAA 3GL1A 3HL8A 1LW2A 3S3MA 1BL3A 2CH5A 2E2QA 3V1QA 3OBWA 5C12A 4FJLA 3SMSA 1NBWA 2OCEA 2QWOA 1W97L 1VSJA 1L3TA 4O8UA 2D0PA 2PY5A 3PSFA 1WB9A 4DFJA 4H5RA 1R59O 3TARA 1A5VA 2G8IA 2RPIA 5CZ1A 3AO1A 4E1NA 4ZTJA 2A1RA 4PKIA 5J2MA 1QHTA 2YJFA 2OPSA 1NK0A 4FJMA 1S1WA 5KGWA 3LDOA 3GE1A 3SUQA 4H5NA 1P8ZA 3THXA 3OYBA 3O4NA 3ZX0A 4C8KA 4OGEA 2Y1JA 3EZ5A 1K73O 3GDQA 3HTVA 4KHNA 1SZ2A 2O8BB 2QWPA 3FE1A 1BIUA 5AQOA 5EU7A 5B8HA 2OA8A 5JS1A 1WAJA 3CI5A 4CZLA 3EY1A 4FOEA 2HHXA 3ZSOA 1V4TA 3BY5A 4GW6A 4GKKK 3RRHA 5J2NA 3D2EB 5DM6L 2CGJA 4KHWA 4Z4IA 4KTZA 1NM1A 4BWJA 3BGRA 3IAYA 3SQ4A 4JKDA 4JI8K 4C1NI 2QWQA 3OA9A 1X3NA 2PAVA 1SL0A 2CH6A 3CC4N 4WYBA 4LF6K 4U67L 2FBYA 2V7YA 4GKJK 2Z1HA 3O3HA 3C6HA 4FLXA 2W42A 3TWHA 3AAPA 5GAHP 4YHHK 2ZM6K 5HOOA 3HK2A 5BPNA 3SAHA 4DR4K 1QVFM 3PO4A 5HROA 4FJ5A 1QZ6A 4FZZA 2HNYA 4CZJA 2D0AA 1XNRK 5TKYA 3LDLA 1GOCA 4B3TK 3LAMA 3C6UA 3VF4A 1QQMA 4C1NK 1RTDA 4YOXA 4BQZA 4C8OA 3HZ6A 1NNEA 1JLEA 3CYMA 3TABA 2YX6A 3ZT3A 2RHKA 2O8CA 1SKSA 4YDUC 2LSNA 1S22A 5C10A 1NJIO 1U45A 3CETA 5SWMA 2WTUA 4M7XA 4DV7K 4ID5A 5C25A 3L0QA 4BE1A 4FPAA 4DTSA 3T19A 3MAQA 2QWMA 4PUOA 4ID1A 1T44A 3CHWA 2Q97A 1WSFA 3UE5A 3MN5A 3MN9A 4KB1A 4Z0UA 4BRMA 2OZMA 3IRXA 4BRAA 1K8AO 2B6AA 1C0TA 3TPQA 4UQGA 3W0LA 3CPWM 1WLJA 1RBSA 4AHTA 1WOQA 3TTFA 2NUBA 4FWQA 4BVPA 4ZTFA 1QQNA 4FJNA 3O9QA 2VG5A 3VEYA 2V7ZA 3O1WA 2P9KA 4IJAA 1KVCA 1S1TA 1S9GA 3WXMB 1HNVA 4CIGA 3E9PA 3SAFA 4CF2A 5E26A 3ZT0A 1NU0A 4AHRA 3DJCA 3V9ZA 5TKWA 2UUCK 2OPPA 2IAJA 4EZ6A 4IO8A 4M41A 5C2DA 4DR3K 1IG9A 4Z4FA 1N33K 2UU9K 4OLBA 4DS5A 1JXEA 5I9EB 4F3OA 2YHWA 3F73A 4B1XB 4Y1DA 2ZWHA 3SLCA 3ID8A 3M6GA 4Z4HA 3QINA 1I3AA 2RF2A 5HRNA 1HUXA 4BE0A 5CYMA 2O8EB 2XRIA 2ITMA 3P31A 5BR8K 1TKTA 3IKMA 2P9LB 2KHOA 2YNGA 1XQSC 4DV3K 4E1MA 1L3VA 1LAWA 1SQKA 2BANA 3DXMB 2D0OA 2YCHA 2IDOA 1N36K 5AQJA 1W0HA 3THWA 1XMQK 3JS6A 4BRGA 5JICA 1VQPN 5LJVA 3AVAA 3TAPA 3THYA 1YITN 4ISGA 3BUZB 4RW9A 4Z4GA 1LWCA 1MU2A 4CF8A 3KJVA 2VQFK 4DHYA 1L3SA 2QEXN 3VMFB 3AVGA 2UYTA 3K59A 4EP5A 3Q7BA 2D0BA 4JKHA 4B9LA 3DLRA 1JLFA 2IVOA 1XHZA 1BOTO 4FVUA 4JK7A 3PO5A 4LH4A 3UKRB 3TAQA 1JL2A 1Z05A 3AO3A 4JHDB 3ZSRA 3VN5A 1JKHA 3AVJA 4CEQA 1GLEG 1W7AA 3NGYA 4H0VB 1NK7A 2EX3A 2P9UA 5MLCQ 2HF4A 3VQEA 1GLFO 1NGEA 1LW0A 1X9SA 4W5QA 2PYLA 4M45A 3G71N 1DEJA 1KLMA 4DV1K 4FK4A 3VQ6A 1Z26A 1KSPA 3DM2A 4MFBA 4B3OA 3MN7A 1KFSA 1WSIA 3VGMA 3DRSA 2O4GA 1E4FT 2F96A 3L2QA 1XWLA 1B9DA 3B6OA 4BR4A 1HQUA 3CFPA 3OYFA 1EETA 1C0GA 4QS8A 4A5AA 4FWOA 3DLBA 2KTQA 4O0IA 4YDUA 2NRXA 1HKGA 4B3SK 3DWLA 4CJSA 4E7HA 4FLWA 3DI6A 1D5AA 1OVQA 3V1RA 5C24A 3KWIA 4BRFA 3THWB 1K9MO 3NF6A 3ZSQA 4DWIA 4FVMA 3M8PA 4BC4A 3VEOA 5JVHL 4W5TA 4JI4K 3MCPA 3DAWA 4R5PA 1Q18A 4DSIA 1NKCA 4W5OA 1NGFA 3KLEA 4FLTA 1KTQA 4FSVA 5KQ8A 1RDAA 1NJXA 3H1QA 4B8CA 2I5JA 4DQIA 1S5JA 1P90A 3B8AX 3LWMA 2IVNA 1BQMA 3O80A 3OY9A 4G1QA 1E3MA 1YF5L 3CD6N 1Y97A 4OPJA 2O8FA 2Z1IA 1VQ6N 5FRMA 1TYQB 4BGBA 3T1YK 1TAQA 2HVIA 4KHSA 5AQSA 5JVGL 3VEZA 1TAUA 4BVOA 3AVCA 4QS9A 3O8MA 4EIAA 3FZHA 4H0TB 1SV5A 3HOTA 5JS2A 2P9UB 5AQLA 2QWRA 2HNDA 3EE9A 1Q9XA 2E6MA 4HTLA 4JLHA 3FZFA 4AQYK 3LDSA 4DR2K 2OTJN 5FPNA 3FR0A 4JI2K 1NGIA 3BEXA 4ISFA 5AR0A 1RCHA 4KREA 1Z6RA 3TSQA 3P39A 2FSKA 5I3UA 3RR7A 1O1WA 5AZJA 4KI6A 4RCHA 3LAKA 2DY4A 5HRSA 4B1VA 1UOCA 3MEGA 3L3VA 1JLQA 2Q1NA 2ZJPL 3O6WA 3ZCMA 4H4MA 1TUYA 1ATNA 3HP6A 3E66A 3OVNA 4CERA 1S9EA 4PWDA 4CHZA 3V9SA 3EZWA 4IFEA 1VQKN 4EHUA 3E1YA 4M3UA 2V52B 4J2DA 4DTNA 5HL7L 1VQ9N 3O3GA 4PHTX 3ZETA 4CJTA 4CZEA 4KAZA 3SNNA 1NMDA 1RT2A 4LF7K 4CFAA 2WUSA 3VQ9A 3S9HA 5FPEA 4KKOA 1D9FA 4MO5A 4KTQA 4M42A 4OX9K 4IBNA 4KTWA 3EEQA 4DF4A 4CEOA 3VQ8A 4LFCK 4M63C 3FGUA 4O44A 4JI5K 1ZC6A 4K42A 1SL2A 4B9NA 1XNQK 1NGBA 4CJPA 4KHQA 3R6MA 3QBXA 3A2FA 2D5RA 