2UXDK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxdK00
5FLXO 2UUAK 4DV3K 3J80O 4X64K 1N34K 4LFAK 1IBLK 1N36K 2HHHK 5IT9O 4DUZK 5LL6Z 4JI5K 4X66K 1HNZK 4LFBK 4CW7B 3T1YK 4DV0K 1I94K 1XNQK 3OTOK 4YY3K 4DR6K 1N33K 2F4VK 4DR1K 3J81O 4NXNK 4K0KK 4CVNE 4DV1K 5A2QO 4DV2K 4LF8K 2VQFK 4V19S 4JI7K 1XMQK 4JI2K 5BR8K 4LF7K 2VQEK 4GKJK 4JI6K 4JI8K 4LFCK 3T1HK 2UU9K 4JI1K 1FJGK 4GKKK 1N32K 5IWAK 4B3RK 4NXMK 1J5EK 5LMUK 4LF4K 4DV6K 2UUCK 4B3SK 4LF9K 4DV5K 4YHHK 1XMOK 2UXBK 2UXCK 4AQYK 1IBMK 1HNXK 4DR3K 4DR2K 1HR0K 1HNWK 3J7AP 4B3MK 2ZM6K 4DR4K 4JI3K 4OX9K 3J7YP 2E5LK 4LF5K 3JAMO 4X65K 1XNRK 4DR7K 4KHPK 5AJ3K 4JV5K 4JI4K 4JYAK 5LMNK 4DV4K 4X62K 4JI0K 4DV7K 4DUYK 4DR5K 4LF6K 4B3TK 1IBKK 2UUBK 2UXDK
chains in the Genus database with same CATH superfamily
4L3QA 3CCSN 3GL1A 3ID8A 3KK1A 1NK6A 3QINA 1VSDA 5FLXO 3V4IA 5HROA 2P9PB 2FLOA 4BY9C 4YFUA 1IBLK 4DF4A 3G71N 4HUGA 3OHRA 3MX2A 5H1SQ 1G99A 1XC3A 1U47A 4FPBA 4CJ5A 1LAVA 4B9LA 4DR6K 4FLUA 2HSTA 3HOSA 4Z4EA 2YNHA 3P31A 3QNNA 5FROA 2OPQA 1WAFA 4DSLA 4DV2K 3NF6A 4DQSA 1RILA 2VQFK 4YOXA 4PL7A 3C6TA 3SPYA 2P9IB 3AA2A 2OANA 2Q1NA 4DWIA 3OYIA 3GG4A 4UQGA 5DMRA 4FK0A 3BUZB 4Z94A 3ZCMA 3FLCO 2VG5A 3VEYA 2YHBA 4B3RK 3TANA 3VA3A 3U8XA 2VWJA 2P9SA 3R3LA 3NE6A 2ASMA 2V51B 4BC2A 4CZIA 3PIOL 4M42A 3CD6N 2X6NA 3AGRA 1VRTA 3H6EA 3DLGA 1ASVA 1XMOK 2QWOA 3IG1A 4B3OA 2ZWHA 4I2QA 1QTMA 1A5WA 1S1XA 2IIRA 3SLCA 3T7ZA 2RKIA 5HRRA 3AVFA 4DR4K 3AVBA 3FZFA 5C42A 3VQCA 2NRRA 4A5BA 4IZ9A 3JAMO 3EYZA 1NWKA 1YIJN 4U7BA 2E6MA 5KGWA 5KI6A 4OPKA 5I3UA 3HPOA 4IFYA 1QZ5A 3HBTA 2YHAA 5LMNK 3AA5X 1C0MA 5FPMA 3FZHA 4DUYK 5I42A 1NGBA 1CXQA 3DM2A 2OA8A 4K25A 1EXQA 1ATRA 5KPTA 3CJ7A 4IO9L 5AQYA 2YHWA 1NJZA 2W42A 1QQCA 1N34K 2E4LA 2NRZA 4BDZA 3PV8A 1JCFA 4ISEA 1NGEA 5IT9O 3V9SA 4FO0A 3M8SA 4JHDB 3C7NB 4OO1J 5GIOA 3L2UA 4MLHA 3SMSA 2YHXA 4RW8A 3THWB 4OPAA 3T1YK 3A5OC 1U2VA 4CVNE 2HNYA 4FOIA 2OTLN 1JCGA 4H0XB 2QWPA 4KBOA 1DEJA 4JD2B 3VEVA 1QSYA 4B1XB 1Q8IA 3TSPA 3U9DA 4V19S 4O8UA 4OKEA 5TKWA 4JS4A 3M8PA 5BR8K 1YF5L 3MWTA 3RMDA 3AVAA 3MXMA 1YVUA 3OS0A 2G8HA 1T03A 3T1HK 5LY3A 4BDYA 2YKMA 4I7FA 1L5UA 1FJGK 4F2SA 3NCIA 3MN5A 1QQNA 4E1JA 4KO0A 1J5EK 4LSNA 1KFSA 3RMBA 1VAZA 2IVNA 2QWLA 1FKPA 4IDKA 3TAPA 5AQKA 1BOTO 2P9SB 2PFUA 2F9TA 4DSKA 1DGKN 4YHHK 2AA4A 3B6PA 4E7HA 3SUNA 3ALYA 4B08A 4Q5VA 1YHQN 4B8CA 1LAWA 3I8BA 4CIGA 3A2FA 5HLFA 4KHSA 1BIZA 1VSFA 4AF1A 3HJFA 3BDPA 3OYAA 3EZWA 1QVGM 2Q36A 3VF4A 4FZXC 4NYNA 1L3UA 4R79A 5K14A 1WB9A 1NM1A 2Z1JA 3E9OA 3SQ4A 2VCPA 4BR7A 5TKYA 4CK1A 1T8EA 4DCHA 1H1VA 2JWLA 5BN8A 3OBYA 2P5OA 4M3WA 1L3TA 4CZJA 3BZCA 1FW6A 2PYJA 4KHWA 4M41A 1VQON 2A5XA 2D0AA 4IJAA 2UUAK 1TV6A 4E3SA 3P39A 4N47A 2W6LA 4DB3A 1BWFO 3CHWA 4N76A 3E1YA 1KQSM 1B9DA 1CXUA 3VOVA 1VQLN 5KPRA 1EKEA 2DFFA 3HTVA 3OYDA 1IKYA 2QXFA 3QFUA 3LL3A 3OTOK 4DV0K 1BG3A 1NK4A 3VQ7A 3K2PA 3P83D 4KB1A 3H3NO 3MEGA 2X74A 3CIPA 4CD3A 3CQ8A 1U2VB 3FZKA 3HM9A 3DXKA 4CHNA 4E7LA 4BG8A 5AQNA 3BEXA 4KH4A 1HKBA 4B1YB 4DU3A 2X78A 3CG7A 1UAXA 3AVJA 1VQ6N 1ESVA 5LJWA 4CJVA 2GUIA 3LP0A 4EIAA 1U6ZA 2QA4N 1WSHA 2CGJA 1N32K 2KW4A 1DTTA 5M1FA 3SUQA 2A3ZA 3EY1A 4N41A 4BRFA 4YOTA 4IFVA 4EFHA 5JMVA 5GAHP 3DOLA 1VQ5N 1EWQA 4O4GA 3JS6A 3LM2A 1RBTA 2HF3A 5FDLA 1MWKA 2HF4A 4PA1A 3NAEA 3SBGA 2G8UA 1TUYA 1EQYA 1RDDA 1IKVA 3VEZA 4OPJA 2IVOA 4JKGA 3KWIA 4QS9A 3U4LA 2BTFA 3DLEA 3B6OA 5B8HA 2XO7A 4B8AB 4XH5A 4ELTA 4OJRA 4BACA 4I6MA 5JVGL 2UUBK 3LP2A 3H45C 3M6GA 4JKCA 3V9XA 1E4GT 3BF3A 3D2EA 3ENOA 5C2DA 3OYJA 1XC9A 2DPNA 1P90A 3TR8A 4DLGA 4H5RA 2QWMA 3JYTA 3F9MA 3SV3A 3KKSA 5JS2A 2XRIA 3TABA 3LANA 4FWRA 2O8DA 4CGHA 4DFKA 4JI5K 3A8YA 3O9SA 4AHSA 1TYQA 4WFBL 4B1UB 3SPZA 2HMPA 4YY3K 1VQ9N 4CECA 1J9AA 1NLVA 4FJ9A 4M7XA 2R7YA 3J7ZO 3D45A 3BP8A 5HL7L 5CY4A 4CIEA 4O0JA 3R6MA 1SKWA 5C25A 2YCHA 3SK3A 4AHUA 1N5YA 4CGJA 3DXKB 3OYGA 3EKUA 4PKGA 4CF2A 2Q97A 4DHYA 1KVBA 3HK2A 4AM7A 4YDUC 1SKRA 4FM2A 1HUXA 3OVNA 1TK8A 2HHXA 1XUPO 3O4NA 4IOAL 1NOZA 4FWKA 3UB5A 4LF9K 3MCAB 4CJEA 1GLCG 2OTJN 4JKHA 4FVUA 2OPRA 4DR2K 1GLJO 4CJTA 4KHQA 1GOCA 3CXCM 4F4KA 2GX9A 4IFEA 2ZM6K 2D0CA 3QIOA 5I9EB 5C12A 3NH2A 4LF5K 1S72N 2Z1HA 1B92A 4PHTX 1ZBLA 4OLBA 3V1QA 2P9NB 5M1PA 1X9MA 3CJ1A 4JKGB 3QNOA 1KXPA 3PX0A 1QS4A 4LF6K 3DOKA 2D0BA 3AVGA 3CJ9A 4M3XA 3I56N 3I0RA 4I6MB 2I7PA 3C6AA 3ZEUA 3TTCA 3ZSQA 4MO4A 3HT3A 4WQ4C 1D8YA 3CCVN 3D2EB 2FSNA 3A5LC 1IH7A 3LM9A 3ITHA 1HKCA 3L2RA 2G8KA 4DQIA 2IOCA 1T6DA 2H3GX 1XNQK 2O8DB 1HMVA 3A5NC 4BRAA 4RW7A 1TYQB 4DLEA 3GDQA 4GVMA 4BC3A 4FK2A 1MWMA 4ZHRA 1NJXA 4KTWA 3U3GA 4ILJA 4W5OA 4RG8A 3K5LA 4CZHA 1HNVA 4C8MA 4FZYA 2Q31A 4Z4IA 3CFRA 1WOQA 3AAPA 4DTPA 4JI8K 5BRHA 4A62A 4YOVA 3M8RA 5LJVA 5CZ1A 1NJWA 1J54A 3LDNA 4YNQA 4EZ9A 4HTLA 4BRQA 1T3VA 4XEIA 5HRNA 1S9GA 3LDLA 4PKIA 1EP4A 3O08A 5LMUK 3EZ5A 4LF4K 3TTDA 2VGMA 1NMNA 1YAGA 4BE2A 5HP1A 4YDUA 5BREA 1X3NA 3UIQA 5AQFA 4BR0A 2UXCK 4FJ5A 1TAQA 