2UXDL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxdL00
4KHZA 1N36Q 1CSQA 5IWAL 1OTCA 1WJJA 3K0XA 5M5WH 1WFQA 1Q8KA 3WWVA 1VQKA 2PQAA 3PUYA 2R93G 5J3BA 4DAYB 3G48A 2Q2IA 4JC0A 5H1SE 4QQBX 2PNHA 3GTMH 2QA4A 4RMFA 3CXCA 5JEAG 4A3EH 1Z47A 2K14A 4POFA 2VUMG 4A3DH 2MFIA 4A3IH 1VQBA 3D0FA 4JI8Q 1NMGA 1HZ9A 1PH6A 1CKNA 4TVAB 3E9HA 1IBKL 3HOWH 3F1ZA 1VCIA 3I7FA 4HIKA 4BBSH 2IX1A 3S17H 4BY7H 2D0OA 3KJOA 4L5QA 2AHOB 5FJ8G 4L5SA 3CMEA 1W3SA 1D8LA 4KHPL 2VQEQ 2JQOA 1FJGQ 3KFUA 1PVOA 1YJNA 1HNZQ 3GTGH 1JJGA 2AWOA 1EFWA 4IPHA 5C0XJ 1H95A 1IBML 4X6AH 2N78A 1SR3A 5LMNL 3CC7A 1ASZA 1WI5A 3NELA 2KHJA 2MNAA 3CMAA 2RHSB 3PF5A 2A19A 5IYBG 3CCUA 5IWAQ 2E2JH 4RG1A 3OW2A 1Y1VG 1PH7A 2L15A 3HKSA 1U0LA 5LMNW 2GVAA 1GO3E 1VS0A 3EN2A 1VQ5A 5C3EH 2VL6A 3CPFA 3NENA 3S2DH 3RNUA 4YWMA 2VZAA 5IP9H 4A3KH 1B8AA 4IOAA 3U4ZA 3S2HH 2BA0A 4O0AA 1PV4A 1XJVA 4JOIA 4C3IH 4DAMA 5GQOA 4PZ7A 3GO5A 2JA8H 2UXDL 2JA9A 2WAQE 1I6HH 1SMXA 1KAWA 1VQ9A 2D0PA 2WFWA 5C4JH 2K5VA 4L5TA 4LNQA 4QIWE 1IBKQ 2Z6KA 1L1OB 1PHJA 4A3MG 3U4VA 4GOPB 1S40A 3I4MG 2IT1A 3U58A 5JJLA 1Q1BA 1LM0A 5C4XH 4YHHL 2A1AA 3LGJA 1V1QA 2OQ0A 1YVCA 4UY8C 3PO3G 4A3GH 4KHPQ 3KYHC 2K5NA 1IBLL 2CCZA 2F3IA 1AE2A 1L0WA 4C2MH 1JT8A 1AE3A 1IBMQ 5LMNQ 3M7NA 1Q7YC 1X3EA 2PQAB 2JEAI 4A3LG 1VQ6A 1TWAH 2PMZE 1YI2A 2UU9L 4OO1I 1VQDA 1G6PA 1NY4A 4OWTB 3FKIH 5M3FG 1VQHA 3H0GG 4GN5A 2B63H 3PUZA 3K81C 2E8GA 1E22A 4KI0A 1VQ7A 2UXCL 2EIFA 1UWVA 2UXDQ 4A93G 1Q81C 4R4TA 3T1HL 1VQNA 2BH8A 3F2DA 4DUYL 4A3JG 5AJ3L 4FDBA 4JI1L 1VQGA 1T9HA 1WYDA 2JE6I 1K83H 4YCWA 4JBWA 1VQFA 2OCEA 2R92H 3DLLA 3HOYG 3AEVA 3T1YL 2I5LX 3L2PA 4YHHQ 2JA7H 4GNXB 1A8VA 4NXNQ 1U5KA 3ULLA 3M85A 1YJWA 3BJUA 3A5UA 1EUJA 3CQZH 1VQPA 5C44G 1IBLQ 1SROA 2NZOA 1NBWA 4GLXA 3RN2A 2NN6I 4DV1L 4A3IG 2XGTA 2ATWA 2UUAL 1I50H 2K50A 4MTNA 4WJ3M 1E1TA 1XTDA 3CD6A 2XTIA 3K8AA 3PGZA 2UU9Q 1X65A 4A3FG 4BBSG 4LFBL 1BBUA 4BY7G 3ULJA 1QUQA 2IHFA 5BR8L 3S15H 1NJIC 1VQIA 2YTVA 4GLVB 3J81i 4OWXB 3J7A5 2UXCQ 4R4QA 3HOVG 4TQUS 4DV4L 2IX0A 2R7ZH 2AKWB 4P72A 3T1HQ 4LF4L 3S1NH 2UUBQ 3GTLH 3M4OH 5IYCH 1YNXA 4DUYQ 1N34L 1SN8A 3M4QA 5AJ3Q 3Q8DA 4JI0L 4JI1Q 1PH5A 1PYBA 4DV2L 1K3RA 2R6GA 3AFQA 3CCVA 2JK8A 2ES2A 5FLMH 3T1YQ 2AWNA 5EAYA 3HOXH 5E7NA 3PUVA 1UEBA 1UE6A 1E1OA 4LF5L 5IYDH 2K4KA 4JYAL 3CW2C 1PFSA 4IJLA 3F2BA 3PSIA 4BA1I 1XMQQ 4R4IA 3TREA 2JA8G 4DV1Q 3GTOH 2UUAQ 3M4PA 3SGIA 1HR0L 4IJHA 1XNRL 1MKHA 1YZ6A 3A74A 4LFBQ 4YWKA 3STBD 4DV5L 4AQYL 1TWGH 5GROA 1HR0W 1FL0A 5M3MH 5BR8Q 3KF6A 5DLQE 4OONA 4PG3A 5C4XG 1G51A 1W2BA 4B3ML 3G71A 3HOUH 4A3GG 1PH2A 3ICEA 4DV4Q 5HGQA 4IOCA 4LF4Q 4A3BH 1K0RA 2K52A 4EQ5A 4LUOA 1N8RC 1N34Q 4C3HH 4YY3L 4JI0Q 4GKJL 1JJCB 1IZ6A 4APVA 1K8AC 1CSPA 3EIVA 1OXVA 1EIYB 4DV2Q 1QVFA 1QVGA 4IFDI 1C9OA 4YCVA 1R9TH 2C35B 3FKIG 5IP7G 1IXRA 4JI2L 2DUDA 4LF5Q 3RZDH 4AIMA 2R7FA 4JYAQ 4B3RL 2E5LL 2HT1A 1V43A 4DV3L 1X9NA 5JEAJ 1N32L 3GTKH 2Z0SA 1DGSA 3G6EA 1L1OC 3J80i 4JI5L 3W1BA 1NE3A 3GDEA 1GD7A 3A5ZB 4OXPA 4DR1L 4GOPC 5C0XI 1N9WA 1HR0Q 5HY6A 1CKOA 3HOZH 4BY1H 1XNRQ 3TQYA 1QUQB 2VY3A 2ZTDA 3HFZB 4DV5Q 4AQYQ 2JA5G 3RLOA 3CAMA 2E2IH 1E3PA 1MJCA 1TWFH 2IHEA 5IE8A 2ID0A 4B3MQ 2YV5A 3PV0A 2JA7G 4OO1G 4DUZL 2Y0SE 4DK6C 1A0IA 3PUWA 1YHAA 1QVCA 3I4NH 2ZJPA 4BBRH 1Q82C 4BXXH 4A3CH 2H5XA 4JI7L 4JI6L 4YY3Q 4GKJQ 1Q1EA 1YJ9A 2JA6G 1WCMG 1A62A 3UDXA 1JMCA 1A63A 3EBEA 2UUCL 4IPCA 4LF7L 5JJIA 4JI2Q 2R93H 2ZJRA 1V9PA 4NB3A 1Q86C 4JG2A 2ZTCA 4NXML 4MZ9A 1S72A 4B3RQ 2E5LQ 2OTJA 4DV3Q 4ALPA 4AH6A 1N32Q 1XPOA 1Y1WH 4OWWB 4JI5Q 4DR1Q 2KCMA 1K73C 1UE1A 2KBNA 3TRZA 5IT9c 3S1QH 4A4IA 4GNXC 1EQRA 2NN6G 3KF6B 1FVIA 1CKNB 1E24A 3TEHB 2BA1A 1HZCA 5M5XH 2E2HH 1L2FA 3E0EA 5M3MG 5FJ8H 3ER0A 3M3YH 1VQJA 2ZJQA 3J81c 3UDFA 4DUZQ 4YCUA 5IYDG 4GKKL 1VQOA 1GM5A 4BA2I 1EIFA 1X56A 1ASYA 4LFAL 3RR5A 2VQFL 1SLJA 1KHIA 4JI6Q 5IYBH 2WB1E 4L5RC 2UXBL 4GN4B 1HZAA 1Y1VH 4A3EG 4A3DG 4LF8L 4PZ8A 2UUCQ 1YEZA 1Y14B 4LUVA 3STBC 3J7ZC 4LF7Q 1OXXK 2EQSA 1BBWA 3D31A 4NXMQ 3GD7A 2GVBA 3DM3A 3JC66 3UE1A 3PIPA 3HOUG 3HOWG 1J6QA 3F8TA 3PUXA 1PH3A 3KF8B 1MIUA 5IY0A 4A3BG 3CC2A 2I5MX 5GAGC 2MO0A 2YTYA 1X3FA 2NZHA 1N33L 1O7IA 2RF4A 2ZM6L 4HJAA 4GN3B 3S14H 4K0KL 3CPWA 2BH2A 1C0AA 4JBJA 1XPUA 1PH1A 4P71A 4A3MH 2WP8J 4Y7NH 4UP9A 2Y0SG 3AQQA 3E9IA 3RLFA 1X6OA 2OQKA 2RCNA 4GKKQ 3PO3H 3CCSA 2OWOA 4LFAQ 1EYGA 1NTGA 1HNXL 5C3EG 2JJQA 2PI2A 4JI4L 4UPAA 1XNQL 2N49A 2VQFQ 4DR2L 5IP9G 4DR3L 4A3KG 1XPRA 2I0QA 1KIXA 3GTPH 4LW1A 3I4OA 3S1RH 2UXBQ 3VDYA 2K75A 1OXSC 4BY1G 3UE0A 4LF8Q 4DV6L 4LUZA 2QGQA 1KC8C 2V1CC 4H02A 1WOCA 3BU2A 3H0GH 3TS0A 1JJ2A 4IFDG 4JV5L 3HKZE 1L1OA 1YITA 2KENA 4QJFA 2IY5B 1X3GA 4GOPA 4P75A 3J80c 1I94L 3I4NG 2NVTH 1SE8A 3ERSX 4BBRG 4A3CG 4NPSA 3RLNA 4OX9L 4AYBE 1IYJB 3OTOL 4A3JH 2ZM6Q 4LF9L 1N33Q 3UDIA 1TWCH 4DR6L 4K0KQ 4WJ4A 3M9BA 3CC4A 5C0XG 4XIGS 3HOYH 2DGYA 1LUZA 3JAMi 2A8VA 3TS2A 1PYSB 5M5YH 4O2DA 4PZ6A 3PCOB 1VQMA 2ZTEA 3PF4A 4JBMA 4P74A 3MXNB 4DR7L 2Q2HA 3I2ZA 1PH8A 5C44H 1HNXQ 4GLAC 4JI4Q 1XNQQ 2F4VL 2CQOA 3MEFA 3I55A 4DR2Q 4DR3Q 2D62A 2WB1G 4YWLA 3S24A 1Y1WG 4HIOA 4DKAC 2B63G 5K36G 2CFMA 4IFDJ 1FGUA 4UP7A 4DV6Q 4A3FH 2YU9H 2RHQB 4IPGA 4X66L 5ELNA 5LMUL 1QZGA 1C7YA 3IRBA 1QZHA 4XTCS 2NVQH 4DV0L 4DR4L 4JV5Q 1KQSA 1I5FA 1P16A 4HIDA 1I94Q 2R92G 2I5HA 3HOVH 2GN5A 1RIPA 1HNWL 4GNXA 1D7QA 3AYHB 4OX9Q 1VQEA 3OTOQ 2KCTA 1XMOL 4LF9Q 1BKBA 3BZCA 4GS3A 3PO2H 4DR6Q 2NVXH 1YIJA 4B3SL 4JCVE 3ZJYC 3I56A 1EQQA 4POGA 3K80C 2LSSA 4KLKA 3A0JA 3CCRA 3L7ZC 2F52A 2JEBI 4DR7Q 1LYLA 4X64L 1S3OA 2YYZA 2B29A 4IPDA 3S1MH 4DV7L 2OTLA 2CWPA 2F4VQ 2QEXA 3KDFA 1YBYA 1TXYA 1KRTA 3OYYA 3H3VI 1B70B 5ELOA 2FXQA 4LWCA 4ME3A 2VUMH 1PA6A 1LTLA 3S16H 2R7ZG 4X66Q 1OXUA 2R7DA 5LMUQ 3HKZG 1AH9A 4DR4Q 1YHBA 1X54A 5IYCG 4DV0Q 1VQ8A 2KHIA 4HJ8A 1HZBA 1RL2A 4NXNL 4Y52H 3H15A 3AFPA 4LF6L 4AYBG 1HNWQ 2ALYB 5FLMG 4JI3L 2VS1A 1JB7A 3HOXG 1KL9A 1B7YB 2N3SA 4R1JA 3CCMA 1XMOQ 1YHQA 4A75A 1SFOH 1UE7A 2Q2UA 1Q46A 4B3SQ 3H3VH 4HJ9A 4X65L 4X62L 4JI7Q 1EOVA 4JOIC 3U50C 2VW9A 5GAHC 2YTXA 1EWIA 5IP7H 2HIVA 2NVYH 3KJPA 1Z9FA 4A76A 4X64Q 1J5EL 4DV7Q 1CKMA 1Q12A 1I3QH 4J15A 5JJKA 1JE5A 1X55A 2K5HA 3W1GA 2N8NA 4EX5A 5GADC 1BVSA 1HJPA 2Z6KC 3GTJH 3GTQH 2UUBL 1HH2P 3KOJA 4QL5A 4LFCL 4DR5L 1MJEA 1PH4A 3K7UC 1UE5A 2MO1A 1CUKA 1GVPA 4UP8A 4HJ7A 2JA5H 3ULPA 3KLWA 1VQCA 4DNIA 4MNOA 4P73A 2AMCB 3B6YA 1VQ4A 2HHHL 2PI2E 3BZKA 3CCLA 4B3TL 1M1KC 3CCQA 1N36L 2LXKA 2CKZB 1KXLA 4LF6Q 1XMQL 3I4MH 2VNUD 1KD1C 3L0OA 3CP0A 4JI3Q 2LXJA 4R4CA 4PMWA 1PH9A 1P8LA 2ASBA 1OXTA 1KRSA 1M90C 2JA6H 1WCMH 1E7ZA 2HIXA 3RN5A 1K9MC 3JAMc 3F2CA 4X65Q 4X62Q 3NBHB 1K8GA 4IO9A 4JBKA 3FHWA 4R4OA 2MQHA 3HOZG 3G4SA 3K7AH 3KDFB 4JI8L 4DK3C 4A3LH 3FP9A 1J5EQ 2CWAA 4DPGA 2WAQG 4HJ5A 3CF5A 4HIMA 3NEMA 1TWHH 3RZOH 3CCJA 1SRUA 5M3FH 3W5OA 4QGUA 2HQLA 4DR5Q 4LFCQ 3CCEA 1IL2A 1G291 3PO2G 2VQEL 1VQAA 5FLXc 1FJGL 1GKHA 2EXDA 3PIOA 3J81j 1HNZL 1VQLA 4A93H 5GAEC 2B3GA 3UDGA 4BXXG 2Q2TA 4C3JH 4QY7A 2HHHQ 1NMFA 4B3TQ
chains in the Genus database with same CATH superfamily
1N36Q 3A8KE 4ZAIA 1OTCA 2F0QA 5M5WH 1WFQA 1VQKA 2PQAA 4R8NA 2R93G 4DAYB 3G48A 5ELEA 1KLGD 2PNHA 4JVZA 5JEAG 1I4RA 2EZVA 4KJNA 2F0OA 3V2TA 1NMGA 1PH6A 1FNUA 1V1OA 1IBKL 3F1ZA 4HIKA 3JAME 5JVG3 2IX1A 3S17H 3E6ZX 2VUMB 5FJ8G 3S16B 3CMEA 1W3SA 3CHBD 1SBBB 1YJNA 5I9PA 1O7LA 4RGNA 5DEHA 4X6AH 2N78A 1ASZA 1STYA 3MXPA 3NELA 2RHSB 3PF5A 4R9WA 2PQEA 4FYDA 4RG1A 3VYUA 2MP1A 1U0LA 1BNZA 1GO3E 3VYRA 1SFOB 2A6ED 5IGGA 3G6JB 3S2DH 5IP9H 2VZAA 3U4ZA 3S2HH 4RFBA 3Q0AA 2EY5A 4C3IH 4DAMA 5CYUA 5GQOA 2UXDL 4U673 1I6HH 2M9VA 1KAWA 1VQ9A 2DNEA 4RGOS 2K5VA 3E5SA 3UI2A 2K5WA 4A3MG 4B9XA 5JJLA 4K5XA 2CH4A 2JA5B 1LM0A 2V4DA 1V1QA 2K5NA 1IBLL 3BZDB 1AE2A 1AE3A 1IBMQ 3HRZC 3I4MB 2JEAI 4XYOA 5EKLA 5COYA 1TWAH 3Q6SA 3J80L 1WCMB 1NY4A 2SDFA 1EOTA 4H13C 1EZ6A 3TZUA 3KLSX 2UXCL 2EIFA 4XDXA 1Q90A 2X6GA 4A93G 2O4XA 3F2DA 1G8ZD 4JI1L 1WYDA 1O80A 4IUNA 4JBWA 2OCEA 3HOYG 4DXGA 1NSNS 3NHHA 4GNXB 1A8VA 3ULLA 1S5BD 4C3JB 2D5DA 3A5UA 2F0SA 1EUJA 5ELCA 5C4ZA 5C44G 1SYCA 1BCPD 4A3IG 5I6WA 4DV1L 1ESRA 1OO9B 2GA4B 3A7AB 3K8AA 5KRUA 2UU9Q 1X65A 2K5DA 3HP3A 4A3FG 3GQBA 3VR3A 4BBSG 1BBUA 4LFBL 1SDFA 3ULJA 2A6HD 2IHFA 3S15H 1NJIC 1WTVA 2A74C 4DNRB 4ZLTF 3J81i 1TQOA 1SYFA 2R7ZH 3S1NH 3HOUB 3BS1A 3T1HQ 4LF4L 3HOWB 5FO9B 4EQPA 5IYCH 1YNXA 1DOLA 1MGSA 3Q8DA 1PH5A 5D14A 1EY8A 3CCVA 2JK8A 5FLMH 2A6EC 2TSSA 3T1YQ 1QE6A 5E7NA 1E1OA 3TP5A 4LF5L 5IYDH 3TDQA 1TY2A 2BE5C 4RWSC 1TS4A 4JYAL 4PNYA 3CW2C 3F2BA 4BA1I 3RZDB 4ZKBB 1PDQA 3GTOH 2UUAQ 2F0MA 3SGIA 3PIO3 4A3KB 4IJHA 4YWKA 3STBD 2PW7A 2HDMA 1FL0A 1H9SA 5BR8Q 1Q8IA 1G51A 1X3QA 1STBA 1PH2A 4IOCA 1WVLA 1K0RA 4C1NI 4LUOA 3ZYYX 1N34Q 4GKJL 2LKVA 1JB3A 1JJCB 1A3TA 1PXUA 1CSPA 1OXVA 2A68C 1RCVD 4IFDI 4YCVA 4IURA 2C35B 2K5QA 3VA5A 5HGTA 4C2MB 1DOMA 4I7ZC 1S5CD 2R7FA 1S5ED 4DGZA 1NR2A 2RQXA 2E5LL 2HT1A 4DV3L 2JP1A 4QCLA 3GTKH 5M9OA 2Z0SA 1YNJC 4JI5L 1NE3A 3GDEA 5C0XI 3HOZH 1XNRQ 2ZTDA 2VY3A 2F0IA 2JA5G 3P1HA 2XVSA 2E2IH 4FO2A 2IHEA 1SXTA 4OO1G 4DUZL 3D6WA 5EQ0A 1ILQA 1A0IA 4DK6C 5ELBA 4XQQA 3TMEA 5IOCA 3K59A 2JXMB 4A3CH 1WCMG 1A62A 3UDXA 2JA7B 4OIKA 5KIXA 5C0XH 3EBEA 2F0UA 4IPCA 1EYCA 4LF7L 3CQZB 5JJIA 2ICEC 2ZJRA 2R93H 3NPPA 4NB3A 3SK5A 1Q86C 4JG2A 2ZTCA 2OTJA 3RUZA 1BCPB 1XPOA 4OWWB 1D5XC 3OMCA 3ND8A 3S1QH 3P7JA 2H4OA 1EEID 4C3JG 4NMZA 5FJ8H 3M3YH 1VQJA 3J81c 3HKZB 