3G10A 1S3XA 1HNWK 1KLNA 4WQ4C 4JKGB 4OKEA 3OS1A 3F5TA 4CZIA 4J2EA 4Q0BA 3D2FA 2KLAA 3RSEA 4OKKA 2G8KA 3VTHA 3ALYA 1ZBFA 2RKIA 3UB5A 4BQLA 1VRUA 1EO1A 1HLUA 2DFFA 4F3TA 1G99A 3I56N 1U2VA 1S72N 3O08A 3K9JA 1FXXA 5K14A 2ZJRL 1W2BM 3TTCA 4FM0A 3AVNA 1NOZA 5F0XA 4DSJA 3B6PA 2G8VA 3AA2A 3NCIA 2BE2A 4BC2A 1RT6A 2BH1A 2XY8A 5ELZA 2F8SA 3ZEUA 1U6ZA 2HHVA 2NNWA 1NKEA 4LH5A 1JL1A 4IEIA 3K58A 3AAQA 3AVLA 1BG3A 3WUHA 1C1CA 4NLBA 2X6NA 4B8AB 4AHCA 4E7KA 1NJWA 1EWRA 3SMPA 1IKWA 4AM6A 4M3XA 3ZYYX 2YI1A 2OPRA 1QSSA 3VQCA 4O5FA 3IDHA 4NXMK 2FF6A 1WSJA 3PIPL 3OYDA 4FJXA 1L5UA 4YNQA 4DF8A 1YJ9N 1REVA 4FXDA 1T03A 4BREA 4DS4A 4DTOA 3V81A 4LFBK 3ZSVA 3M1FA 4I6MA 3LANA 1LOTB 3ATVA 1KCFA 3L2RA 2Z1GA 3LDNA 4JI6K 2KZZA 3NF9A 3ID6A 1TVRA 3AVHA 1TL3A 3D2EA 2YKNA 3LALA 3SV3A 2Q0RA 4IWVA 4RG8A 2B4JA 4XH4A 4CJ7A 1NK5A 2AJQA 4DUZK 3BZCA 1YTAA 4LF5K 4CFCA 1U2VB 3KK7A 1NOYA 4O0JA 4CD3A 4CJVA 2OTLN 3DMJA 3U8XA 3KKRA 4BG9A 3VA0A 3LP3A 3DOLA 5HRRA 5AQWA 3O9SA 1XHXA 1BA0A 4CJKA 3CM5A 3GBTA 3KLHA 5F2RA 3RMBA 1MA9B 2BUPA 4YOVA 4B1UB 2E2NA 4GV9A 1X9WA 3PX6A 3ZEUB 1RBVA 2GTDA 4JKEA 4FK2A 3CCVN 3F9KA 3JXUA 3LPUA 2A5XA 3D45A 1HNXK 1QS4A 4CEDA 1U4BA 4CZGA 3AVKA 2Q36A 3LL3A 1TK8A 2BGGA 4H4OA 5KI6A 3ISNC 3HSCA 4DR6K 3A5NC 4Y0WA 1GLAG 2YJEA 4RW4A 4KRFA 3O9RA 1TUUA 3QBWA 1JJ2M 3KLFA 4I6MB 1EWQA 5CE3A 4YOYA 1TKXA 4GV3A 3SQ0A 1B92A 1BHLA 4CGHA 3V4IA 4TSXA 1WSHA 1LV5A 5M1QA 1BCMA 4FJ8A 4WQ4A 3C6TA 3R3LA 1SKWA 3L6QA 3PLAA 2E2PA 4CJRA 1IBLK 3THVA 4DSLA 3KD5E 3NF7A 2F9TA 2QKBA 3ASMA 4WFBL 3QIPA 1OKJA 1W9HA 4CGFA 4C8NA 1VSDA 4BR5A 3MECA 1KVBA 3L2WA 2VCPA 2PZSA 2P51A 2Z1JA 5A2QO 3FFKB 2D0CA 3O4QA 4CZHA 2EWSA 1U47A 1GLDG 3SYZA 3HI0A 4AH9A 4FWPA 4ELUA 2P1JA 3ZT1A 4DTUA 3C7NB 3I0SA 3Q7CA 1RILA 1ZBHA 1EQYA 4W5RA 4DSFA 4N5SA 3G0ZA 2O8EA 4CGGA 2QK9A 3P38A 4BDZA 2DFHA 3N4PA 2P9LA 4CEZA 3TANA 1LCUA 4CGDA 1KAYA 4YY3K 4E89A 5AQVA 4CF9A 5LY3A 4BACA 3T1HK 3DXMA 3WXJA 4CJQA 5JLFA 2HB5A 3DYAA 3EO3A 4FO0A 2XY6A 3ATUA 4JI7K 3G25A 3L8BA 2YV0X 3CJAA 1KQSM 4JRQA 4B9TA 4M3YA 3OYMA 5D3GA 5LMUK 4LC9B 5HP1A 1RT5A 4IG0A 2HHSA 4YORA 4G9ZA 3HSTB 1Q82O 5KRTA
chains in the Genus database with same CATH topology
4CVNE 1N34K 2UXBK 5LL6Z 2UUCK 4JI8K 5AJ3K 3OTOK 2VQEK 4DR3K 4LF6K 1N33K 1FJGK 2UU9K 4NXMK 4GKJK 3J7AP 4LF9K 4V19S 1IBKK 1HR0K 4B3SK 4YHHK 4DR7K 4DV2K 2ZM6K 4JI1K 4LFBK 4DR4K 1N32K 5BR8K 3J80O 4DV5K 4LF8K 1IBLK 4JI3K 1XNRK 4LF7K 4JI4K 4JI6K 4CW7B 2HHHK 4DV3K 4B3TK 4LFAK 4OX9K 1J5EK 4JV5K 4LFCK 3J7YP 1N36K 4JI5K 1XMQK 4X66K 2UXCK 1XNQK 2UXDK 5LMNK 4X65K 2UUAK 1I94K 5IT9O 4DV6K 4DUZK 5A2QO 1HNWK 4LF5K 1XMOK 4DV7K 3T1YK 2VQFK 4LF4K 4DUYK 4KHPK 4AQYK 4DV0K 4X62K 4DR2K 4DR1K 2E5LK 4JI2K 5FLXO 2F4VK 4YY3K 4DR5K 3T1HK 4K0KK 1IBMK 4B3MK 4NXNK 4X64K 1HNXK 4B3RK 5IWAK 1HNZK 4JI7K 4DV1K 3JAMO 3J81O 4JI0K 4JYAK 4DV4K 4GKKK 5LMUK 2UUBK 4DR6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVN E;  1N34 K;  2UXB K;  5LL6 Z;  2UUC K;  4JI8 K;  5AJ3 K;  3OTO K;  2VQE K;  4DR3 K;  4LF6 K;  1N33 K;  1FJG K;  2UU9 K;  4NXM K;  4GKJ K;  3J7A P;  4LF9 K;  4V19 S;  1IBK K;  1HR0 K;  4B3S K;  4YHH K;  4DR7 K;  4DV2 K;  2ZM6 K;  4JI1 K;  4LFB K;  4DR4 K;  1N32 K;  5BR8 K;  3J80 O;  4DV5 K;  4LF8 K;  1IBL K;  4JI3 K;  1XNR K;  4LF7 K;  4JI4 K;  4JI6 K;  4CW7 B;  2HHH K;  4DV3 K;  4B3T K;  4LFA K;  4OX9 K;  1J5E K;  4JV5 K;  4LFC K;  3J7Y P;  1N36 K;  4JI5 K;  1XMQ K;  4X66 K;  2UXC K;  1XNQ K;  2UXD K;  5LMN K;  4X65 K;  2UUA K;  1I94 K;  5IT9 O;  4DV6 K;  4DUZ K;  5A2Q O;  1HNW K;  4LF5 K;  1XMO K;  4DV7 K;  3T1Y K;  2VQF K;  4LF4 K;  4DUY K;  4KHP K;  4AQY K;  4DV0 K;  4X62 K;  4DR2 K;  4DR1 K;  2E5L K;  4JI2 K;  5FLX O;  2F4V K;  4YY3 K;  4DR5 K;  3T1H K;  4K0K K;  1IBM K;  4B3M K;  4NXN K;  4X64 K;  1HNX K;  4B3R K;  5IWA K;  1HNZ K;  4JI7 K;  4DV1 K;  3JAM O;  3J81 O;  4JI0 K;  4JYA K;  4DV4 K;  4GKK K;  5LMU K;  2UUB K;  4DR6 K; 
