2UXDL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxdL00
3PIPA 2UXDL 5DLQE 2VQFL 2UUAQ 3NEMA 1WJJA 3ICEA 4A3LG 2NN6I 4ME3A 1GO3E 1S40A 2ZTDA 1PH6A 1MJEA 2E5LL 3PO3G 3HOZH 3S24A 1H95A 4JI8L 1I5FA 4X62Q 2Z6KC 3W1GA 1IBLL 4OXPA 1KIXA 3KOJA 4IJHA 3HOUH 4GLVB 1B70B 1VQGA 2XGTA 3E0EA 1OTCA 2B63H 2H5XA 1MIUA 4C3JH 3H3VI 4A75A 2A19A 1JT8A 4UPAA 1PH9A 4P74A 3AFPA 1VQEA 2AWOA 3Q8DA 3FKIH 2Q2TA 1VS0A 2EXDA 4GLXA 1YIJA 2B3GA 5ELNA 1MKHA 2Y0SG 3L2PA 2GN5A 2UXDQ 1NJIC 1BVSA 2DUDA 1M90C 3RLNA 3RN5A 3J80i 4GNXC 1HR0L 3CC2A 1UE6A 5JJIA 2E2HH 3L7ZC 3HOZG 3TREA 1K8AC 2R92G 3TS2A 3GD7A 1CKNB 4A3GG 1NBWA 1PH7A 1T9HA 1RIPA 4DUZL 2JA8H 3I4MH 4QY7A 1E22A 4POFA 4DR6L 4B3RQ 2GVBA 4HIMA 1A8VA 4IFDG 4YWKA 1JB7A 4GN4B 4JI2Q 2R93H 4X62L 3CCLA 2K5HA 3KYHC 4QJFA 2N49A 2HHHQ 4K0KQ 4Y52H 3TRZA 3EIVA 3M9BA 2LSSA 2MO0A 1JMCA 4A3FG 1U5KA 4JI4Q 4LUVA 4A3KH 1L1OC 2RCNA 4DKAC 1CSQA 4DUYL 3U58A 1O7IA 1W3SA 3BZKA 4NPSA 1J5EL 4YWLA 1S3OA 5IP9H 2ASBA 1XNQL 3U4VA 2JA7H 1K0RA 5M3FH 3CD6A 1HR0Q 1LTLA 4HJ5A 4HJ8A 2IT1A 1XMOQ 3BU2A 2WFWA 4LF4L 1TWHH 4A3BH 3G71A 4BBSG 2ATWA 1HZCA 5IP9G 3PSIA 1YITA 2QA4A 4JI6L 2KCTA 2K5VA 5FLMH 2A1AA 2VZAA 2I5HA 4A3MH 2MFIA 1VQHA 5IY0A 1YHQA 4XTCS 4HJ7A 3JAMi 5GAEC 3J81i 4HJ9A 3FP9A 3CCSA 4LFAL 4DR6Q 3M4PA 1VCIA 2L15A 1TXYA 4JC0A 1HNXQ 3HOWG 1SR3A 2PQAA 1VQNA 2N3SA 1CKMA 2LXJA 1J5EQ 2K75A 2KENA 5C0XJ 4MNOA 4YY3L 1V43A 4JI3L 2IHFA 3HOWH 2R7ZH 2JA9A 1Z9FA 3I56A 3S2HH 3T1YQ 2HIXA 2AMCB 2QEXA 1IXRA 4X66L 2AHOB 1AE3A 1Q46A 4OWTB 5HY6A 1Y1WH 1GM5A 1E1OA 1FJGL 1N33Q 1HNZL 1KD1C 3GTLH 1N8RC 4LWCA 4KHPQ 1L1OA 2RHSB 3ER0A 3U50C 5EAYA 1LM0A 4JYAQ 4HIKA 3KJPA 3G4SA 2MO1A 4JBWA 4DV5L 3I4NG 4A3IH 2B63G 2C35B 1YHBA 3S15H 5LMUQ 1JJCB 1KQSA 4R4TA 4DV4Q 1K9MC 3ULJA 1N34L 1Y1VH 2MQHA 4GOPB 3KLWA 3J7ZC 4A3LH 3I2ZA 4DR3L 1IBKL 1YNXA 3HKSA 3RZDH 1PFSA 4IJLA 1VQLA 1E3PA 2JEBI 1TWFH 3ZJYC 5AJ3Q 4LUZA 4HIOA 1XMQL 4LF9Q 3MEFA 2OQ0A 2XTIA 2R7DA 1X56A 4QL5A 3HOVG 1RL2A 1VQIA 1N36Q 1XJVA 1P16A 3HOXH 3OTOL 5IYBG 2I0QA 3T1YL 1VQBA 1NTGA 2ZJPA 1QUQA 4JI0L 1EWIA 3DLLA 3W5OA 5IYDG 4DV6L 4AYBG 1VQDA 4GKJQ 4A3CH 4X6AH 2Z0SA 4JCVE 2VQFQ 1VQCA 3NENA 1OXXK 3A5ZB 5M3MG 4X65L 3A5UA 1HNWQ 5M5YH 1QZGA 1X54A 4KLKA 4APVA 3G6EA 1EUJA 4NXML 2EQSA 2UXBQ 4P75A 5M3MH 3G48A 1Q7YC 4DR3Q 4DV2L 1IBKQ 1XTDA 2IX0A 5LMNW 1DGSA 2K50A 2KCMA 2JA8G 5IP7G 1Q86C 3I4MG 2A8VA 1MJCA 1NY4A 5C4XH 3CP0A 3F2CA 4C2MH 3I7FA 3CCUA 1P8LA 3PUXA 3J81j 1XMQQ 4DV7L 4JG2A 1Q1BA 2R93G 4GN3B 1VQKA 5C4XG 5IYDH 2K52A 2F4VQ 1E1TA 3PF4A 1VQ8A 3F8TA 5IE8A 4BBRH 5HGQA 4LF5L 1LYLA 1XPUA 3HOYH 3EN2A 4LFCQ 4B3ML 4IPHA 4A3BG 1VQFA 1B8AA 1WCMG 2Q2HA 4R4QA 4YWMA 2NVXH 2UUCQ 4B3TL 2CWPA 2JK8A 3ULLA 4X66Q 5M3FG 1QZHA 4TVAB 1D7QA 4MTNA 1XNRQ 1ASZA 5IWAL 1VQAA 3PUWA 4P72A 1I94Q 4LW1A 4PG3A 2PNHA 1WCMH 1Q81C 4DUZQ 1KAWA 4B3RL 4B3MQ 3CC7A 4LF7L 4OX9L 2UUBL 3F2DA 1BBUA 4JI5Q 1YJNA 3CCQA 4GNXB 5IWAQ 3RN2A 2JA7G 3RZOH 1UE1A 2UXCQ 2CQOA 1I6HH 5LMUL 3L0OA 1JE5A 4DPGA 3EBEA 4JI1Q 3KJOA 1ASYA 1N34Q 4X64L 1YVCA 4POGA 4DUYQ 4C3HH 4OO1I 1SN8A 2D0OA 4DV7Q 3GTOH 4JI5L 4LFCL 4DK6C 1QVFA 