1EY9A 2MGSA 1QILA 1X56A 2B2TC 3RR5A 1DD2A 2VQFL 4AYBB 4G7OC 3HOXB 3V05A 5TSSA 1YEZA 1Y14B 2Q8IB 4LUVA 3STBC 1WTQA 3RD4A 1T5EA 1BBWA 2RDFA 4NXMQ 3HOUG 3DM3A 3PIPA 3HOWG 1GHJA 3CRKC 4FF1A 1PH3A 1MIUA 2I5MX 2YTYA 1EEFD 3S14H 1C0AA 1RD9D 1LT3D 4JBJA 4A3MH 1DOKA 1LT4D 2XNAC 3ERQA 1HFGA 1X6OA 2OQKA 4GKKQ 1SMYC 1NTGA 3BYTB 5C5LA 2SOBA 3TN2A 3GTPH 4A3KG 2LS01 2NYZD 2UXBQ 4FXKC 1OXSC 1A2TA 3UE0A 4LF8Q 3U9OA 4JPBW 2BCOA 1B1ZA 1KC8C 2V1CC 4H02A 4JV5L 1SYGA 4C1NK 1L1OA 2IY5B 2AUJD 4B08A 2NTSA 1KNAA 3RLNA 3OTOL 1IYJB 4LK1C 1TWFB 2WV6D 3E3XA 4KKSA 4XIGS 1ICWA 3HOYH 3JAMi 2B2WC 4HSVA 5FOBB 4O2DA 4PZ6A 3PCOB 1VQMA 4P74A 5I4DA 4JI4Q 5C44H 4GLAC 5CMDA 2CQOA 4DR2Q 4DR3Q 1AFPA 3BG3A 2PNRC 2NUCA 4IUTA 4IFDJ 2YU9H 4DV6Q 4A3FH 1S5DD 2RHQB 4IPGA 5ELNA 1QZGA 1QZHA 1EFID 4XTCS 4DR4L 4R8IA 3C1EA 5C5MA 1E2ZA 2GN5A 4ABNA 1VQEA 4CJ1B 4DR6Q 1XMOL 4LF9Q 1BKBA 2WACA 4JCVE 4KKUA 4QF4A 4POGA 3K80C 2LSSA 3A0JA 3CCRA 3L7ZC 3T51B 3NE5B 1BDOA 3X3MA 1U9RA 2XRQD 1EU4A 1X32A 1B70B 5CV7A 3QJYA 3A54A 3BVMA 2VUMH 1LTLA 3S16H 4UHVA 2O2LD 2BDOA 3HKZG 4TRDA 1YHBA 1X54A 1DYQA 5EGTA 1HZBA 1PTOC 2BDNA 4Y52H 2XWBB 2NBFA 4LF6L 4AYBG 4JI3L 3HOXG 1EIHA 1B7YB 2N3SA 2CH4W 1SFOH 3CU7A 1UE7A 2Q2UA 4BWGB 4RA8A 4HJ9A 3K57A 4JOIC 3U50C 2VW9A 2YTXA 4ZYSA 2F03A 1Z9FA 3S1RB 4X64Q 4NKLA 3NQTA 1PMRA 2NZ1D 5GADC 3GP7A 1HJPA 1KDCA 2Z6KC 2DY8A 2UUBL 3H94A 1U4PA 3HZXA 1GVPA 2PZWA 2JA5H 3ULPA 3KLWA 4XYQA 1IYUA 2EJGC 3B6YA 4H7BA 1KAAA 2PI2E 1D1IA 3BZKA 1N36L 4OO1H 2LXKA 4NDXA 3SK4A 4V0BA 3W2DA 4LMQD 2F0GA 3VR6A 4KV6A 4GZYC 3I4MH 3HS0C 1PH9A 1P8LA 4FF4A 1WCMH 2HIXA 4DN4M 1K9MC 3JAMc 4X65Q 3NBHB 3BDOA 4CHTB 1IKLA 4A3LH 1EYAA 3L9AX 3FP9A 1B50A 1LACA 4DPGA 4HMIA 1CI3M 1AZQA 3QB3A 2NB0A 5M3FH 3KLSA 3DUZA 3W5OA 2HQLA 4BY7B 4LFCQ 2RKSA 1IL2A 1G291 5ELDA 1VQAA 4K5WA 4RKLA 5GAEC 3UDGA 1ILPA 5J39A 2Q2TA 1II3A 2HD3A 4QY7A 4C3JH 4KHZA 1CSQA 1WJJA 3K0XA 1LT6D 1Q8KA 2E2JB 3FMCA 4JC0A 1NUCA 3J7YW 1H9KA 1Z47A 2K14A 2KCNA 2L0CA 4ULLA 1CA6A 4MIUA 1CKNA 1TS5A 2HUGA 3E9HA 4U68A 3HOWH 4XT3B 2H1EA 3KJOA 1GUTA 1EQTA 4DA2A 2EVBA 1ENFA 1JJGA 1HNZQ 5C4XB 2AWOA 2Z4IA 1EFWA 3I91A 3KBXA 1IBML 4KHVA 2KHJA 3CMAA 4FVMA 5IWAQ 3OW2A 2D2CC 3SHLA 3QO2A 2VL6A 2B2UC 4YWMA 4A3KH 4E6IA 1PV4A 1CQVA 3LWUA 1SE3A 2JA8H 3GO5A 1RDPD 1SMXA 3VR4A 1I3QB 2D0PA 4L5TA 4LNQA 4QIWE 1CZGA 1L1OB 4PV1C 1ZKOA 1Q1BA 3AMUA 3IAYA 1TT2A 1R4QB 3LGJA 4A3GH 2OQ0A 1IL8A 2F3IA 1EQVA 1O7ZA 4C2MH 3SK6A 2L5TA 2ZT9C 3TP8A 1J9OA 1Q7YC 1X3EA 3A56A 1VQ6A 2PMZE 3EA6A 2UU9L 1WTRA 5FLXL 1K8MA 2XSCA 4G57A 1M8AA 3FKIH 1TS2A 3NBIA 1VQHA 4GN5A 2QCPX 3TP7A 4F8MA 3K81C 1GUGA 1E22A 1E0BA 5I2YA 1EIGA 1FR3A 3T1HL 5CV5A 1VQNA 1RKNA 2LMCB 4YCWA 5EPLA 1VQFA 3AEVA 4L6TB 3T1YL 2I5LX 3L2PA 4A93B 4YHHQ 2JA7H 3MXNA 3Q23A 1YNND 3BJUA 3CQZH 1VQPA 1H9JA 2NZOA 2L55A 1Y8PB 2NN6I 2EXZA 2UUAL 2CVRA 2XTIA 2E76C 1XYIA 3GTMB 3K6OA 4BY7G 4A3EB 2CQAA 5BR8L 4K14A 1VQIA 4GLVB 3KK7A 3K5OA 2BOSA 2AKWB 4BBSB 1ZXTA 2UUBQ 1GOZA 2DJFC 2KJXA 4DUYQ 1N34L 1SN8A 4KK7A 1JORA 2NN6H 4TSSA 1RHPA 3D3RA 3IFTA 4C3HB 3R2TA 3AFQA 2R6GA 4K8IA 4JK1C 5KNCA 2ES2A 3GTGB 4QUCA 3HOXH 1UE6A 2DN8A 3T56B 2K4KA 2Y0SB 2CW0D 4IJLA 3A55A 3TREA 3SXHA 1TIID 4FNFA 1XNRL 3A74A 4KD3A 2K03A 5C4XG 5C4JB 3ICEA 2VB3X 4A3BH 2PO4A 1SAPA 1U4MA 4C56C 1IZ6A 1EIYB 2PPBC 3EIVA 1QVGA 1C9OA 1UEAB 5IP7G 1IXRA 3T13A 2F0WA 2DUDA 1D5MC 4KKTA 3J80i 2A69C 1N9WA 1HR0Q 1Y1WB 2WB1B 3TQYA 1H9MA 1QUQB 3HFZB 4DV5Q 3FEWX 2B63B 5CR3A 4EGVA 1MJCA 1TWFH 1EYDA 3MZ5A 3QOLA 4ODGA 3MEHA 3I70A 2ZJPA 3DHQA 1K83B 2Q8RE 2R92B 4YY3Q 4XT1B 1A3VA 2B2VA 1YJ9A 3D4WA 2LFNA 1LTRD 1A6XA 1PFBA 5ELFA 3MFGA 4JI2Q 1V9PA 4F7XA 4PMCA 5DM63 4K2LA 4NXML 1S72A 1ZYRD 4ALPA 4AH6A 4DR1Q 1K73C 1UE1A 2PZUA 2QEJC 2EYPA 5EKKA 4GNXC 1RJTA 1CKNB 1E24A 2RSOA 3TEHB 2BA1A 3CKIB 4IZ8A 3E0EA 1K3BC 2XWJB 3NP8A 2ZJQA 2VXWA 4YCUA 3M4OB 5JPNC 4GKKL 4WJWA 4BA2I 4DF7A 3E0JA 1HA6A 1SLJA 1KHIA 1MI2A 4JI6Q 2KA7A 3NK9A 4L5RC 2UXBL 3HG9A 1FYCA 4A3EG 4LF8L 2UUCQ 2AQ1B 1WD1A 1VMPA 2AUKA 1ZEQX 2KEDA 3D31A 2GVBA 3R8BA 3F8TA 2EYMA 2MO0A 1XTCD 1TWGB 5CV4A 2RF4A 4C3HG 4DXFA 3OMGA 1EL0A 4XQNA 4ZCKA 5CC4A 2Y0SG 4P2CB 3E9IA 5IT9E 5E4WC 4K5VA 1CHPD 2K33A 1EYGA 4JI4L 3I4LA 4UPAA 5A2QL 4DR2L 4DR3L 1XPRA 2I0QA 1V1PB 3I4OA 4LW1A 3S1RH 1R9TB 3D8GA 4KY5A 4BY1G 4BS9A 4MHEA 4DV6L 1QNUA 1F77A 2KQ3A 3TS0A 3BU2A 1DCZA 1WD0A 2NVQB 4GOPA 3J80c 2N55A 3I4NG 3ERSX 4BBRG 2MPMA 1MSGA 4DR6L 1EWHA 5CORA 2ZM6Q 4LF9L 4IUUA 4K0KQ 3SDZA 4WJ4A 1I6VC 5EPKA 3C2PA 2R61A 3FVQA 1EY6A 1MSHA 3VR5A 1B2TA 2NVXB 1DONA 1RTNA 4FXDA 4JBMA 1JC7A 3MXNB 1XPUA 1HNXQ 1SNMA 1ZYRC 2X69A 1Y1WG 2WB1G 2P5ZX 4YWLA 1F2MA 2B63G 2O5JC 3J81L 1FGUA 1SYEA 1C7YA 5EJWA 1HQRD 1DXMA 1KQSA 1GUOA 1I5FA 1MHWC 3NTIA 4FXGC 2R92G 3WOEA 1IW7D 2XN9C 4IN3A 4OX9Q 5M5XB 2KCTA 1WTXA 4GS3A 3K5LA 3HEJA 3TSSA 5BN3A 2EYLA 3I56A 1BCPC 2J0TD 4LAAA 2HDLA 4L8JA 3W3AA 2F52A 2JEBI 3NBHA 1LABA 2FMMA 4IPDA 2B29A 3SE0A 4X64L 2Z6BA 2F4VQ 2QEXA 1Y1VB 1YBYA 2SNSA 1KRTA 2A6HC 1D1KA 1E2VA 2FXQA 5JEAH 3QWNA 4X66Q 5LMUQ 2HCIA 1DJRD 4DV0Q 1PRTF 1VQ8A 2KHIA 2N88A 2EOTA 5K5PA 5C3XA 3H15A 3AFPA 2B2YA 1YHQA 1SYBA 5C3WA 4Y7NB 2XIWA 1Q46A 1FD7D 4X65L 5GAHC 5IP7H 1EWIA 1AZPA 2HIVA 5CV6A 2NVYH 4CKCA 1XXGA 3MA2B 4O42A 1CKMA 1Q12A 3K7AB 1I3QH 1JE5A 1G6ZA 3KOJA 1LO5D 2FJ2A 4LFCL 1MJEA 3K7UC 1UE5A 1CUKA 4FP5D 4UP8A 2QDLA 4DNIA 1SJED 4P73A 3CCLA 2NVTB 2K28A 3CCQA 2CKZB 4A3JB 2XRSD 1XMQL 1ONLA 5CV9A 4R4CA 4CDEC 4WRDA 2O5IC 3I3CA 5M5YB 5D65A 4X62Q 1GHKA 1B9NA 3S9WA 2JSOA 1Q3LA 2MQHA 5C4HA 3G4SA 1CT1D 4DK3C 2G9HD 1STNA 3CF5A 4HIMA 1J8IA 1SRUA 3SEBA 4M1UB 1IW7C 2F0PA 1SNDA 3S17B 3A7LA 3OIPA 4Q5VA 3PO2G 1AW7A 1HNZL 2SNMA 3J81j 4A93H 1F9SA 3RMHA 1PTOF 5IWAL 1B9MA 1BOSA 4I65A 3WWVA 1STEA 4DAVA 1I4XA 3PUYA 3D4DA 5J3BA 2Q2IA 5IGEA 3GTMH 2QA4A 3CXCA 3G7LA 4A3EH 3T4AC 4POFA 3S2HB 1EY5A 2MFIA 2EYHA 4A3IH 3S1MB 4IQZA 1W6JA 4JI8Q 3OPOA 1HZ9A 3GV3A 1I6HB 4N9PA 4BBSH 1VCIA 5DNFA 2ICIA 2D0OA 1JICA 3I72A 2AHOB 2F0KA 1PRTB 2VQEQ 3QOJA 3KFUA 3GTGH 3OSOA 4IPHA 5C0XJ 3BYYB 5IGCA 3CCUA 3SVMA 3MAQA 1Y1VG 2B39A 2L15A 5KYIA 3J80E 3EN2A 2VB2X 1JOQA 3VYTA 3NENA 2PW5A 1B8AA 4OELB 1XJVA 5KYLA 1DM0B 1Y8NB 2WAQE 1UNSA 3H6MA 4ZQ3A 1QNKA 1V8QA 2L11A 2F0NA 2WFWA 2JYOA 5C4JH 3GTQB 2X6LA 4J6HA 2J4XA 4WORA 3U4VA 4GOPB 2IT1A 3U58A 1VF5C 4YHHL 5CBAE 1CZWA 4KHPQ 4UY8C 1YVCA 3KYHC 1L0WA 3AB9A 5LMNQ 3O13A 1STAA 1LT5D 3DEOA 1E2WA 4RHSA 3K5MA 1YI2A 1QWYA 1W6KA 2JA6B 1VQDA 4OO1I 4OWTB 3WOFA 1MD2D 2B63H 3CRLC 2E8GA 4KI0A 1VQ7A 3S15B 2F0JA 3K0YA 2QKIC 4R4TA 1Q81C 2BH8A 4DUYL 4A3JG 3FPPA 4FDBA 1T9HA 2JE6I 1K83H 4HR7B 2R92H 2OF1A 3DLLA 1PTOB 2EYOA 5L37A 3M85A 3V96A 1C48A 1KABA 1ML0D 3RN2A 5G3LF 2ATWA 4WJ3M 2K50A 2PYKA 1XTDA 3CD6A 1O7YA 3GTOB 3PGZA 5EPJA 2EY2A 3P20A 3QG1A 4A3DB 1QUQA 2YTVA 2L12A 5FO8B 1HRJA 2E74C 4CBVA 4OWXB 3J7A5 3OWFA 2EE1A 4R4QA 4TQUS 2IX0A 4RGMA 2QF7A 2F0LA 3M4OH 1HUMA 3PMFA 3M4QA 1G2SA 4J1MA 5AJ3Q 2FINB 1PYBA 3DWQA 1BO0A 3I8ZA 3R93A 4DAPA 1K3RA 3VA7A 3DXJC 1JWSD 5EAYA 1SE2A 3PUVA 1XMQQ 3PSIA 3C46A 4R4IA 5C3EB 3M4PA 1HR0L 1MKHA 1YZ6A 4DV5L 5J22A 5KNDA 3NTHA 1TWGH 5GROA 5AFWA 1HR0W 5DLQE 4PG3A 1WTOA 3HOUH 4ZKCB 4Q0FA 2KUMA 2RA4A 4DV4Q 5HGQA 1TR5A 2I07B 4JI0Q 4YY3L 1K28A 4RGTA 1CTMA 1NAPA 4APVA 1F9PA 1JQYD 1PYWD 4DV2Q 3VR2A 4H44C 1R9TH 1JWMD 4JI2L 3RZDH 5E4XA 1X9NA 3G6EA 1DGSA 1L1OC 4OXPA 4HCSA 4DR1L 1ET9A 3A5ZB 1IYVA 5HY6A 1CKOA 5T1GA 3X3NA 5KEEA 4AQYQ 3S1QB 3CAMA 1G2TA 1E3PA 3FPUB 5IE8A 4B3MQ 3PV0A 5DAUA 2E75C 2L4NA 1YHAA 1Q82C 4JI7L 4JI6L 2EYFA 2FMCA 2JA6G 1A63A 3EROA 1L0XB 1TY0A 2UUCL 1V1PA 1BXTA 2K01A 5KNBA 1I50B 4B3RQ 2Z9HA 1N32Q 1KTKA 2KVMA 3AU7A 2KBNA 5IT9c 1EQRA 3KF6B 3N6RA 5M5XH 1I4PA 3GTLB 5IYDG 4O1NA 4XXEA 1L0YB 4QUFA 1Y1VH 4A3DG 1JR0D 1OXXK 1PZJD 1RODA 2EQSA 2EY1A 4NP5A 3GD7A 3JC66 1GUWA 3UE1A 4F87A 3PUXA 4OIJA 3J7AV 2NZHA 3EVQA 1O7IA 1LTID 2ZM6L 3KUPA 4GN3B 4HJAA 4K0KL 4Y7NH 4UP9A 3AQQA 4OEMB 2RCNA 2OWOA 4LFAQ 1HNXL 5C3EG 1CHQD 2JJQA 2DJGC 2N49A 3QR8A 1KIXA 5I6YA 4NW2A 3Q24A 1D5ZC 2I46A 3NQIA 3NSWA 4KD4A 4FF2A 2YU9B 1WOCA 4IUQA 2ZXRA 4IFDG 1I4HA 3HKZE 4G7ZC 1XWEA 2KENA 1WTPA 2F3WA 4P75A 4WFN3 4BY1B 1AP0A 2NVTH 4A3CG 2QW7A 4NPSA 4OX9L 1N33Q 4AYBE 4A3JH 3A8IE 3UDIA 2ENBA 3M9BA 5C0XG 5FK9C 1VMCA 5IGBA 3I4NB 3TS2A 1PYSB 2M2LA 5M5YH 4BBRB 1GXDC 1EWCA 1F2LA 1XNQQ 3C3LA 1XX8A 4YIJA 5D3DA 3MEFA 2F4VL 2RVLA 4Z9CB 3MTSA 2Q8TA 5K36G 2CFMA 4X66L 5LMUL 5E3FA 3IRBA 4DV0L 3SK8A 2RDGA 2F4IA 3OW7A 1P16A 3WDNA 4HIDA 1I94Q 4HEDA 2I5HA 3EFXD 2OT2A 1D2BA 1JWUD 1SYDA 2C5CA 2R3ZA 2E2HB 1PLFA 1S5FD 3BZCA 1HXYD 4X3KA 1YNNC 1YIJA 1M4VA 2E2DC 3ZJYC 2G5DA 2B2TA 4OGQC 2BE5D 4DR7Q 2NTTA 2YYZA 1ESFA 3S1MH 4HN7A 1R4PB 1LTBD 5HURA 1RF2D 3OYYA 3H3VI 2KOLA 4N8FA 1B44D 5ELOA 4ME3A 5KGUA 1PA6A 1B3AA 1OXUA 2R7DA 1WTWA 2F0VA 5LL6X 2IW3A 4NXNL 1T5XD 1NR4A 2EJMA 1HNWQ 1EU3A 4KJOA 1CQFA 5BN4A 4A75A 1KNEA 2IJ0A 1EY7A 2A68D 2CW0C 1MBYA 4I7AA 4B3SQ 3H3VH 3TZDA 3PO3B 1F9QA 1STHA 4X62L 4HTHA 2B8GA 4JI7Q 1LLRD 4N8X1 3QIAA 4A76A 1HFNA 4KY7A 4DV7Q 2F0HA 1K0SA 4K6LA 5JJKA 3MXUA 1YNJD 2N8NA 2RSNA 3GTQH 1BVSA 4S3SA 4QL5A 5M3FB 3H0GB 2MO1A 4OHJA 4HJ7A 4IUVA 1QG7A 2LY7A 5A35A 1VQ4A 2KCCA 5T1IA 1M1KC 1U4RA 2Z1CA 1KXLA 2M00A 4RAUC 4ZK9B 1GUNA 3M7GA 2L9HA 1TWCB 1Y69U 2VNUD 3CP0A 2LXJA 4PMWA 1QOHA 5J1ZA 1OXTA 4KMUC 4X3TA 2B2WA 1HUNA 5JJZA 2JA6H 1NCVA 3RN5A 4KN7C 1BCPF 3F2CA 4IO9A 5ISRA 3FHWA 3KDFB 