3ZSVA 3KLGA 1DKGD 3IDHA 4HWIA 1CZ9A 1RT1A 3J7YP 2E5LK 3QLHA 1T7PA 3RRGA 3G25A 5AR0A 1UWBA 1VRUA 3AVHA 2EHGA 3THXA 3Q7BA 1VQPN 1WSGA 1ZBFA 1RNHA 4FWOA 3ZX2A 3KLFA 3VEOA 3QEXA 1YXQA 4FLZA 2HHTA 2VYPA 1M1KO 1TKTA 4CGFA 3ZT2A 3NMUA 2WOMA 3HL8A 2NRVA 4NLCA 3MXIA 3CETA 4CFBA 2E88A 5F0XA 2JLEA 3TSUA 4DKWA 2YI1A 2CGKA 3L6QA 2FBXA 3VPZA 3ZSYA 3L8BA 4DTJA 3DXMA 3FFIA 3VESA 4DSJA 3ZEUB 2V7YA 5J2MA 3I55N 3MECA 4FJJA 4I9LA 4LY7A 1EO1A 3RR7A 3WUHA 5GAEP 4MO5A 4KI4A 4JK7A 5BPLA 2G8WA 3ZETA 1KRPA 4FWSA 5AQVA 4Z4FA 3SQ1A 5AZJA 2Z1GA 3NH0A 3V9WA 3V9UA 1C6VA 2I7NA 1K8KA 3V81A 4CFAA 2IGIA 1C0GA 3VA0A 4Y0WA 1TAUA 4C23A 3MN7A 4O5BA 1JLAA 3K57A 3VTIA 1S3XA 4ZTFA 4IDHA 3DWLA 4NXMK 3KD1E 4KTQA 2W41A 4OVLA 4E0DA 1XWLA 2YNGA 2DFEA 3PUFA 5KQDA 4AILC 1EWRA 3PX4A 1VSHA 4DU4A 3S41A 1HQUA 1RTIA 3CMAN 1YT3A 3DLHA 3QFPA 4CBUA 1BU6O 3PIPL 1HR0K 3E01A 1WBBA 3R9PA 1C0TA 4XH1A 2ETJA 4BROA 2HHUA 1ZBSA 4RCHA 3P38A 3QBWA 3AVMA 3O80A 3SV4A 2X6SA 4XH4A 1LCUA 3HYFA 1RDWX 2XY6A 1SKSA 5C2FA 3VQAA 4CEQA 5ADXA 1Z05A 4WFNL 2DTUA 3LP3A 3VQEA 3PSIA 5F1XA 1SQKA 3THXB 4PL8A 1EX4A 3SJJA 1R0AA 3A5MC 1BA1A 2FBYA 4Z4HA 3W0LA 1RBVA 3QDKA 3IAYA 4BREA 2UXDK 1U49A 4W5QA 4C1NI 1RTDA 1ASUA 1VSMA 4DF8A 5FPNA 5EY4A 1EETA 4FWPA 4X64K 3DLKA 4LH4A 3I8DA 4E1NA 3O9QA 4CF0A 4M3YA 3O1WA 5AQTA 4B9MA 4FLVA 4AHVA 3DXMB 3SMPA 3GOIA 5KTQA 1NGDA 3EO3A 4EZ6A 1F21A 1OVYA 1HNIA 1S1WA 2BE2A 4FL9A 3J81O 4F9OA 4W5NA 3KLEA 3O4WA 4F3OA 3TU5A 4LF8K 3AGKA 1U4BA 4JAXA 3ZETB 1NGHA 3F2KA 5J2PA 2KHOA 1ZC6A 5AZJB 3CCMN 4BRIA 1WLJA 2NRTA 4DQ8A 4JI1K 4O8KA 4IOCL 5GADP 4LD0A 3VEWA 1K8KB 4B1ZA 4JNEA 5AQSA 3T1AA 3I0SA 4BR5A 3NF8A 4AM6A 5BRDA 1JLQA 3TWHA 2HHQA 1LW0A 1GLDG 3FE1A 2QXLA 4FW2A 2UUCK 5AFUA 1NK5A 5JICA 4KH5A 4HCCA 4FJGA 4KI6A 4KTZA 2Q0RA 4JN4A 4CK3A 3RSEA 1S22A 3KK2A 1YJ9N 4FJ8A 3MDQA 3V1OA 1HJOA 3VGKA 3BF1A 4B3MK 3VEXA 1GLLO 3CCQN 4MDAA 4KFBA 4BRNA 1NJYA 4BRDA 4LH5A 4CFCA 1LWEA 1N6QA 4FM1A 1NNEA 2QI2A 1IKWA 2QKKA 2O8CA 3O1BA 1QQMA 2XHBA 3ATUA 4M3ZA 3OYHA 4E7IA 3K58A 1VQ4N 1TL3A 4IEIA 2RE2A 1QSLA 4CEZA 1ILYA 3F73A 4GV3A 4CEDA 2FXUA 3O3GA 3D7EO 1KFDA 4BRGA 3IMXA 5AQRA 4FOEA 1LV5A 1WUAA 4IG3A 1X3MA 1OH6A 5JLFA 4BGAA 4NCGA 2BDPA 1Q81O 4DTNA 2KFNA 3V1RA 3E9PA 1LW2A 1N36K 1WAJA 3QB0A 1K6YA 1HYZA 5CR4A 3A0IX 3C6HA 3O9RA 4PQUA 4RW6A 3LDQA 5EX5A 4CGDA 4NO7A 2PZSA 4AHCA 1W9HA 1DT9A 3OJUA 1HQEA 4N56A 3LP1A 3LDSA 2P9LA 4E7JA 1TUUA 1GLFO 3KTQA 3HP9A 1N33K 3SZ2A 1S5JA 2E2OA 1G15A 4AHRA 5A2QO 1K73O 1XQSC 3K5MA 2FC0A 2NNWA 3DI6A 1XMQK 1GLBG 2GV9A 4KREA 3DLLL 1KVCA 2E8AA 1KLNA 4MLEA 4BRPA 2AP1A 4CERA 4IWVA 2UU9K 1NMDA 1KAZA 4FCYA 3GE1A 4BRMA 3CC2N 3PO5A 1WSEA 4AHTA 1YITN 3CM5A 4CJQA 1IV0A 3AA4A 3VQ4A 4R5PA 3EE9A 4B9VA 2HBJA 3CI5A 1T44A 2P9KA 3H08A 2HMIA 3IRXA 2WC9A 4H0PA 2UXBK 1W7AA 1HNXK 3K9KA 4KHYA 2NRXA 3O9UA 4GY2B 4CZFA 4FLWA 4OX9K 3RSEB 2ZQBA 1OH5A 1SS6A 1BDGA 1VSKA 3S3OA 1S1UA 1X9WA 3HI0A 1T05A 3VN5A 4ZTJA 3CERA 4I9QA 4KB0A 3SUPA 3HRGA 2O8CB 4RW9A 4FJNA 3ENBA 4FWLA 4H0YB 2Z1IA 1GOBA 3BZKA 3F9KA 3NGZA 5M1KA 1JL2A 3L2VA 4IJNA 3QERA 3AVNA 1BCOA 3AV9A 3WNGA 5FPEA 3KD5E 3NDKA 3CCRN 3SAGA 4CEEA 1TK5A 1ITGA 4JKFA 1W2BM 2BANA 3FGUA 3OYMA 1Y97A 3KJVA 5AQWA 1J6ZA 4E1MA 3D6RA 3ZT0A 3DJCA 2A1RA 1TKZA 1S1TA 4YORA 1J5OA 2OCEA 2HBMA 3NFAA 2O4GA 2HVHA 3WXKA 1GOAA 2RN2A 2NRWA 4M3TA 2P9LB 4M3RA 4GVEA 3VGLA 1KAXA 1JLGA 3CM6A 1S6QA 3CCEN 4C8KA 4KHNA 1C0FA 5CZ2A 2ZD1A 1YJWN 4CZLA 3U3YA 1ASWA 2EX3A 4BE0A 4GKJK 4RTFD 2NZTA 4J2BA 2D0OA 3G6EN 4JRQA 4IXCA 4Z4GA 1RDBA 2D4WA 1L3SA 1HRHA 4CZKA 1VSEA 4FJKA 3TAFA 4K8XA 5J2QA 1NU0A 2W6KA 2VG6A 4JKBA 4CJKA 2OYQA 1RBUA 1SV5A 4EP4A 3D2FA 4CF1A 2CH5A 4BQZA 1IBMK 2IS3A 3VQPA 5EVZA 3CJBA 3M8QA 3HPHA 2KFZA 2FF6A 2P9KB 4CZMA 3EKSA 1TKXA 4CJ3A 2JWKA 4CJWA 4B9NA 4BWJA 2D5RA 2D0PA 3SQ0A 4FJMA 3KLIA 1QE1A 3CJCA 1T6CA 4ID5A 5CHIA 1B9FA 4W5RA 3C0BA 4FJ7A 1NG9A 3HXMA 5GAGP 1IJJA 3OYEA 2YX6A 3F5TA 2HHVA 3ID6A 3RTVA 3IFRA 3ZT3A 4KKOA 4B1VA 3DLBA 4YOYA 3U9ZA 1XHZA 3ZT4A 4QAGA 1RBSA 3J80O 5KRSA 3DMJA 3KK3A 1A5VA 1Y64A 1IG9A 1JCEA 3ZT1A 4K43A 1WN7A 2G8IA 3AO5A 4BRCA 3K0SA 3PX6A 4JS5A 3THYA 1BUPA 4CHOA 4CIFA 4HHTA 2WBNA 4EHTA 1RFQA 4OKJA 3LAKA 3CCUN 1TGOA 3RRHA 2KZZA 4QS7A 1S6PA 4FW1A 4CJFA 4CGGA 3DRPA 3CQYA 1RT3A 3OYBA 3RWUA 3AAQA 3AO3A 4JEPA 2RPIA 2VGNA 1R59O 1K8AO 2Q3SA 5GINA 4DSEA 3MN6A 5CE3A 1V4SA 1WSIA 3OYNA 3LDOA 3WXIA 1IG8A 4FYDA 3QETA 4DV5K 4CF8A 1E3MA 3DRSA 2W40A 1K9MO 1WBDA 3K9JA 2FF3B 1JJ2M 4DMNA 3MEDA 2F7TA 3E9LA 2IVPA 3TAMA 4DTSA 3CF5L 3D2FB 2PYLA 2OPPA 5CYMA 4FPAA 2B5JA 3D0PA 1IKXA 2G8FA 4G9ZA 3J8AA 1RDUA 4OLAA 1QHTA 3SI6A 1FXXA 4MQ3A 4NYFA 4UY8O 4KH6A 1UOCA 2GWJA 1Q9YA 2Q0UA 2P1JA 2KKZA 2FBTA 4BRKA 1OH8A 3HZ6A 4YOUA 2OPSA 3L3UA 3QBXA 4J2DA 3HO1A 1BGXT 2FSKA 1NGCA 1NOYA 1SL2A 4GV6A 3RMAA 2Y1IA 4A59A 1OH7A 3LPUA 3WXMB 3WQTA 3CCLN 1VQKN 2HHSA 3KIOA 4BVPA 4HVJA 4FK4A 3AO1A 3TAEA 1A5XA 1NK7A 3B8AX 1W0HA 1DLOA 2Q2RA 