3PO3H 2JA5G 4H02A 4A4IA 4A3IG 1TWCH 2E2JH 4DR1Q 4DR4L 4B3SL 1G51A 1S72A 1OXSC 2CWAA 2VQEL 4A76A 2IY5B 4IFDI 3TS0A 5BR8Q 1VQPA 3BZCA 1CKNA 1KRSA 2KHIA 1PHJA 2UUCL 5E7NA 2WAQG 2YTVA 5GAHC 4GLAC 2DGYA 1YJ9A 2WB1G 3S2DH 3S1RH 2D62A 1Q1EA 4A93H 3PGZA 4LF8Q 4BY7H 4ALPA 3I55A 3PCOB 2IHEA 5LMNQ 1SLJA 1BBWA 1SRUA 1N32L 3J80c 5IYBH 2BA0A 3A0JA 3ULPA 4JI1L 3S14H 2WP8J 4UP9A 3S16H 1E24A 3J7A5 1Z47A 3GDEA 3CCEA 4DR7Q 1CSPA 4HIDA 1GVPA 4JI7Q 5C4JH 4LUOA 2HQLA 5LMNL 4DR1L 4JBMA 1SROA 2UUAL 1IYJB 4XIGS 1JJ2A 3HOXG 2ALYB 3UDFA 4LF6Q 4NXNQ 2V1CC 2CKZB 1AE2A 3GTMH 2YU9H 2I5LX 4JI8Q 3STBC 2VW9A 3CW2C 1Y1VG 4YHHL 3CPWA 4OWWB 4R4CA 2B29A 2NVTH 1PH4A 1L0WA 2F3IA 2ZTCA 4LF5Q 3PO2G 2OWOA 3HFZB 1M1KC 4A3DG 2KBNA 4DV1Q 4P71A 2I5MX 5IT9c 1L2FA 3A74A 4YCVA 3CCJA 3U4ZA 1BKBA 3NBHB 2E8GA 2PI2A 1JJGA 1FL0A 2K5NA 3FHWA 2KHJA 1WFQA 3VDYA 4LF8L 3HOVH 5IYCH 4EX5A 4YCWA 2HHHL 4GNXA 4K0KL 4O2DA 1PH8A 5FLMG 2RHQB 1IZ6A 4HJAA 2Q2UA 3CPFA 4LF9L 4KHPL 3CCVA 3KDFA 3UDXA 2UUBQ 5IP7H 1XPOA 4A3KG 1I3QH 3H3VH 3OTOQ 4JI3Q 1XMOL 3FKIG 4R1JA 3E9IA 2HT1A 1J6QA 4YHHQ 1KC8C 4X64Q 2JEAI 3AEVA 3PUVA 1OXVA 3PIOA 2JA6G 3CF5A 1R9TH 3RLFA 1HZBA 4A3DH 1K8GA 2ID0A 2OQKA 4JI2L 3OW2A 1PA6A 5GROA 2AKWB 1N33L 3PO2H 1HZ9A 3KF6A 3ERSX 4WJ4A 4R4OA 3GTJH 4R4IA 1Q8KA 1YEZA 4AIMA 2OTJA 3HKZG 3T1HL 2UU9L 3KFUA 5C3EH 1FVIA 1G6PA 4GKKQ 4RG1A 2JJQA 1EIFA 1OXUA 3KF8B 3RR5A 1X55A 4EQ5A 4DV4L 3AQQA 2EIFA 1W2BA 2BA1A 4BY1H 4OO1G 3DM3A 2R7ZG 3GTKH 4JI4L 3TEHB 1AH9A 4IPDA 3S1QH 2K14A 3WWVA 3S1MH 1KXLA 3M3YH 3RNUA 1C7YA 1HZAA 5C44H 1XNQQ 2VL6A 5FLXc 4L5TA 1GD7A 4YCUA 2HIVA 3CXCA 2PMZE 1YHAA 5JJLA 1TWGH 4C3IH 1XPRA 1QUQB 2QGQA 4AQYL 1GKHA 2NZHA 3PF5A 1N36L 4PZ8A 5GADC 1EFWA 3M85A 5FJ8G 3STBD 5H1SE 1PH2A 1K83H 1EOVA 3MXNB 3PUZA 1PVOA 1KHIA 4RMFA 2R7FA 4AQYQ 2JA5H 2UU9Q 4BXXH 3H15A 1SE8A 1NMFA 1EIYB 4DV0Q 3CMAA 1PV4A 2F52A 4L5RC 4A3JG 1HNWL 1WI5A 1PH3A 2YTYA 2Z6KA 3K0XA 1Q82C 1TWAH 4BA2I 5K36G 2GVAA 2D0PA 1B7YB 3D31A 3CCMA 4UY8C 5ELOA 4PZ6A 1WYDA 1G291 1PYSB 4DK3C 4A3EG 5M5WH 4J15A 4GKJL 4LFBL 2Q2IA 2YTXA 5M5XH 3UDIA 1VQ5A 4JBKA 4BY7G 2R6GA 2VY3A 3JAMc 2ZTEA 3RLOA 3J81c 5BR8L 1VQ9A 1VQ6A 4QQBX 1VQMA 1N9WA 4L5QA 5GAGC 2Y0SE 4DR5Q 1IBML 4OWXB 2MNAA 1QVCA 4B3TQ 2ES2A 3PUYA 2ZM6L 4DV3L 1OXTA 4KI0A 4PZ7A 4GOPA 1PH5A 4FDBA 4L5SA 3S17H 1YI2A 4JBJA 4PMWA 4TQUS 4BBRG 2NVYH 1NMGA 2FXQA 4Y7NH 1N32Q 1X3GA 4GN5A 2RF4A 5JEAJ 3HOUG 4LF4Q 5IYCG 4DR5L 1IBMQ 4A3CG 3M4OH 1KRTA 3GTQH 4DAYB 3HKZE 3UDGA 4DV5Q 1X3EA 4JI6Q 4LF7Q 4A3GH 2YYZA 1YBYA 4DV0L 3T1HQ 2R92H 4DV3Q 2JA6H 1EQRA 1I50H 2CFMA 2F4VL 3JC66 4A3EH 1SFOH 4GOPC 1Y14B 2JE6I 3E9HA 4IPGA 2OTLA 1A0IA 4OX9Q 2NVQH 3AYHB 1VQOA 2IX1A 4NXMQ 1YZ6A 3UE0A 2UXBL 1EQQA 4WJ3M 4JV5Q 1HNXL 1A63A 3KDFB 3H0GH 4LFBQ 3NELA 1K73C 2WB1E 4A3MG 1FGUA 3SGIA 3UE1A 1I94L 2ZM6Q 4AH6A 4YY3Q 5JEAG 4B3SQ 5JJKA 3CAMA 3K81C 1EYGA 1WOCA 2PQAB 3OYYA 3PV0A 4X65Q 1HR0W 4DV6Q 4DV1L 4IOAA 3GO5A 1CUKA 1HH2P 2WAQE 3D0FA 4IPCA 3LGJA 1A62A 5C0XI 4DR4Q 4KHZA 4O0AA 3F1ZA 2PI2E 4OONA 5GQOA 3HOYG 4BBSH 1X6OA 3BJUA 4MZ9A 4UP7A 1HNZQ 4JOIA 4UP8A 1FJGQ 5C44G 4IOCA 