#chains in the Genus database with same CATH topology
 3QFP A;  1VSF A;  1KAZ A;  5LL6 Z;  1D4X A;  4CJ3 A;  5AJ3 K;  3U9Z A;  3UKR A;  2FBV A;  2E20 A;  2YNF A;  2P9S A;  5M1N A;  3C95 A;  4JHD A;  3VER A;  3CXC M;  4H0P A;  1WAF A;  1QQC A;  1YAG A;  2KFZ A;  1IV0 A;  1K6Y A;  4CI6 A;  2QWN A;  1N8R O;  2G8H A;  3AGR A;  3KKS A;  1HYV A;  3RMC A;  4OPK A;  2YHB A;  4WFN L;  3CIP A;  4MLE A;  1JCF A;  4B9M A;  5EY4 A;  2B5J A;  3WT0 A;  4CEB A;  1BWF O;  1RT3 A;  3LM2 A;  1SAZ A;  1XC3 A;  1ITG A;  1NMN A;  3QNN A;  3SV4 A;  1IO2 A;  4YOU A;  1VHX A;  4XIU A;  4QAG A;  1NGC A;  1WNS A;  5C42 A;  4CFD A;  4A2A A;  3K5N A;  3VQ7 A;  4FJ9 A;  4IOC L;  3WXK A;  1Z25 A;  1J54 A;  2GX9 A;  1FW6 A;  3ENO A;  3QNO A;  1KXP A;  3KLI A;  5BR9 A;  4O55 A;  2OYQ A;  3I0R A;  2OZS A;  4DR1 K;  3VPZ A;  1VQ5 N;  1HX1 A;  2KKZ A;  1WBB A;  5GIN A;  4M3T A;  3SJJ A;  1GOB A;  3DLE A;  3T1A A;  3OS2 A;  1CZ9 A;  4X64 K;  5BRE A;  1L3U A;  2YNI A;  2IS3 A;  2DFE A;  1TKZ A;  1C0F A;  3DRP A;  3CG7 A;  2NLX A;  4CJF A;  3AA3 A;  4DV4 K;  5AQZ A;  4CD1 A;  3I8B A;  3QIC A;  1TYQ A;  2P9S B;  1J6Z A;  3K5O A;  5C0Y A;  3AA5 X;  3PUF A;  3SK3 A;  4B1W B;  2G8W A;  1ASV A;  1R0A A;  4HHT A;  4E7L A;  1QQO A;  1VRT A;  3FLC O;  2XY7 A;  4FLY A;  1IKX A;  2A41 A;  3QML A;  3H6E A;  4KFB A;  3K9K A;  1NGG A;  4BE2 A;  3BF1 A;  4HCC A;  1JXB A;  3FFI A;  5JLH A;  3NH1 A;  2P9P A;  4E19 A;  4NO7 A;  4EFH A;  4Q5V A;  4DV5 K;  4H5W A;  5F1X A;  3PX4 A;  3KTQ A;  4F9O A;  5LJW A;  4AF1 A;  3SPY A;  1GLB G;  3VQB A;  1A5X A;  1ILY A;  1LWF A;  3SQ2 A;  5AZI B;  5BRH A;  3PY8 A;  1WUA A;  4H03 B;  4FLZ A;  1QZ5 A;  3D7E O;  4X65 K;  4ELV A;  2UUA K;  1RDB A;  4KV8 A;  5DMR A;  1DKG D;  3AGK A;  1HJR A;  3K5L A;  3M8Q A;  3P1G A;  3QB0 A;  3C0B A;  2HNZ A;  3NHG A;  4FPB A;  4JN4 A;  4UY8 O;  1NJZ A;  1ATR A;  4B9V A;  2VG7 A;  3CJB A;  4JS4 A;  5AFU H;  2GBZ A;  5FDL A;  3DLL L;  1TK5 A;  4OPA A;  4FM2 A;  3I33 A;  2HST A;  5FLX O;  2PFU A;  1VSM A;  1EKE A;  1X3M A;  2VGN A;  3EE8 A;  3H3O B;  1IKY A;  4DTR A;  1TL1 A;  1VSH A;  2X6S A;  4BR7 A;  3EL2 A;  1RDD A;  3VEX A;  1A5W A;  3CCQ N;  4DFP A;  5IWA K;  1HNZ K;  3AA4 A;  4O4G A;  2OAN A;  4DG1 A;  4FZY A;  3HT3 A;  4NCA A;  3CCS N;  4IKF A;  1E4G T;  2OPQ A;  3V6D A;  5E84 A;  3QEP A;  4JKG A;  3O1B A;  3OYI A;  3QIO A;  4MLH A;  2QA4 N;  2UUB K;  4FL9 A;  5FPM A;  4BC5 A;  2VWB A;  3VGK A;  3SCX A;  2BTF A;  4OLA A;  4ELT A;  3AO4 A;  4GY2 B;  2P9P B;  1RDW X;  3VQA A;  4DU1 A;  3MX5 A;  3I55 N;  3ZSW A;  2E4L A;  3ENH A;  4FLU A;  3K2P A;  1BA1 A;  3AVF A;  1NKB A;  1BCO A;  4M3R A;  4FM1 A;  2PBD A;  1T05 A;  3J8A A;  2NRH A;  2A3Z A;  3L4Q A;  4F4K A;  3AO2 A;  4IOX A;  2XY5 A;  4NCG A;  3ZSZ A;  2HF3 A;  3EKU A;  3ULE B;  4PKH A;  5ADX A;  5H1S Q;  1IH7 A;  1M90 O;  2UXD K;  3A5M C;  3P4I A;  5FRN A;  4DLG A;  4IXC A;  5AQX A;  3SQ1 A;  3HPO A;  3OYN A;  1J53 A;  1S1V A;  5SZT A;  3AVI A;  5GIO A;  2VGM A;  3AY9 A;  1RTJ A;  3CM6 A;  3ITH A;  3JYT A;  3U4L A;  1ASW A;  3O4W A;  3UIQ A;  2E5L K;  2QWL A;  2FF3 B;  3D6R A;  3U3Y A;  3MXI A;  4E1J A;  2QTD A;  4FYD A;  3CME N;  4JEP A;  1HRH A;  4A61 A;  1NJY A;  3QLH A;  2RN2 A;  1D9D A;  3VQ4 A;  2JWL A;  1X1P A;  2F8T A;  4FWL A;  3M5R A;  3ZT2 A;  4JD2 B;  4JI0 K;  4E7J A;  2P9I A;  4BRQ A;  2IOC A;  2XO7 A;  1BI4 B;  1YJW N;  1VQM N;  2ASM A;  4DB3 A;  1IKV A;  1JLC A;  5KRS A;  1S1U A;  4HVJ A;  1RT1 A;  1ASU A;  1RDU A;  1RT7 A;  1HKC A;  4DQQ A;  