4JI8L 1J5EQ 2CWAA 3TBIB 2WAQG 4CGYB 4HJ5A 2PCFB 3K58A 4QGUA 4EQOA 4DR5Q 2F0TA 3D4RA 1PFNA 2VQEL 3EJIA 3KLRA 3BDCA 2B3GA 4BXXG 1PTOH 4ID6A 2WKDA 4DFAA 2HHHQ 1NMFA 1QJOA 4B3TQ 3HOVB 1HCZA 2OXPA 4QIWB 4EQNA 3PO2B 3LNNA 4QMGA 4QQBX 3MC0B 5H1SE 1C4QA 1Z7TA 5EBCA 4RKBA 3M4YA 1C8CA 4RMFA 4A3DH 2VUMG 1VQBA 3D0FA 1FGBD 2JA8B 1H9RA 4TVAB 2PMZB 4RHRA 3I7FA 1SSOA 4BY7H 3T16A 2D9UA 1PFMA 2ZXOA 2A5HA 4L5QA 4ZUIA 1SNCA 4L5SA 2EYJA 2F1MA 1D8LA 4UAIA 2QILA 4KHPL 2JQOA 1FJGQ 1PVOA 3N52A 4K8JA 4A3GB 1H95A 5LMNL 1SR3A 2IPKD 3CC7A 1WI5A 2MNAA 2A19A 5IYBG 2E2JH 3HGBA 3L3OC 4CDCC 5FLXE 1PH7A 3LWEA 1SMYD 3HKSA 1KDAA 2AQ3B 2GVAA 5LMNW 1VS0A 1VQ5A 5C3EH 3CPFA 4MTKA 4DK1A 3RNUA 2KECA 2FFKB 5FO7B 4IOAA 2BA0A 4O0AA 5IIFA 3KF8A 3FKIB 4JOIA 1EY4A 4PZ7A 2JA9A 3MXGA 2F0FA 1PRTD 4IFDH 5CV8A 3GTJB 1IBKQ 1CFMA 2Z6KA 4HAEA 2F3VA 1PHJA 1CA5A 1S40A 3I4MG 2DNCA 5C4XH 2A1AA 1AN8A 3PO3G 2Z4HA 3VYSA 3BDLA 2CCZA 3OWEB 1BBXC 1JT8A 3DMUA 3M7NA 2EPBA 2WIIB 4G4KA 2PQAB 4A3LG 4V190 1KDBA 3I90A 1JE4A 1G6PA 5EKIA 5M3FG 2K7VA 3H0GG 4HMJA 4J8QA 3PUZA 5K36H 2K32A 3FDTA 1UWVA 1SJHD 2UXDQ 1D6EC 3RZOB 1TWHB 4CJ0B 5AJ3L 3FRPB 1VQGA 2B2VC 2Z8LA 3H09A 4K2KA 4NXNQ 1U5KA 1ET6A 5M3MB 1YJWA 1IBLQ 1CK1A 1SROA 1NBWA 1IHZA 1RTOA 4GLXA 1LTTD 1TKWB 3R3OA 5M5WB 2XGTA 1JOOA 1I50H 4MTNA 1E1TA 2JN4A 3A8JE 1FNWA 2A73B 1GUSA 3MWYW 2UXCQ 2EY6A 3HOVG 4DV4L 4P72A 2PZTA 3MFYA 3GTLH 3K5NA 3J7AF 4JI0L 4JI1Q 1PTOD 4A3BB 3BVGA 4N9TA 3NUCA 4PMBA 4DV2L 1WTHA 5C6AA 1BR9A 2AWNA 1UEBA 1SNQA 1TVXA 1PFSA 2JA8G 1UAPA 4DV1Q 3NTKA 1UUPA 5I9OA 3S2DB 2B2UA 1PRTC 1GJXA 1DZ1A 4LFBQ 5CGKA 4AQYL 4C3IB 1F2YA 4RH6A 3KF6A 1B3QA 4OONA 2IWHA 1K8OA 3DEPA 1W2BA 4B3ML 3G71A 1CM9A 4A3GG 4G7HC 4KN4C 1HA5A 1TU2B 4LF4Q 2K52A 1Z6HA 1JCKB 4EQ5A 3OHXC 3U9SA 1N8RC 4C3HH 3H3VC 4RCNA 1K8AC 4TKOB 3MHBA 4OL7A 1QVFA 3FKIG 4B9WA 4LF5Q 4AIMA 4KY6A 4JYAQ 2L1BA 3LX0A 5LL6S 4B3RL 1V43A 5JEAJ 2KEEA 1N32L 3OOCA 1FNVA 1TWAB 3W1BA 1GD7A 4GOPC 2FHTA 4BY1H 3DM1A 3NWSA 3D6CA 2WKCA 3RLOA 3P75A 1QB5D 3GV6A 2ID0A 2JA7G 2YV5A 2Y0SE 4CDDC 3PUWA 1QVCA 3I4NH 3JAML 4BBRH 4BXXH 2H5XA 4MN3A 4GKJQ 1Q1EA 5EBDA 3NXWA 1JMCA 4QB4A 3ND9A 4X3UA 3C1FA 2ZXPA 1SEBD 3H91A 4XQJA 1A3UA 4MZ9A 1STGA 2E5LQ 1LTSD 4DV3Q 1Y1WH 3R2IA 4JI5Q 3MVVA 1HTPA 2KCMA 1KLUD 1BF4A 3TRZA 3DWAA 1H9SB 4A4IA 2NN6G 2MUYA 1FVIA 2MJ8A 1HZCA 2AQ2B 2E2HH 1L2FA 5M3MG 3ER0A 3S1NB 2R7ZB 3UDFA 1I4QA 4DUZQ 1A2UA 5A2QE 1VQOA 1GM5A 1EIFA 1ASYA 4LFAL 4DAYA 5G3LD 5IYBH 2WB1E 4GN4B 1HZAA 2HCCA 4CKBA 4PZ8A 3J7ZC 4IUPA 4LF7Q 2K04A 1QCBD 3URYA 1J6QA 3KF8B 4RCOA 5IODA 5IY0A 4A3BG 3IFDA 3CC2A 5GAGC 1X3FA 1N33L 1ENCA 2B2YC 3BVZA 3CPWA 2BH2A 4CDFC 1O78A 1PH1A 4P71A 2WP8J 5NUCA 4PQXA 4DNTB 3PIP3 3OIQA 5JOBA 3RLFA 3PO3H 3CCSA 2K05A 1XNQL 2PI2A 1X3PA 1S4ZA 2VQFQ 5F2DA 5IP9G 1Y8OB 2OEOA 3J81E 3VDYA 3TP6A 2K75A 1BQQT 2C9OA 4C3IG 4HSPA 5JAVA 4LUZA 2QGQA 4EVOA 1JOKA 3GTKB 1JJ2A 3H0GH 1YITA 5I2XA 4IALA 4QJFA 1X3GA 3HOZB 3T53B 1I94L 4ME5A 1EZ8A 1SE8A 1LV9A 5DM73 2J7ZA 4KTAA 2E2IB 1TWCH 4F88A 3CC4A 4X3SA 5IGFA 2QDBA 3IL8A 2DGYA 1LUZA 2A8VA 3PF4A 2ZTEA 4DR7L 2CHBD 2Q2HA 3I2ZA 1EY0A 3ONAB 1F2ZA 4ILWA 5IT9L 1PH8A 3I55A 2D62A 3S24A 3NWTA 2K1BA 4HIOA 4DKAC 4CJ2C 2R93B 2RBMA 1ENAA 3EQLC 4UP7A 2NVQH 4JV5Q 1PZID 1B53A 1SNOA 1B4OA 1PZKD 4ZRZA 3HOVH 1RIPA 1HNWL 4GNXA 1HQMC 1D7QA 3AYHB 4HCEA 3OTOQ 4L63B 2MHVA 3PO2H 2KHSA 2G9DA 3M3YB 1G91A 2NVXH 1NNXA 2EJFC 4B3SL 1EQQA 2RDHA 4KLKA 1SNPA 1LYLA 1S3OA 3F2UA 4DV7L 2OTLA 2CWPA 2NVYB 3KDFA 1TXYA 1HPCA 3PQIA 5CBEE 4LWCA 4K6DA 4M8AA 5IGDA 2R7ZG 1LTAD 1AEXA 1AH9A 4DR4Q 5IYCG 4HJ8A 1U4LA 2F0EA 1RL2A 3Q22A 3SR1A 5FKAC 3S14B 2ALYB 5FLMG 1JB7A 2VS1A 1KL9A 3I73A 4R1JA 3CCMA 4A3MB 1XMOQ 2K6AA 2TMPA 5BN5A 2IL8A 3ITPA 4JW0A 1EOVA 5JVH3 3GTPB 3KJPA 2B8FA 1J5EL 1HTLD 4J15A 1X55A 2K5HA 3IKJA 3W1GA 2A69D 2F0DA 2EDGA 4EX5A 4CKEA 3GTJH 1HH2P 2SEBD 4H0LC 4DR5L 1PH4A 1VQCA 1VF7A 4MNOA 2AMCB 2HHHL 4B3TL 5JPMC 5D3IB 1SE4A 4ZUJA 5E1FA 2IX3A 4LF6Q 1KD1C 3L0OA 4JI3Q 4FF3A 3KBGA 3HOYB 1TS3A 3DWPA 2ASBA 1KRSA 1M90C 1F9RA 1E7ZA 1K8GA 5C44B 4JBKA 1LTGD 1BUVT 4R4OA 3HOZG 3K7AH 2DY7A 4A3IB 1A15A 4LJZC 4DK0A 3NEMA 1TWHH 1VDZA 3RZOH 3CCJA 4A3FB 2RCFA 4DU9A 4UDUC 3CCEA 2NWGA 1HHVA 2HQEA 5FLXc 1FJGL 1GKHA 1I4GA 2EXDA 3PIOA 1VQLA 1ICFB 2WINB 2WAQB 5LHY1 5M3MH 1IKMA
chains in the Genus database with same CATH topology
4KHZA 1N36Q 1CSQA 5IWAL 1OTCA 1WJJA 3K0XA 5M5WH 1WFQA 1Q8KA 3WWVA 1VQKA 2PQAA 3PUYA 2R93G 5J3BA 4DAYB 3G48A 2Q2IA 4JC0A 5H1SE 4QQBX 2PNHA 3GTMH 2QA4A 4RMFA 3CXCA 5JEAG 4A3EH 1Z47A 2K14A 4POFA 2VUMG 4A3DH 2MFIA 4A3IH 1VQBA 3D0FA 4JI8Q 1NMGA 1HZ9A 1PH6A 1CKNA 4TVAB 3E9HA 1IBKL 3HOWH 3F1ZA 1VCIA 3I7FA 4HIKA 4BBSH 2IX1A 3S17H 4BY7H 2D0OA 3KJOA 4L5QA 2AHOB 5FJ8G 4L5SA 3CMEA 1W3SA 1D8LA 4KHPL 2VQEQ 2JQOA 1FJGQ 3KFUA 1PVOA 1YJNA 1HNZQ 3GTGH 1JJGA 2AWOA 1EFWA 4IPHA 5C0XJ 1H95A 1IBML 4X6AH 2N78A 1SR3A 5LMNL 3CC7A 1ASZA 1WI5A 3NELA 2KHJA 2MNAA 3CMAA 2RHSB 3PF5A 2A19A 5IYBG 3CCUA 5IWAQ 2E2JH 4RG1A 3OW2A 1Y1VG 1PH7A 2L15A 3HKSA 1U0LA 5LMNW 2GVAA 1GO3E 1VS0A 3EN2A 1VQ5A 5C3EH 2VL6A 3CPFA 3NENA 3S2DH 3RNUA 4YWMA 2VZAA 5IP9H 4A3KH 1B8AA 4IOAA 3U4ZA 3S2HH 2BA0A 4O0AA 1PV4A 1XJVA 4JOIA 4C3IH 4DAMA 5GQOA 4PZ7A 3GO5A 2JA8H 2UXDL 2JA9A 2WAQE 1I6HH 1SMXA 1KAWA 1VQ9A 2D0PA 2WFWA 5C4JH 2K5VA 4L5TA 4LNQA 4QIWE 1IBKQ 2Z6KA 1L1OB 1PHJA 4A3MG 3U4VA 4GOPB 1S40A 3I4MG 2IT1A 3U58A 5JJLA 1Q1BA 1LM0A 5C4XH 4YHHL 2A1AA 3LGJA 1V1QA 2OQ0A 1YVCA 4UY8C 3PO3G 4A3GH 4KHPQ 3KYHC 2K5NA 1IBLL 2CCZA 2F3IA 1AE2A 1L0WA 4C2MH 1JT8A 1AE3A 1IBMQ 5LMNQ 3M7NA 1Q7YC 1X3EA 2PQAB 2JEAI 4A3LG 1VQ6A 1TWAH 2PMZE 1YI2A 2UU9L 4OO1I 1VQDA 1G6PA 1NY4A 4OWTB 3FKIH 5M3FG 1VQHA 3H0GG 4GN5A 2B63H 3PUZA 3K81C 2E8GA 1E22A 4KI0A 1VQ7A 2UXCL 2EIFA 1UWVA 2UXDQ 4A93G 1Q81C 4R4TA 3T1HL 1VQNA 2BH8A 3F2DA 4DUYL 4A3JG 5AJ3L 4FDBA 4JI1L 1VQGA 1T9HA 1WYDA 2JE6I 1K83H 4YCWA 4JBWA 1VQFA 2OCEA 2R92H 3DLLA 3HOYG 3AEVA 3T1YL 2I5LX 3L2PA 4YHHQ 2JA7H 4GNXB 1A8VA 4NXNQ 1U5KA 3ULLA 3M85A 1YJWA 3BJUA 3A5UA 1EUJA 3CQZH 1VQPA 5C44G 1IBLQ 1SROA 2NZOA 1NBWA 4GLXA 3RN2A 2NN6I 4DV1L 4A3IG 2XGTA 2ATWA 2UUAL 1I50H 2K50A 4MTNA 4WJ3M 1E1TA 1XTDA 3CD6A 2XTIA 3K8AA 3PGZA 2UU9Q 1X65A 4A3FG 4BBSG 4LFBL 1BBUA 4BY7G 3ULJA 1QUQA 2IHFA 5BR8L 3S15H 1NJIC 1VQIA 2YTVA 4GLVB 3J81i 4OWXB 3J7A5 2UXCQ 4R4QA 3HOVG 4TQUS 4DV4L 2IX0A 2R7ZH 2AKWB 4P72A 3T1HQ 4LF4L 3S1NH 2UUBQ 3GTLH 3M4OH 5IYCH 1YNXA 4DUYQ 1N34L 1SN8A 3M4QA 5AJ3Q 3Q8DA 4JI0L 4JI1Q 1PH5A 1PYBA 4DV2L 1K3RA 2R6GA 3AFQA 3CCVA 2JK8A 2ES2A 5FLMH 3T1YQ 2AWNA 5EAYA 3HOXH 5E7NA 3PUVA 1UEBA 1UE6A 1E1OA 4LF5L 5IYDH 2K4KA 4JYAL 3CW2C 1PFSA 4IJLA 3F2BA 3PSIA 4BA1I 1XMQQ 4R4IA 3TREA 2JA8G 4DV1Q 3GTOH 2UUAQ 3M4PA 3SGIA 1HR0L 4IJHA 1XNRL 1MKHA 1YZ6A 3A74A 4LFBQ 4YWKA 3STBD 4DV5L 4AQYL 1TWGH 5GROA 1HR0W 1FL0A 5M3MH 5BR8Q 3KF6A 5DLQE 4OONA 4PG3A 5C4XG 1G51A 1W2BA 4B3ML 3G71A 3HOUH 4A3GG 1PH2A 3ICEA 4DV4Q 5HGQA 4IOCA 4LF4Q 4A3BH 1K0RA 2K52A 4EQ5A 4LUOA 1N8RC 1N34Q 4C3HH 4YY3L 4JI0Q 4GKJL 1JJCB 1IZ6A 4APVA 1K8AC 1CSPA 3EIVA 1OXVA 1EIYB 4DV2Q 1QVFA 1QVGA 4IFDI 1C9OA 4YCVA 1R9TH 2C35B 3FKIG 5IP7G 1IXRA 4JI2L 2DUDA 4LF5Q 3RZDH 4AIMA 2R7FA 4JYAQ 4B3RL 2E5LL 2HT1A 1V43A 4DV3L 1X9NA 5JEAJ 1N32L 3GTKH 2Z0SA 1DGSA 3G6EA 1L1OC 3J80i 4JI5L 3W1BA 1NE3A 3GDEA 1GD7A 3A5ZB 4OXPA 4DR1L 4GOPC 5C0XI 1N9WA 1HR0Q 5HY6A 1CKOA 3HOZH 4BY1H 1XNRQ 3TQYA 1QUQB 2VY3A 2ZTDA 3HFZB 4DV5Q 4AQYQ 2JA5G 3RLOA 3CAMA 2E2IH 1E3PA 1MJCA 1TWFH 2IHEA 5IE8A 2ID0A 4B3MQ 2YV5A 3PV0A 2JA7G 4OO1G 4DUZL 2Y0SE 4DK6C 1A0IA 3PUWA 1YHAA 1QVCA 3I4NH 2ZJPA 4BBRH 1Q82C 4BXXH 4A3CH 2H5XA 4JI7L 4JI6L 4YY3Q 4GKJQ 1Q1EA 1YJ9A 2JA6G 1WCMG 1A62A 3UDXA 1JMCA 1A63A 3EBEA 2UUCL 4IPCA 4LF7L 5JJIA 4JI2Q 2R93H 2ZJRA 1V9PA 4NB3A 1Q86C 4JG2A 2ZTCA 4NXML 4MZ9A 1S72A 4B3RQ 2E5LQ 2OTJA 4DV3Q 4ALPA 4AH6A 1N32Q 1XPOA 1Y1WH 4OWWB 4JI5Q 4DR1Q 2KCMA 1K73C 1UE1A 2KBNA 3TRZA 5IT9c 3S1QH 4A4IA 4GNXC 1EQRA 2NN6G 3KF6B 1FVIA 1CKNB 1E24A 3TEHB 2BA1A 1HZCA 5M5XH 2E2HH 1L2FA 3E0EA 5M3MG 5FJ8H 3ER0A 3M3YH 1VQJA 2ZJQA 3J81c 3UDFA 4DUZQ 4YCUA 5IYDG 4GKKL 1VQOA 1GM5A 4BA2I 1EIFA 1X56A 1ASYA 4LFAL 3RR5A 2VQFL 1SLJA 1KHIA 4JI6Q 5IYBH 2WB1E 4L5RC 2UXBL 4GN4B 1HZAA 1Y1VH 4A3EG 4A3DG 4LF8L 4PZ8A 2UUCQ 1YEZA 1Y14B 4LUVA 3STBC 3J7ZC 4LF7Q 1OXXK 2EQSA 1BBWA 3D31A 4NXMQ 3GD7A 2GVBA 3DM3A 3JC66 3UE1A 3PIPA 3HOUG 3HOWG 1J6QA 3F8TA 3PUXA 1PH3A 3KF8B 1MIUA 5IY0A 4A3BG 3CC2A 2I5MX 5GAGC 2MO0A 2YTYA 1X3FA 2NZHA 1N33L 1O7IA 2RF4A 2ZM6L 4HJAA 4GN3B 3S14H 4K0KL 3CPWA 2BH2A 1C0AA 4JBJA 1XPUA 1PH1A 4P71A 4A3MH 2WP8J 4Y7NH 4UP9A 2Y0SG 3AQQA 3E9IA 3RLFA 1X6OA 2OQKA 2RCNA 4GKKQ 3PO3H 3CCSA 2OWOA 4LFAQ 1EYGA 1NTGA 1HNXL 5C3EG 2JJQA 2PI2A 4JI4L 4UPAA 1XNQL 2N49A 2VQFQ 4DR2L 5IP9G 4DR3L 4A3KG 1XPRA 2I0QA 1KIXA 3GTPH 4LW1A 3I4OA 3S1RH 2UXBQ 3VDYA 2K75A 1OXSC 4BY1G 3UE0A 4LF8Q 4DV6L 4LUZA 2QGQA 1KC8C 2V1CC 4H02A 1WOCA 3BU2A 3H0GH 3TS0A 1JJ2A 4IFDG 4JV5L 3HKZE 1L1OA 1YITA 2KENA 4QJFA 2IY5B 1X3GA 4GOPA 4P75A 3J80c 1I94L 3I4NG 2NVTH 1SE8A 3ERSX 4BBRG 4A3CG 4NPSA 3RLNA 4OX9L 4AYBE 1IYJB 3OTOL 4A3JH 2ZM6Q 4LF9L 1N33Q 3UDIA 1TWCH 4DR6L 4K0KQ 4WJ4A 3M9BA 3CC4A 5C0XG 4XIGS 3HOYH 2DGYA 1LUZA 3JAMi 2A8VA 3TS2A 1PYSB 5M5YH 4O2DA 4PZ6A 3PCOB 1VQMA 2ZTEA 3PF4A 4JBMA 4P74A 3MXNB 4DR7L 2Q2HA 3I2ZA 1PH8A 5C44H 1HNXQ 4GLAC 4JI4Q 1XNQQ 2F4VL 2CQOA 3MEFA 3I55A 4DR2Q 4DR3Q 2D62A 2WB1G 4YWLA 3S24A 1Y1WG 