4DR2L 2AWNA 4P73A 1VQ4A 2JQOA 3K8AA 3W1BA 2BH8A 3K7UC 3F2BA 4IO9A 5C3EG 4A3FH 1PH1A 4JYAL 3KF6B 5J3BA 4DNIA 2BH2A 1K3RA 4AYBE 1VQ7A 4QIWE 1PYBA 1V1QA 1SMXA 3K80C 3I4OA 3K7AH 2N8NA 4GS3A 3AFQA 4DV2Q 3H0GG 2CCZA 1L1OB 2NN6G 4A93G 1KL9A 4NB3A 2OCEA 4BA1I 3CMEA 4JI7L 1VQJA 1UE7A 1X65A 5FJ8H 1IBLQ 2E2IH 2NZOA 3S1NH 2VUMH 1NE3A 4JOIC 1IL2A 1X9NA 1V9PA 1HJPA 4JV5L 2E5LQ 4DAMA 2ZJRA 4NXNL 4LF6L 3CQZH 2LXKA 1C0AA 3M4QA 5AJ3L 3CCRA 1YJWA 3IRBA 4QGUA 1C9OA 2VUMG 3GTPH 1UE5A 4A3JH 1UEBA 3M7NA 3GTGH 4IFDJ 1CKOA 1UWVA 3TQYA 2VNUD 3B6YA 1D8LA 4BY1G 4LNQA 1LUZA 3CC4A 2K4KA 2VS1A 1Q12A 2N78A 2YV5A 1Y1WG 4JI0Q 1X3FA 4GKKL 1XNRL 1E7ZA 5C0XG 4BXXG 1QVGA 4DR7L 3I4NH 1U0LA 2VQEQ 2UXCL 2ZJQA 4DR2Q 4LFAQ
chains in the Genus database with same CATH superfamily
2UXDL 5DLQE 5JJZA 2ZXOA 1U4MA 3NK9A 2F0KA 5G3LD 3ERQA 3W1GA 4UAIA 1DYQA 3KOJA 1VQGA 4IFDH 2B63H 1PTOD 2MJ8A 1JICA 4UPAA 3MFGA 4P74A 3AFPA 3Q8DA 4DN4M 1DZ1A 3T16A 1LTBD 3X3MA 2K1BA 1MKHA 2J7ZA 1PZKD 2C5CA 1ZYRD 3J80i 3CC2A 3M4OB 2H4OA 2E2HH 3TREA 5ELFA 3O13A 2R92G 1H9SA 3R2TA 4K8IA 4A3GG 4DUZL 3ND9A 4KY7A 4X62L 2K5HA 2K5DA 3KYHC 2N49A 2HHHQ 1A2TA 1EYGA 3BZKA 1IYVA 3OWFA 1S3OA 3HZXA 2ASBA 1LTRD 5D3IB 1SYEA 1LTLA 1HR0Q 1E2VA 5JVG3 4HJ8A 2WFWA 4BBSG 4HN7A 2K33A 5IP9G 2G9HD 2QA4A 2WV6D 2VZAA 1LABA 2SDFA 1HHVA 1S5DD 1VQHA 5DEHA 5IY0A 4HJ9A 1HTLD 3FP9A 1A15A 4IN3A 4X3UA 3M4PA 1YNND 2PQAA 2OEOA 3VYUA 2PZUA 5IGCA 2M9VA 1IL8A 4YY3L 1ILQA 4JI3L 4R8IA 4N9TA 3WOFA 2JA9A 2Z4IA 1ZYRC 1FD7D 1SBBB 3I72A 1IXRA 4O42A 2AHOB 2AUKA 1Q46A 5C44B 4IUTA 1Y1WH 3SVMA 1EY9A 1FJGL 1J9OA 1HNZL 3GTLH 2F0TA 4LWCA 3JAML 3J81L 1Y69U 3U50C 5ELBA 2Z1CA 1CZGA 4HIKA 3BYTB 1Y1VB 3KJPA 4FF3A 1YHBA 2EY5A 1RCVD 2VB2X 2RSNA 1JJCB 3NTKA 1KQSA 3OMCA 1F9RA 1N34L 4CKBA 3KLWA 1VQLA 3RZDH 1XMQL 1TWFH 3G7LA 3GV3A 1LT4D 2J0TD 2OQ0A 2XTIA 5D65A 2R7DA 1XX8A 5CMDA 1RL2A 1VQIA 2XIWA 1XJVA 3C1EA 2L12A 2I0QA 2CVRA 2F0GA 1I6HB 1LT6D 1PLFA 4A3CH 2B2WA 1VDZA 1B44D 2JA6B 3NENA 1M8AA 4FXKC 4A3EB 4KLKA 3QWNA 1IBKQ 1CTMA 4DV2L 1XTDA 2EYOA 3AB9A 5LMNW 2F0LA 2K50A 3NP8A 1EY0A 4UHVA 5IP7G 5M9OA 1MJCA 4HSPA 2K6AA 3EROA 3F2CA 1B2TA 1P8LA 3PUXA 5LL6S 4DV7L 2AQ2B 3BVMA 2KA7A 4FF4A 1K83B 1E1TA 2DY7A 3D4RA 3F8TA 4BBRH 1D5XC 5HGQA 3HOXB 4B3ML 4A3BG 3K5OA 5E1FA 4EVOA 2JK8A 3ULLA 4FXDA 1D7QA 4ZK9B 1CQVA 1WCMH 1ZKOA 2X69A 2F3WA 4DUZQ 1KAWA 4B3MQ 3DM1A 1EFID 4CGYB 4CHTB 5M5YB 2UUBL 1PTOF 3F2DA 2CQOA 4K6DA 5LMUL 1ONLA 3K5LA 5E4WC 2NB0A 3FRPB 1BCPB 2R61A 4OEMB 2D0OA 1YNJC 3GTOH 4LFCL 1TU2B 4H02A 1CFMA 3D6CA 2QILA 1OXSC 2VQEL 5EPJA 1E0BA 4A76A 5BR8Q 2EPBA 2KHIA 1PHJA 3Q6SA 2UUCL 4BY7B 1HUMA 5GAHC 2IPKD 3HG9A 5A35A 1JWMD 3S1RH 1Q1EA 2E75C 3I55A 1N32L 5A2QL 2NBFA 1IW7D 1WTXA 5IGGA 4O1NA 4JI1L 3S14H 1DD2A 1BF4A 1C4QA 1Z47A 4H7BA 2BOSA 1BCPC 4DR1L 1ET6A 1SROA 2KHSA 2ALYB 4ODGA 1Q8IA 2CW0C 5C5MA 2V1CC 1AE2A 1K8MA 3GTMH 2HD3A 3R2IA 2VW9A 1F77A 4OWWB 4C3JB 3T4AC 3S1QB 4PMBA 3ZYYX 2OWOA 2AUJD 3HFZB 1M1KC 1C48A 2KBNA 4A3MB 2I5MX 1L2FA 3A74A 3U4ZA 2E8GA 2PI2A 1FL0A 2KHJA 5KYIA 3MEHA 1DONA 4EX5A 3SK4A 4K0KL 4GNXA 1Y1WB 1STYA 2HDLA 