1WSJA 3BY5A 2GELA 4WYBA 2YJEA 3ZX0A 4CEOA 4BR2A 5AQHA 4DR1K 3ZLJA 4NXNK 4K0KK 3LDPA 4DV1K 4PWDA 4WQ5A 2CGLA 2WUSA 3UKRA 4FJLA 1ZBUA 3THYB 4FVMA 5BPNA 2O8EA 4Y1DA 4FJHA 5AQIA 3CMEN 2WFBA 2HBKA 2BUPA 4Y1CA 4LF7K 3AVCA 2IC3A 1X9SA 1NGAA 5C24A 4CK2A 1SL0A 3WQUA 2GBZA 2QK9A 1Q9XA 5HRSA 1QVFM 3LALA 3QEPA 3MN9A 3O9TA 3FZLA 3KZBA 4JKDA 3VQ5A 2P5GA 4C8NA 4CJPA 5AQPA 4NCAA 1BHLA 4ISFA 2QKBA 4Z0UA 4YOWA 4BDPA 3K59A 4CJRA 4F2RA 3EL2A 4TSXA 1D9FA 5HOOA 3J7AP 3KKRA 3OW2M 1S1VA 4A57A 2B6AA 2D1KA 3MWPA 5AZIA 2A6AA 3CC7N 5F2RA 4JHDA 2ZGYA 2ZE2A 3C7NA 3OYKA 1HKGA 4M3UA 3WNEA 3CJAA 4WF9L 2WONA 1KSPA 2OZSA 4H0OA 1MA9B 3THWA 5AJ3K 4JK8A 3VF2A 3VQBA 3RR8A 1KTQA 4JYAK 2GUPA 5EU7A 4DV4K 1VQ8N 2YHYA 1CZBA 3FFKB 1GLEG 4CGIA 4CHPA 4JD2A 4RW4A 3HM8A 5GIPA 3CFPA 3QEWA 3THVA 2QEXN 1JXEA 1Z6RA 1SZ2A 4FM0A 1JKHA 4LFAK 4NB4A 3TPQA 2NRHA 4FSVA 1ATSA 5DM6L 4H0VB 5FPDA 1O13A 3WT0A 3QMLA 1XHXA 4C8LA 3KWGA 5C10A 4JLHA 2OZMA 4GNIA 1RT5A 4DU1A 1BISA 1RT6A 2F8TA 1Z26A 2F4VK 2HNZA 3O3HA 3OBWA 1RTJA 3G4SN 4FWMA 3UKUA 4BRLA 3TARA 4QS8A 1KD1O 2DFHA 3ZYYX 2PY5A 1NGIA 3I33A 1ZYQA 2IAJA 3MX5A 2IDOA 2ATQA 2F8SA 3AVLA 3AVKA 2YKNA 3WXJA 4O0IA 4DQRA 3UKRB 4E89A 5BR9A 5AQZA 4DTOA 2HB5A 5BRFA 2O8EB 5JLHA 4KHUA 4JRPA 3HVRA 1BQMA 3G10A 3HOTA 2BGGA 1VSLA 1NKCA 4BC5A 3VETA 1LWFA 1TVRA 1JLCA 3N4QA 3ATVA 4BQLA 4B9UA 3QEVA 5HBMA 3GBTA 1D4XA 4N5SA 4A61A 1WNSA 2QWQA 4FLTA 4FXDA 4FJXA 1I39A 4KRFA 2E1ZA 3MK6A 4AQYK 3HSCA 3DLRA 1V4TA 1RDCA 2O8FA 1C1AA 1ZXOA 4K8ZA 2XY8A 3HSTB 4DTMA 4X65K 5KRTA 4HUEA 2HW3A 3R8EA 5AZIB 5AQUA 3SYZA 5AQXA 3H1VX 4DTUA 1OKJA 3ZSOA 2ZJQL 1JXBA 3SAHA 4B3TK 2ASPA 3IKMA 1FK9A 3KK7A 3VQDA 2VWBA 4CJLA 4DTXA 3LZJA 3S3MA 1KC8O 1VSJA 4H4OA 3AARA 1C1BA 3NVKA 1Q86O 4X66K 1BQNA 4CW7B 3KVGA 3SAFA 1I94K 2ZJPL 3NVMA 5AQGA 2WTUA 5SZTA 3NH1A 2J4RA 1M90O 1LOTB 4M63C 4CESA 2E20A 3TTFA 1VQNN 1VK0A 4DS4A 3AA3A 3UKUB 2YNFA 4JI7K 4DQPA 1VSIA 4I2PA 3C6UA 1SUQA 4JI2K 1W97L 4K42A 4OKKA 5AQJA 3EN9A 4LFCK 5FRMA 1XI1A 4DS5A 4H8KA 4Z4CA 4DQQA 1ZBHA 4GKKK 1NBWA 3M3ZA 5IWAK 4DSFA 4Q0BA 1J53A 3JXUA 3SBTA 4BG9A 4F3TA 3ZX3A 3E66A 1TL1A 3V6DA 4DFMA 4ILHA 1VQMN 3ZSZA 3OYCA 4NCBA 3M1FA 4NLBA 2VG7A 2XY7A 4DR3K 4DTRA 1JLFA 3ULDA 2B4JA 3QIPA 2DY4A 1C1CA 3WNFA 4H5WA 4RWTA 4QOZB 1N8RO 4FZZA 1HX1A 4CJ7A 3RMCA 2HNDA 4CE9A 2O8FB 3QESA 4A2BA 4JKAA 1JL1A 1XNRK 3C95A 1RTHA 3O4QA 2O8BA 3RVCA 5J2NA 1CZAN 2P9UA 3C65A 2GTDA 3CC4N 3SUOA 4J2EA 4BGBA 3K5OA 1X9JA 3UE5A 1MU2A 1NK0A 5JVHL 4AH9A 2E2QA 2A40A 3AVIA 4BC4A 3U6FA 4GW6A 4DV3K 4IG0A 4B9TA 1P8ZA 2HHHK 4H4MA 1QHAA 2UYTA 5CYQA 3CQXA 4WCEL 5SWMA 1BI4A 3OS2A 2YJFA 4LFBK 2I5JA 5AQOA 1BA0A 3VQ6A 2E2NA 4CJSA 2KQ2A 1NKEA 1TKDA 1E4FT 4ICLA 4CJ4A 1DTQA 1U04A 4EP5A 3V9ZA 2PBDA 4J8FA 3DAWA 4CHQA 3ULEA 3L4IA 3O5BA 2QW9A 4IOXA 2ZF5O 4PUOA 4FWNA 1Q7YO 2FSJA 3PY8A 1U48A 1NK9A 1KLMA 3NGYA 3K5NA 3SCXA 3O3FA 4E7KA 2P9NA 3LZIA 3EEQA 5AQQA 3CCJN 2KTQA 3SQ2A 4KV8A 1YUWA 2Y1JA 5HRPA 3VENA 5M1NA 5E84A 4B3SK 5ADXH 1RCHA 3OA9A 1NKBA 1HLUA 2JGUA 1RBRA 3IUCA 4HCBA 3OYLA 3MXJA 3SNNA 1HNWK 2HHWA 1X1PA 1SAZA 1UA0A 4OGEA 2FBVA 5E41A 1YTUA 4W5TA 3G0ZA 4WFAL 3OJSA 4PKHA 1IO2A 4DR7K 4KHPK 3FR0A 4CBWA 2ITMA 4U67L 2HBLA 3QO9A 4CCHA 4X62K 4CEAA 2E6LA 4BWMA 4BRHA 1MDUB 2A42A 4CFDA 3ENHA 3TSQA 1IBKK 2A1SA 4DFJA 3MMVA 2O8BB 5EXWA 2V52B 3PSFA 4CEFA 2P9UB 1QSSA 1KCFA 4M45A 1NGJA 4J2AA 3H46O 5KGXA 1HJRA 2XY5A 2RHKA 2E1YA 1OVQA 1UA1A 5M1QA 4DUZK 3HPGA 3TAQA 4PY5A 3NF9A 1JLBA 2GWKA 3VF6A 4ELUA 1BCMA 5T7BA 2HOEA 5BN9A 5LL6Z 1NGGA 1BL3A 1RT7A 3VTHA 1HNZK 1GLAG 4CZGA 1HYSA 1NK8A 3T69A 3WEEA 1BI4B 3O6WA 3P1GA 3H3OB 4ID1A 3VQ8A 3HP6A 3QEIA 1TK0A 2RF2A 3ZSXA 4O44A 3VQQA 2KZMA 3SJHA 3CYMA 3L3VA 4MDBA 4FLYA 1YJNN 5AFUH 1Q18A 3ULEB 4O5FA 2A41A 3VGMA 1JLEA 4CHYA 3AY9A 4H0TB 4KAZA 3Q7CA 4M7YA 4WQ5C 1YI2N 4CD1A 2EWSA 4B9QA 4E19A 1YVNA 4LC9B 2ZGZA 3LAMA 4DV6K 3ZSRA 4FLXA 4HUFA 3ISNC 1ATNA 2QTDA 1RT2A 2ITGA 4CBXA 3OYFA 1NJIO 2AJQA 4WE1A 4CZEA 3T19A 4BR4A 4A5AA 2CH6A 1VQ7N 2ZJRL 5ELZA 4A2AA 3AO4A 1KVAA 1O1WA 2ASOA 1KAYA 1ZBIA 4BE1A 4BR9A 3AO2A 4CEBA 4CJUA 1BO5O 3NHGA 4ISGA 3MCPA 4B1WB 4G1QA 1QZ6A 4JI4K 3HVTA 3C94A 4JI0K 1Z25A 4DR5K 4EAHD 2KLAA 4LSLA 3BGRA 3LWMA 5AQMA 3PO4A 2P9PA 3CPWM 2G8VA 5C0YA 4C1NK 4K41A 4H5NA 3FZMA 3NF7A 2V7ZA 2LSNA 1WSFA 5C15A 2YV0X 3VMFB 1REVA 3L2WA 2QWNA 4H03B 3NGIA 4DSIA 1LWCA 1D9DA 3ZSWA 5JS1A 4IKFA 4OPHA 3DYAA 5J1EA 2QWRA 3P5JA 3OY9A 3WXLA 3ASMA 5M1OA 3S9HA 4H5TA 5DK5A 1HPZA 4DFPA 3O8MA 3KLHA 4KPYA 3W3DA 5KPZA 4JK9A 3T3FA 4CF9A 2NUBA 4GMJB 3TAGA 1RGIA 4IO8A 3WEEB 1YTAA 4CHZA 3P4IA 1RT4A 2NLXA 2P9IA 4DG1A 5AQLA 2P51A 1RDAA 4OGCA 1U45A 2F96A 3QICA 4O55A 3MEEA 4QCLA 4XIUA 4IEEA 2F9WA 4BVOA 3H1QA 2VQEK 4JI6K 4EHUA 3NBPA 4FWQA 3DRRA 3L4QA 1C0UA 1I3AA 5BPMA 3M5RA 2BH1A 2PAVA 2O4IA 4GV9A 1L3VA 4C8OA 5KQ8A 4HTUA 5E26A 4IBNA 1NGFA 4B9SA 2GEMA 3VERA 3EE8A 5DM7L 1BIUA 4MFBA 5EOYA 3TI0A 3CPEA 3OS1A 3L0QA 1VHXA 5FRNA 3KHYA 4ILGB 4ELVA 1QQOA 3N4PA 2VWKA 1HPMA 4JI3K 4F8RA 5MLCQ 4JKEA 3PLAA 3CFOA 3JSMA 2HVIA 3LWLA 2QM1A 3IS9A 1Q82O 1SL1A 4JV5K 4FJIA 3S3NA 4H5VA 1FKOA 1CLQA 3L2QA 4DV7K 1HYVA 4L8RB 3VQ9A 3R1XA 4WQ4A 4CI6A 5D3GA 3WNHA 1S9EA 3LPTA 1D5AA 3MAQA 2YNIA 2E2PA