4HIOA 4DKAC 2B63G 5K36G 2CFMA 4IFDJ 1FGUA 4UP7A 4DV6Q 4A3FH 2YU9H 2RHQB 4IPGA 4X66L 5ELNA 5LMUL 1QZGA 1C7YA 3IRBA 1QZHA 4XTCS 2NVQH 4DV0L 4DR4L 4JV5Q 1KQSA 1I5FA 1P16A 4HIDA 1I94Q 2R92G 2I5HA 3HOVH 2GN5A 1RIPA 1HNWL 4GNXA 1D7QA 3AYHB 4OX9Q 1VQEA 3OTOQ 2KCTA 1XMOL 4LF9Q 1BKBA 3BZCA 4GS3A 3PO2H 4DR6Q 2NVXH 1YIJA 4B3SL 4JCVE 3ZJYC 3I56A 1EQQA 4POGA 3K80C 2LSSA 4KLKA 3A0JA 3CCRA 3L7ZC 2F52A 2JEBI 4DR7Q 1LYLA 4X64L 1S3OA 2YYZA 2B29A 4IPDA 3S1MH 4DV7L 2OTLA 2CWPA 2F4VQ 2QEXA 3KDFA 1YBYA 1TXYA 1KRTA 3OYYA 3H3VI 1B70B 5ELOA 2FXQA 4LWCA 4ME3A 2VUMH 1PA6A 1LTLA 3S16H 2R7ZG 4X66Q 1OXUA 2R7DA 5LMUQ 3HKZG 1AH9A 4DR4Q 1YHBA 1X54A 5IYCG 4DV0Q 1VQ8A 2KHIA 4HJ8A 1HZBA 1RL2A 4NXNL 4Y52H 3H15A 3AFPA 4LF6L 4AYBG 1HNWQ 2ALYB 5FLMG 4JI3L 2VS1A 1JB7A 3HOXG 1KL9A 1B7YB 2N3SA 4R1JA 3CCMA 1XMOQ 1YHQA 4A75A 1SFOH 1UE7A 2Q2UA 1Q46A 4B3SQ 3H3VH 4HJ9A 4X65L 4X62L 4JI7Q 1EOVA 4JOIC 3U50C 2VW9A 5GAHC 2YTXA 1EWIA 5IP7H 2HIVA 2NVYH 3KJPA 1Z9FA 4A76A 4X64Q 1J5EL 4DV7Q 1CKMA 1Q12A 1I3QH 4J15A 5JJKA 1JE5A 1X55A 2K5HA 3W1GA 2N8NA 4EX5A 5GADC 1BVSA 1HJPA 2Z6KC 3GTJH 3GTQH 2UUBL 1HH2P 3KOJA 4QL5A 4LFCL 4DR5L 1MJEA 1PH4A 3K7UC 1UE5A 2MO1A 1CUKA 1GVPA 4UP8A 4HJ7A 2JA5H 3ULPA 3KLWA 1VQCA 4DNIA 4MNOA 4P73A 2AMCB 3B6YA 1VQ4A 2HHHL 2PI2E 3BZKA 3CCLA 4B3TL 1M1KC 3CCQA 1N36L 2LXKA 2CKZB 1KXLA 4LF6Q 1XMQL 3I4MH 2VNUD 1KD1C 3L0OA 3CP0A 4JI3Q 2LXJA 4R4CA 4PMWA 1PH9A 1P8LA 2ASBA 1OXTA 1KRSA 1M90C 2JA6H 1WCMH 1E7ZA 2HIXA 3RN5A 1K9MC 3JAMc 3F2CA 4X65Q 4X62Q 3NBHB 1K8GA 4IO9A 4JBKA 3FHWA 4R4OA 2MQHA 3HOZG 3G4SA 3K7AH 3KDFB 4JI8L 4DK3C 4A3LH 3FP9A 1J5EQ 2CWAA 4DPGA 2WAQG 4HJ5A 3CF5A 4HIMA 3NEMA 1TWHH 3RZOH 3CCJA 1SRUA 5M3FH 3W5OA 4QGUA 2HQLA 4DR5Q 4LFCQ 3CCEA 1IL2A 1G291 3PO2G 2VQEL 1VQAA 5FLXc 1FJGL 1GKHA 2EXDA 3PIOA 3J81j 1HNZL 1VQLA 4A93H 5GAEC 2B3GA 3UDGA 4BXXG 2Q2TA 4C3JH 4QY7A 2HHHQ 1NMFA 4B3TQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ A;  1N36 Q;  1CSQ A;  5IWA L;  1OTC A;  1WJJ A;  3K0X A;  5M5W H;  1WFQ A;  1Q8K A;  3WWV A;  1VQK A;  2PQA A;  3PUY A;  2R93 G;  5J3B A;  4DAY B;  3G48 A;  2Q2I A;  4JC0 A;  5H1S E;  4QQB X;  2PNH A;  3GTM H;  2QA4 A;  4RMF A;  3CXC A;  5JEA G;  4A3E H;  1Z47 A;  2K14 A;  4POF A;  2VUM G;  4A3D H;  2MFI A;  4A3I H;  1VQB A;  3D0F A;  4JI8 Q;  1NMG A;  1HZ9 A;  1PH6 A;  1CKN A;  4TVA B;  3E9H A;  1IBK L;  3HOW H;  3F1Z A;  1VCI A;  3I7F A;  4HIK A;  4BBS H;  2IX1 A;  3S17 H;  4BY7 H;  2D0O A;  3KJO A;  4L5Q A;  2AHO B;  5FJ8 G;  4L5S A;  3CME A;  1W3S A;  1D8L A;  4KHP L;  2VQE Q;  2JQO A;  1FJG Q;  3KFU A;  1PVO A;  1YJN A;  1HNZ Q;  3GTG H;  1JJG A;  2AWO A;  1EFW A;  4IPH A;  5C0X J;  1H95 A;  1IBM L;  4X6A H;  2N78 A;  1SR3 A;  5LMN L;  3CC7 A;  1ASZ A;  1WI5 A;  3NEL A;  2KHJ A;  2MNA A;  3CMA A;  2RHS B;  3PF5 A;  2A19 A;  5IYB G;  3CCU A;  5IWA Q;  2E2J H;  4RG1 A;  3OW2 A;  1Y1V G;  1PH7 A;  2L15 A;  3HKS A;  1U0L A;  5LMN W;  2GVA A;  1GO3 E;  1VS0 A;  3EN2 A;  1VQ5 A;  5C3E H;  2VL6 A;  3CPF A;  3NEN A;  3S2D H;  3RNU A;  4YWM A;  2VZA A;  5IP9 H;  4A3K H;  1B8A A;  4IOA A;  3U4Z A;  3S2H H;  2BA0 A;  4O0A A;  1PV4 A;  1XJV A;  4JOI A;  4C3I H;  4DAM A;  5GQO A;  4PZ7 A;  3GO5 A;  2JA8 H;  2UXD L;  2JA9 A;  2WAQ E;  1I6H H;  1SMX A;  1KAW A;  1VQ9 A;  2D0P A;  2WFW A;  5C4J H;  2K5V A;  4L5T A;  4LNQ A;  4QIW E;  1IBK Q;  2Z6K A;  1L1O B;  1PHJ A;  4A3M G;  3U4V A;  4GOP B;  1S40 A;  3I4M G;  2IT1 A;  3U58 A;  5JJL A;  1Q1B A;  1LM0 A;  5C4X H;  4YHH L;  2A1A A;  3LGJ A;  1V1Q A;  2OQ0 A;  1YVC A;  4UY8 C;  3PO3 G;  4A3G H;  4KHP Q;  3KYH C;  2K5N A;  1IBL L;  2CCZ A;  2F3I A;  1AE2 A;  1L0W A;  4C2M H;  1JT8 A;  1AE3 A;  1IBM Q;  5LMN Q;  3M7N A;  1Q7Y C;  1X3E A;  2PQA B;  2JEA I;  4A3L G;  1VQ6 A;  1TWA H;  2PMZ E;  1YI2 A;  2UU9 L;  4OO1 I;  1VQD A;  1G6P A;  1NY4 A;  4OWT B;  3FKI H;  5M3F G;  1VQH A;  3H0G G;  4GN5 A;  2B63 H;  3PUZ A;  3K81 C;  2E8G A;  1E22 A;  4KI0 A;  1VQ7 A;  2UXC L;  2EIF A;  1UWV A;  2UXD Q;  4A93 G;  1Q81 C;  4R4T A;  3T1H L;  1VQN A;  2BH8 A;  3F2D A;  4DUY L;  4A3J G;  5AJ3 L;  4FDB A;  4JI1 L;  1VQG A;  1T9H A;  1WYD A;  2JE6 I;  1K83 H;  4YCW A;  4JBW A;  1VQF A;  2OCE A;  2R92 H;  3DLL A;  3HOY G;  3AEV A;  3T1Y L;  2I5L X;  3L2P A;  4YHH Q;  2JA7 H;  4GNX B;  1A8V A;  4NXN Q;  1U5K A;  3ULL A;  3M85 A;  1YJW A;  3BJU A;  3A5U A;  1EUJ A;  3CQZ H;  1VQP A;  5C44 G;  1IBL Q;  1SRO A;  2NZO A;  1NBW A;  4GLX A;  3RN2 A;  2NN6 I;  4DV1 L;  4A3I G;  2XGT A;  2ATW A;  2UUA L;  1I50 H;  2K50 A;  4MTN A;  4WJ3 M;  1E1T A;  1XTD A;  3CD6 A;  2XTI A;  3K8A A;  3PGZ A;  2UU9 Q;  1X65 A;  4A3F G;  4BBS G;  4LFB L;  1BBU A;  4BY7 G;  3ULJ A;  1QUQ A;  2IHF A;  5BR8 L;  3S15 H;  1NJI C;  1VQI A;  2YTV A;  4GLV B;  3J81 i;  4OWX B;  3J7A 5;  2UXC Q;  4R4Q A;  3HOV G;  4TQU S;  4DV4 L;  2IX0 A;  2R7Z H;  2AKW B;  4P72 A;  3T1H Q;  4LF4 L;  3S1N H;  2UUB Q;  3GTL H;  3M4O H;  5IYC H;  1YNX A;  4DUY Q;  1N34 L;  1SN8 A;  3M4Q A;  5AJ3 Q;  3Q8D A;  4JI0 L;  4JI1 Q;  1PH5 A;  1PYB A;  4DV2 L;  1K3R A;  2R6G A;  3AFQ A;  3CCV A;  2JK8 A;  2ES2 A;  5FLM H;  3T1Y Q;  2AWN A;  5EAY A;  3HOX H;  5E7N A;  3PUV A;  1UEB A;  1UE6 A;  1E1O A;  4LF5 L;  5IYD H;  2K4K A;  4JYA L;  3CW2 C;  1PFS A;  4IJL A;  3F2B A;  3PSI A;  4BA1 I;  1XMQ Q;  4R4I A;  3TRE A;  2JA8 G;  4DV1 Q;  3GTO H;  2UUA Q;  3M4P A;  3SGI A;  1HR0 L;  4IJH A;  1XNR L;  1MKH A;  1YZ6 A;  3A74 A;  4LFB Q;  4YWK A;  3STB D;  4DV5 L;  4AQY L;  1TWG H;  5GRO A;  1HR0 W;  1FL0 A;  5M3M H;  5BR8 Q;  3KF6 A;  5DLQ E;  4OON A;  4PG3 A;  5C4X G;  1G51 A;  1W2B A;  4B3M L;  3G71 A;  3HOU H;  4A3G G;  1PH2 A;  3ICE A;  4DV4 Q;  5HGQ A;  4IOC A;  4LF4 Q;  4A3B H;  1K0R A;  2K52 A;  4EQ5 A;  4LUO A;  1N8R C;  1N34 Q;  4C3H H;  4YY3 L;  4JI0 Q;  4GKJ L;  1JJC B;  1IZ6 A;  4APV A;  1K8A C;  1CSP A;  3EIV A;  1OXV A;  1EIY B;  4DV2 Q;  1QVF A;  1QVG A;  4IFD I;  1C9O A;  4YCV A;  1R9T H;  2C35 B;  3FKI G;  5IP7 G;  1IXR A;  4JI2 L;  2DUD A;  4LF5 Q;  3RZD H;  4AIM A;  2R7F A;  4JYA Q;  4B3R L;  2E5L L;  2HT1 A;  1V43 A;  4DV3 L;  1X9N A;  5JEA J;  1N32 L;  3GTK H;  2Z0S A;  1DGS A;  3G6E A;  1L1O C;  3J80 i;  4JI5 L;  3W1B A;  1NE3 A;  3GDE A;  1GD7 A;  3A5Z B;  4OXP A;  4DR1 L;  4GOP C;  5C0X I;  1N9W A;  1HR0 Q;  5HY6 A;  1CKO A;  3HOZ H;  4BY1 H;  1XNR Q;  3TQY A;  1QUQ B;  2VY3 A;  2ZTD A;  3HFZ B;  4DV5 Q;  4AQY Q;  2JA5 G;  3RLO A;  3CAM A;  2E2I H;  1E3P A;  1MJC A;  1TWF H;  2IHE A;  5IE8 A;  2ID0 A;  4B3M Q;  2YV5 A;  3PV0 A;  2JA7 G;  4OO1 G;  4DUZ L;  2Y0S E;  4DK6 C;  1A0I A;  3PUW A;  1YHA A;  1QVC A;  3I4N H;  2ZJP A;  4BBR H;  1Q82 C;  4BXX H;  4A3C H;  2H5X A;  4JI7 L;  4JI6 L;  4YY3 Q;  4GKJ Q;  1Q1E A;  1YJ9 A;  2JA6 G;  1WCM G;  1A62 A;  3UDX A;  1JMC A;  1A63 A;  3EBE A;  2UUC L;  4IPC A;  4LF7 L;  5JJI A;  4JI2 Q;  2R93 H;  2ZJR A;  1V9P A;  4NB3 A;  1Q86 C;  4JG2 A;  2ZTC A;  4NXM L;  4MZ9 A;  1S72 A;  4B3R Q;  2E5L Q;  2OTJ A;  4DV3 Q;  4ALP A;  4AH6 A;  1N32 Q;  1XPO A;  1Y1W H;  4OWW B;  4JI5 Q;  4DR1 Q;  2KCM A;  1K73 C;  1UE1 A;  2KBN A;  3TRZ A;  5IT9 c;  3S1Q H;  4A4I A;  4GNX C;  1EQR A;  2NN6 G;  3KF6 B;  1FVI A;  1CKN B;  1E24 A;  3TEH B;  2BA1 A;  1HZC A;  5M5X H;  2E2H H;  1L2F A;  3E0E A;  5M3M G;  5FJ8 H;  3ER0 A;  3M3Y H;  1VQJ A;  2ZJQ A;  3J81 c;  3UDF A;  4DUZ Q;  4YCU A;  5IYD G;  4GKK L;  1VQO A;  1GM5 A;  4BA2 I;  1EIF A;  1X56 A;  1ASY A;  4LFA L;  3RR5 A;  2VQF L;  1SLJ A;  1KHI A;  4JI6 Q;  5IYB H;  2WB1 E;  4L5R C;  2UXB L;  4GN4 B;  1HZA A;  1Y1V H;  4A3E G;  4A3D G;  4LF8 L;  4PZ8 A;  2UUC Q;  1YEZ A;  1Y14 B;  4LUV A;  3STB C;  3J7Z C;  4LF7 Q;  1OXX K;  2EQS A;  1BBW A;  3D31 A;  4NXM Q;  3GD7 A;  2GVB A;  3DM3 A;  3JC6 6;  3UE1 A;  3PIP A;  3HOU G;  3HOW G;  1J6Q A;  3F8T A;  3PUX A;  1PH3 A;  3KF8 B;  1MIU A;  5IY0 A;  4A3B G;  3CC2 A;  2I5M X;  5GAG C;  2MO0 A;  2YTY A;  1X3F A;  2NZH A;  1N33 L;  1O7I A;  2RF4 A;  2ZM6 L;  4HJA A;  4GN3 B;  3S14 H;  4K0K L;  3CPW A;  2BH2 A;  1C0A A;  4JBJ A;  1XPU A;  1PH1 A;  4P71 A;  4A3M H;  2WP8 J;  4Y7N H;  4UP9 A;  2Y0S G;  3AQQ A;  3E9I A;  3RLF A;  1X6O A;  2OQK A;  2RCN A;  4GKK Q;  3PO3 H;  3CCS A;  2OWO A;  4LFA Q;  1EYG A;  1NTG A;  1HNX L;  5C3E G;  2JJQ A;  2PI2 A;  4JI4 L;  4UPA A;  1XNQ L;  2N49 A;  2VQF Q;  4DR2 L;  5IP9 G;  4DR3 L;  4A3K G;  1XPR A;  2I0Q A;  1KIX A;  3GTP H;  4LW1 A;  3I4O A;  3S1R H;  2UXB Q;  3VDY A;  2K75 A;  1OXS C;  4BY1 G;  3UE0 A;  4LF8 Q;  4DV6 L;  4LUZ A;  2QGQ A;  1KC8 C;  2V1C C;  4H02 A;  1WOC A;  3BU2 A;  3H0G H;  3TS0 A;  1JJ2 A;  4IFD G;  4JV5 L;  3HKZ E;  1L1O A;  1YIT A;  2KEN A;  4QJF A;  2IY5 B;  1X3G A;  4GOP A;  4P75 A;  3J80 c;  1I94 L;  3I4N G;  2NVT H;  1SE8 A;  3ERS X;  4BBR G;  4A3C G;  4NPS A;  3RLN A;  4OX9 L;  4AYB E;  1IYJ B;  3OTO L;  4A3J H;  2ZM6 Q;  4LF9 L;  1N33 Q;  3UDI A;  1TWC H;  4DR6 L;  4K0K Q;  4WJ4 A;  3M9B A;  3CC4 A;  5C0X G;  4XIG S;  3HOY H;  2DGY A;  1LUZ A;  3JAM i;  2A8V A;  3TS2 A;  1PYS B;  5M5Y H;  4O2D A;  4PZ6 A;  3PCO B;  1VQM A;  2ZTE A;  3PF4 A;  4JBM A;  4P74 A;  3MXN B;  4DR7 L;  2Q2H A;  3I2Z A;  1PH8 A;  5C44 H;  1HNX Q;  4GLA C;  4JI4 Q;  1XNQ Q;  2F4V L;  2CQO A;  