4CHY A;  4IJN A;  2EHG A;  3K0S A;  4CFB A;  2VQE K;  4IG3 A;  1UA1 A;  4K8Z A;  3WQT A;  1YTU A;  1SL1 A;  4K8X A;  4Z4C A;  4B9Q A;  2H3G X;  4V19 S;  1IBK K;  2BDP A;  2GUP A;  5AQN A;  3DLG A;  4I2P A;  4CJE A;  2E2O A;  3QES A;  1T7P A;  1Q86 O;  1T3V A;  4GV6 A;  2O4I A;  2ZD1 A;  3CPE A;  3L4I A;  2HOE A;  4AHS A;  3V9X A;  4DQP A;  3LDP A;  5ADX H;  4CW7 B;  2VG6 A;  3ZSY A;  4O5B A;  4LFA K;  1Q9Y A;  3OYA A;  1BU6 O;  4N56 A;  3S41 A;  4IOA L;  2GEM A;  2FSJ A;  2PYJ A;  5AQH A;  5EVZ A;  5HLF A;  2Y1I A;  3IS9 A;  1K8K A;  3RR8 A;  1VQ8 N;  3T7Z A;  3R1X A;  3A5O C;  4LSL A;  1S6P A;  4C8L A;  3DOK A;  1YJN N;  4MDA A;  4AHV A;  4CF1 A;  4JAX A;  3RVC A;  3CQX A;  1I94 K;  3MX2 A;  4NYN A;  2X78 A;  3S3N A;  2E1Y A;  3QET A;  3PSI A;  1RTI A;  4F2S A;  5KPR A;  4WCE L;  2FSN A;  2I7N A;  2YHA A;  4K25 A;  4KH4 A;  4B9U A;  3UKU A;  1C0U A;  1HKB A;  4CZM A;  2QXL A;  2ZQB A;  2GEL A;  5BPL A;  1B9F A;  4FCY A;  3K5M A;  3VF6 A;  4CHP A;  3LZJ A;  1GLC G;  4CJU A;  4WQ5 C;  5I42 A;  2P9I B;  3VQP A;  1T6C A;  4LSN A;  4DFM A;  4BY9 C;  5AQP A;  4ILG B;  3DXK A;  1ESV A;  5BN9 A;  3O5B A;  4YFU A;  4CF0 A;  4DKW A;  1HPM A;  4CEE A;  3JAM O;  3CER A;  4PL8 A;  5T7B A;  2YNH A;  4EHT A;  4N47 A;  3TU5 A;  3OYJ A;  3L3U A;  3HXM A;  1U04 A;  1VSL A;  3VEV A;  4IEE A;  2WON A;  4BGA A;  3KVG A;  4CBX A;  3GOI A;  4CVN E;  2UXB K;  3C7N A;  4BG8 A;  3V9U A;  3HPH A;  4BRH A;  4IDK A;  3A8Y A;  1C6V A;  2NRZ A;  4CZK A;  3OTO K;  3H08 A;  3KK2 A;  4JKC A;  4DFK A;  5AQY A;  1UAX A;  3NVK A;  2ZE2 A;  2Q31 A;  1QTM A;  3CJ7 A;  3MED A;  4JS5 A;  3AVM A;  3NAE A;  1SS6 A;  5GIP A;  4E0D A;  1K8K B;  3U6F A;  2JGU A;  3J80 O;  4FLV A;  3KK3 A;  4GVE A;  3OYH A;  2DPN A;  4NYF A;  4DCH A;  3HVR A;  3NGI A;  4KH5 A;  3NMU A;  3LZI A;  3MK6 A;  3NVM A;  3O9U A;  4B08 A;  5C2F A;  2NRT A;  1XI1 A;  5J2Q A;  3OYE A;  3IG1 A;  3UKU B;  4BRC A;  4OGC A;  4BR2 A;  5AQM A;  1DGK N;  3E9L A;  1T6D A;  4N41 A;  1HQE A;  3OYC A;  1N6Q A;  4CK2 A;  4DTP A;  1QHA A;  4FJK A;  1HMV A;  3WNF A;  4CES A;  1JLB A;  4RW7 A;  2JWK A;  1VQO N;  3NH2 A;  3CJC A;  2I7P A;  4H0O A;  4KH6 A;  3OHR A;  3BZK A;  3DXK B;  3LP1 A;  4BDP A;  1UWB A;  4I2Q A;  3DRR A;  5AQR A;  4AM7 A;  4DV0 K;  1NK8 A;  4J2A A;  4XH1 A;  4CGI A;  3O3F A;  3R8E A;  5AQI A;  3E9O A;  3OJS A;  1S6Q A;  3MN6 A;  4CIF A;  4FW2 A;  2F4V K;  3H45 C;  4H8K A;  1SUQ A;  4DR5 K;  3OW2 M;  4GNI A;  2AP1 A;  1NK9 A;  1IBM K;  2GV9 A;  4W5N A;  2FBT A;  1RBU A;  4PY5 A;  3KWG A;  1ZBL A;  4HCB A;  4FOI A;  4B1Y B;  1YXQ A;  3G6E N;  1G15 A;  1BQN A;  2WC9 A;  5AQU A;  2KW4 A;  4JYA K;  3HRG A;  2ZGY A;  4AIL C;  3MEE A;  4B1Z A;  2ASO A;  3KHY A;  4LY7 A;  4BC3 A;  1WSE A;  4E3S A;  4CHQ A;  3CJ1 A;  1XUP O;  1HJO A;  4ISE A;  5CHI A;  1HYS A;  4IO9 L;  2ETJ A;  3F9M A;  2FC0 A;  3KZB A;  5CR4 A;  3PV8 A;  3CF5 L;  1HNI A;  5JMV A;  1FJG K;  4JK8 A;  3MWT A;  3J7A P;  1WSG A;  1HR0 K;  4M3W A;  1J5O A;  1HYZ A;  3HPG A;  2NRV A;  1YIJ N;  4DR7 K;  3LPT A;  4A5B A;  4JRP A;  1VQ7 N;  4DU4 A;  2IIR A;  1RTH A;  1KD1 O;  3CQY A;  3VEN A;  4DLE A;  4FWS A;  1JCG A;  2ATQ A;  3SBG A;  3THX B;  2ITG A;  3WQU A;  3SUO A;  1IJJ A;  3CCR N;  3NGZ A;  3HM8 A;  1QSY A;  5KQD A;  1CZA N;  4GVM A;  4IDH A;  4ILJ A;  1BDG A;  4M7Y A;  5EX5 A;  4XEI A;  3P5J A;  4X66 K;  3GG4 A;  4HUE A;  3BF3 A;  3HO1 A;  4JK9 A;  4WQ5 A;  2UXC K;  2V51 B;  5KTQ A;  1SKR A;  1VSK A;  1YI2 N;  2P5O A;  2YKM A;  4RW8 A;  2HHT A;  1FK9 A;  1JLG A;  3C6A A;  1XMO K;  1NGA A;  4OVL A;  3IMX A;  2HW3 A;  3OYL A;  1TK0 A;  1MDU B;  2E1Z A;  4RWT A;  3QEI A;  3SUP A;  4A57 A;  