4O2DA 5I9PA 1PH8A 1SE4A 3CPFA 3KDFA 1I3QH 3H3VH 1BQQT 1I4RA 1EEID 3SHLA 1XMOL 3FKIG 5KNCA 1ESRA 1CHPD 3E9IA 1OXVA 4QB4A 2JA6G 1R9TH 1HZBA 1LT3D 4A3DH 4ZKBB 5JEAH 1RKNA 1PA6A 5GROA 3PO2H 3VYRA 3KF6A 3I90A 4K14A 4RGNA 4R4IA 1Q8KA 3T1HL 5C3EH 3PIP3 1FVIA 1G6PA 4GKKQ 2F0DA 2JJQA 2PZWA 5ISRA 2DJFC 1EIFA 3RR5A 1LO5D 2DNCA 2HDMA 3SK8A 5CORA 2BA1A 4BY1H 1WD1A 3TEHB 4IPDA 1C7YA 3BZDB 4QIWB 5FLXc 4L5TA 4YCUA 3CXCA 5EKIA 1X3PA 5JJLA 1TWGH 2QGQA 2E76C 4CKEA 2NZHA 3PF5A 1EYAA 1WTWA 5C6AA 1EIGA 2LY7A 4V0BA 5KEEA 1PH2A 2PMZB 1K83H 3MXGA 1HQRD 1PXUA 2JA5H 2F0OA 1Z7TA 3CMAA 2YTYA 1H9MA 2KEEA 2Z6KA 4AYBB 5M5WB 1SNQA 3A56A 5K36G 3OOCA 1B7YB 3D31A 1G291 4A3EG 4J15A 1GXDC 5M5XH 4BY7G 2R6GA 2VY3A 3GTMB 3RLOA 5BR8L 2R3ZA 4L5QA 5FOBB 4QF4A 4OWXB 2MNAA 3QOLA 4B3TQ 2KQ3A 3DWPA 4L5SA 3S17H 4FDBA 5IOCA 2CH4A 2FXQA 3SEBA 4Y7NH 4GN5A 1N32Q 3MFYA 5JEAJ 2Y0SB 1KRTA 4DAYB 4J1MA 4A3GH 1YBYA 4DV0L 3ITPA 4NDXA 4WORA 3TP8A 1QILA 1SNOA 2EYHA 3JC66 1D5ZC 4HSVA 1SFOH 2L0CA 1ZEQX 1X32A 1PDQA 5CBAE 2HCIA 2DJGC 3PO3B 1EWHA 1EQQA 4JV5Q 1JC7A 1A63A 3KDFB 4DFAA 4LFBQ 2DN8A 1K73C 2NVXB 4MTKA 2K7VA 4HCSA 1A3TA 3C2PA 4X3SA 1EL0A 3CAMA 1LTID 3PV0A 3NSWA 2PW7A 3GO5A 2CW0D 4IPCA 2IW3A 3LGJA 4DR4Q 1DM0B 5GQOA 3W3AA 4M8AA 1X6OA 3C3LA 4UP7A 4JOIA 4UP8A 2I46A 2AWNA 2LKVA 2JQOA 3K8AA 3W1BA 3FKIB 5ELCA 5IGFA 2Z9HA 1JWSD 4QIWE 3K80C 4GS3A 1V1QA 1SMXA 3K7AH 2RBMA 2N8NA 2EJGC 4DAPA 3NUCA 4DV2Q 2CCZA 1L1OB 2NN6G 4A93G 1KL9A 1A2UA 2OCEA 4NB3A 3CMEA 4JI7L 1X65A 1IBLQ 2NZOA 2B63B 1IL2A 4JOIC 1PRTD 1KLUD 4OELB 3CQZH 4MN3A 1C0AA 4YIJA 2A6HC 3FPPA 4IUNA 3IRBA 5J39A 4QGUA 1DXMA 4BS9A 3VYTA 3GTGH 2I07B 3B6YA 1D2BA 1LUZA 3CC4A 3E5SA 2D9UA 2B39A 2N78A 2VS1A 2YV5A 4LJZC 1SYCA 4GKKL 1SAPA 4BXXG 1II3A 4RWSC 5I6YA 1U0LA 5D14A 1Y8NB 4BBSB 4LFAQ 3Q24A 1Q90A 3QG1A 3NEMA 3IFDA 3I4NB 4A3LG 1EIHA 5IODA 1GO3E 1S40A 1H95A 2E5LL 3PO3G 4KHVA 3DHQA 4JI8L 3V2TA 1TT2A 1CM9A 2K32A 2QKIC 5T1GA 4OXPA 1KIXA 4DAYA 2BCOA 2F0IA 4GLVB 2XGTA 1G2TA 1MIUA 2E2DC 3MHBA 3OIQA 4RFBA 5L37A 5C5LA 1PH9A 2CH4W 3P20A 2Q2TA 1VS0A 2EXDA 2F0HA 2BE5C 2F0VA 2A73B 5C4HA 1NJIC 2DUDA 4XQQA 3RLNA 3RN5A 1M90C 2IL8A 1HR0L 1RDPD 1WTOA 1HTPA 3L7ZC 1BOSA 1K8AC 3TS2A 1KTKA 1CKNB 1KDCA 1PH7A 2JA8H 3I4MH 4QY7A 1E22A 1F2ZA 4POFA 4DR6L 3KF8A 4LK1C 5IGDA 4IFDG 4OIKA 4YWKA 3J80L 3HEJA 2F1MA 4QJFA 3URYA 4Y52H 1GJXA 3M9BA 3BVZA 2LSSA 2MO0A 1L1OC 4DKAC 4DUYL 1CSQA 2YU9H 1W3SA 4N8X1 1VMCA 1XNQL 2JA7H 2IT1A 2L9HA 1TWHH 3LWUA 3L9AX 1GUWA 5I2YA 2KCTA 5FLMH 1E2WA 4J6HA 4F88A 1HUNA 3IL8A 5GAEC 1ESFA 1TS4A 2CHBD 3CCSA 1Y8OB 1PTOB 1VCIA 1TXYA 3HOWG 1HCZA 4RCOA 2LXJA 4RKLA 3ONAB 3SXHA 4MNOA 1LTAD 3HOWH 3DEOA 2R7ZH 3S2HH 4K6LA 4X66L 3GTGB 1SFOB 2A69D 1FYCA 2M2LA 1EEFD 1SJHD 1D1IA 2FINB 4C3IG 5KGUA 3GTQB 3SDZA 3M7GA 4RGMA 4A93B 3G4SA 4KK7A 4DNTB 1G91A 4DV5L 2B2VA 3I4NG 2B63G 3S15H 1EY8A 3ULJA 3J7ZC 4A3LH 1IBKL 3HKSA 1PFSA 3MXNA 3ZJYC 1H9JA 4QL5A 3HOVG 3HOXH 5IYBG 1FNVA 3T1YL 4DGZA 3DLLA 1RJTA 1MSHA 1SSOA 1GUTA 4GKJQ 4L63B 5KNDA 4MIUA 4DU9A 5HGTA 5M3MG 1OXXK 3A5UA 2ZXRA 3IFTA 3GTKB 5BN3A 5M5YH 4ZCKA 3G6EA 1CZWA 