3MEF A;  3I55 A;  4DR2 Q;  4DR3 Q;  2D62 A;  2WB1 G;  4YWL A;  3S24 A;  1Y1W G;  4HIO A;  4DKA C;  2B63 G;  5K36 G;  2CFM A;  4IFD J;  1FGU A;  4UP7 A;  4DV6 Q;  4A3F H;  2YU9 H;  2RHQ B;  4IPG A;  4X66 L;  5ELN A;  5LMU L;  1QZG A;  1C7Y A;  3IRB A;  1QZH A;  4XTC S;  2NVQ H;  4DV0 L;  4DR4 L;  4JV5 Q;  1KQS A;  1I5F A;  1P16 A;  4HID A;  1I94 Q;  2R92 G;  2I5H A;  3HOV H;  2GN5 A;  1RIP A;  1HNW L;  4GNX A;  1D7Q A;  3AYH B;  4OX9 Q;  1VQE A;  3OTO Q;  2KCT A;  1XMO L;  4LF9 Q;  1BKB A;  3BZC A;  4GS3 A;  3PO2 H;  4DR6 Q;  2NVX H;  1YIJ A;  4B3S L;  4JCV E;  3ZJY C;  3I56 A;  1EQQ A;  4POG A;  3K80 C;  2LSS A;  4KLK A;  3A0J A;  3CCR A;  3L7Z C;  2F52 A;  2JEB I;  4DR7 Q;  1LYL A;  4X64 L;  1S3O A;  2YYZ A;  2B29 A;  4IPD A;  3S1M H;  4DV7 L;  2OTL A;  2CWP A;  2F4V Q;  2QEX A;  3KDF A;  1YBY A;  1TXY A;  1KRT A;  3OYY A;  3H3V I;  1B70 B;  5ELO A;  2FXQ A;  4LWC A;  4ME3 A;  2VUM H;  1PA6 A;  1LTL A;  3S16 H;  2R7Z G;  4X66 Q;  1OXU A;  2R7D A;  5LMU Q;  3HKZ G;  1AH9 A;  4DR4 Q;  1YHB A;  1X54 A;  5IYC G;  4DV0 Q;  1VQ8 A;  2KHI A;  4HJ8 A;  1HZB A;  1RL2 A;  4NXN L;  4Y52 H;  3H15 A;  3AFP A;  4LF6 L;  4AYB G;  1HNW Q;  2ALY B;  5FLM G;  4JI3 L;  2VS1 A;  1JB7 A;  3HOX G;  1KL9 A;  1B7Y B;  2N3S A;  4R1J A;  3CCM A;  1XMO Q;  1YHQ A;  4A75 A;  1SFO H;  1UE7 A;  2Q2U A;  1Q46 A;  4B3S Q;  3H3V H;  4HJ9 A;  4X65 L;  4X62 L;  4JI7 Q;  1EOV A;  4JOI C;  3U50 C;  2VW9 A;  5GAH C;  2YTX A;  1EWI A;  5IP7 H;  2HIV A;  2NVY H;  3KJP A;  1Z9F A;  4A76 A;  4X64 Q;  1J5E L;  4DV7 Q;  1CKM A;  1Q12 A;  1I3Q H;  4J15 A;  5JJK A;  1JE5 A;  1X55 A;  2K5H A;  3W1G A;  2N8N A;  4EX5 A;  5GAD C;  1BVS A;  1HJP A;  2Z6K C;  3GTJ H;  3GTQ H;  2UUB L;  1HH2 P;  3KOJ A;  4QL5 A;  4LFC L;  4DR5 L;  1MJE A;  1PH4 A;  3K7U C;  1UE5 A;  2MO1 A;  1CUK A;  1GVP A;  4UP8 A;  4HJ7 A;  2JA5 H;  3ULP A;  3KLW A;  1VQC A;  4DNI A;  4MNO A;  4P73 A;  2AMC B;  3B6Y A;  1VQ4 A;  2HHH L;  2PI2 E;  3BZK A;  3CCL A;  4B3T L;  1M1K C;  3CCQ A;  1N36 L;  2LXK A;  2CKZ B;  1KXL A;  4LF6 Q;  1XMQ L;  3I4M H;  2VNU D;  1KD1 C;  3L0O A;  3CP0 A;  4JI3 Q;  2LXJ A;  4R4C A;  4PMW A;  1PH9 A;  1P8L A;  2ASB A;  1OXT A;  1KRS A;  1M90 C;  2JA6 H;  1WCM H;  1E7Z A;  2HIX A;  3RN5 A;  1K9M C;  3JAM c;  3F2C A;  4X65 Q;  4X62 Q;  3NBH B;  1K8G A;  4IO9 A;  4JBK A;  3FHW A;  4R4O A;  2MQH A;  3HOZ G;  3G4S A;  3K7A H;  3KDF B;  4JI8 L;  4DK3 C;  4A3L H;  3FP9 A;  1J5E Q;  2CWA A;  4DPG A;  2WAQ G;  4HJ5 A;  3CF5 A;  4HIM A;  3NEM A;  1TWH H;  3RZO H;  3CCJ A;  1SRU A;  5M3F H;  3W5O A;  4QGU A;  2HQL A;  4DR5 Q;  4LFC Q;  3CCE A;  1IL2 A;  1G29 1;  3PO2 G;  2VQE L;  1VQA A;  5FLX c;  1FJG L;  1GKH A;  2EXD A;  3PIO A;  3J81 j;  1HNZ L;  1VQL A;  4A93 H;  5GAE C;  2B3G A;  3UDG A;  4BXX G;  2Q2T A;  4C3J H;  4QY7 A;  2HHH Q;  1NMF A;  4B3T Q; 
#chains in the Genus database with same CATH topology
 1N36 Q;  3A8K E;  4ZAI A;  1OTC A;  2F0Q A;  5M5W H;  1WFQ A;  1VQK A;  2PQA A;  4R8N A;  2R93 G;  4DAY B;  3G48 A;  5ELE A;  1KLG D;  2PNH A;  4JVZ A;  5JEA G;  1I4R A;  2EZV A;  4KJN A;  2F0O A;  3V2T A;  1NMG A;  1PH6 A;  1FNU A;  1V1O A;  1IBK L;  3F1Z A;  4HIK A;  3JAM E;  5JVG 3;  2IX1 A;  3S17 H;  3E6Z X;  2VUM B;  5FJ8 G;  3S16 B;  3CME A;  1W3S A;  3CHB D;  1SBB B;  1YJN A;  5I9P A;  1O7L A;  4RGN A;  5DEH A;  4X6A H;  2N78 A;  1ASZ A;  1STY A;  3MXP A;  3NEL A;  2RHS B;  3PF5 A;  4R9W A;  2PQE A;  4FYD A;  4RG1 A;  3VYU A;  2MP1 A;  1U0L A;  1BNZ A;  1GO3 E;  3VYR A;  1SFO B;  2A6E D;  5IGG A;  3G6J B;  3S2D H;  5IP9 H;  2VZA A;  3U4Z A;  3S2H H;  4RFB A;  3Q0A A;  2EY5 A;  4C3I H;  4DAM A;  5CYU A;  5GQO A;  2UXD L;  4U67 3;  1I6H H;  2M9V A;  1KAW A;  1VQ9 A;  2DNE A;  4RGO S;  2K5V A;  3E5S A;  3UI2 A;  2K5W A;  4A3M G;  4B9X A;  5JJL A;  4K5X A;  2CH4 A;  2JA5 B;  1LM0 A;  2V4D A;  1V1Q A;  2K5N A;  1IBL L;  3BZD B;  1AE2 A;  1AE3 A;  1IBM Q;  3HRZ C;  3I4M B;  2JEA I;  4XYO A;  5EKL A;  5COY A;  1TWA H;  3Q6S A;  3J80 L;  1WCM B;  1NY4 A;  2SDF A;  1EOT A;  4H13 C;  1EZ6 A;  3TZU A;  3KLS X;  2UXC L;  2EIF A;  4XDX A;  1Q90 A;  2X6G A;  4A93 G;  2O4X A;  3F2D A;  1G8Z D;  4JI1 L;  1WYD A;  1O80 A;  4IUN A;  4JBW A;  2OCE A;  3HOY G;  4DXG A;  1NSN S;  3NHH A;  4GNX B;  1A8V A;  3ULL A;  1S5B D;  4C3J B;  2D5D A;  3A5U A;  2F0S A;  1EUJ A;  5ELC A;  5C4Z A;  5C44 G;  1SYC A;  1BCP D;  4A3I G;  5I6W A;  4DV1 L;  1ESR A;  1OO9 B;  2GA4 B;  3A7A B;  3K8A A;  5KRU A;  2UU9 Q;  1X65 A;  2K5D A;  3HP3 A;  4A3F G;  3GQB A;  3VR3 A;  4BBS G;  1BBU A;  4LFB L;  1SDF A;  3ULJ A;  2A6H D;  2IHF A;  3S15 H;  1NJI C;  1WTV A;  2A74 C;  4DNR B;  4ZLT F;  3J81 i;  1TQO A;  1SYF A;  2R7Z H;  3S1N H;  3HOU B;  3BS1 A;  3T1H Q;  4LF4 L;  3HOW B;  5FO9 B;  4EQP A;  5IYC H;  1YNX A;  1DOL A;  1MGS A;  3Q8D A;  1PH5 A;  5D14 A;  1EY8 A;  3CCV A;  2JK8 A;  5FLM H;  2A6E C;  2TSS A;  3T1Y Q;  1QE6 A;  5E7N A;  1E1O A;  3TP5 A;  4LF5 L;  5IYD H;  3TDQ A;  1TY2 A;  2BE5 C;  4RWS C;  1TS4 A;  4JYA L;  4PNY A;  3CW2 C;  3F2B A;  4BA1 I;  3RZD B;  4ZKB B;  1PDQ A;  3GTO H;  2UUA Q;  2F0M A;  3SGI A;  3PIO 3;  4A3K B;  4IJH A;  4YWK A;  3STB D;  2PW7 A;  2HDM A;  1FL0 A;  1H9S A;  5BR8 Q;  1Q8I A;  1G51 A;  1X3Q A;  1STB A;  1PH2 A;  4IOC A;  1WVL A;  1K0R A;  4C1N I;  4LUO A;  3ZYY X;  1N34 Q;  4GKJ L;  2LKV A;  1JB3 A;  1JJC B;  1A3T A;  1PXU A;  1CSP A;  1OXV A;  2A68 C;  1RCV D;  4IFD I;  4YCV A;  4IUR A;  2C35 B;  2K5Q A;  3VA5 A;  5HGT A;  4C2M B;  1DOM A;  4I7Z C;  1S5C D;  2R7F A;  1S5E D;  4DGZ A;  1NR2 A;  2RQX A;  2E5L L;  2HT1 A;  4DV3 L;  2JP1 A;  4QCL A;  3GTK H;  5M9O A;  2Z0S A;  1YNJ C;  4JI5 L;  1NE3 A;  3GDE A;  5C0X I;  3HOZ H;  1XNR Q;  2ZTD A;  2VY3 A;  2F0I A;  2JA5 G;  3P1H A;  2XVS A;  2E2I H;  4FO2 A;  2IHE A;  1SXT A;  4OO1 G;  4DUZ L;  3D6W A;  5EQ0 A;  1ILQ A;  1A0I A;  4DK6 C;  5ELB A;  4XQQ A;  3TME A;  5IOC A;  3K59 A;  2JXM B;  4A3C H;  1WCM G;  1A62 A;  3UDX A;  2JA7 B;  4OIK A;  5KIX A;  5C0X H;  3EBE A;  2F0U A;  4IPC A;  1EYC A;  4LF7 L;  3CQZ B;  5JJI A;  2ICE C;  2ZJR A;  2R93 H;  3NPP A;  4NB3 A;  3SK5 A;  1Q86 C;  4JG2 A;  2ZTC A;  2OTJ A;  3RUZ A;  1BCP B;  1XPO A;  4OWW B;  1D5X C;  3OMC A;  3ND8 A;  3S1Q H;  3P7J A;  2H4O A;  1EEI D;  4C3J G;  4NMZ A;  5FJ8 H;  3M3Y H;  1VQJ A;  3J81 c;  3HKZ B;  1EY9 A;  2MGS A;  1QIL A;  1X56 A;  2B2T C;  3RR5 A;  1DD2 A;  2VQF L;  4AYB B;  4G7O C;  3HOX B;  3V05 A;  5TSS A;  1YEZ A;  1Y14 B;  2Q8I B;  4LUV A;  3STB C;  1WTQ A;  3RD4 A;  1T5E A;  1BBW A;  2RDF A;  4NXM Q;  3HOU G;  3DM3 A;  3PIP A;  3HOW G;  1GHJ A;  3CRK C;  4FF1 A;  1PH3 A;  1MIU A;  2I5M X;  2YTY A;  1EEF D;  3S14 H;  1C0A A;  1RD9 D;  1LT3 D;  4JBJ A;  4A3M H;  1DOK A;  1LT4 D;  2XNA C;  3ERQ A;  1HFG A;  1X6O A;  2OQK A;  4GKK Q;  1SMY C;  1NTG A;  3BYT B;  5C5L A;  2SOB A;  3TN2 A;  3GTP H;  4A3K G;  2LS0 1;  2NYZ D;  2UXB Q;  4FXK C;  1OXS C;  1A2T A;  3UE0 A;  4LF8 Q;  3U9O A;  4JPB W;  2BCO A;  1B1Z A;  1KC8 C;  2V1C C;  4H02 A;  4JV5 L;  1SYG A;  4C1N K;  1L1O A;  2IY5 B;  2AUJ D;  4B08 A;  2NTS A;  1KNA A;  3RLN A;  3OTO L;  1IYJ B;  4LK1 C;  1TWF B;  2WV6 D;  3E3X A;  4KKS A;  4XIG S;  1ICW A;  3HOY H;  3JAM i;  2B2W C;  4HSV A;  5FOB B;  4O2D A;  4PZ6 A;  3PCO B;  1VQM A;  4P74 A;  5I4D A;  4JI4 Q;  5C44 H;  4GLA C;  5CMD A;  2CQO A;  4DR2 Q;  4DR3 Q;  1AFP A;  3BG3 A;  2PNR C;  2NUC A;  4IUT A;  4IFD J;  2YU9 H;  4DV6 Q;  4A3F H;  1S5D D;  2RHQ B;  4IPG A;  5ELN A;  1QZG A;  1QZH A;  1EFI D;  4XTC S;  4DR4 L;  4R8I A;  3C1E A;  5C5M A;  1E2Z A;  2GN5 A;  4ABN A;  1VQE A;  4CJ1 B;  4DR6 Q;  1XMO L;  4LF9 Q;  1BKB A;  2WAC A;  4JCV E;  4KKU A;  4QF4 A;  4POG A;  3K80 C;  2LSS A;  3A0J A;  3CCR A;  3L7Z C;  3T51 B;  3NE5 B;  1BDO A;  3X3M A;  1U9R A;  2XRQ D;  1EU4 A;  1X32 A;  1B70 B;  5CV7 A;  3QJY A;  3A54 A;  3BVM A;  2VUM H;  1LTL A;  3S16 H;  4UHV A;  2O2L D;  2BDO A;  3HKZ G;  4TRD A;  1YHB A;  1X54 A;  1DYQ A;  5EGT A;  1HZB A;  1PTO C;  2BDN A;  4Y52 H;  2XWB B;  2NBF A;  4LF6 L;  4AYB G;  4JI3 L;  3HOX G;  1EIH A;  1B7Y B;  2N3S A;  2CH4 W;  1SFO H;  3CU7 A;  1UE7 A;  2Q2U A;  4BWG B;  4RA8 A;  4HJ9 A;  3K57 A;  4JOI C;  3U50 C;  2VW9 A;  2YTX A;  4ZYS A;  2F03 A;  1Z9F A;  3S1R B;  4X64 Q;  4NKL A;  3NQT A;  1PMR A;  2NZ1 D;  5GAD C;  3GP7 A;  1HJP A;  1KDC A;  2Z6K C;  2DY8 A;  2UUB L;  3H94 A;  1U4P A;  3HZX A;  1GVP A;  2PZW A;  2JA5 H;  3ULP A;  3KLW A;  4XYQ A;  1IYU A;  2EJG C;  3B6Y A;  4H7B A;  1KAA A;  2PI2 E;  1D1I A;  3BZK A;  1N36 L;  4OO1 H;  2LXK A;  4NDX A;  3SK4 A;  4V0B A;  3W2D A;  4LMQ D;  2F0G A;  3VR6 A;  4KV6 A;  4GZY C;  3I4M H;  3HS0 C;  1PH9 A;  1P8L A;  4FF4 A;  1WCM H;  2HIX A;  4DN4 M;  1K9M C;  3JAM c;  4X65 Q;  3NBH B;  3BDO A;  4CHT B;  1IKL A;  4A3L H;  1EYA A;  3L9A X;  3FP9 A;  1B50 A;  1LAC A;  4DPG A;  4HMI A;  1CI3 M;  1AZQ A;  3QB3 A;  2NB0 A;  5M3F H;  3KLS A;  3DUZ A;  3W5O A;  2HQL A;  4BY7 B;  4LFC Q;  2RKS A;  1IL2 A;  1G29 1;  5ELD A;  1VQA A;  4K5W A;  4RKL A;  5GAE C;  3UDG A;  1ILP A;  5J39 A;  2Q2T A;  1II3 A;  2HD3 A;  4QY7 A;  4C3J H;  4KHZ A;  1CSQ A;  1WJJ A;  