chains in the Genus database with same CATH topology
5FLXO 2UUAK 4DV3K 3J80O 4X64K 1N34K 4LFAK 1IBLK 1N36K 2HHHK 5IT9O 4DUZK 5LL6Z 4JI5K 4X66K 1HNZK 4LFBK 4CW7B 3T1YK 4DV0K 1I94K 1XNQK 3OTOK 4YY3K 4DR6K 1N33K 2F4VK 4DR1K 3J81O 4NXNK 4K0KK 4CVNE 4DV1K 5A2QO 4DV2K 4LF8K 2VQFK 4V19S 4JI7K 1XMQK 4JI2K 5BR8K 4LF7K 2VQEK 4GKJK 4JI6K 4JI8K 4LFCK 3T1HK 2UU9K 4JI1K 1FJGK 4GKKK 1N32K 5IWAK 4B3RK 4NXMK 1J5EK 5LMUK 4LF4K 4DV6K 2UUCK 4B3SK 4LF9K 4DV5K 4YHHK 1XMOK 2UXBK 2UXCK 4AQYK 1IBMK 1HNXK 4DR3K 4DR2K 1HR0K 1HNWK 3J7AP 4B3MK 2ZM6K 4DR4K 4JI3K 4OX9K 3J7YP 2E5LK 4LF5K 3JAMO 4X65K 1XNRK 4DR7K 4KHPK 5AJ3K 4JV5K 4JI4K 4JYAK 5LMNK 4DV4K 4X62K 4JI0K 4DV7K 4DUYK 4DR5K 4LF6K 4B3TK 1IBKK 2UUBK 2UXDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX O;  2UUA K;  4DV3 K;  3J80 O;  4X64 K;  1N34 K;  4LFA K;  1IBL K;  1N36 K;  2HHH K;  5IT9 O;  4DUZ K;  5LL6 Z;  4JI5 K;  4X66 K;  1HNZ K;  4LFB K;  4CW7 B;  3T1Y K;  4DV0 K;  1I94 K;  1XNQ K;  3OTO K;  4YY3 K;  4DR6 K;  1N33 K;  2F4V K;  4DR1 K;  3J81 O;  4NXN K;  4K0K K;  4CVN E;  4DV1 K;  5A2Q O;  4DV2 K;  4LF8 K;  2VQF K;  4V19 S;  4JI7 K;  1XMQ K;  4JI2 K;  5BR8 K;  4LF7 K;  2VQE K;  4GKJ K;  4JI6 K;  4JI8 K;  4LFC K;  3T1H K;  2UU9 K;  4JI1 K;  1FJG K;  4GKK K;  1N32 K;  5IWA K;  4B3R K;  4NXM K;  1J5E K;  5LMU K;  4LF4 K;  4DV6 K;  2UUC K;  4B3S K;  4LF9 K;  4DV5 K;  4YHH K;  1XMO K;  2UXB K;  2UXC K;  4AQY K;  1IBM K;  1HNX K;  4DR3 K;  4DR2 K;  1HR0 K;  1HNW K;  3J7A P;  4B3M K;  2ZM6 K;  4DR4 K;  4JI3 K;  4OX9 K;  3J7Y P;  2E5L K;  4LF5 K;  3JAM O;  4X65 K;  1XNR K;  4DR7 K;  4KHP K;  5AJ3 K;  4JV5 K;  4JI4 K;  4JYA K;  5LMN K;  4DV4 K;  4X62 K;  4JI0 K;  4DV7 K;  4DUY K;  4DR5 K;  4LF6 K;  4B3T K;  1IBK K;  2UUB K;  2UXD K; 
#chains in the Genus database with same CATH topology
 4L3Q A;  3CCS N;  3GL1 A;  3ID8 A;  3KK1 A;  1NK6 A;  3QIN A;  1VSD A;  5FLX O;  3V4I A;  5HRO A;  2P9P B;  2FLO A;  4BY9 C;  4YFU A;  1IBL K;  4DF4 A;  3G71 N;  4HUG A;  3OHR A;  3MX2 A;  5H1S Q;  1G99 A;  1XC3 A;  1U47 A;  4FPB A;  4CJ5 A;  1LAV A;  4B9L A;  4DR6 K;  4FLU A;  2HST A;  3HOS A;  4Z4E A;  2YNH A;  3P31 A;  3QNN A;  5FRO A;  2OPQ A;  1WAF A;  4DSL A;  4DV2 K;  3NF6 A;  4DQS A;  1RIL A;  2VQF K;  4YOX A;  4PL7 A;  3C6T A;  3SPY A;  2P9I B;  3AA2 A;  2OAN A;  2Q1N A;  4DWI A;  3OYI A;  3GG4 A;  4UQG A;  5DMR A;  4FK0 A;  3BUZ B;  4Z94 A;  3ZCM A;  3FLC O;  2VG5 A;  3VEY A;  2YHB A;  4B3R K;  3TAN A;  3VA3 A;  3U8X A;  2VWJ A;  2P9S A;  3R3L A;  3NE6 A;  2ASM A;  2V51 B;  4BC2 A;  4CZI A;  3PIO L;  4M42 A;  3CD6 N;  2X6N A;  3AGR A;  1VRT A;  3H6E A;  3DLG A;  1ASV A;  1XMO K;  2QWO A;  3IG1 A;  4B3O A;  2ZWH A;  4I2Q A;  1QTM A;  1A5W A;  1S1X A;  2IIR A;  3SLC A;  3T7Z A;  2RKI A;  5HRR A;  3AVF A;  4DR4 K;  3AVB A;  3FZF A;  5C42 A;  3VQC A;  2NRR A;  4A5B A;  4IZ9 A;  3JAM O;  3EYZ A;  1NWK A;  1YIJ N;  4U7B A;  2E6M A;  5KGW A;  5KI6 A;  4OPK A;  5I3U A;  3HPO A;  4IFY A;  1QZ5 A;  3HBT A;  2YHA A;  5LMN K;  3AA5 X;  1C0M A;  5FPM A;  3FZH A;  4DUY K;  5I42 A;  1NGB A;  1CXQ A;  3DM2 A;  2OA8 A;  4K25 A;  1EXQ A;  1ATR A;  5KPT A;  3CJ7 A;  4IO9 L;  5AQY A;  2YHW A;  1NJZ A;  2W42 A;  1QQC A;  1N34 K;  2E4L A;  2NRZ A;  4BDZ A;  3PV8 A;  1JCF A;  4ISE A;  1NGE A;  5IT9 O;  3V9S A;  4FO0 A;  3M8S A;  4JHD B;  3C7N B;  4OO1 J;  5GIO A;  3L2U A;  4MLH A;  3SMS A;  2YHX A;  4RW8 A;  3THW B;  4OPA A;  3T1Y K;  3A5O C;  1U2V A;  4CVN E;  2HNY A;  4FOI A;  2OTL N;  1JCG A;  4H0X B;  2QWP A;  4KBO A;  1DEJ A;  4JD2 B;  3VEV A;  1QSY A;  4B1X B;  1Q8I A;  3TSP A;  3U9D A;  4V19 S;  4O8U A;  4OKE A;  5TKW A;  4JS4 A;  3M8P A;  5BR8 K;  1YF5 L;  3MWT A;  3RMD A;  3AVA A;  3MXM A;  1YVU A;  3OS0 A;  2G8H A;  1T03 A;  3T1H K;  5LY3 A;  4BDY A;  2YKM A;  4I7F A;  1L5U A;  1FJG K;  4F2S A;  3NCI A;  3MN5 A;  1QQN A;  4E1J A;  4KO0 A;  1J5E K;  4LSN A;  1KFS A;  3RMB A;  1VAZ A;  2IVN A;  2QWL A;  1FKP A;  4IDK A;  3TAP A;  5AQK A;  1BOT O;  2P9S B;  2PFU A;  2F9T A;  4DSK A;  1DGK N;  4YHH K;  2AA4 A;  3B6P A;  4E7H A;  3SUN A;  3ALY A;  4B08 A;  4Q5V A;  1YHQ N;  4B8C A;  1LAW A;  3I8B A;  4CIG A;  3A2F A;  5HLF A;  4KHS A;  1BIZ A;  1VSF A;  4AF1 A;  3HJF A;  3BDP A;  3OYA A;  3EZW A;  1QVG M;  2Q36 A;  3VF4 A;  4FZX C;  4NYN A;  1L3U A;  4R79 A;  5K14 A;  1WB9 A;  1NM1 A;  2Z1J A;  3E9O A;  3SQ4 A;  2VCP A;  4BR7 A;  5TKY A;  4CK1 A;  1T8E A;  4DCH A;  1H1V A;  2JWL A;  5BN8 A;  3OBY A;  2P5O A;  4M3W A;  1L3T A;  4CZJ A;  3BZC A;  1FW6 A;  2PYJ A;  4KHW A;  4M41 