4FXGC 2UXBQ 5M3MH 3G48A 1JB3A 1STEA 2KCMA 2JA8G 3I4MG 1VF5C 3CCUA 3BDCA 5EKLA 2F4VQ 3PF4A 5E3FA 1XPUA 3HOYH 4LFCQ 3H0GB 1B8AA 4YWMA 4B3TL 2KJXA 5M3FG 5EPLA 2EYLA 4TVAB 4MTNA 1SYDA 1XNRQ 4LW1A 4PG3A 2ENBA 3KUPA 1EY4A 3NWSA 1Z6HA 2EY2A 2B8GA 2FHTA 1BBUA 4JI5Q 2UXCQ 1UE1A 1PTOH 5COYA 4XT1B 1R4QB 4JI1Q 1N34Q 4X64L 1YVCA 3A54A 4A3JB 4DUYQ 4OO1I 1SN8A 2R7ZB 1SE2A 4JI5L 1QVFA 4A4IA 2PPBC 4DR1Q 4DR4L 1G51A 5CGKA 4IFDI 1VQPA 1U4RA 1KRSA 1YNNC 2WAQG 3DXJC 5EBDA 4L8JA 4DAVA 3S2DH 4TSSA 4ALPA 1SLJA 1BBWA 4I65A 2BA0A 3ULPA 2O5JC 1E24A 3J7A5 1BO0A 3MA2B 1PRTF 2RCFA 2R93B 3DEPA 2EJFC 2F0FA 4JI7Q 2UUAL 4XIGS 2EDGA 1EOTA 3Q0AA 4N9PA 1S5FD 2ZT9C 3STBC 3E0JA 1Y1VG 3CPWA 4HMIA 4XDXA 4R4CA 4X3KA 4L6TB 2NVTH 3RZOB 2F3IA 4KN7C 4J8QA 2F0SA 2DNEA 2QF7A 5FO7B 2NYZD 3M3YB 2MGSA 2O2LD 3J7YW 1XXGA 5IT9c 4YCVA 3CCJA 1BKBA 1JJGA 2K5NA 3FHWA 1I6VC 4LF8L 4QCLA 1SXTA 3HGBA 4YCWA 5ELEA 2HHHL 4XT3B 3D3RA 3NBHA 2E2JB 1IZ6A 1F2LA 4ILWA 3GTPB 2E2HB 2Z4HA 3UDXA 2UUBQ 2NZ1D 3R93A 3NQTA 3MXUA 2PW5A 1JWUD 1SDFA 4KKTA 4R1JA 5C4JB 3OSOA 4YHHQ 1KC8C 3AEVA 4A3BB 1MD2D 4CDDC 3RLFA 1D1KA 2ID0A 2OQKA 3EQLC 2FMCA 1AZQA 4JI2L 1N33L 4G7ZC 4C56C 2XWBB 2B2UC 3J80E 1CK1A 1WVLA 1VF7A 2EY6A 4WJ4A 3TBIB 1F2MA 1YEZA 1F9PA 3KFUA 5FLXE 5DM73 4QMGA 1ICFB 1HFGA 4DV4L 3KF8B 1HRJA 1EYDA 4OGQC 2QDBA 2K28A 1JQYD 3DM3A 2R7ZG 1HFNA 3GTKH 4C3HG 4IUPA 4U68A 1XNQQ 1IHZA 2F0MA 4U673 4FYDA 2PMZE 1XPRA 4C3IH 1ET9A 3TDQA 4AQYL 2A74C 3RUZA 5BN5A 2A6EC 4RH6A 4GZYC 2O4XA 1AZPA 1EFWA 2WIIB 5H1SE 1NCVA 3MAQA 1D6EC 1PVOA 2UU9Q 2R7FA 4AQYQ 3GTLB 1B3AA 2WKCA 1HNWL 5CV4A 1KNAA 1NR2A 4CJ0B 4N8FA 4BA2I 1TY2A 2L11A 5A2QE 2QDLA 4DK3C 3J7AF 3SR1A 2ZTEA 1VQ9A 1N9WA 1ICWA 1K3BC 1BBXC 2Y0SE 4DR5Q 1IBML 4KTAA 1UEAB 3PUYA 2SOBA 4DV3L 4PZ7A 1PH5A 1YI2A 4CBVA 1JOKA 4BBRG 1NMGA 4ZKCB 3UI2A 2WKDA 3D4WA 3GV6A 3H09A 5DNFA 4DR5L 1IBMQ 2EZVA 3HKZE 3UDGA 4DV5Q 4LF7Q 1J8IA 4EQNA 3T1HQ 4ZUJA 4DV3Q 4QUCA 2JA6H 2CFMA 3LNNA 4A3EH 1ENFA 4FO2A 2L5TA 2IX3A 4GOPC 1O80A 2PNRC 2OTLA 4OX9Q 2IX1A 4NXMQ 2RDHA 4JW0A 3K57A 1A3VA 1FGUA 4B3SQ 5JEAG 2SNSA 1FGBD 3OYYA 1LTGD 1HR0W 1CUKA 3D0FA 4ZYSA 5C0XI 1O7LA 1ML0D 4KHZA 4BBSH 2PI2E 3BJUA 4MZ9A 4KHPL 4DR2L 1LACA 1VQ4A 2BH8A 2JYOA 2NUCA 4UDUC 1GHKA 1PYBA 1QNKA 3F2UA 3AFQA 2R92B 1G2SA 1UE7A 3DWQA 2E2IH 4FNFA 1OO9B 2VUMH 3S1NH 1NE3A 1TS3A 3FPUB 1X9NA 1V9PA 2E5LQ 4NXNL 2LXKA 3M4QA 2OT2A 5AJ3L 1YJWA 2VUMG 3J7AV 4CDFC 4ME5A 1UE5A 3GTPH 1CKOA 2RA4A 3TQYA 4BBRB 4OO1H 1WD0A 1Y1WG 2F0JA 5KRUA 4OHJA 1V8QA 1XNRL 3I4NH 4ULLA 2UXCL 2ZJQA 1LTTD 3PIPA 1STGA 3R3OA 2F0UA 2RQXA 2NN6I 1PH6A 3PIO3 4NMZA 4KN4C 3S24A 3MWYW 4X62Q 1B1ZA 2VB3X 2Z6KC 4X3TA 4IJHA 5CV9A 4ZQ3A 1B70B 1BUVT 4XQJA 3E0EA 1WTRA 3QB3A 3H3VI 1ENAA 4A75A 2A19A 1JT8A 3JAME 3J81E 4GLXA 2A68C 3GTJB 5ELNA 3WDNA 2Y0SG 3L2PA 2GN5A 4GNXC 2KCCA 4Q5VA 3CKIB 4HCEA 1NBWA 2EYJA 2PYKA 2JP1A 4B3RQ 2K01A 1B4OA 1MI2A 3IKJA 3VR2A 2GVBA 4HIMA 1A8VA 3T56B 2RSOA 4GN4B 2EVBA 1QOHA 2K04A 1EQVA 2JA7B 4G7OC 1CI3M 3PO2G 4JI4Q 3Q22A 3HOUB 3U58A 1O7IA 4JPBW 4NPSA 4YWLA 2KECA 1PMRA 3U4VA 5M3FH 3CD6A 3DMUA 3PMFA 2ATWA 1HZCA 