3QFU A;  2E8A A;  4DSE A;  3DLH A;  3MXM A;  4EAH D;  3VF2 A;  5GAE P;  4R79 A;  3VES A;  3WNH A;  2W41 A;  3MDQ A;  4FK0 A;  1X9J A;  3KK1 A;  4U7B A;  1WBD A;  4IFV A;  2D1K A;  3KLG A;  2IGI A;  2E88 A;  1DT9 A;  3VTI A;  3OS0 A;  3T69 A;  3H3N O;  5CY4 A;  3QO9 A;  5HRP A;  2D4W A;  5EOY A;  5AZI A;  3ZX2 A;  1EP4 A;  3O9T A;  1O13 A;  3QDK A;  4CBU A;  4RW6 A;  4F2R A;  1EX4 A;  1U49 A;  3VGL A;  2W6L A;  3EYZ A;  4FJ7 A;  1N5Y A;  3TR8 A;  3CCM N;  4YOT A;  3M8S A;  2O8D A;  4FJJ A;  2KZM A;  3V9W A;  4NCB A;  2O8C B;  3TAM A;  1C1B A;  4ILH A;  1XC9 A;  4A2B A;  2DTU A;  5AFU A;  5M1O A;  1CXU A;  4CGJ A;  4A59 A;  3CCJ N;  4C23 A;  1NK6 A;  1OH5 A;  1ZXO A;  4KB0 A;  4I7F A;  1S1X A;  1YUW A;  5FPD A;  1Y64 A;  4EZ9 A;  2P9N A;  2E6L A;  3D0P A;  5BPM A;  3TTD A;  5AQQ A;  4HTU A;  3W3D A;  3NH0 A;  3IFR A;  4DQ8 A;  2FBX A;  3CQ8 A;  4H0Y B;  2CGK A;  2F9W A;  1KC8 O;  1X9M A;  4RTF D;  2GUI A;  4JI3 K;  3FZL A;  1T8E A;  4CHO A;  4BRL A;  4CK1 A;  4KHU A;  3LDQ A;  1F21 A;  2FLO A;  4WFA L;  4I9L A;  2P9K B;  1YHQ N;  4H5T A;  4PA1 A;  5LMN K;  2QXF A;  1IG8 A;  4H0X B;  1ZBU A;  4HUG A;  4GMJ B;  5M1F A;  3RMA A;  1KFD A;  1BO5 O;  4NLC A;  1KRP A;  5EXW A;  5KPT A;  2AA4 A;  1GLJ O;  3BP8 A;  3CCL N;  4FWM A;  1YVN A;  4CHN A;  3L2U A;  2W6K A;  2HBL A;  4BR0 A;  3LM9 A;  4CJL A;  3LWL A;  4FJH A;  1YVU A;  1I39 A;  3JSM A;  4MQ3 A;  3BDP A;  1ZBS A;  2NRR A;  4C8M A;  4WE1 A;  1GLL O;  2HVH A;  3L2V A;  3N4Q A;  2HBJ A;  4K0K K;  2O8D B;  2YHY A;  3MCA B;  4BDY A;  3ULE A;  4B3R K;  3U9D A;  1BUP A;  3EN9 A;  4YOW A;  3J81 O;  4CJW A;  4BRI A;  2Q3S A;  5CYQ A;  3SPZ A;  1NK4 A;  1RNH A;  3NDK A;  4J2B A;  1MWK A;  2FXU A;  1HPZ A;  3NBP A;  5AQG A;  2HHU A;  3VQQ A;  1RBT A;  2P9N B;  1CLQ A;  4A62 A;  4WF9 L;  4FWR A;  1OH8 A;  3HBT A;  4KI4 A;  3NF8 A;  3K57 A;  3G4S N;  2HHQ A;  3THY B;  4DTM A;  3WEE A;  3CC7 N;  4XH5 A;  3F2K A;  4N76 A;  1H1V A;  3VA3 A;  1VAZ A;  3SUN A;  2A1S A;  1CXQ A;  1MWM A;  3A5L C;  2Q0U A;  4DV2 K;  2G8F A;  4EP4 A;  3WNE A;  3VET A;  4JI1 K;  4OPH A;  4PKG A;  3TSP A;  2QKK A;  3MMV A;  4DTJ A;  3KIO A;  4CJ4 A;  1JCE A;  1CZB A;  3CCU N;  2HHH K;  3FZM A;  4JD2 A;  3WXL A;  1OH6 A;  3SBT A;  3QER A;  4ZHR A;  1NGD A;  4JV5 K;  4FJI A;  4H5V A;  3CJ9 A;  1JLA A;  1BI4 A;  3S3O A;  1QE1 A;  5J2P A;  3MWP A;  2X74 A;  3OYG A;  2QW9 A;  3HM9 A;  4BRN A;  2WBN A;  4OJR A;  3AO5 A;  4BR9 A;  5CZ2 A;  5IT9 O;  1LWE A;  5FRO A;  4DV6 K;  5BN8 A;  1RBR A;  2HMP A;  1NGJ A;  5DK5 A;  4KPY A;  4KHY A;  5M1P A;  4LD0 A;  1RGI A;  1ATS A;  4LF4 K;  2KFN A;  3AVB A;  3P83 D;  3ZT4 A;  1LAV A;  4CJ5 A;  2A42 A;  4BRO A;  4CEC A;  3VOV A;  4DUY K;  5GAG P;  1D8Y A;  2WOM A;  4FJG A;  4OKJ A;  3SJH A;  3RRG A;  1BIS A;  3HOS A;  1Q7Y O;  1UA0 A;  3H1V X;  5HBM A;  2A40 A;  3M3Z A;  5J1E A;  4Z4E A;  3PX0 A;  2RE2 A;  3U3G A;  1FKO A;  4B3M K;  3KD1 E;  4NXN K;  5M1K A;  4E7I A;  2QI2 A;  2QM1 A;  1OH7 A;  3MXJ A;  4I9Q A;  3OJU A;  1M1K O;  4JKB A;  4HWI A;  1VSI A;  3R9P A;  5AQK A;  3WEE B;  5GAD P;  3CFR A;  4J8F A;  4PQU A;  4IFY A;  3SAG A;  4CE9 A;  2IVP A;  2F7T A;  5BRD A;  2J4R A;  2VWJ A;  2WFB A;  1VQN N;  3AAR A;  4CEA A;  3CCE N;  1NLV A;  3C94 A;  2ZJQ L;  4DU3 A;  4K43 A;  3DLK A;  1VK0 A;  3HJF A;  2O8F B;  1WN7 A;  1BGX T;  3OYK A;  3ULD A;  4M3Z A;  3WXI A;  3NE6 A;  1YT3 A;  2KQ2 A;  2GWK A;  3VQ5 A;  3WNG A;  1GOA A;  3VEW A;  5KGX A;  4OO1 J;  3LP0 A;  2ZF5 O;  2HBK A;  1V4S A;  3LP2 A;  3HP9 A;  1N32 K;  4FWK A;  3TAF A;  1TV6 A;  2JLE A;  3CFO A;  3H46 O;  2ASP A;  3VQD A;  2NZT A;  3RTV A;  3ENB A;  3PIO L;  5E41 A;  4FW1 A;  