3K0X A;  1LT6 D;  1Q8K A;  2E2J B;  3FMC A;  4JC0 A;  1NUC A;  3J7Y W;  1H9K A;  1Z47 A;  2K14 A;  2KCN A;  2L0C A;  4ULL A;  1CA6 A;  4MIU A;  1CKN A;  1TS5 A;  2HUG A;  3E9H A;  4U68 A;  3HOW H;  4XT3 B;  2H1E A;  3KJO A;  1GUT A;  1EQT A;  4DA2 A;  2EVB A;  1ENF A;  1JJG A;  1HNZ Q;  5C4X B;  2AWO A;  2Z4I A;  1EFW A;  3I91 A;  3KBX A;  1IBM L;  4KHV A;  2KHJ A;  3CMA A;  4FVM A;  5IWA Q;  3OW2 A;  2D2C C;  3SHL A;  3QO2 A;  2VL6 A;  2B2U C;  4YWM A;  4A3K H;  4E6I A;  1PV4 A;  1CQV A;  3LWU A;  1SE3 A;  2JA8 H;  3GO5 A;  1RDP D;  1SMX A;  3VR4 A;  1I3Q B;  2D0P A;  4L5T A;  4LNQ A;  4QIW E;  1CZG A;  1L1O B;  4PV1 C;  1ZKO A;  1Q1B A;  3AMU A;  3IAY A;  1TT2 A;  1R4Q B;  3LGJ A;  4A3G H;  2OQ0 A;  1IL8 A;  2F3I A;  1EQV A;  1O7Z A;  4C2M H;  3SK6 A;  2L5T A;  2ZT9 C;  3TP8 A;  1J9O A;  1Q7Y C;  1X3E A;  3A56 A;  1VQ6 A;  2PMZ E;  3EA6 A;  2UU9 L;  1WTR A;  5FLX L;  1K8M A;  2XSC A;  4G57 A;  1M8A A;  3FKI H;  1TS2 A;  3NBI A;  1VQH A;  4GN5 A;  2QCP X;  3TP7 A;  4F8M A;  3K81 C;  1GUG A;  1E22 A;  1E0B A;  5I2Y A;  1EIG A;  1FR3 A;  3T1H L;  5CV5 A;  1VQN A;  1RKN A;  2LMC B;  4YCW A;  5EPL A;  1VQF A;  3AEV A;  4L6T B;  3T1Y L;  2I5L X;  3L2P A;  4A93 B;  4YHH Q;  2JA7 H;  3MXN A;  3Q23 A;  1YNN D;  3BJU A;  3CQZ H;  1VQP A;  1H9J A;  2NZO A;  2L55 A;  1Y8P B;  2NN6 I;  2EXZ A;  2UUA L;  2CVR A;  2XTI A;  2E76 C;  1XYI A;  3GTM B;  3K6O A;  4BY7 G;  4A3E B;  2CQA A;  5BR8 L;  4K14 A;  1VQI A;  4GLV B;  3KK7 A;  3K5O A;  2BOS A;  2AKW B;  4BBS B;  1ZXT A;  2UUB Q;  1GOZ A;  2DJF C;  2KJX A;  4DUY Q;  1N34 L;  1SN8 A;  4KK7 A;  1JOR A;  2NN6 H;  4TSS A;  1RHP A;  3D3R A;  3IFT A;  4C3H B;  3R2T A;  3AFQ A;  2R6G A;  4K8I A;  4JK1 C;  5KNC A;  2ES2 A;  3GTG B;  4QUC A;  3HOX H;  1UE6 A;  2DN8 A;  3T56 B;  2K4K A;  2Y0S B;  2CW0 D;  4IJL A;  3A55 A;  3TRE A;  3SXH A;  1TII D;  4FNF A;  1XNR L;  3A74 A;  4KD3 A;  2K03 A;  5C4X G;  5C4J B;  3ICE A;  2VB3 X;  4A3B H;  2PO4 A;  1SAP A;  1U4M A;  4C56 C;  1IZ6 A;  1EIY B;  2PPB C;  3EIV A;  1QVG A;  1C9O A;  1UEA B;  5IP7 G;  1IXR A;  3T13 A;  2F0W A;  2DUD A;  1D5M C;  4KKT A;  3J80 i;  2A69 C;  1N9W A;  1HR0 Q;  1Y1W B;  2WB1 B;  3TQY A;  1H9M A;  1QUQ B;  3HFZ B;  4DV5 Q;  3FEW X;  2B63 B;  5CR3 A;  4EGV A;  1MJC A;  1TWF H;  1EYD A;  3MZ5 A;  3QOL A;  4ODG A;  3MEH A;  3I70 A;  2ZJP A;  3DHQ A;  1K83 B;  2Q8R E;  2R92 B;  4YY3 Q;  4XT1 B;  1A3V A;  2B2V A;  1YJ9 A;  3D4W A;  2LFN A;  1LTR D;  1A6X A;  1PFB A;  5ELF A;  3MFG A;  4JI2 Q;  1V9P A;  4F7X A;  4PMC A;  5DM6 3;  4K2L A;  4NXM L;  1S72 A;  1ZYR D;  4ALP A;  4AH6 A;  4DR1 Q;  1K73 C;  1UE1 A;  2PZU A;  2QEJ C;  2EYP A;  5EKK A;  4GNX C;  1RJT A;  1CKN B;  1E24 A;  2RSO A;  3TEH B;  2BA1 A;  3CKI B;  4IZ8 A;  3E0E A;  1K3B C;  2XWJ B;  3NP8 A;  2ZJQ A;  2VXW A;  4YCU A;  3M4O B;  5JPN C;  4GKK L;  4WJW A;  4BA2 I;  4DF7 A;  3E0J A;  1HA6 A;  1SLJ A;  1KHI A;  1MI2 A;  4JI6 Q;  2KA7 A;  3NK9 A;  4L5R C;  2UXB L;  3HG9 A;  1FYC A;  4A3E G;  4LF8 L;  2UUC Q;  2AQ1 B;  1WD1 A;  1VMP A;  2AUK A;  1ZEQ X;  2KED A;  3D31 A;  2GVB A;  3R8B A;  3F8T A;  2EYM A;  2MO0 A;  1XTC D;  1TWG B;  5CV4 A;  2RF4 A;  4C3H G;  4DXF A;  3OMG A;  1EL0 A;  4XQN A;  4ZCK A;  5CC4 A;  2Y0S G;  4P2C B;  3E9I A;  5IT9 E;  5E4W C;  4K5V A;  1CHP D;  2K33 A;  1EYG A;  4JI4 L;  3I4L A;  4UPA A;  5A2Q L;  4DR2 L;  4DR3 L;  1XPR A;  2I0Q A;  1V1P B;  3I4O A;  4LW1 A;  3S1R H;  1R9T B;  3D8G A;  4KY5 A;  4BY1 G;  4BS9 A;  4MHE A;  4DV6 L;  1QNU A;  1F77 A;  2KQ3 A;  3TS0 A;  3BU2 A;  1DCZ A;  1WD0 A;  2NVQ B;  4GOP A;  3J80 c;  2N55 A;  3I4N G;  3ERS X;  4BBR G;  2MPM A;  1MSG A;  4DR6 L;  1EWH A;  5COR A;  2ZM6 Q;  4LF9 L;  4IUU A;  4K0K Q;  3SDZ A;  4WJ4 A;  1I6V C;  5EPK A;  3C2P A;  2R61 A;  3FVQ A;  1EY6 A;  1MSH A;  3VR5 A;  1B2T A;  2NVX B;  1DON A;  1RTN A;  4FXD A;  4JBM A;  1JC7 A;  3MXN B;  1XPU A;  1HNX Q;  1SNM A;  1ZYR C;  2X69 A;  1Y1W G;  2WB1 G;  2P5Z X;  4YWL A;  1F2M A;  2B63 G;  2O5J C;  3J81 L;  1FGU A;  1SYE A;  1C7Y A;  5EJW A;  1HQR D;  1DXM A;  1KQS A;  1GUO A;  1I5F A;  1MHW C;  3NTI A;  4FXG C;  2R92 G;  3WOE A;  1IW7 D;  2XN9 C;  4IN3 A;  4OX9 Q;  5M5X B;  2KCT A;  1WTX A;  4GS3 A;  3K5L A;  3HEJ A;  3TSS A;  5BN3 A;  2EYL A;  3I56 A;  1BCP C;  2J0T D;  4LAA A;  2HDL A;  4L8J A;  3W3A A;  2F52 A;  2JEB I;  3NBH A;  1LAB A;  2FMM A;  4IPD A;  2B29 A;  3SE0 A;  4X64 L;  2Z6B A;  2F4V Q;  2QEX A;  1Y1V B;  1YBY A;  2SNS A;  1KRT A;  2A6H C;  1D1K A;  1E2V A;  2FXQ A;  5JEA H;  3QWN A;  4X66 Q;  5LMU Q;  2HCI A;  1DJR D;  4DV0 Q;  1PRT F;  1VQ8 A;  2KHI A;  2N88 A;  2EOT A;  5K5P A;  5C3X A;  3H15 A;  3AFP A;  2B2Y A;  1YHQ A;  1SYB A;  5C3W A;  4Y7N B;  2XIW A;  1Q46 A;  1FD7 D;  4X65 L;  5GAH C;  5IP7 H;  1EWI A;  1AZP A;  2HIV A;  5CV6 A;  2NVY H;  4CKC A;  1XXG A;  3MA2 B;  4O42 A;  1CKM A;  1Q12 A;  3K7A B;  1I3Q H;  1JE5 A;  1G6Z A;  3KOJ A;  1LO5 D;  2FJ2 A;  4LFC L;  1MJE A;  3K7U C;  1UE5 A;  1CUK A;  4FP5 D;  4UP8 A;  2QDL A;  4DNI A;  1SJE D;  4P73 A;  3CCL A;  2NVT B;  2K28 A;  3CCQ A;  2CKZ B;  4A3J B;  2XRS D;  1XMQ L;  1ONL A;  5CV9 A;  4R4C A;  4CDE C;  4WRD A;  2O5I C;  3I3C A;  5M5Y B;  5D65 A;  4X62 Q;  1GHK A;  1B9N A;  3S9W A;  2JSO A;  1Q3L A;  2MQH A;  5C4H A;  3G4S A;  1CT1 D;  4DK3 C;  2G9H D;  1STN A;  3CF5 A;  4HIM A;  1J8I A;  1SRU A;  3SEB A;  4M1U B;  1IW7 C;  2F0P A;  1SND A;  3S17 B;  3A7L A;  3OIP A;  4Q5V A;  3PO2 G;  1AW7 A;  1HNZ L;  2SNM A;  3J81 j;  4A93 H;  1F9S A;  3RMH A;  1PTO F;  5IWA L;  1B9M A;  1BOS A;  4I65 A;  3WWV A;  1STE A;  4DAV A;  1I4X A;  3PUY A;  3D4D A;  5J3B A;  2Q2I A;  5IGE A;  3GTM H;  2QA4 A;  3CXC A;  3G7L A;  4A3E H;  3T4A C;  4POF A;  3S2H B;  1EY5 A;  2MFI A;  2EYH A;  4A3I H;  3S1M B;  4IQZ A;  1W6J A;  4JI8 Q;  3OPO A;  1HZ9 A;  3GV3 A;  1I6H B;  4N9P A;  4BBS H;  1VCI A;  5DNF A;  2ICI A;  2D0O A;  1JIC A;  3I72 A;  2AHO B;  2F0K A;  1PRT B;  2VQE Q;  3QOJ A;  3KFU A;  3GTG H;  3OSO A;  4IPH A;  5C0X J;  3BYY B;  5IGC A;  3CCU A;  3SVM A;  3MAQ A;  1Y1V G;  2B39 A;  2L15 A;  5KYI A;  3J80 E;  3EN2 A;  2VB2 X;  1JOQ A;  3VYT A;  3NEN A;  2PW5 A;  1B8A A;  4OEL B;  1XJV A;  5KYL A;  1DM0 B;  1Y8N B;  2WAQ E;  1UNS A;  3H6M A;  4ZQ3 A;  1QNK A;  1V8Q A;  2L11 A;  2F0N A;  2WFW A;  2JYO A;  5C4J H;  3GTQ B;  2X6L A;  4J6H A;  2J4X A;  4WOR A;  3U4V A;  4GOP B;  2IT1 A;  3U58 A;  1VF5 C;  4YHH L;  5CBA E;  1CZW A;  4KHP Q;  4UY8 C;  1YVC A;  3KYH C;  1L0W A;  3AB9 A;  5LMN Q;  3O13 A;  1STA A;  1LT5 D;  3DEO A;  1E2W A;  4RHS A;  3K5M A;  1YI2 A;  1QWY A;  1W6K A;  2JA6 B;  1VQD A;  4OO1 I;  4OWT B;  3WOF A;  1MD2 D;  2B63 H;  3CRL C;  2E8G A;  4KI0 A;  1VQ7 A;  3S15 B;  2F0J A;  3K0Y A;  2QKI C;  4R4T A;  1Q81 C;  2BH8 A;  4DUY L;  4A3J G;  3FPP A;  4FDB A;  1T9H A;  2JE6 I;  1K83 H;  4HR7 B;  2R92 H;  2OF1 A;  3DLL A;  1PTO B;  2EYO A;  5L37 A;  3M85 A;  3V96 A;  1C48 A;  1KAB A;  1ML0 D;  3RN2 A;  5G3L F;  2ATW A;  4WJ3 M;  2K50 A;  2PYK A;  1XTD A;  3CD6 A;  1O7Y A;  3GTO B;  3PGZ A;  5EPJ A;  2EY2 A;  3P20 A;  3QG1 A;  4A3D B;  1QUQ A;  2YTV A;  2L12 A;  5FO8 B;  1HRJ A;  2E74 C;  4CBV A;  4OWX B;  3J7A 5;  3OWF A;  2EE1 A;  4R4Q A;  4TQU S;  2IX0 A;  4RGM A;  2QF7 A;  2F0L A;  3M4O H;  1HUM A;  3PMF A;  3M4Q A;  1G2S A;  4J1M A;  5AJ3 Q;  2FIN B;  1PYB A;  3DWQ A;  1BO0 A;  3I8Z A;  3R93 A;  4DAP A;  1K3R A;  3VA7 A;  3DXJ C;  1JWS D;  5EAY A;  1SE2 A;  3PUV A;  1XMQ Q;  3PSI A;  3C46 A;  4R4I A;  5C3E B;  3M4P A;  1HR0 L;  1MKH A;  1YZ6 A;  4DV5 L;  5J22 A;  5KND A;  3NTH A;  1TWG H;  5GRO A;  5AFW A;  1HR0 W;  5DLQ E;  4PG3 A;  1WTO A;  3HOU H;  4ZKC B;  4Q0F A;  2KUM A;  2RA4 A;  4DV4 Q;  5HGQ A;  1TR5 A;  2I07 B;  4JI0 Q;  4YY3 L;  1K28 A;  4RGT A;  1CTM A;  1NAP A;  4APV A;  1F9P A;  1JQY D;  1PYW D;  4DV2 Q;  3VR2 A;  4H44 C;  1R9T H;  1JWM D;  4JI2 L;  3RZD H;  5E4X A;  1X9N A;  3G6E A;  1DGS A;  1L1O C;  4OXP A;  4HCS A;  4DR1 L;  1ET9 A;  3A5Z B;  1IYV A;  5HY6 A;  1CKO A;  5T1G A;  3X3N A;  5KEE A;  4AQY Q;  3S1Q B;  3CAM A;  1G2T A;  1E3P A;  3FPU B;  5IE8 A;  4B3M Q;  3PV0 A;  5DAU A;  2E75 C;  2L4N A;  1YHA A;  1Q82 C;  4JI7 L;  4JI6 L;  2EYF A;  2FMC A;  2JA6 G;  1A63 A;  3ERO A;  1L0X B;  1TY0 A;  2UUC L;  1V1P A;  1BXT A;  2K01 A;  5KNB A;  1I50 B;  4B3R Q;  2Z9H A;  1N32 Q;  1KTK A;  2KVM A;  3AU7 A;  2KBN A;  5IT9 c;  1EQR A;  3KF6 B;  3N6R A;  5M5X H;  1I4P A;  3GTL B;  5IYD G;  4O1N A;  4XXE A;  1L0Y B;  4QUF A;  1Y1V H;  4A3D G;  1JR0 D;  1OXX K;  1PZJ D;  1ROD A;  2EQS A;  2EY1 A;  4NP5 A;  3GD7 A;  3JC6 6;  1GUW A;  3UE1 A;  4F87 A;  3PUX A;  4OIJ A;  3J7A V;  2NZH A;  3EVQ A;  1O7I A;  1LTI D;  2ZM6 L;  3KUP A;  4GN3 B;  4HJA A;  4K0K L;  4Y7N H;  4UP9 A;  3AQQ A;  4OEM B;  2RCN A;  2OWO A;  4LFA Q;  1HNX L;  5C3E G;  1CHQ D;  2JJQ A;  2DJG C;  2N49 A;  3QR8 A;  1KIX A;  5I6Y A;  4NW2 A;  3Q24 A;  1D5Z C;  2I46 A;  3NQI A;  3NSW A;  4KD4 A;  4FF2 A;  2YU9 B;  1WOC A;  4IUQ A;  2ZXR A;  4IFD G;  1I4H A;  3HKZ E;  4G7Z C;  1XWE A;  2KEN A;  1WTP A;  2F3W A;  4P75 A;  4WFN 3;  4BY1 B;  1AP0 A;  2NVT H;  4A3C G;  2QW7 A;  4NPS