A;  1VQO N;  2A5X A;  2D0A A;  4IJA A;  2UUA K;  1TV6 A;  4E3S A;  3P39 A;  4N47 A;  2W6L A;  4DB3 A;  1BWF O;  3CHW A;  4N76 A;  3E1Y A;  1KQS M;  1B9D A;  1CXU A;  3VOV A;  1VQL N;  5KPR A;  1EKE A;  2DFF A;  3HTV A;  3OYD A;  1IKY A;  2QXF A;  3QFU A;  3LL3 A;  3OTO K;  4DV0 K;  1BG3 A;  1NK4 A;  3VQ7 A;  3K2P A;  3P83 D;  4KB1 A;  3H3N O;  3MEG A;  2X74 A;  3CIP A;  4CD3 A;  3CQ8 A;  1U2V B;  3FZK A;  3HM9 A;  3DXK A;  4CHN A;  4E7L A;  4BG8 A;  5AQN A;  3BEX A;  4KH4 A;  1HKB A;  4B1Y B;  4DU3 A;  2X78 A;  3CG7 A;  1UAX A;  3AVJ A;  1VQ6 N;  1ESV A;  5LJW A;  4CJV A;  2GUI A;  3LP0 A;  4EIA A;  1U6Z A;  2QA4 N;  1WSH A;  2CGJ A;  1N32 K;  2KW4 A;  1DTT A;  5M1F A;  3SUQ A;  2A3Z A;  3EY1 A;  4N41 A;  4BRF A;  4YOT A;  4IFV A;  4EFH A;  5JMV A;  5GAH P;  3DOL A;  1VQ5 N;  1EWQ A;  4O4G A;  3JS6 A;  3LM2 A;  1RBT A;  2HF3 A;  5FDL A;  1MWK A;  2HF4 A;  4PA1 A;  3NAE A;  3SBG A;  2G8U A;  1TUY A;  1EQY A;  1RDD A;  1IKV A;  3VEZ A;  4OPJ A;  2IVO A;  4JKG A;  3KWI A;  4QS9 A;  3U4L A;  2BTF A;  3DLE A;  3B6O A;  5B8H A;  2XO7 A;  4B8A B;  4XH5 A;  4ELT A;  4OJR A;  4BAC A;  4I6M A;  5JVG L;  2UUB K;  3LP2 A;  3H45 C;  3M6G A;  4JKC A;  3V9X A;  1E4G T;  3BF3 A;  3D2E A;  3ENO A;  5C2D A;  3OYJ A;  1XC9 A;  2DPN A;  1P90 A;  3TR8 A;  4DLG A;  4H5R A;  2QWM A;  3JYT A;  3F9M A;  3SV3 A;  3KKS A;  5JS2 A;  2XRI A;  3TAB A;  3LAN A;  4FWR A;  2O8D A;  4CGH A;  4DFK A;  4JI5 K;  3A8Y A;  3O9S A;  4AHS A;  1TYQ A;  4WFB L;  4B1U B;  3SPZ A;  2HMP A;  4YY3 K;  1VQ9 N;  4CEC A;  1J9A A;  1NLV A;  4FJ9 A;  4M7X A;  2R7Y A;  3J7Z O;  3D45 A;  3BP8 A;  5HL7 L;  5CY4 A;  4CIE A;  4O0J A;  3R6M A;  1SKW A;  5C25 A;  2YCH A;  3SK3 A;  4AHU A;  1N5Y A;  4CGJ A;  3DXK B;  3OYG A;  3EKU A;  4PKG A;  4CF2 A;  2Q97 A;  4DHY A;  1KVB A;  3HK2 A;  4AM7 A;  4YDU C;  1SKR A;  4FM2 A;  1HUX A;  3OVN A;  1TK8 A;  2HHX A;  1XUP O;  3O4N A;  4IOA L;  1NOZ A;  4FWK A;  3UB5 A;  4LF9 K;  3MCA B;  4CJE A;  1GLC G;  2OTJ N;  4JKH A;  4FVU A;  2OPR A;  4DR2 K;  1GLJ O;  4CJT A;  4KHQ A;  1GOC A;  3CXC M;  4F4K A;  2GX9 A;  4IFE A;  2ZM6 K;  2D0C A;  3QIO A;  5I9E B;  5C12 A;  3NH2 A;  4LF5 K;  1S72 N;  2Z1H A;  1B92 A;  4PHT X;  1ZBL A;  4OLB A;  3V1Q A;  2P9N B;  5M1P A;  1X9M A;  3CJ1 A;  4JKG B;  3QNO A;  1KXP A;  3PX0 A;  1QS4 A;  4LF6 K;  3DOK A;  2D0B A;  3AVG A;  3CJ9 A;  4M3X A;  3I56 N;  3I0R A;  4I6M B;  2I7P A;  3C6A A;  3ZEU A;  3TTC A;  3ZSQ A;  4MO4 A;  3HT3 A;  4WQ4 C;  1D8Y A;  3CCV N;  3D2E B;  2FSN A;  3A5L C;  1IH7 A;  3LM9 A;  3ITH A;  1HKC A;  3L2R A;  2G8K A;  4DQI A;  2IOC A;  1T6D A;  2H3G X;  1XNQ K;  2O8D B;  1HMV A;  3A5N C;  4BRA A;  4RW7 A;  1TYQ B;  4DLE A;  3GDQ A;  4GVM A;  4BC3 A;  4FK2 A;  1MWM A;  4ZHR A;  1NJX A;  4KTW A;  3U3G A;  4ILJ A;  4W5O A;  4RG8 A;  3K5L A;  4CZH A;  1HNV A;  4C8M A;  4FZY A;  2Q31 A;  4Z4I A;  3CFR A;  1WOQ A;  3AAP A;  4DTP A;  4JI8 K;  5BRH A;  4A62 A;  4YOV A;  3M8R A;  5LJV A;  5CZ1 A;  1NJW A;  1J54 A;  3LDN A;  4YNQ A;  4EZ9 A;  4HTL A;  4BRQ A;  1T3V A;  4XEI A;  5HRN A;  1S9G A;  3LDL A;  4PKI A;  1EP4 A;  3O08 A;  5LMU K;  3EZ5 A;  4LF4 K;  3TTD A;  2VGM A;  1NMN A;  1YAG A;  4BE2 A;  5HP1 A;  4YDU A;  5BRE A;  1X3N A;  3UIQ A;  5AQF A;  4BR0 A;  2UXC K;  4FJ5 A;  1TAQ A;  3ZSV A;  3KLG A;  1DKG D;  3IDH A;  4HWI A;  1CZ9 A;  1RT1 A;  3J7Y P;  2E5L K;  3QLH A;  1T7P A;  3RRG A;  3G25 A;  5AR0 A;  1UWB A;  1VRU A;  3AVH A;  2EHG A;  3THX A;  3Q7B A;  1VQP N;  1WSG A;  1ZBF A;  1RNH A;  4FWO A;  3ZX2 A;  3KLF A;  3VEO A;  3QEX A;  1YXQ A;  4FLZ A;  2HHT A;  2VYP A;  1M1K O;  1TKT A;  4CGF A;  3ZT2 A;  3NMU A;  2WOM A;  3HL8 A;  2NRV A;  4NLC A;  3MXI A;  3CET A;  4CFB A;  2E88 A;  5F0X A;  2JLE A;  3TSU A;  4DKW A;  2YI1 A;  2CGK A;  3L6Q A;  2FBX A;  3VPZ A;  3ZSY A;  3L8B A;  4DTJ A;  3DXM A;  3FFI A;  3VES A;  4DSJ A;  3ZEU B;  2V7Y A;  5J2M A;  3I55 N;  3MEC A;  4FJJ A;  4I9L A;  4LY7 A;  1EO1 A;  3RR7 A;  3WUH A;  5GAE P;  4MO5 A;  4KI4 A;  4JK7 A;  5BPL A;  2G8W A;  3ZET A;  1KRP A;  4FWS A;  5AQV A;  4Z4F A;  3SQ1 A;  5AZJ A;  2Z1G A;  3NH0 A;  3V9W A;  3V9U A;  1C6V A;  2I7N A;  1K8K A;  3V81 A;  4CFA A;  2IGI A;  1C0G A;  3VA0 A;  4Y0W A;  1TAU A;  4C23 A;  3MN7 A;  4O5B A;  1JLA A;  3K57 A;  3VTI A;  1S3X A;  4ZTF A;  4IDH A;  3DWL A;  4NXM K;  3KD1 E;  4KTQ A;  2W41 A;  4OVL A;  4E0D A;  1XWL A;  2YNG A;  2DFE A;  3PUF A;  5KQD A;  4AIL C;  1EWR A;  3PX4 A;  1VSH A;  4DU4 A;  3S41 A;  1HQU A;  1RTI A;  3CMA N;  1YT3 A;  3DLH A;  3QFP A;  4CBU A;  1BU6 O;  3PIP L;  1HR0 K;  3E01 A;  1WBB A;  3R9P A;  1C0T A;  4XH1 A;  2ETJ A;  4BRO A;  2HHU A;  1ZBS A;  4RCH A;  3P38 A;  3QBW A;  3AVM A;  3O80 A;  3SV4 A;  2X6S A;  4XH4 A;  1LCU A;  3HYF A;  1RDW X;  2XY6 A;  1SKS A;  5C2F A;  3VQA