3HVT A;  1J5E K;  1KAX A;  3CC2 N;  1RFQ A;  5DM7 L;  5AZJ B;  3TAG A;  3IUC A;  3TI0 A;  4B9S A;  3QEX A;  3ZLJ A;  1VSE A;  1DLO A;  3E01 A;  3M8R A;  3A0I X;  3J7Z O;  4BRP A;  2CGL A;  1TKD A;  2P5G A;  1BIZ A;  4FZX C;  4QCL A;  1NWK A;  3TSU A;  2ZGZ A;  1Q8I A;  4K41 A;  1QSL A;  4KO0 A;  2A6A A;  1VQ4 N;  4BWM A;  4IZ9 A;  2IC3 A;  4MDB A;  4DSK A;  4AHU A;  4Y1C A;  3V1O A;  4BRD A;  3RWU A;  4KHP K;  4X62 K;  2NRW A;  4F8R A;  3QEV A;  3QEW A;  1FKP A;  1NGH A;  3RMD A;  5AQT A;  3I8D A;  3ZSX A;  5BRF A;  4DQR A;  4CCH A;  3ZET B;  4O8K A;  1KVA A;  1Q81 O;  2VYP A;  3SZ2 A;  4NB4 A;  2YHX A;  5C15 A;  1U48 A;  5AQF A;  2HMI A;  4Z94 A;  4L3Q A;  2HBM A;  1C1A A;  2XHB A;  5KPZ A;  4KBO A;  4JKA A;  4BRK A;  1RDC A;  3CMA N;  4PL7 A;  1DTQ A;  4QOZ B;  2R7Y A;  1NG9 A;  4ICL A;  1QVG M;  2O8B A;  2HHW A;  1ZYQ A;  4HUF A;  1N34 K;  1ZBI A;  4QS7 A;  2GWJ A;  1J9A A;  2VWK A;  3ZX3 A;  3FZK A;  3T3F A;  3AV9 A;  3SI6 A;  3C65 A;  3OBY A;  4CIE A;  4MO4 A;  3D2F B;  1EXQ A;  4L8R B;  4CK3 A;  3RSE B;  4LF9 K;  1TGO A;  2W40 A;  4FWN A;  1VQL N;  4JNE A;  4DMN A;  1OVY A;  1RT4 A;  4JKF A;  4CZF A;  3EKS A;  4LF8 K;  4CEF A;  4DTX A;  1C0M A;  4CBW A;  2G8U A;  4DQS A;  1DTT A;  3TAE A;  2Q2R A;  3HYF A;  3J7Y P;  3NFA A;  3GL1 A;  3HL8 A;  1LW2 A;  3S3M A;  1BL3 A;  2CH5 A;  2E2Q A;  3V1Q A;  3OBW A;  5C12 A;  4FJL A;  3SMS A;  1NBW A;  2OCE A;  2QWO A;  1W97 L;  1VSJ A;  1L3T A;  4O8U A;  2D0P A;  2PY5 A;  3PSF A;  1WB9 A;  4DFJ A;  4H5R A;  1R59 O;  3TAR A;  1A5V A;  2G8I A;  2RPI A;  5CZ1 A;  3AO1 A;  4E1N A;  4ZTJ A;  2A1R A;  4PKI A;  5J2M A;  1QHT A;  2YJF A;  2OPS A;  1NK0 A;  4FJM A;  1S1W A;  5KGW A;  3LDO A;  3GE1 A;  3SUQ A;  4H5N A;  1P8Z A;  3THX A;  3OYB A;  3O4N A;  3ZX0 A;  4C8K A;  4OGE A;  2Y1J A;  3EZ5 A;  1K73 O;  3GDQ A;  3HTV A;  4KHN A;  1SZ2 A;  2O8B B;  2QWP A;  3FE1 A;  1BIU A;  5AQO A;  5EU7 A;  5B8H A;  2OA8 A;  5JS1 A;  1WAJ A;  3CI5 A;  4CZL A;  3EY1 A;  4FOE A;  2HHX A;  3ZSO A;  1V4T A;  3BY5 A;  4GW6 A;  4GKK K;  3RRH A;  5J2N A;  3D2E B;  5DM6 L;  2CGJ A;  4KHW A;  4Z4I A;  4KTZ A;  1NM1 A;  4BWJ A;  3BGR A;  3IAY A;  3SQ4 A;  4JKD A;  4JI8 K;  4C1N I;  2QWQ A;  3OA9 A;  1X3N A;  2PAV A;  1SL0 A;  2CH6 A;  3CC4 N;  4WYB A;  4LF6 K;  4U67 L;  2FBY A;  2V7Y A;  4GKJ K;  2Z1H A;  3O3H A;  3C6H A;  4FLX A;  2W42 A;  3TWH A;  3AAP A;  5GAH P;  4YHH K;  2ZM6 K;  5HOO A;  3HK2 A;  5BPN A;  3SAH A;  4DR4 K;  1QVF M;  3PO4 A;  5HRO A;  4FJ5 A;  1QZ6 A;  4FZZ A;  2HNY A;  4CZJ A;  2D0A A;  1XNR K;  5TKY A;  3LDL A;  1GOC A;  4B3T K;  3LAM A;  3C6U A;  3VF4 A;  1QQM A;  4C1N K;  1RTD A;  4YOX A;  4BQZ A;  4C8O A;  3HZ6 A;  1NNE A;  1JLE A;  3CYM A;  3TAB A;  2YX6 A;  3ZT3 A;  2RHK A;  2O8C A;  1SKS A;  4YDU C;  2LSN A;  1S22 A;  5C10 A;  1NJI O;  1U45 A;  3CET A;  5SWM A;  2WTU A;  4M7X A;  4DV7 K;  4ID5 A;  5C25 A;  3L0Q A;  4BE1 A;  4FPA A;  4DTS A;  3T19 A;  3MAQ A;  2QWM A;  4PUO A;  4ID1 A;  1T44 A;  3CHW A;  2Q97 A;  1WSF A;  3UE5 A;  3MN5 A;  3MN9 A;  4KB1 A;  4Z0U A;  4BRM A;  2OZM A;  3IRX A;  4BRA A;  1K8A O;  2B6A A;  1C0T A;  3TPQ A;  4UQG A;  3W0L A;  3CPW M;  1WLJ A;  1RBS A;  4AHT A;  1WOQ A;  3TTF A;  2NUB A;  4FWQ A;  4BVP A;  4ZTF A;  1QQN A;  4FJN A;  3O9Q A;  2VG5 A;  3VEY A;  2V7Z A;  3O1W A;  2P9K A;  4IJA A;  1KVC A;  1S1T A;  1S9G A;  3WXM B;  1HNV A;  4CIG A;  3E9P A;  3SAF A;  4CF2 A;  5E26 A;  3ZT0 A;  1NU0 A;  4AHR A;  3DJC A;  3V9Z A;  5TKW A;  2UUC K;  2OPP A;  2IAJ A;  4EZ6 A;  4IO8 A;  4M41 A;  5C2D A;  4DR3 K;  1IG9 A;  4Z4F A;  1N33 K;  2UU9 K;  4OLB A;  4DS5 A;  1JXE A;  5I9E B;  4F3O A;  2YHW A;  3F73 A;  4B1X B;  4Y1D