A;  4OX9 L;  1N33 Q;  4AYB E;  4A3J H;  3A8I E;  3UDI A;  2ENB A;  3M9B A;  5C0X G;  5FK9 C;  1VMC A;  5IGB A;  3I4N B;  3TS2 A;  1PYS B;  2M2L A;  5M5Y H;  4BBR B;  1GXD C;  1EWC A;  1F2L A;  1XNQ Q;  3C3L A;  1XX8 A;  4YIJ A;  5D3D A;  3MEF A;  2F4V L;  2RVL A;  4Z9C B;  3MTS A;  2Q8T A;  5K36 G;  2CFM A;  4X66 L;  5LMU L;  5E3F A;  3IRB A;  4DV0 L;  3SK8 A;  2RDG A;  2F4I A;  3OW7 A;  1P16 A;  3WDN A;  4HID A;  1I94 Q;  4HED A;  2I5H A;  3EFX D;  2OT2 A;  1D2B A;  1JWU D;  1SYD A;  2C5C A;  2R3Z A;  2E2H B;  1PLF A;  1S5F D;  3BZC A;  1HXY D;  4X3K A;  1YNN C;  1YIJ A;  1M4V A;  2E2D C;  3ZJY C;  2G5D A;  2B2T A;  4OGQ C;  2BE5 D;  4DR7 Q;  2NTT A;  2YYZ A;  1ESF A;  3S1M H;  4HN7 A;  1R4P B;  1LTB D;  5HUR A;  1RF2 D;  3OYY A;  3H3V I;  2KOL A;  4N8F A;  1B44 D;  5ELO A;  4ME3 A;  5KGU A;  1PA6 A;  1B3A A;  1OXU A;  2R7D A;  1WTW A;  2F0V A;  5LL6 X;  2IW3 A;  4NXN L;  1T5X D;  1NR4 A;  2EJM A;  1HNW Q;  1EU3 A;  4KJO A;  1CQF A;  5BN4 A;  4A75 A;  1KNE A;  2IJ0 A;  1EY7 A;  2A68 D;  2CW0 C;  1MBY A;  4I7A A;  4B3S Q;  3H3V H;  3TZD A;  3PO3 B;  1F9Q A;  1STH A;  4X62 L;  4HTH A;  2B8G A;  4JI7 Q;  1LLR D;  4N8X 1;  3QIA A;  4A76 A;  1HFN A;  4KY7 A;  4DV7 Q;  2F0H A;  1K0S A;  4K6L A;  5JJK A;  3MXU A;  1YNJ D;  2N8N A;  2RSN A;  3GTQ H;  1BVS A;  4S3S A;  4QL5 A;  5M3F B;  3H0G B;  2MO1 A;  4OHJ A;  4HJ7 A;  4IUV A;  1QG7 A;  2LY7 A;  5A35 A;  1VQ4 A;  2KCC A;  5T1I A;  1M1K C;  1U4R A;  2Z1C A;  1KXL A;  2M00 A;  4RAU C;  4ZK9 B;  1GUN A;  3M7G A;  2L9H A;  1TWC B;  1Y69 U;  2VNU D;  3CP0 A;  2LXJ A;  4PMW A;  1QOH A;  5J1Z A;  1OXT A;  4KMU C;  4X3T A;  2B2W A;  1HUN A;  5JJZ A;  2JA6 H;  1NCV A;  3RN5 A;  4KN7 C;  1BCP F;  3F2C A;  4IO9 A;  5ISR A;  3FHW A;  3KDF B;  4JI8 L;  1J5E Q;  2CWA A;  3TBI B;  2WAQ G;  4CGY B;  4HJ5 A;  2PCF B;  3K58 A;  4QGU A;  4EQO A;  4DR5 Q;  2F0T A;  3D4R A;  1PFN A;  2VQE L;  3EJI A;  3KLR A;  3BDC A;  2B3G A;  4BXX G;  1PTO H;  4ID6 A;  2WKD A;  4DFA A;  2HHH Q;  1NMF A;  1QJO A;  4B3T Q;  3HOV B;  1HCZ A;  2OXP A;  4QIW B;  4EQN A;  3PO2 B;  3LNN A;  4QMG A;  4QQB X;  3MC0 B;  5H1S E;  1C4Q A;  1Z7T A;  5EBC A;  4RKB A;  3M4Y A;  1C8C A;  4RMF A;  4A3D H;  2VUM G;  1VQB A;  3D0F A;  1FGB D;  2JA8 B;  1H9R A;  4TVA B;  2PMZ B;  4RHR A;  3I7F A;  1SSO A;  4BY7 H;  3T16 A;  2D9U A;  1PFM A;  2ZXO A;  2A5H A;  4L5Q A;  4ZUI A;  1SNC A;  4L5S A;  2EYJ A;  2F1M A;  1D8L A;  4UAI A;  2QIL A;  4KHP L;  2JQO A;  1FJG Q;  1PVO A;  3N52 A;  4K8J A;  4A3G B;  1H95 A;  5LMN L;  1SR3 A;  2IPK D;  3CC7 A;  1WI5 A;  2MNA A;  2A19 A;  5IYB G;  2E2J H;  3HGB A;  3L3O C;  4CDC C;  5FLX E;  1PH7 A;  3LWE A;  1SMY D;  3HKS A;  1KDA A;  2AQ3 B;  2GVA A;  5LMN W;  1VS0 A;  1VQ5 A;  5C3E H;  3CPF A;  4MTK A;  4DK1 A;  3RNU A;  2KEC A;  2FFK B;  5FO7 B;  4IOA A;  2BA0 A;  4O0A A;  5IIF A;  3KF8 A;  3FKI B;  4JOI A;  1EY4 A;  4PZ7 A;  2JA9 A;  3MXG A;  2F0F A;  1PRT D;  4IFD H;  5CV8 A;  3GTJ B;  1IBK Q;  1CFM A;  2Z6K A;  4HAE A;  2F3V A;  1PHJ A;  1CA5 A;  1S40 A;  3I4M G;  2DNC A;  5C4X H;  2A1A A;  1AN8 A;  3PO3 G;  2Z4H A;  3VYS A;  3BDL A;  2CCZ A;  3OWE B;  1BBX C;  1JT8 A;  3DMU A;  3M7N A;  2EPB A;  2WII B;  4G4K A;  2PQA B;  4A3L G;  4V19 0;  1KDB A;  3I90 A;  1JE4 A;  1G6P A;  5EKI A;  5M3F G;  2K7V A;  3H0G G;  4HMJ A;  4J8Q A;  3PUZ A;  5K36 H;  2K32 A;  3FDT A;  1UWV A;  1SJH D;  2UXD Q;  1D6E C;  3RZO B;  1TWH B;  4CJ0 B;  5AJ3 L;  3FRP B;  1VQG A;  2B2V C;  2Z8L A;  3H09 A;  4K2K A;  4NXN Q;  1U5K A;  1ET6 A;  5M3M B;  1YJW A;  1IBL Q;  1CK1 A;  1SRO A;  1NBW A;  1IHZ A;  1RTO A;  4GLX A;  1LTT D;  1TKW B;  3R3O A;  5M5W B;  2XGT A;  1JOO A;  1I50 H;  4MTN A;  1E1T A;  2JN4 A;  3A8J E;  1FNW A;  2A73 B;  1GUS A;  3MWY W;  2UXC Q;  2EY6 A;  3HOV G;  4DV4 L;  4P72 A;  2PZT A;  3MFY A;  3GTL H;  3K5N A;  3J7A F;  4JI0 L;  4JI1 Q;  1PTO D;  4A3B B;  3BVG A;  4N9T A;  3NUC A;  4PMB A;  4DV2 L;  1WTH A;  5C6A A;  1BR9 A;  2AWN A;  1UEB A;  1SNQ A;  1TVX A;  1PFS A;  2JA8 G;  1UAP A;  4DV1 Q;  3NTK A;  1UUP A;  5I9O A;  3S2D B;  2B2U A;  1PRT C;  1GJX A;  1DZ1 A;  4LFB Q;  5CGK A;  4AQY L;  4C3I B;  1F2Y A;  4RH6 A;  3KF6 A;  1B3Q A;  4OON A;  2IWH A;  1K8O A;  3DEP A;  1W2B A;  4B3M L;  3G71 A;  1CM9 A;  4A3G G;  4G7H C;  4KN4 C;  1HA5 A;  1TU2 B;  4LF4 Q;  2K52 A;  1Z6H A;  1JCK B;  4EQ5 A;  3OHX C;  3U9S A;  1N8R C;  4C3H H;  3H3V C;  4RCN A;  1K8A C;  4TKO B;  3MHB A;  4OL7 A;  1QVF A;  3FKI G;  4B9W A;  4LF5 Q;  4AIM A;  4KY6 A;  4JYA Q;  2L1B A;  3LX0 A;  5LL6 S;  4B3R L;  1V43 A;  5JEA J;  2KEE A;  1N32 L;  3OOC A;  1FNV A;  1TWA B;  3W1B A;  1GD7 A;  4GOP C;  2FHT A;  4BY1 H;  3DM1 A;  3NWS A;  3D6C A;  2WKC A;  3RLO A;  3P75 A;  1QB5 D;  3GV6 A;  2ID0 A;  2JA7 G;  2YV5 A;  2Y0S E;  4CDD C;  3PUW A;  1QVC A;  3I4N H;  3JAM L;  4BBR H;  4BXX H;  2H5X A;  4MN3 A;  4GKJ Q;  1Q1E A;  5EBD A;  3NXW A;  1JMC A;  4QB4 A;  3ND9 A;  4X3U A;  3C1F A;  2ZXP A;  1SEB D;  3H91 A;  4XQJ A;  1A3U A;  4MZ9 A;  1STG A;  2E5L Q;  1LTS D;  4DV3 Q;  1Y1W H;  3R2I A;  4JI5 Q;  3MVV A;  1HTP A;  2KCM A;  1KLU D;  1BF4 A;  3TRZ A;  3DWA A;  1H9S B;  4A4I A;  2NN6 G;  2MUY A;  1FVI A;  2MJ8 A;  1HZC A;  2AQ2 B;  2E2H H;  1L2F A;  5M3M G;  3ER0 A;  3S1N B;  2R7Z B;  3UDF A;  1I4Q A;  4DUZ Q;  1A2U A;  5A2Q E;  1VQO A;  1GM5 A;  1EIF A;  1ASY A;  4LFA L;  4DAY A;  5G3L D;  5IYB H;  2WB1 E;  4GN4 B;  1HZA A;  2HCC A;  4CKB A;  4PZ8 A;  3J7Z C;  4IUP A;  4LF7 Q;  2K04 A;  1QCB D;  3URY A;  1J6Q A;  3KF8 B;  4RCO A;  5IOD A;  5IY0 A;  4A3B G;  3IFD A;  3CC2 A;  5GAG C;  1X3F A;  1N33 L;  1ENC A;  2B2Y C;  3BVZ A;  3CPW A;  2BH2 A;  4CDF C;  1O78 A;  1PH1 A;  4P71 A;  2WP8 J;  5NUC A;  4PQX A;  4DNT B;  3PIP 3;  3OIQ A;  5JOB A;  3RLF A;  3PO3 H;  3CCS A;  2K05 A;  1XNQ L;  2PI2 A;  1X3P A;  1S4Z A;  2VQF Q;  5F2D A;  5IP9 G;  1Y8O B;  2OEO A;  3J81 E;  3VDY A;  3TP6 A;  2K75 A;  1BQQ T;  2C9O A;  4C3I G;  4HSP A;  5JAV A;  4LUZ A;  2QGQ A;  4EVO A;  1JOK A;  3GTK B;  1JJ2 A;  3H0G H;  1YIT A;  5I2X A;  4IAL A;  4QJF A;  1X3G A;  3HOZ B;  3T53 B;  1I94 L;  4ME5 A;  1EZ8 A;  1SE8 A;  1LV9 A;  5DM7 3;  2J7Z A;  4KTA A;  2E2I B;  1TWC H;  4F88 A;  3CC4 A;  4X3S A;  5IGF A;  2QDB A;  3IL8 A;  2DGY A;  1LUZ A;  2A8V A;  3PF4 A;  2ZTE A;  4DR7 L;  2CHB D;  2Q2H A;  3I2Z A;  1EY0 A;  3ONA B;  1F2Z A;  4ILW A;  5IT9 L;  1PH8 A;  3I55 A;  2D62 A;  3S24 A;  3NWT A;  2K1B A;  4HIO A;  4DKA C;  4CJ2 C;  2R93 B;  2RBM A;  1ENA A;  3EQL C;  4UP7 A;  2NVQ H;  4JV5 Q;  1PZI D;  1B53 A;  1SNO A;  1B4O A;  1PZK D;  4ZRZ A;  3HOV H;  1RIP A;  1HNW L;  4GNX A;  1HQM C;  1D7Q A;  3AYH B;  4HCE A;  3OTO Q;  4L63 B;  2MHV A;  3PO2 H;  2KHS A;  2G9D A;  3M3Y B;  1G91 A;  2NVX H;  1NNX A;  2EJF C;  4B3S L;  1EQQ A;  2RDH A;  4KLK A;  1SNP A;  1LYL A;  1S3O A;  3F2U A;  4DV7 L;  2OTL A;  2CWP A;  2NVY B;  3KDF A;  1TXY A;  1HPC A;  3PQI A;  5CBE E;  4LWC A;  4K6D A;  4M8A A;  5IGD A;  2R7Z G;  1LTA D;  1AEX A;  1AH9 A;  4DR4 Q;  5IYC G;  4HJ8 A;  1U4L A;  2F0E A;  1RL2 A;  3Q22 A;  3SR1 A;  5FKA C;  3S14 B;  2ALY B;  5FLM G;  1JB7 A;  2VS1 A;  1KL9 A;  3I73 A;  4R1J A;  3CCM A;  4A3M B;  1XMO Q;  2K6A A;  2TMP A;  5BN5 A;  2IL8 A;  3ITP A;  4JW0 A;  1EOV A;  5JVH 3;  3GTP B;  3KJP A;  2B8F A;  1J5E L;  1HTL D;  4J15 A;  1X55 A;  2K5H A;  3IKJ A;  3W1G A;  2A69 D;  2F0D A;  2EDG A;  4EX5 A;  4CKE A;  3GTJ H;  1HH2 P;  2SEB D;  4H0L C;  4DR5 L;  1PH4 A;  1VQC A;  1VF7 A;  4MNO A;  2AMC B;  2HHH L;  4B3T L;  5JPM C;  5D3I B;  1SE4 A;  4ZUJ A;  5E1F A;  2IX3 A;  4LF6 Q;  1KD1 C;  3L0O A;  4JI3 Q;  4FF3 A;  3KBG A;  3HOY B;  1TS3 A;  3DWP A;  2ASB A;  1KRS A;  1M90 C;  1F9R A;  1E7Z A;  1K8G A;  5C44 B;  4JBK A;  1LTG D;  1BUV T;  4R4O A;  3HOZ G;  3K7A H;  2DY7 A;  4A3I B;  1A15 A;  4LJZ C;  4DK0 A;  3NEM A;  1TWH H;  1VDZ A;  3RZO H;  3CCJ A;  4A3F B;  2RCF A;  4DU9 A;  4UDU C;  3CCE A;  2NWG A;  1HHV A;  2HQE A;  5FLX c;  1FJG L;  1GKH A;  1I4G A;  2EXD A;  3PIO A;  1VQL A;  1ICF B;  2WIN B;  2WAQ B;  5LHY 1;  5M3M H;  1IKM A; 
#chains in the Genus database with same CATH homology