1SJED 1JE4A 5D3DA 2K5VA 3NWTA 2A1AA 5EGTA 3VR6A 3H3VC 2I5HA 4A3MH 2KOLA 2MFIA 5I6WA 1CQFA 4B9WA 4HJ7A 3JAMi 3J81i 4LFAL 2L15A 1SR3A 1VQNA 1CKMA 1J5EQ 1NNXA 1QB5D 2K75A 2ZXPA 1F2YA 1V43A 2IHFA 2Q8RE 3KBGA 2P5ZX 1Z9FA 1S5CD 1STNA 1YNJD 2AMCB 1EQTA 1AE3A 4A3KB 1UNSA 1Q3LA 4H0LC 4OWTB 5HY6A 1GM5A 3CRKC 3Q23A 1N33Q 4KHPQ 1L1OA 2L4NA 2RHSB 3ER0A 5EBCA 1O78A 4ZAIA 3KK7A 4A3IH 2C35B 1KAAA 4B08A 4DV4Q 3RMHA 3S16B 3VYSA 5F2DA 3EJIA 1GOZA 3I2ZA 1K28A 1I4PA 5JVH3 5AJ3Q 4HIOA 2EYFA 4RA8A 3MEFA 1X56A 3HOYB 5LL6X 3OTOL 2ZJPA 1QUQA 1EZ6A 4K5WA 5IYDG 1LT5D 1VQDA 3TP6A 4X6AH 5FKAC 3NHHA 1TS5A 2MP1A 2XWJB 4JK1C 5M3MB 2CQAA 5T1IA 4JCVE 3MTSA 4RHSA 1HNWQ 4X65L 1X54A 2B2TA 1NR4A 3S17B 1EUJA 2VXWA 4P75A 3VR4A 5LHY1 1Q7YC 2AQ1B 4DR3Q 2IX0A 1B50A 1DGSA 2JA8B 3I4MB 1Q86C 2A8VA 5C4XH 1KNEA 1CT1D 1GUOA 2RDFA 3R8BA 3J81j 4E6IA 1DOLA 1XMQQ 3NQIA 2R93G 1Q1BA 4GN3B 4OL7A 1VQKA 5IYDH 2K52A 3ND8A 1VQ8A 4C2MB 2A5HA 2LMCB 1BNZA 1S4ZA 4LF5L 2UUCQ 2Q2HA 4R4QA 2NVXH 1XYIA 2CWPA 4X66Q 1TWAB 3OWEB 2PCFB 3S2DB 1ASZA 2M00A 4P72A 1I94Q 1RHPA 4B3RL 3TSSA 4LF7L 2MHVA 4NP5A 4OX9L 3P75A 3A55A 3CHBD 5C0XH 4GNXB 3RN2A 2JA7G 1KABA 1I6HH 3A8JE 3T53B 3MC0B 3EBEA 1ASYA 4DV7Q 2A68D 3PO3H 4A3IG 1TWCH 1GHJA 4B3SL 3BS1A 1CA5A 3TS0A 1SNPA 1EU3A 4GLAC 4H13C 3V96A 5KNBA 2WB1G 2J4XA 2D62A 4A93H 5NUCA 3PGZA 1R9TB 2Z8LA 3PCOB 2IHEA 3E3XA 1PFNA 4LMQD 3J80c 3IAYA 3KLSA 5IYBH 1IKMA 2WP8J 3S16H 3GDEA 4DR7Q 3CRLC 5IGBA 3FDTA 1RD9D 4NW2A 4F8MA 5C4JH 4LUOA 5C3EB 5K36H 4EQPA 4WFN3 1IKLA 1JJ2A 3HOXG 4NXNQ 4KMUC 4C3HB 3A8KE 5CV6A 1M4VA 2B8FA 2I5LX 3CQZB 4YHHL 1SNDA 2MPMA 5EQ0A 3NPPA 2ZTCA 2OF1A 1WTQA 3N52A 3NBHB 4CKCA 3VDYA 1W6JA 5IYCH 3GTOB 1I4HA 2Q8TA 1W6KA 4IURA 4ZLTF 1EZ8A 3BG3A 5FLMG 2XNAC 2A69C 4DK0A 1FNUA 4Q0FA 3NE5B 2JA5B 3OTOQ 2HT1A 4C3IB 1J6QA 2FFKB 1AP0A 4X64Q 1I4XA 3U9OA 3QIAA 1QNUA 3CU7A 4RHRA 4DK1A 2XSCA 2AKWB 4V190 1HZ9A 5DAUA 3ERSX 1O7YA 2WB1B 1PRTB 5CV5A 4PNYA 1X55A 2QCPX 4FVMA 3AQQA 2EIFA 1W2BA 5JPMC 2PZTA 1H9SB 4KKUA 4CJ2C 4JI4L 5EKKA 2EJMA 3S1QH 2K14A 4K2KA 2JN4A 3A7LA 2F0WA 3WOEA 3RNUA 4A3GB 1RODA 5C44H 2HIVA 1HA5A 1DJRD 1GUSA 4FF1A 1MSGA 1EWCA 1G8ZD 1QUQB 3VR5A 1GKHA 1N36L 1STBA 5JPNC 2B2WC 4CDEC 5FJ8G 3STBD 1QJOA 1UUPA 3A7AB 1NUCA 3PUZA 4F7XA 4G7HC 2FMMA 1STAA 3D6WA 2TMPA 1SE8A 1EIYB 4DV0Q 1PV4A 2F52A 3TN2A 4A3JG 1WI5A 1TWFB 2RKSA 3K0XA 1TWAH 2IJ0A 4ABNA 3HOZB 2HUGA 5CV8A 1MGSA 3CCMA 4UY8C 1WYDA 1ENCA 1IW7C 1PYSB 4LFBL 4IUVA 4GKJL 1VQ5A 3JAMc 3J81c 1VQ6A 1QWYA 4LAAA 4QQBX 1VQMA 3HOWB 4WJWA 1RTOA 5K5PA 3X3NA 5CYUA 1BXTA 4KI0A 5C3XA 2NVTB 1XTCD 4JBJA 3KBXA 4BY1B 2NVYH 4PV1C 5FK9C 1X3GA 3HOUG 4LF4Q 4G57A 4A3CG 1EYCA 3GTQH 4JI6Q 3TZUA 2R92H 1EQRA 2F4VL 1QCBD 3DUZA 3OHXC 2JE6I 3E9HA 5DM63 4IPGA 1A0IA 3QOJA 5FO9B 2EE1A 2NVQH 3AYHB 1VQOA 1ZXTA 1K0SA 1JORA 1JCKB 1YZ6A 2N88A 3QR8A 1HNXL 3NELA 2WB1E 2XRQD 3SGIA 1TS2A 5AFWA 1PFBA 4AH6A 2ZM6Q 5JJKA 3K81C 1WOCA 2PQAB 4TRDA 4IOAA 4X65Q 2F0NA 1HH2P 2WAQE 1A62A 4RCNA 3F1ZA 1HXYD 4OONA 3NTHA 5C3WA 5C44G 3K5NA 4IOCA 4A3FH 3K7UC 5FO8B 4JYAL 4DNIA 1K3RA 2E2IB 3K59A 1VQ7A 1N8RC 2EYPA 1SEBD 