A;  2ZWH A;  3SLC A;  3ID8 A;  3M6G A;  4Z4H A;  3QIN A;  1I3A A;  2RF2 A;  5HRN A;  1HUX A;  4BE0 A;  5CYM A;  2O8E B;  2XRI A;  2ITM A;  3P31 A;  5BR8 K;  1TKT A;  3IKM A;  2P9L B;  2KHO A;  2YNG A;  1XQS C;  4DV3 K;  4E1M A;  1L3V A;  1LAW A;  1SQK A;  2BAN A;  3DXM B;  2D0O A;  2YCH A;  2IDO A;  1N36 K;  5AQJ A;  1W0H A;  3THW A;  1XMQ K;  3JS6 A;  4BRG A;  5JIC A;  1VQP N;  5LJV A;  3AVA A;  3TAP A;  3THY A;  1YIT N;  4ISG A;  3BUZ B;  4RW9 A;  4Z4G A;  1LWC A;  1MU2 A;  4CF8 A;  3KJV A;  2VQF K;  4DHY A;  1L3S A;  2QEX N;  3VMF B;  3AVG A;  2UYT A;  3K59 A;  4EP5 A;  3Q7B A;  2D0B A;  4JKH A;  4B9L A;  3DLR A;  1JLF A;  2IVO A;  1XHZ A;  1BOT O;  4FVU A;  4JK7 A;  3PO5 A;  4LH4 A;  3UKR B;  3TAQ A;  1JL2 A;  1Z05 A;  3AO3 A;  4JHD B;  3ZSR A;  3VN5 A;  1JKH A;  3AVJ A;  4CEQ A;  1GLE G;  1W7A A;  3NGY A;  4H0V B;  1NK7 A;  2EX3 A;  2P9U A;  5MLC Q;  2HF4 A;  3VQE A;  1GLF O;  1NGE A;  1LW0 A;  1X9S A;  4W5Q A;  2PYL A;  4M45 A;  3G71 N;  1DEJ A;  1KLM A;  4DV1 K;  4FK4 A;  3VQ6 A;  1Z26 A;  1KSP A;  3DM2 A;  4MFB A;  4B3O A;  3MN7 A;  1KFS A;  1WSI A;  3VGM A;  3DRS A;  2O4G A;  1E4F T;  2F96 A;  3L2Q A;  1XWL A;  1B9D A;  3B6O A;  4BR4 A;  1HQU A;  3CFP A;  3OYF A;  1EET A;  1C0G A;  4QS8 A;  4A5A A;  4FWO A;  3DLB A;  2KTQ A;  4O0I A;  4YDU A;  2NRX A;  1HKG A;  4B3S K;  3DWL A;  4CJS A;  4E7H A;  4FLW A;  3DI6 A;  1D5A A;  1OVQ A;  3V1R A;  5C24 A;  3KWI A;  4BRF A;  3THW B;  1K9M O;  3NF6 A;  3ZSQ A;  4DWI A;  4FVM A;  3M8P A;  4BC4 A;  3VEO A;  5JVH L;  4W5T A;  4JI4 K;  3MCP A;  3DAW A;  4R5P A;  1Q18 A;  4DSI A;  1NKC A;  4W5O A;  1NGF A;  3KLE A;  4FLT A;  1KTQ A;  4FSV A;  5KQ8 A;  1RDA A;  1NJX A;  3H1Q A;  4B8C A;  2I5J A;  4DQI A;  1S5J A;  1P90 A;  3B8A X;  3LWM A;  2IVN A;  1BQM A;  3O80 A;  3OY9 A;  4G1Q A;  1E3M A;  1YF5 L;  3CD6 N;  1Y97 A;  4OPJ A;  2O8F A;  2Z1I A;  1VQ6 N;  5FRM A;  1TYQ B;  4BGB A;  3T1Y K;  1TAQ A;  2HVI A;  4KHS A;  5AQS A;  5JVG L;  3VEZ A;  1TAU A;  4BVO A;  3AVC A;  4QS9 A;  3O8M A;  4EIA A;  3FZH A;  4H0T B;  1SV5 A;  3HOT A;  5JS2 A;  2P9U B;  5AQL A;  2QWR A;  2HND A;  3EE9 A;  1Q9X A;  2E6M A;  4HTL A;  4JLH A;  3FZF A;  4AQY K;  3LDS A;  4DR2 K;  2OTJ N;  5FPN A;  3FR0 A;  4JI2 K;  1NGI A;  3BEX A;  4ISF A;  5AR0 A;  1RCH A;  4KRE A;  1Z6R A;  3TSQ A;  3P39 A;  2FSK A;  5I3U A;  3RR7 A;  1O1W A;  5AZJ A;  4KI6 A;  4RCH A;  3LAK A;  2DY4 A;  5HRS A;  4B1V A;  1UOC A;  3MEG A;  3L3V A;  1JLQ A;  2Q1N A;  2ZJP L;  3O6W A;  3ZCM A;  4H4M A;  1TUY A;  1ATN A;  3HP6 A;  3E66 A;  3OVN A;  4CER A;  1S9E A;  4PWD A;  4CHZ A;  3V9S A;  3EZW A;  4IFE A;  1VQK N;  4EHU A;  3E1Y A;  4M3U A;  2V52 B;  4J2D A;  4DTN A;  5HL7 L;  1VQ9 N;  3O3G A;  4PHT X;  3ZET A;  4CJT A;  4CZE A;  4KAZ A;  3SNN A;  1NMD A;  1RT2 A;  4LF7 K;  4CFA A;  2WUS A;  3VQ9 A;  3S9H A;  5FPE A;  4KKO A;  1D9F A;  4MO5 A;  4KTQ A;  4M42 A;  4OX9 K;  4IBN A;  4KTW A;  3EEQ A;  4DF4 A;  4CEO A;  3VQ8 A;  4LFC K;  4M63 C;  3FGU A;  4O44 A;  4JI5 K;  1ZC6 A;  4K42 A;  1SL2 A;  4B9N A;  1XNQ K;  1NGB A;  4CJP A;  4KHQ A;  3R6M A;  3QBX A;  3A2F A;  2D5R A;  3G10 A;  1S3X A;  1HNW K;  1KLN A;  4WQ4 C;  4JKG B;  4OKE A;  3OS1 A;  3F5T A;  4CZI A;  4J2E A;  4Q0B A;  3D2F A;  2KLA A;  3RSE A;  4OKK A;  2G8K A;  3VTH A;  3ALY A;  1ZBF A;  2RKI A;  3UB5 A;  4BQL A;  1VRU A;  1EO1 A;  1HLU A;  2DFF A;  4F3T A;  1G99 A;  3I56 N;  1U2V A;  1S72 N;  3O08 A;  3K9J A;  1FXX A;  5K14 A;  2ZJR L;  1W2B M;  3TTC A;  4FM0 A;  3AVN A;  1NOZ A;  5F0X A;  4DSJ A;  3B6P A;  2G8V A;  3AA2 A;  3NCI A;  2BE2 A;  4BC2 A;  1RT6 A;  2BH1 A;  2XY8 A;  5ELZ A;  2F8S A;  3ZEU A;  1U6Z A;  2HHV A;  2NNW