A;  4CEQ A;  5ADX A;  1Z05 A;  4WFN L;  2DTU A;  3LP3 A;  3VQE A;  3PSI A;  5F1X A;  1SQK A;  3THX B;  4PL8 A;  1EX4 A;  3SJJ A;  1R0A A;  3A5M C;  1BA1 A;  2FBY A;  4Z4H A;  3W0L A;  1RBV A;  3QDK A;  3IAY A;  4BRE A;  2UXD K;  1U49 A;  4W5Q A;  4C1N I;  1RTD A;  1ASU A;  1VSM A;  4DF8 A;  5FPN A;  5EY4 A;  1EET A;  4FWP A;  4X64 K;  3DLK A;  4LH4 A;  3I8D A;  4E1N A;  3O9Q A;  4CF0 A;  4M3Y A;  3O1W A;  5AQT A;  4B9M A;  4FLV A;  4AHV A;  3DXM B;  3SMP A;  3GOI A;  5KTQ A;  1NGD A;  3EO3 A;  4EZ6 A;  1F21 A;  1OVY A;  1HNI A;  1S1W A;  2BE2 A;  4FL9 A;  3J81 O;  4F9O A;  4W5N A;  3KLE A;  3O4W A;  4F3O A;  3TU5 A;  4LF8 K;  3AGK A;  1U4B A;  4JAX A;  3ZET B;  1NGH A;  3F2K A;  5J2P A;  2KHO A;  1ZC6 A;  5AZJ B;  3CCM N;  4BRI A;  1WLJ A;  2NRT A;  4DQ8 A;  4JI1 K;  4O8K A;  4IOC L;  5GAD P;  4LD0 A;  3VEW A;  1K8K B;  4B1Z A;  4JNE A;  5AQS A;  3T1A A;  3I0S A;  4BR5 A;  3NF8 A;  4AM6 A;  5BRD A;  1JLQ A;  3TWH A;  2HHQ A;  1LW0 A;  1GLD G;  3FE1 A;  2QXL A;  4FW2 A;  2UUC K;  5AFU A;  1NK5 A;  5JIC A;  4KH5 A;  4HCC A;  4FJG A;  4KI6 A;  4KTZ A;  2Q0R A;  4JN4 A;  4CK3 A;  3RSE A;  1S22 A;  3KK2 A;  1YJ9 N;  4FJ8 A;  3MDQ A;  3V1O A;  1HJO A;  3VGK A;  3BF1 A;  4B3M K;  3VEX A;  1GLL O;  3CCQ N;  4MDA A;  4KFB A;  4BRN A;  1NJY A;  4BRD A;  4LH5 A;  4CFC A;  1LWE A;  1N6Q A;  4FM1 A;  1NNE A;  2QI2 A;  1IKW A;  2QKK A;  2O8C A;  3O1B A;  1QQM A;  2XHB A;  3ATU A;  4M3Z A;  3OYH A;  4E7I A;  3K58 A;  1VQ4 N;  1TL3 A;  4IEI A;  2RE2 A;  1QSL A;  4CEZ A;  1ILY A;  3F73 A;  4GV3 A;  4CED A;  2FXU A;  3O3G A;  3D7E O;  1KFD A;  4BRG A;  3IMX A;  5AQR A;  4FOE A;  1LV5 A;  1WUA A;  4IG3 A;  1X3M A;  1OH6 A;  5JLF A;  4BGA A;  4NCG A;  2BDP A;  1Q81 O;  4DTN A;  2KFN A;  3V1R A;  3E9P A;  1LW2 A;  1N36 K;  1WAJ A;  3QB0 A;  1K6Y A;  1HYZ A;  5CR4 A;  3A0I X;  3C6H A;  3O9R A;  4PQU A;  4RW6 A;  3LDQ A;  5EX5 A;  4CGD A;  4NO7 A;  2PZS A;  4AHC A;  1W9H A;  1DT9 A;  3OJU A;  1HQE A;  4N56 A;  3LP1 A;  3LDS A;  2P9L A;  4E7J A;  1TUU A;  1GLF O;  3KTQ A;  3HP9 A;  1N33 K;  3SZ2 A;  1S5J A;  2E2O A;  1G15 A;  4AHR A;  5A2Q O;  1K73 O;  1XQS C;  3K5M A;  2FC0 A;  2NNW A;  3DI6 A;  1XMQ K;  1GLB G;  2GV9 A;  4KRE A;  3DLL L;  1KVC A;  2E8A A;  1KLN A;  4MLE A;  4BRP A;  2AP1 A;  4CER A;  4IWV A;  2UU9 K;  1NMD A;  1KAZ A;  4FCY A;  3GE1 A;  4BRM A;  3CC2 N;  3PO5 A;  1WSE A;  4AHT A;  1YIT N;  3CM5 A;  4CJQ A;  1IV0 A;  3AA4 A;  3VQ4 A;  4R5P A;  3EE9 A;  4B9V A;  2HBJ A;  3CI5 A;  1T44 A;  2P9K A;  3H08 A;  2HMI A;  3IRX A;  2WC9 A;  4H0P A;  2UXB K;  1W7A A;  1HNX K;  3K9K A;  4KHY A;  2NRX A;  3O9U A;  4GY2 B;  4CZF A;  4FLW A;  4OX9 K;  3RSE B;  2ZQB A;  1OH5 A;  1SS6 A;  1BDG A;  1VSK A;  3S3O A;  1S1U A;  1X9W A;  3HI0 A;  1T05 A;  3VN5 A;  4ZTJ A;  3CER A;  4I9Q A;  4KB0 A;  3SUP A;  3HRG A;  2O8C B;  4RW9 A;  4FJN A;  3ENB A;  4FWL A;  4H0Y B;  2Z1I A;  1GOB A;  3BZK A;  3F9K A;  3NGZ A;  5M1K A;  1JL2 A;  3L2V A;  4IJN A;  3QER A;  3AVN A;  1BCO A;  3AV9 A;  3WNG A;  5FPE A;  3KD5 E;  3NDK A;  3CCR N;  3SAG A;  4CEE A;  1TK5 A;  1ITG A;  4JKF A;  1W2B M;  2BAN A;  3FGU A;  3OYM A;  1Y97 A;  3KJV A;  5AQW A;  1J6Z A;  4E1M A;  3D6R A;  3ZT0 A;  3DJC A;  2A1R A;  1TKZ A;  1S1T A;  4YOR A;  1J5O A;  2OCE A;  2HBM A;  3NFA A;  2O4G A;  2HVH A;  3WXK A;  1GOA A;  2RN2 A;  2NRW A;  4M3T A;  2P9L B;  4M3R A;  4GVE A;  3VGL A;  1KAX A;  1JLG A;  3CM6 A;  1S6Q A;  3CCE N;  4C8K A;  4KHN A;  1C0F A;  5CZ2 A;  2ZD1 A;  1YJW N;  4CZL A;  3U3Y A;  1ASW A;  2EX3 A;  4BE0 A;  4GKJ K;  4RTF D;  2NZT A;  4J2B A;  2D0O A;  3G6E N;  4JRQ A;  4IXC A;  4Z4G A;  1RDB A;  2D4W A;  1L3S A;  1HRH A;  4CZK A;  1VSE A;  4FJK A;  3TAF A;  4K8X A;  5J2Q A;  1NU0 A;  2W6K A;  2VG6 A;  4JKB A;  4CJK A;  2OYQ A;  1RBU A;  1SV5 A;  4EP4 A;  3D2F A;  4CF1 A;  2CH5 A;  4BQZ A;  1IBM K;  2IS3 A;  3VQP A;  5EVZ A;  3CJB A;  3M8Q A;  3HPH A;  2KFZ A;  2FF6 A;  2P9K B;  4CZM A;  3EKS A;  1TKX A;  4CJ3 A;  2JWK A;  4CJW A;  4B9N A;  4BWJ A;  2D5R A;  2D0P A;  3SQ0 A;  4FJM A;  3KLI A;  1QE1 A;  3CJC A;  1T6C A;  4ID5 A;  5CHI A;  1B9F A;  4W5R A;  3C0B A;  4FJ7 A;  1NG9 A;  3HXM A;  5GAG P;  1IJJ A;  3OYE A;  2YX6 A;  3F5T A;  2HHV A;  3ID6 A;  3RTV A;  3IFR A;  3ZT3 A;  4KKO A;  4B1V A;  3DLB A;  4YOY A;  3U9Z A;  1XHZ A;  3ZT4 A;  4QAG A;  1RBS A;  3J80 O;  5KRS A;  3DMJ A;  3KK3 A;  1A5V A;  1Y64 A;  1IG9 A;  1JCE A;  3ZT1 A;  4K43 A;  1WN7 A;  2G8I A;  3AO5 A;  4BRC A;  3K0S A;  3PX6 A;  4JS5 A;  3THY A;  1BUP A;  4CHO A;  4CIF A;  4HHT A;  2WBN A;  4EHT A;  1RFQ A;  4OKJ A;  3LAK A;  3CCU N;  1TGO A;  3RRH A;  2KZZ A;  4QS7 A;  1S6P A;  4FW1 A;  4CJF A;  4CGG A;  3DRP A;  3CQY A;  1RT3 A;  3OYB A;  3RWU A;  3AAQ A;  3AO3 A;  4JEP A;  2RPI A;  2VGN A;  1R59 O;  