5ELDA 2BDOA 4KY5A 3K0YA 4JV5L 2C9OA 2ZJRA 4LF6L 4K2LA 1C9OA 5EPKA 1SYGA 4A3JH 1UEBA 3M7NA 3FVQA 3H6MA 1VMPA 3SE0A 2NWGA 4BY1G 4KY6A 1L0XB 3EA6A 1Q12A 1TKWB 4JI0Q 1E7ZA 1WTPA 5J22A 1TR5A 3VR3A 1QVGA 3K6OA 2VQEQ 3HOVH 1PZID 2VQFL 2K05A 4OIJA 2UUAQ 1U4PA 1WJJA 3ICEA 3SK6A 1I3QB 4ME3A 4CDCC 3HOZH 2ZTDA 1MJEA 1G6ZA 1DOKA 1HPCA 3RZDB 1I5FA 2KVMA 1KDAA 4HTHA 1SMYD 3C46A 1O7ZA 1IBLL 2E74C 2RVLA 3HOUH 1OTCA 2H5XA 4C3JH 4KKSA 2QEJC 4MHEA 2WACA 5E4XA 4RGTA 1VQEA 2AWOA 4DXGA 3FKIH 4F87A 1YIJA 2B3GA 1EY6A 3K7AB 5IIFA 2KUMA 2FJ2A 1V1PB 2UXDQ 1XWEA 3OPOA 1BVSA 3KLRA 2IWHA 2F0EA 1Y8PB 3E6ZX 3MVVA 1UE6A 5JJIA 3BYYB 3QO2A 3HOZG 3EVQA 3GD7A 2X6GA 1SYBA 4ID6A 3LX0A 3VA7A 5EJWA 1T9HA 1RIPA 1RF2D 4C3JG 1V1PA 1JB7A 4JI2Q 2R93H 3CCLA 3AMUA 4K0KQ 3V05A 3TRZA 3EIVA 3S15B 1JMCA 2XVSA 1NAPA 1U5KA 4A3FG 4LUVA 4A3KH 2RCNA 1J5EL 1D5MC 5IGEA 3OMGA 5IP9H 1K0RA 4HJ5A 3W2DA 1LTSD 3BU2A 3MXPA 1XMOQ 4LF4L 4A3BH 1B53A 3G71A 3AU7A 1BCPD 1EY5A 3BDLA 3PSIA 1YITA 1UAPA 1LV9A 1WCMB 4FP5D 4JI6L 2K5QA 1HQMC 1YHQA 2A6ED 4XTCS 2F0QA 3M4YA 4DR6Q 4JC0A 1HNXQ 2ICIA 2O5IC 3H91A 2F03A 1SE3A 2N3SA 4XXEA 1TWGB 3TP5A 3D8GA 2KENA 1MHWC 5C0XJ 2VUMB 1GUGA 1FNWA 1DCZA 4IQZA 3I56A 1E2ZA 2HIXA 4IUUA 3T1YQ 2QEXA 2PO4A 2NVQB 1E1OA 1KD1C 3L3OC 1CHQD 2EXZA 5EAYA 1LM0A 4JYAQ 2MO1A 4JBWA 3OIPA 2AQ3B 4EGVA 3LWEA 5LMUQ 4R4TA 5CV7A 5IT9L 1K9MC 1Y1VH 2MQHA 4GOPB 3BDOA 4DR3L 1YNXA 4IJLA 1E3PA 2JEBI 4LF9Q 4LUZA 1I4GA 1U4LA 1PZJD 2ICEC 1PYWD 5CBEE 1N36Q 1P16A 2JXMB 1JOOA 1F9QA 1VQBA 1JOQA 1NTGA 4JI0L 1V1OA 1EWIA 3W5OA 4DV6L 1X3QA 2LFNA 4AYBG 1PFMA 2Z0SA 1BCPF 2OXPA 1CA6A 3U9SA 2VQFQ 1VQCA 4HEDA 3A5ZB 1TVXA 2A6HD 2L1BA 1QZGA 4APVA 3I70A 1C8CA 4NXML 2EQSA 2F4IA 1AEXA 5CR3A 4C1NK 1TY0A 1NY4A 1H9KA 3CP0A 4C2MH 3I7FA 4JG2A 1WTHA 1LLRD 5C4XG 1HA6A 3C1FA 5IE8A 4I7ZC 1LYLA 3EN2A 4IPHA 1VQFA 1WCMG 5M3FB 4RKBA 5KYLA 3P1HA 3KLSX 1QZHA 5IWAL 1VQAA 3PUWA 2PQEA 1Q81C 2PNHA 2G5DA 3CC7A 3HKZB 5HURA 1YJNA 3CCQA 5IWAQ 3RZOH 3QJYA 3L0OA 1TWCB 1JE5A 4DPGA 3KJOA 4POGA 1BR9A 4C3HH 2NN6H 1MBYA 4RGOS 4DK6C 4WRDA 5I4DA 2JA5G 2SEBD 4B9XA 2E2JH 1SYFA 3S1NB 1S72A 2CWAA 3I73A 4TKOB 2X6LA 2IY5B 4H44C 2G9DA 2KCNA 3GP7A 1TQOA 3BZCA 1CKNA 3HS0C 5E7NA 3G6JB 2YTVA 3TP7A 3TZDA 4P2CB 2DGYA 4JVZA 1YJ9A 1BDOA 4HR7B 3HRZC 1EY7A 2BDNA 4LF8Q 4BY7H 2QW7A 5LMNQ 1SRUA 2JSOA 3A0JA 3A8IE 4K5VA 3I3CA 4UP9A 2H1EA 3CCEA 3BVGA 1ILPA 3S9WA 1CSPA 4HIDA 1GVPA 4G4KA 2B2UA 2B2TC 5LMNL 2HQLA 4JBMA 3S14B 1B9NA 1IYJB 5M5XB 3UDFA 4LF6Q 4ZRZA 2CKZB 2XN9C 5FLXL 4C1NI 1STHA 3HP3A 1AW7A 5JOBA 4JI8Q 3CW2C 4I7AA 4FF2A 1B9MA 2B29A 2NTTA 4CJ1B 1PH4A 1L0WA 5IT9E 4LF5Q 4M1UB 4A3DG 4DV1Q 4P71A 4PQXA 1SNCA 4IZ8A 3EFXD 1TIID 3PQIA 1WFQA 3S1RB 2N55A 3T13A 3OW7A 1I50B 2RHQB 4HJAA 2Q2UA 1IYUA 4LF9L 4DA2A 3CCVA 5IP7H 1XPOA 5C4XB 1QE6A 4A3KG 4JI3Q 3K5MA 3S2HB 2LS01 2JEAI 2K03A 1TWHB 3PUVA 5TSSA 1H9RA 3PIOA 3CF5A 5CC4A 1K8GA 3OW2A 1WTVA 2GA4B 1SMYC 3NBIA 5J1ZA 4R4OA 1A6XA 3GTJH 3D4DA 4AIMA 1B3QA 4NKLA 3HKZG 2OTJA 2UU9L 4QUFA 3VA5A 2EY1A 4RG1A 1OXUA 4EQ5A 1JR0D 4R8NA 4OO1G 4K5XA 1AH9A 1U9RA 3WWVA 3S1MH 1KXLA 3M3YH 1HZAA 2TSSA 