 4KHZ A;  1N36 Q;  1CSQ A;  5IWA L;  1OTC A;  1WJJ A;  3K0X A;  5M5W H;  1WFQ A;  1Q8K A;  3WWV A;  1VQK A;  2PQA A;  3PUY A;  2R93 G;  5J3B A;  4DAY B;  3G48 A;  2Q2I A;  4JC0 A;  5H1S E;  4QQB X;  2PNH A;  3GTM H;  2QA4 A;  4RMF A;  3CXC A;  5JEA G;  4A3E H;  1Z47 A;  2K14 A;  4POF A;  2VUM G;  4A3D H;  2MFI A;  4A3I H;  1VQB A;  3D0F A;  4JI8 Q;  1NMG A;  1HZ9 A;  1PH6 A;  1CKN A;  4TVA B;  3E9H A;  1IBK L;  3HOW H;  3F1Z A;  1VCI A;  3I7F A;  4HIK A;  4BBS H;  2IX1 A;  3S17 H;  4BY7 H;  2D0O A;  3KJO A;  4L5Q A;  2AHO B;  5FJ8 G;  4L5S A;  3CME A;  1W3S A;  1D8L A;  4KHP L;  2VQE Q;  2JQO A;  1FJG Q;  3KFU A;  1PVO A;  1YJN A;  1HNZ Q;  3GTG H;  1JJG A;  2AWO A;  1EFW A;  4IPH A;  5C0X J;  1H95 A;  1IBM L;  4X6A H;  2N78 A;  1SR3 A;  5LMN L;  3CC7 A;  1ASZ A;  1WI5 A;  3NEL A;  2KHJ A;  2MNA A;  3CMA A;  2RHS B;  3PF5 A;  2A19 A;  5IYB G;  3CCU A;  5IWA Q;  2E2J H;  4RG1 A;  3OW2 A;  1Y1V G;  1PH7 A;  2L15 A;  3HKS A;  1U0L A;  5LMN W;  2GVA A;  1GO3 E;  1VS0 A;  3EN2 A;  1VQ5 A;  5C3E H;  2VL6 A;  3CPF A;  3NEN A;  3S2D H;  3RNU A;  4YWM A;  2VZA A;  5IP9 H;  4A3K H;  1B8A A;  4IOA A;  3U4Z A;  3S2H H;  2BA0 A;  4O0A A;  1PV4 A;  1XJV A;  4JOI A;  4C3I H;  4DAM A;  5GQO A;  4PZ7 A;  3GO5 A;  2JA8 H;  2UXD L;  2JA9 A;  2WAQ E;  1I6H H;  1SMX A;  1KAW A;  1VQ9 A;  2D0P A;  2WFW A;  5C4J H;  2K5V A;  4L5T A;  4LNQ A;  4QIW E;  1IBK Q;  2Z6K A;  1L1O B;  1PHJ A;  4A3M G;  3U4V A;  4GOP B;  1S40 A;  3I4M G;  2IT1 A;  3U58 A;  5JJL A;  1Q1B A;  1LM0 A;  5C4X H;  4YHH L;  2A1A A;  3LGJ A;  1V1Q A;  2OQ0 A;  1YVC A;  4UY8 C;  3PO3 G;  4A3G H;  4KHP Q;  3KYH C;  2K5N A;  1IBL L;  2CCZ A;  2F3I A;  1AE2 A;  1L0W A;  4C2M H;  1JT8 A;  1AE3 A;  1IBM Q;  5LMN Q;  3M7N A;  1Q7Y C;  1X3E A;  2PQA B;  2JEA I;  4A3L G;  1VQ6 A;  1TWA H;  2PMZ E;  1YI2 A;  2UU9 L;  4OO1 I;  1VQD A;  1G6P A;  1NY4 A;  4OWT B;  3FKI H;  5M3F G;  1VQH A;  3H0G G;  4GN5 A;  2B63 H;  3PUZ A;  3K81 C;  2E8G A;  1E22 A;  4KI0 A;  1VQ7 A;  2UXC L;  2EIF A;  1UWV A;  2UXD Q;  4A93 G;  1Q81 C;  4R4T A;  3T1H L;  1VQN A;  2BH8 A;  3F2D A;  4DUY L;  4A3J G;  5AJ3 L;  4FDB A;  4JI1 L;  1VQG A;  1T9H A;  1WYD A;  2JE6 I;  1K83 H;  4YCW A;  4JBW A;  1VQF A;  2OCE A;  2R92 H;  3DLL A;  3HOY G;  3AEV A;  3T1Y L;  2I5L X;  3L2P A;  4YHH Q;  2JA7 H;  4GNX B;  1A8V A;  4NXN Q;  1U5K A;  3ULL A;  3M85 A;  1YJW A;  3BJU A;  3A5U A;  1EUJ A;  3CQZ H;  1VQP A;  5C44 G;  1IBL Q;  1SRO A;  2NZO A;  1NBW A;  4GLX A;  3RN2 A;  2NN6 I;  4DV1 L;  4A3I G;  2XGT A;  2ATW A;  2UUA L;  1I50 H;  2K50 A;  4MTN A;  4WJ3 M;  1E1T A;  1XTD A;  3CD6 A;  2XTI A;  3K8A A;  3PGZ A;  2UU9 Q;  1X65 A;  4A3F G;  4BBS G;  4LFB L;  1BBU A;  4BY7 G;  3ULJ A;  1QUQ A;  2IHF A;  5BR8 L;  3S15 H;  1NJI C;  1VQI A;  2YTV A;  4GLV B;  3J81 i;  4OWX B;  3J7A 5;  2UXC Q;  4R4Q A;  3HOV G;  4TQU S;  4DV4 L;  2IX0 A;  2R7Z H;  2AKW B;  4P72 A;  3T1H Q;  4LF4 L;  3S1N H;  2UUB Q;  3GTL H;  3M4O H;  5IYC H;  1YNX A;  4DUY Q;  1N34 L;  1SN8 A;  3M4Q A;  5AJ3 Q;  3Q8D A;  4JI0 L;  4JI1 Q;  1PH5 A;  1PYB A;  4DV2 L;  1K3R A;  2R6G A;  3AFQ A;  3CCV A;  2JK8 A;  2ES2 A;  5FLM H;  3T1Y Q;  2AWN A;  5EAY A;  3HOX H;  5E7N A;  3PUV A;  1UEB A;  1UE6 A;  1E1O A;  4LF5 L;  5IYD H;  2K4K A;  4JYA L;  3CW2 C;  1PFS A;  4IJL A;  3F2B A;  3PSI A;  4BA1 I;  1XMQ Q;  4R4I A;  3TRE A;  2JA8 G;  4DV1 Q;  3GTO H;  2UUA Q;  3M4P A;  3SGI A;  1HR0 L;  4IJH A;  1XNR L;  1MKH A;  1YZ6 A;  3A74 A;  4LFB Q;  4YWK A;  3STB D;  4DV5 L;  4AQY L;  1TWG H;  5GRO A;  1HR0 W;  1FL0 A;  5M3M H;  5BR8 Q;  3KF6 A;  5DLQ E;  4OON A;  4PG3 A;  5C4X G;  1G51 A;  1W2B A;  4B3M L;  3G71 A;  3HOU H;  4A3G G;  1PH2 A;  3ICE A;  4DV4 Q;  5HGQ A;  4IOC A;  4LF4 Q;  4A3B H;  1K0R A;  2K52 A;  4EQ5 A;  4LUO A;  1N8R C;  1N34 Q;  4C3H H;  4YY3 L;  4JI0 Q;  4GKJ L;  1JJC B;  1IZ6 A;  4APV A;  1K8A C;  1CSP A;  3EIV A;  1OXV A;  1EIY B;  4DV2 Q;  1QVF A;  1QVG A;  4IFD I;  1C9O A;  4YCV A;  1R9T H;  2C35 B;  3FKI G;  5IP7 G;  1IXR A;  4JI2 L;  2DUD A;  4LF5 Q;  3RZD H;  4AIM A;  2R7F A;  4JYA Q;  4B3R L;  2E5L L;  2HT1 A;  1V43 A;  4DV3 L;  1X9N A;  5JEA J;  1N32 L;  3GTK H;  2Z0S A;  1DGS A;  3G6E A;  1L1O C;  3J80 i;  4JI5 L;  3W1B A;  1NE3 A;  3GDE A;  1GD7 A;  3A5Z B;  4OXP A;  4DR1 L;  4GOP C;  5C0X I;  1N9W A;  1HR0 Q;  5HY6 A;  1CKO A;  3HOZ H;  4BY1 H;  1XNR Q;  3TQY A;  1QUQ B;  2VY3 A;  2ZTD A;  3HFZ B;  4DV5 Q;  4AQY Q;  2JA5 G;  3RLO A;  3CAM A;  2E2I H;  1E3P A;  1MJC A;  1TWF H;  2IHE A;  5IE8 A;  2ID0 A;  4B3M Q;  2YV5 A;  3PV0 A;  2JA7 G;  4OO1 G;  4DUZ L;  2Y0S E;  4DK6 C;  1A0I A;  3PUW A;  1YHA A;  1QVC A;  3I4N H;  2ZJP A;  4BBR H;  1Q82 C;  4BXX H;  4A3C H;  2H5X A;  4JI7 L;  4JI6 L;  4YY3 Q;  4GKJ Q;  1Q1E A;  1YJ9 A;  2JA6 G;  1WCM G;  1A62 A;  3UDX A;  1JMC A;  1A63 A;  3EBE A;  2UUC L;  4IPC A;  4LF7 L;  5JJI A;  4JI2 Q;  2R93 H;  2ZJR A;  1V9P A;  4NB3 A;  1Q86 C;  4JG2 A;  2ZTC A;  4NXM L;  4MZ9 A;  1S72 A;  4B3R Q;  2E5L Q;  2OTJ A;  4DV3 Q;  4ALP A;  4AH6 A;  1N32 Q;  1XPO A;  1Y1W H;  4OWW B;  4JI5 Q;  4DR1 Q;  2KCM A;  1K73 C;  1UE1 A;  2KBN A;  3TRZ A;  5IT9 c;  3S1Q H;  4A4I A;  4GNX C;  1EQR A;  2NN6 G;  3KF6 B;  1FVI A;  1CKN B;  1E24 A;  3TEH B;  2BA1 A;  1HZC A;  5M5X H;  2E2H H;  1L2F A;  3E0E A;  5M3M G;  5FJ8 H;  3ER0 A;  3M3Y H;  1VQJ A;  2ZJQ A;  3J81 c;  3UDF A;  4DUZ Q;  4YCU A;  5IYD G;  4GKK L;  1VQO A;  1GM5 A;  4BA2 I;  1EIF A;  1X56 A;  1ASY A;  4LFA L;  3RR5 A;  2VQF L;  1SLJ A;  1KHI A;  4JI6 Q;  5IYB H;  2WB1 E;  4L5R C;  2UXB L;  4GN4 B;  1HZA A;  1Y1V H;  4A3E G;  4A3D G;  4LF8 L;  4PZ8 A;  2UUC Q;  1YEZ A;  1Y14 B;  4LUV A;  3STB C;  3J7Z C;  4LF7 Q;  1OXX K;  2EQS A;  1BBW A;  3D31 A;  4NXM Q;  3GD7 A;  2GVB A;  3DM3 A;  3JC6 6;  3UE1 A;  3PIP A;  3HOU G;  3HOW G;  1J6Q A;  3F8T A;  3PUX A;  1PH3 A;  3KF8 B;  1MIU A;  5IY0 A;  4A3B G;  3CC2 A;  2I5M X;  5GAG C;  2MO0 A;  2YTY A;  1X3F A;  2NZH A;  1N33 L;  1O7I A;  2RF4 A;  2ZM6 L;  4HJA A;  4GN3 B;  3S14 H;  4K0K L;  3CPW A;  2BH2 A;  1C0A A;  4JBJ A;  1XPU A;  1PH1 A;  4P71 A;  4A3M H;  2WP8 J;  4Y7N H;  4UP9 A;  2Y0S G;  3AQQ A;  3E9I A;  3RLF A;  1X6O A;  2OQK A;  2RCN A;  4GKK Q;  3PO3 H;  3CCS A;  2OWO A;  4LFA Q;  1EYG A;  1NTG A;  1HNX L;  5C3E G;  2JJQ A;  2PI2 A;  4JI4 L;  4UPA A;  1XNQ L;  2N49 A;  2VQF Q;  4DR2 L;  5IP9 G;  4DR3 L;  4A3K G;  1XPR A;  2I0Q A;  1KIX A;  3GTP H;  4LW1 A;  3I4O A;  3S1R H;  2UXB Q;  3VDY A;  2K75 A;  1OXS C;  4BY1 G;  3UE0 A;  4LF8 Q;  4DV6 L;  4LUZ A;  2QGQ A;  1KC8 C;  2V1C C;  4H02 A;  1WOC A;  3BU2 A;  3H0G H;  3TS0 A;  1JJ2 A;  4IFD G;  4JV5 L;  3HKZ E;  1L1O A;  1YIT A;  2KEN A;  4QJF A;  2IY5 B;  1X3G A;  4GOP A;  4P75 A;  3J80 c;  1I94 L;  3I4N G;  2NVT H;  1SE8 A;  3ERS X;  4BBR G;  4A3C G;  4NPS A;  3RLN A;  4OX9 L;  4AYB E;  1IYJ B;  3OTO L;  4A3J H;  2ZM6 Q;  4LF9 L;  1N33 Q;  3UDI A;  1TWC H;  4DR6 L;  4K0K Q;  4WJ4 A;  3M9B A;  3CC4 A;  5C0X G;  4XIG S;  3HOY H;  2DGY A;  1LUZ A;  3JAM i;  2A8V A;  3TS2 A;  1PYS B;  5M5Y H;  4O2D A;  4PZ6 A;  3PCO B;  1VQM A;  2ZTE A;  3PF4 A;  4JBM A;  4P74 A;  3MXN B;  4DR7 L;  2Q2H A;  3I2Z A;  1PH8 A;  5C44 H;  1HNX Q;  4GLA C;  4JI4 Q;  1XNQ Q;  2F4V L;  2CQO A;  3MEF A;  3I55 A;  4DR2 Q;  4DR3 Q;  2D62 A;  2WB1 G;  4YWL A;  3S24 A;  1Y1W G;  4HIO A;  4DKA C;  2B63 G;  5K36 G;  2CFM A;  4IFD J;  1FGU A;  4UP7 A;  4DV6 Q;  4A3F H;  2YU9 H;  2RHQ B;  4IPG A;  4X66 L;  5ELN A;  5LMU L;  1QZG A;  1C7Y A;  3IRB A;  1QZH A;  4XTC S;  2NVQ H;  4DV0 L;  4DR4 L;  4JV5 Q;  1KQS A;  1I5F A;  1P16 A;  4HID A;  1I94 Q;  2R92 G;  2I5H A;  3HOV H;  2GN5 A;  1RIP A;  1HNW L;  4GNX A;  1D7Q A;  3AYH B;  4OX9 Q;  1VQE A;  3OTO Q;  2KCT A;  1XMO L;  4LF9 Q;  1BKB A;  3BZC A;  4GS3 A;  3PO2 H;  4DR6 Q;  2NVX H;  1YIJ A;  4B3S L;  4JCV E;  3ZJY C;  3I56 A;  1EQQ A;  4POG A;  3K80 C;  2LSS A;  4KLK A;  3A0J A;  3CCR A;  3L7Z C;  2F52 A;  2JEB I;  4DR7 Q;  1LYL A;  4X64 L;  1S3O A;  2YYZ A;  2B29 A;  4IPD A;  3S1M H;  4DV7 L;  2OTL A;  2CWP A;  2F4V Q;  2QEX A;  3KDF A;  1YBY A;  1TXY A;  1KRT A;  3OYY A;  3H3V I;  1B70 B;  5ELO A;  2FXQ A;  4LWC A;  4ME3 A;  2VUM H;  1PA6 A;  1LTL A;  3S16 H;  2R7Z G;  4X66 Q;  1OXU A;  2R7D A;  5LMU Q;  3HKZ G;  1AH9 A;  4DR4 Q;  1YHB A;  1X54 A;  5IYC G;  4DV0 Q;  1VQ8 A;  2KHI A;  4HJ8 A;  1HZB A;  1RL2 A;  4NXN L;  4Y52 H;  3H15 A;  3AFP A;  4LF6 L;  4AYB G;  1HNW Q;  2ALY B;  5FLM G;  4JI3 L;  2VS1 A;  1JB7 A;  3HOX G;  1KL9 A;  1B7Y B;  2N3S A;  4R1J A;  3CCM A;  1XMO Q;  1YHQ A;  4A75 A;  1SFO H;  1UE7 A;  2Q2U A;  1Q46 A;  4B3S Q;  3H3V H;  4HJ9 A;  4X65 L;  4X62 L;  4JI7 Q;  1EOV A;  4JOI C;  3U50 C;  2VW9 A;  5GAH C;  2YTX A;  1EWI A;  5IP7 H;  2HIV A;  2NVY H;  3KJP A;  1Z9F A;  4A76 A;  4X64 Q;  1J5E L;  4DV7 Q;  1CKM A;  1Q12 A;  1I3Q H;  4J15 A;  5JJK A;  1JE5 A;  1X55 A;  2K5H A;  3W1G A;  2N8N A;  4EX5 A;  5GAD C;  1BVS A;  1HJP A;  2Z6K C;  3GTJ H;  3GTQ H;  2UUB L;  1HH2 P;  3KOJ A;  4QL5 A;  4LFC L;  4DR5 L;  1MJE A;  1PH4 A;  3K7U C;  1UE5 A;  2MO1 A;  1CUK A;  1GVP A;  4UP8 A;  4HJ7 A;  2JA5 H;  3ULP A;  3KLW A;  1VQC A;  4DNI A;  4MNO A;  4P73 A;  2AMC B;  3B6Y A;  1VQ4 A;  2HHH L;  2PI2 E;  3BZK A;  3CCL A;  4B3T L;  1M1K C;  3CCQ A;  1N36 L;  2LXK A;  2CKZ B;  1KXL A;  4LF6 Q;  1XMQ L;  3I4M H;  2VNU D;  1KD1 C;  3L0O A;  3CP0 A;  4JI3 Q;  2LXJ A;  4R4C A;  4PMW A;  1PH9 A;  1P8L A;  2ASB A;  1OXT A;  1KRS A;  1M90 C;  2JA6 H;  1WCM H;  1E7Z A;  2HIX A;  3RN5 A;  1K9M C;  3JAM c;  3F2C A;  4X65 Q;  4X62 Q;  3NBH B;  1K8G A;  4IO9 A;  4JBK A;  3FHW A;  4R4O A;  2MQH A;  3HOZ G;  3G4S A;  3K7A H;  3KDF B;  4JI8 L;  4DK3 C;  4A3L H;  3FP9 A;  1J5E Q;  2CWA A;  4DPG A;  2WAQ G;  4HJ5 A;  3CF5 A;  4HIM A;  3NEM A;  1TWH H;  3RZO H;  3CCJ A;  1SRU A;  5M3F H;  3W5O A;  4QGU A;  2HQL A;  4DR5 Q;  4LFC Q;  3CCE A;  1IL2 A;  1G29 1;  3PO2 G;  2VQE L;  1VQA A;  5FLX c;  1FJG L;  1GKH A;  2EXD A;  3PIO A;  3J81 j;  1HNZ L;  1VQL A;  4A93 H;  5GAE C;  2B3G A;  3UDG A;  4BXX G;  2Q2T A;  4C3J H;  4QY7 A;  2HHH Q;  1NMF A;  4B3T Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...