1K8A O;  2Q3S A;  5GIN A;  4DSE A;  3MN6 A;  5CE3 A;  1V4S A;  1WSI A;  3OYN A;  3LDO A;  3WXI A;  1IG8 A;  4FYD A;  3QET A;  4DV5 K;  4CF8 A;  1E3M A;  3DRS A;  2W40 A;  1K9M O;  1WBD A;  3K9J A;  2FF3 B;  1JJ2 M;  4DMN A;  3MED A;  2F7T A;  3E9L A;  2IVP A;  3TAM A;  4DTS A;  3CF5 L;  3D2F B;  2PYL A;  2OPP A;  5CYM A;  4FPA A;  2B5J A;  3D0P A;  1IKX A;  2G8F A;  4G9Z A;  3J8A A;  1RDU A;  4OLA A;  1QHT A;  3SI6 A;  1FXX A;  4MQ3 A;  4NYF A;  4UY8 O;  4KH6 A;  1UOC A;  2GWJ A;  1Q9Y A;  2Q0U A;  2P1J A;  2KKZ A;  2FBT A;  4BRK A;  1OH8 A;  3HZ6 A;  4YOU A;  2OPS A;  3L3U A;  3QBX A;  4J2D A;  3HO1 A;  1BGX T;  2FSK A;  1NGC A;  1NOY A;  1SL2 A;  4GV6 A;  3RMA A;  2Y1I A;  4A59 A;  1OH7 A;  3LPU A;  3WXM B;  3WQT A;  3CCL N;  1VQK N;  2HHS A;  3KIO A;  4BVP A;  4HVJ A;  4FK4 A;  3AO1 A;  3TAE A;  1A5X A;  1NK7 A;  3B8A X;  1W0H A;  1DLO A;  2Q2R A;  1WSJ A;  3BY5 A;  2GEL A;  4WYB A;  2YJE A;  3ZX0 A;  4CEO A;  4BR2 A;  5AQH A;  4DR1 K;  3ZLJ A;  4NXN K;  4K0K K;  3LDP A;  4DV1 K;  4PWD A;  4WQ5 A;  2CGL A;  2WUS A;  3UKR A;  4FJL A;  1ZBU A;  3THY B;  4FVM A;  5BPN A;  2O8E A;  4Y1D A;  4FJH A;  5AQI A;  3CME N;  2WFB A;  2HBK A;  2BUP A;  4Y1C A;  4LF7 K;  3AVC A;  2IC3 A;  1X9S A;  1NGA A;  5C24 A;  4CK2 A;  1SL0 A;  3WQU A;  2GBZ A;  2QK9 A;  1Q9X A;  5HRS A;  1QVF M;  3LAL A;  3QEP A;  3MN9 A;  3O9T A;  3FZL A;  3KZB A;  4JKD A;  3VQ5 A;  2P5G A;  4C8N A;  4CJP A;  5AQP A;  4NCA A;  1BHL A;  4ISF A;  2QKB A;  4Z0U A;  4YOW A;  4BDP A;  3K59 A;  4CJR A;  4F2R A;  3EL2 A;  4TSX A;  1D9F A;  5HOO A;  3J7A P;  3KKR A;  3OW2 M;  1S1V A;  4A57 A;  2B6A A;  2D1K A;  3MWP A;  5AZI A;  2A6A A;  3CC7 N;  5F2R A;  4JHD A;  2ZGY A;  2ZE2 A;  3C7N A;  3OYK A;  1HKG A;  4M3U A;  3WNE A;  3CJA A;  4WF9 L;  2WON A;  1KSP A;  2OZS A;  4H0O A;  1MA9 B;  3THW A;  5AJ3 K;  4JK8 A;  3VF2 A;  3VQB A;  3RR8 A;  1KTQ A;  4JYA K;  2GUP A;  5EU7 A;  4DV4 K;  1VQ8 N;  2YHY A;  1CZB A;  3FFK B;  1GLE G;  4CGI A;  4CHP A;  4JD2 A;  4RW4 A;  3HM8 A;  5GIP A;  3CFP A;  3QEW A;  3THV A;  2QEX N;  1JXE A;  1Z6R A;  1SZ2 A;  4FM0 A;  1JKH A;  4LFA K;  4NB4 A;  3TPQ A;  2NRH A;  4FSV A;  1ATS A;  5DM6 L;  4H0V B;  5FPD A;  1O13 A;  3WT0 A;  3QML A;  1XHX A;  4C8L A;  3KWG A;  5C10 A;  4JLH A;  2OZM A;  4GNI A;  1RT5 A;  4DU1 A;  1BIS A;  1RT6 A;  2F8T A;  1Z26 A;  2F4V K;  2HNZ A;  3O3H A;  3OBW A;  1RTJ A;  3G4S N;  4FWM A;  3UKU A;  4BRL A;  3TAR A;  4QS8 A;  1KD1 O;  2DFH A;  3ZYY X;  2PY5 A;  1NGI A;  3I33 A;  1ZYQ A;  2IAJ A;  3MX5 A;  2IDO A;  2ATQ A;  2F8S A;  3AVL A;  3AVK A;  2YKN A;  3WXJ A;  4O0I A;  4DQR A;  3UKR B;  4E89 A;  5BR9 A;  5AQZ A;  4DTO A;  2HB5 A;  5BRF A;  2O8E B;  5JLH A;  4KHU A;  4JRP A;  3HVR A;  1BQM A;  3G10 A;  3HOT A;  2BGG A;  1VSL A;  1NKC A;  4BC5 A;  3VET A;  1LWF A;  1TVR A;  1JLC A;  3N4Q A;  3ATV A;  4BQL A;  4B9U A;  3QEV A;  5HBM A;  3GBT A;  1D4X A;  4N5S A;  4A61 A;  1WNS A;  2QWQ A;  4FLT A;  4FXD A;  4FJX A;  1I39 A;  4KRF A;  2E1Z A;  3MK6 A;  4AQY K;  3HSC A;  3DLR A;  1V4T A;  1RDC A;  2O8F A;  1C1A A;  1ZXO A;  4K8Z A;  2XY8 A;  3HST B;  4DTM A;  4X65 K;  5KRT A;  4HUE A;  2HW3 A;  3R8E A;  5AZI B;  5AQU A;  3SYZ A;  5AQX A;  3H1V X;  4DTU A;  1OKJ A;  3ZSO A;  2ZJQ L;  1JXB A;  3SAH A;  4B3T K;  2ASP A;  3IKM A;  1FK9 A;  3KK7 A;  3VQD A;  2VWB A;  4CJL A;  4DTX A;  3LZJ A;  3S3M A;  1KC8 O;  1VSJ A;  4H4O A;  3AAR A;  1C1B A;  3NVK A;  1Q86 O;  4X66 K;  1BQN A;  4CW7 B;  3KVG A;  3SAF A;  1I94 K;  2ZJP L;  3NVM A;  5AQG A;  2WTU A;  5SZT A;  3NH1 A;  2J4R A;  1M90 O;  1LOT B;  4M63 C;  4CES A;  2E20 A;  3TTF A;  1VQN N;  1VK0 A;  4DS4 A;  3AA3 A;  3UKU B;  2YNF A;  4JI7 K;  4DQP A;  1VSI A;  4I2P A;  3C6U A;  1SUQ A;  4JI2 K;  1W97 L;  4K42 A;  4OKK A;  5AQJ A;  3EN9 A;  4LFC K;  5FRM A;  1XI1 A;  4DS5 A;  4H8K A;  4Z4C A;  4DQQ A;  1ZBH A;  4GKK K;  1NBW A;  3M3Z A;  5IWA K;  4DSF A;  4Q0B A;  1J53 A;  3JXU A;  3SBT A;  4BG9 A;  4F3T A;  3ZX3 A;  3E66 A;  1TL1 A;  3V6D A;  4DFM A;  4ILH A;  1VQM N;  3ZSZ A;  3OYC A;  4NCB A;  3M1F A;  4NLB A;  2VG7 A;  2XY7 A;  4DR3 K;  4DTR A;  1JLF A;  3ULD A;  2B4J A;  3QIP A;  2DY4 A;  1C1C A;  3WNF A;  4H5W A;  4RWT A;  4QOZ B;  1N8R O;  4FZZ A;  1HX1 A;  4CJ7 A;  3RMC A;  2HND A;  4CE9 A;  2O8F B;  3QES A;  4A2B A;  4JKA A;  1JL1 A;  1XNR K;  3C95 A;  1RTH A;  3O4Q A;  2O8B A;  3RVC A;  5J2N A;  1CZA N;  2P9U A;  3C65 A;  2GTD A;  3CC4 N;  3SUO A;  4J2E A;  4BGB A;  3K5O A;  1X9J A;  3UE5 A;  1MU2 A;  1NK0 A;  5JVH L;  4AH9 A;  2E2Q A;  2A40 A;  3AVI A;  4BC4 A;  3U6F A;  4GW6 A;  4DV3 K;  4IG0 A;  4B9T A;  1P8Z A;  2HHH K;  4H4M A;  1QHA A;  2UYT A;  5CYQ A;  3CQX A;  4WCE L;  5SWM A;  1BI4 A;  3OS2 A;  2YJF A;  4LFB K;  2I5J A;  5AQO A;  1BA0 A;  3VQ6 A;  2E2N A;  