A;  1NKE A;  4LH5 A;  1JL1 A;  4IEI A;  3K58 A;  3AAQ A;  3AVL A;  1BG3 A;  3WUH A;  1C1C A;  4NLB A;  2X6N A;  4B8A B;  4AHC A;  4E7K A;  1NJW A;  1EWR A;  3SMP A;  1IKW A;  4AM6 A;  4M3X A;  3ZYY X;  2YI1 A;  2OPR A;  1QSS A;  3VQC A;  4O5F A;  3IDH A;  4NXM K;  2FF6 A;  1WSJ A;  3PIP L;  3OYD A;  4FJX A;  1L5U A;  4YNQ A;  4DF8 A;  1YJ9 N;  1REV A;  4FXD A;  1T03 A;  4BRE A;  4DS4 A;  4DTO A;  3V81 A;  4LFB K;  3ZSV A;  3M1F A;  4I6M A;  3LAN A;  1LOT B;  3ATV A;  1KCF A;  3L2R A;  2Z1G A;  3LDN A;  4JI6 K;  2KZZ A;  3NF9 A;  3ID6 A;  1TVR A;  3AVH A;  1TL3 A;  3D2E A;  2YKN A;  3LAL A;  3SV3 A;  2Q0R A;  4IWV A;  4RG8 A;  2B4J A;  4XH4 A;  4CJ7 A;  1NK5 A;  2AJQ A;  4DUZ K;  3BZC A;  1YTA A;  4LF5 K;  4CFC A;  1U2V B;  3KK7 A;  1NOY A;  4O0J A;  4CD3 A;  4CJV A;  2OTL N;  3DMJ A;  3U8X A;  3KKR A;  4BG9 A;  3VA0 A;  3LP3 A;  3DOL A;  5HRR A;  5AQW A;  3O9S A;  1XHX A;  1BA0 A;  4CJK A;  3CM5 A;  3GBT A;  3KLH A;  5F2R A;  3RMB A;  1MA9 B;  2BUP A;  4YOV A;  4B1U B;  2E2N A;  4GV9 A;  1X9W A;  3PX6 A;  3ZEU B;  1RBV A;  2GTD A;  4JKE A;  4FK2 A;  3CCV N;  3F9K A;  3JXU A;  3LPU A;  2A5X A;  3D45 A;  1HNX K;  1QS4 A;  4CED A;  1U4B A;  4CZG A;  3AVK A;  2Q36 A;  3LL3 A;  1TK8 A;  2BGG A;  4H4O A;  5KI6 A;  3ISN C;  3HSC A;  4DR6 K;  3A5N C;  4Y0W A;  1GLA G;  2YJE A;  4RW4 A;  4KRF A;  3O9R A;  1TUU A;  3QBW A;  1JJ2 M;  3KLF A;  4I6M B;  1EWQ A;  5CE3 A;  4YOY A;  1TKX A;  4GV3 A;  3SQ0 A;  1B92 A;  1BHL A;  4CGH A;  3V4I A;  4TSX A;  1WSH A;  1LV5 A;  5M1Q A;  1BCM A;  4FJ8 A;  4WQ4 A;  3C6T A;  3R3L A;  1SKW A;  3L6Q A;  3PLA A;  2E2P A;  4CJR A;  1IBL K;  3THV A;  4DSL A;  3KD5 E;  3NF7 A;  2F9T A;  2QKB A;  3ASM A;  4WFB L;  3QIP A;  1OKJ A;  1W9H A;  4CGF A;  4C8N A;  1VSD A;  4BR5 A;  3MEC A;  1KVB A;  3L2W A;  2VCP A;  2PZS A;  2P51 A;  2Z1J A;  5A2Q O;  3FFK B;  2D0C A;  3O4Q A;  4CZH A;  2EWS A;  1U47 A;  1GLD G;  3SYZ A;  3HI0 A;  4AH9 A;  4FWP A;  4ELU A;  2P1J A;  3ZT1 A;  4DTU A;  3C7N B;  3I0S A;  3Q7C A;  1RIL A;  1ZBH A;  1EQY A;  4W5R A;  4DSF A;  4N5S A;  3G0Z A;  2O8E A;  4CGG A;  2QK9 A;  3P38 A;  4BDZ A;  2DFH A;  3N4P A;  2P9L A;  4CEZ A;  3TAN A;  1LCU A;  4CGD A;  1KAY A;  4YY3 K;  4E89 A;  5AQV A;  4CF9 A;  5LY3 A;  4BAC A;  3T1H K;  3DXM A;  3WXJ A;  4CJQ A;  5JLF A;  2HB5 A;  3DYA A;  3EO3 A;  4FO0 A;  2XY6 A;  3ATU A;  4JI7 K;  3G25 A;  3L8B A;  2YV0 X;  3CJA A;  1KQS M;  4JRQ A;  4B9T A;  4M3Y A;  3OYM A;  5D3G A;  5LMU K;  4LC9 B;  5HP1 A;  1RT5 A;  4IG0 A;  2HHS A;  4YOR A;  4G9Z A;  3HST B;  1Q82 O;  5KRT A; 
#chains in the Genus database with same CATH homology
 4CVN E;  1N34 K;  2UXB K;  5LL6 Z;  2UUC K;  4JI8 K;  5AJ3 K;  3OTO K;  2VQE K;  4DR3 K;  4LF6 K;  1N33 K;  1FJG K;  2UU9 K;  4NXM K;  4GKJ K;  3J7A P;  4LF9 K;  4V19 S;  1IBK K;  1HR0 K;  4B3S K;  4YHH K;  4DR7 K;  4DV2 K;  2ZM6 K;  4JI1 K;  4LFB K;  4DR4 K;  1N32 K;  5BR8 K;  3J80 O;  4DV5 K;  4LF8 K;  1IBL K;  4JI3 K;  1XNR K;  4LF7 K;  4JI4 K;  4JI6 K;  4CW7 B;  2HHH K;  4DV3 K;  4B3T K;  4LFA K;  4OX9 K;  1J5E K;  4JV5 K;  4LFC K;  3J7Y P;  1N36 K;  4JI5 K;  1XMQ K;  4X66 K;  2UXC K;  1XNQ K;  2UXD K;  5LMN K;  4X65 K;  2UUA K;  1I94 K;  5IT9 O;  4DV6 K;  4DUZ K;  5A2Q O;  1HNW K;  4LF5 K;  1XMO K;  4DV7 K;  3T1Y K;  2VQF K;  4LF4 K;  4DUY K;  4KHP K;  4AQY K;  4DV0 K;  4X62 K;  4DR2 K;  4DR1 K;  2E5L K;  4JI2 K;  5FLX O;  2F4V K;  4YY3 K;  4DR5 K;  3T1H K;  4K0K K;  1IBM K;  4B3M K;  4NXN K;  4X64 K;  1HNX K;  4B3R K;  5IWA K;  1HNZ K;  4JI7 K;  4DV1 K;  3JAM O;  3J81 O;  4JI0 K;  4JYA K;  4DV4 K;  4GKK K;  5LMU K;  2UUB K;  4DR6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...