4CJS A;  2KQ2 A;  1NKE A;  1TKD A;  1E4F T;  4ICL A;  4CJ4 A;  1DTQ A;  1U04 A;  4EP5 A;  3V9Z A;  2PBD A;  4J8F A;  3DAW A;  4CHQ A;  3ULE A;  3L4I A;  3O5B A;  2QW9 A;  4IOX A;  2ZF5 O;  4PUO A;  4FWN A;  1Q7Y O;  2FSJ A;  3PY8 A;  1U48 A;  1NK9 A;  1KLM A;  3NGY A;  3K5N A;  3SCX A;  3O3F A;  4E7K A;  2P9N A;  3LZI A;  3EEQ A;  5AQQ A;  3CCJ N;  2KTQ A;  3SQ2 A;  4KV8 A;  1YUW A;  2Y1J A;  5HRP A;  3VEN A;  5M1N A;  5E84 A;  4B3S K;  5ADX H;  1RCH A;  3OA9 A;  1NKB A;  1HLU A;  2JGU A;  1RBR A;  3IUC A;  4HCB A;  3OYL A;  3MXJ A;  3SNN A;  1HNW K;  2HHW A;  1X1P A;  1SAZ A;  1UA0 A;  4OGE A;  2FBV A;  5E41 A;  1YTU A;  4W5T A;  3G0Z A;  4WFA L;  3OJS A;  4PKH A;  1IO2 A;  4DR7 K;  4KHP K;  3FR0 A;  4CBW A;  2ITM A;  4U67 L;  2HBL A;  3QO9 A;  4CCH A;  4X62 K;  4CEA A;  2E6L A;  4BWM A;  4BRH A;  1MDU B;  2A42 A;  4CFD A;  3ENH A;  3TSQ A;  1IBK K;  2A1S A;  4DFJ A;  3MMV A;  2O8B B;  5EXW A;  2V52 B;  3PSF A;  4CEF A;  2P9U B;  1QSS A;  1KCF A;  4M45 A;  1NGJ A;  4J2A A;  3H46 O;  5KGX A;  1HJR A;  2XY5 A;  2RHK A;  2E1Y A;  1OVQ A;  1UA1 A;  5M1Q A;  4DUZ K;  3HPG A;  3TAQ A;  4PY5 A;  3NF9 A;  1JLB A;  2GWK A;  3VF6 A;  4ELU A;  1BCM A;  5T7B A;  2HOE A;  5BN9 A;  5LL6 Z;  1NGG A;  1BL3 A;  1RT7 A;  3VTH A;  1HNZ K;  1GLA G;  4CZG A;  1HYS A;  1NK8 A;  3T69 A;  3WEE A;  1BI4 B;  3O6W A;  3P1G A;  3H3O B;  4ID1 A;  3VQ8 A;  3HP6 A;  3QEI A;  1TK0 A;  2RF2 A;  3ZSX A;  4O44 A;  3VQQ A;  2KZM A;  3SJH A;  3CYM A;  3L3V A;  4MDB A;  4FLY A;  1YJN N;  5AFU H;  1Q18 A;  3ULE B;  4O5F A;  2A41 A;  3VGM A;  1JLE A;  4CHY A;  3AY9 A;  4H0T B;  4KAZ A;  3Q7C A;  4M7Y A;  4WQ5 C;  1YI2 N;  4CD1 A;  2EWS A;  4B9Q A;  4E19 A;  1YVN A;  4LC9 B;  2ZGZ A;  3LAM A;  4DV6 K;  3ZSR A;  4FLX A;  4HUF A;  3ISN C;  1ATN A;  2QTD A;  1RT2 A;  2ITG A;  4CBX A;  3OYF A;  1NJI O;  2AJQ A;  4WE1 A;  4CZE A;  3T19 A;  4BR4 A;  4A5A A;  2CH6 A;  1VQ7 N;  2ZJR L;  5ELZ A;  4A2A A;  3AO4 A;  1KVA A;  1O1W A;  2ASO A;  1KAY A;  1ZBI A;  4BE1 A;  4BR9 A;  3AO2 A;  4CEB A;  4CJU A;  1BO5 O;  3NHG A;  4ISG A;  3MCP A;  4B1W B;  4G1Q A;  1QZ6 A;  4JI4 K;  3HVT A;  3C94 A;  4JI0 K;  1Z25 A;  4DR5 K;  4EAH D;  2KLA A;  4LSL A;  3BGR A;  3LWM A;  5AQM A;  3PO4 A;  2P9P A;  3CPW M;  2G8V A;  5C0Y A;  4C1N K;  4K41 A;  4H5N A;  3FZM A;  3NF7 A;  2V7Z A;  2LSN A;  1WSF A;  5C15 A;  2YV0 X;  3VMF B;  1REV A;  3L2W A;  2QWN A;  4H03 B;  3NGI A;  4DSI A;  1LWC A;  1D9D A;  3ZSW A;  5JS1 A;  4IKF A;  4OPH A;  3DYA A;  5J1E A;  2QWR A;  3P5J A;  3OY9 A;  3WXL A;  3ASM A;  5M1O A;  3S9H A;  4H5T A;  5DK5 A;  1HPZ A;  4DFP A;  3O8M A;  3KLH A;  4KPY A;  3W3D A;  5KPZ A;  4JK9 A;  3T3F A;  4CF9 A;  2NUB A;  4GMJ B;  3TAG A;  1RGI A;  4IO8 A;  3WEE B;  1YTA A;  4CHZ A;  3P4I A;  1RT4 A;  2NLX A;  2P9I A;  4DG1 A;  5AQL A;  2P51 A;  1RDA A;  4OGC A;  1U45 A;  2F96 A;  3QIC A;  4O55 A;  3MEE A;  4QCL A;  4XIU A;  4IEE A;  2F9W A;  4BVO A;  3H1Q A;  2VQE K;  4JI6 K;  4EHU A;  3NBP A;  4FWQ A;  3DRR A;  3L4Q A;  1C0U A;  1I3A A;  5BPM A;  3M5R A;  2BH1 A;  2PAV A;  2O4I A;  4GV9 A;  1L3V A;  4C8O A;  5KQ8 A;  4HTU A;  5E26 A;  4IBN A;  1NGF A;  4B9S A;  2GEM A;  3VER A;  3EE8 A;  5DM7 L;  1BIU A;  4MFB A;  5EOY A;  3TI0 A;  3CPE A;  3OS1 A;  3L0Q A;  1VHX A;  5FRN A;  3KHY A;  4ILG B;  4ELV A;  1QQO A;  3N4P A;  2VWK A;  1HPM A;  4JI3 K;  4F8R A;  5MLC Q;  4JKE A;  3PLA A;  3CFO A;  3JSM A;  2HVI A;  3LWL A;  2QM1 A;  3IS9 A;  1Q82 O;  1SL1 A;  4JV5 K;  4FJI A;  3S3N A;  4H5V A;  1FKO A;  1CLQ A;  3L2Q A;  4DV7 K;  1HYV A;  4L8R B;  3VQ9 A;  3R1X A;  4WQ4 A;  4CI6 A;  5D3G A;  3WNH A;  1S9E A;  3LPT A;  1D5A A;  3MAQ A;  2YNI A;  2E2P A; 
#chains in the Genus database with same CATH homology
 5FLX O;  2UUA K;  4DV3 K;  3J80 O;  4X64 K;  1N34 K;  4LFA K;  1IBL K;  1N36 K;  2HHH K;  5IT9 O;  4DUZ K;  5LL6 Z;  4JI5 K;  4X66 K;  1HNZ K;  4LFB K;  4CW7 B;  3T1Y K;  4DV0 K;  1I94 K;  1XNQ K;  3OTO K;  4YY3 K;  4DR6 K;  1N33 K;  2F4V K;  4DR1 K;  3J81 O;  4NXN K;  4K0K K;  4CVN E;  4DV1 K;  5A2Q O;  4DV2 K;  4LF8 K;  2VQF K;  4V19 S;  4JI7 K;  1XMQ K;  4JI2 K;  5BR8 K;  4LF7 K;  2VQE K;  4GKJ K;  4JI6 K;  4JI8 K;  4LFC K;  3T1H K;  2UU9 K;  4JI1 K;  1FJG K;  4GKK K;  1N32 K;  5IWA K;  4B3R K;  4NXM K;  1J5E K;  5LMU K;  4LF4 K;  4DV6 K;  2UUC K;  4B3S K;  4LF9 K;  4DV5 K;  4YHH K;  1XMO K;  2UXB K;  2UXC K;  4AQY K;  1IBM K;  1HNX K;  4DR3 K;  4DR2 K;  1HR0 K;  1HNW K;  3J7A P;  4B3M K;  2ZM6 K;  4DR4 K;  4JI3 K;  4OX9 K;  3J7Y P;  2E5L K;  4LF5 K;  3JAM O;  4X65 K;  1XNR K;  4DR7 K;  4KHP K;  5AJ3 K;  4JV5 K;  4JI4 K;  4JYA K;  5LMN K;  4DV4 K;  4X62 K;  4JI0 K;  4DV7 K;  4DUY K;  4DR5 K;  4LF6 K;  4B3T K;  1IBK K;  2UUB K;  2UXD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...