4S3SA 2VL6A 3N6RA 4XQNA 1GD7A 3K58A 1A3UA 1YHAA 1DOMA 1K8OA 1AFPA 3FEWX 1L0YB 1T5EA 4PZ8A 4A3DB 2NVYB 2EOTA 4R9WA 5GADC 3M85A 2L55A 3PO2B 3I91A 4IUQA 1EOVA 3MXNB 3GQBA 1S5ED 4IALA 1KHIA 4RMFA 4BXXH 3H15A 1I4QA 1NMFA 1EU4A 4L5RC 4ZUIA 1PH3A 1Q82C 3DWAA 4A3IB 2GVAA 2D0PA 4HAEA 3MZ5A 5ELOA 4PZ6A 3I4LA 5M5WH 1PTOC 4PMCA 2Q2IA 2YTXA 3UDIA 4JBKA 2Q8IB 5GAGC 1FR3A 1QVCA 3FMCA 1F9SA 2ES2A 3NXWA 2ZM6L 1OXTA 2Z6BA 4GOPA 4KD4A 4PMWA 4TQUS 5I9OA 4A3FB 3TMEA 2RF4A 3NTIA 5C4ZA 4EQOA 5IYCG 3M4OH 4RAUC 1X3EA 2WINB 2YYZA 4XYOA 3T51B 4DNRB 2XRSD 1I50H 2B2YC 2EYMA 1Y14B 5I2XA 4XYQA 1GUNA 2D5DA 1NSNS 5KIXA 3UE0A 2UXBL 4WJ3M 1KDBA 1KLGD 3H0GH 4K8JA 2WAQB 2YU9B 4A3MG 1PRTC 3UE1A 1I94L 4DXFA 5BN4A 4YY3Q 3P7JA 2F3VA 3RD4A 4DV6Q 4DV1L 2K5WA 4HMJA 4O0AA 3HOYG 4KD3A 1QG7A 1FJGQ 1HNZQ 4P73A 4Y7NB 4KJOA 4IO9A 3F2BA 1PH1A 2HQEA 2SNMA 5C3EG 4KV6A 3KF6B 5J3BA 2F0PA 2BH2A 2B2VC 2MUYA 4AYBE 2HCCA 3I4OA 3H0GG 3I8ZA 5JAVA 4BA1I 1VQJA 4DF7A 5FJ8H 2B2YA 3S1MB 5G3LF 2D2CC 3H94A 1HJPA 4DAMA 1R4PB 2NTSA 3CCRA 4IFDJ 3SK5A 1UWVA 2VNUD 1D8LA 1T5XD 4LNQA 3HOVB 2KEDA 4KJNA 2K4KA 1RTNA 1X3FA 4Z9CB 2RDGA 5C0XG 1S5BD 2BE5D 4DR7L 2DY8A 1AN8A 2V4DA 4BWGB 4DR2Q 1SNMA
chains in the Genus database with same CATH topology
3PIPA 2UXDL 5DLQE 2VQFL 2UUAQ 3NEMA 1WJJA 3ICEA 4A3LG 2NN6I 4ME3A 1GO3E 1S40A 2ZTDA 1PH6A 1MJEA 2E5LL 3PO3G 3HOZH 3S24A 1H95A 4JI8L 1I5FA 4X62Q 2Z6KC 3W1GA 1IBLL 4OXPA 1KIXA 3KOJA 4IJHA 3HOUH 4GLVB 1B70B 1VQGA 2XGTA 3E0EA 1OTCA 2B63H 2H5XA 1MIUA 4C3JH 3H3VI 4A75A 2A19A 1JT8A 4UPAA 1PH9A 4P74A 3AFPA 1VQEA 2AWOA 3Q8DA 3FKIH 2Q2TA 1VS0A 2EXDA 4GLXA 1YIJA 2B3GA 5ELNA 1MKHA 2Y0SG 3L2PA 2GN5A 2UXDQ 1NJIC 1BVSA 2DUDA 1M90C 3RLNA 3RN5A 3J80i 4GNXC 1HR0L 3CC2A 1UE6A 5JJIA 2E2HH 3L7ZC 3HOZG 3TREA 1K8AC 2R92G 3TS2A 3GD7A 1CKNB 4A3GG 1NBWA 1PH7A 1T9HA 1RIPA 4DUZL 2JA8H 3I4MH 4QY7A 1E22A 4POFA 4DR6L 4B3RQ 2GVBA 4HIMA 1A8VA 4IFDG 4YWKA 1JB7A 4GN4B 4JI2Q 2R93H 4X62L 3CCLA 2K5HA 3KYHC 4QJFA 2N49A 2HHHQ 4K0KQ 4Y52H 3TRZA 3EIVA 3M9BA 2LSSA 2MO0A 1JMCA 4A3FG 1U5KA 4JI4Q 4LUVA 4A3KH 1L1OC 2RCNA 4DKAC 1CSQA 4DUYL 3U58A 1O7IA 1W3SA 3BZKA 4NPSA 1J5EL 4YWLA 1S3OA 5IP9H 2ASBA 1XNQL 3U4VA 2JA7H 1K0RA 5M3FH 3CD6A 1HR0Q 1LTLA 4HJ5A 4HJ8A 2IT1A 1XMOQ 3BU2A 2WFWA 4LF4L 1TWHH 4A3BH 3G71A 4BBSG 2ATWA 1HZCA 5IP9G 3PSIA 1YITA 2QA4A 4JI6L 2KCTA 2K5VA 5FLMH 2A1AA 2VZAA 2I5HA 4A3MH 2MFIA 1VQHA 5IY0A 1YHQA 4XTCS 4HJ7A 3JAMi 5GAEC 3J81i 4HJ9A 3FP9A 3CCSA 4LFAL 4DR6Q 3M4PA 1VCIA 2L15A 1TXYA 4JC0A 1HNXQ 3HOWG 1SR3A 2PQAA 1VQNA 2N3SA 1CKMA 2LXJA 1J5EQ 2K75A 2KENA 5C0XJ 4MNOA 4YY3L 1V43A 4JI3L 2IHFA 3HOWH 2R7ZH 2JA9A 1Z9FA 3I56A 3S2HH 3T1YQ 2HIXA 2AMCB 2QEXA 1IXRA 4X66L 2AHOB 1AE3A 1Q46A 4OWTB 5HY6A 1Y1WH 1GM5A 1E1OA 1FJGL 1N33Q 1HNZL 1KD1C 3GTLH 1N8RC 4LWCA 4KHPQ 1L1OA 2RHSB 3ER0A 3U50C 5EAYA 1LM0A 4JYAQ 4HIKA 3KJPA 3G4SA 2MO1A 4JBWA 4DV5L 3I4NG 4A3IH 2B63G 2C35B 1YHBA 3S15H 5LMUQ 1JJCB 1KQSA 4R4TA 4DV4Q 1K9MC 3ULJA 1N34L 1Y1VH 2MQHA 4GOPB 3KLWA 3J7ZC 4A3LH 3I2ZA 4DR3L 1IBKL 1YNXA 3HKSA 3RZDH 1PFSA 4IJLA 1VQLA 1E3PA 2JEBI 1TWFH 3ZJYC 5AJ3Q 4LUZA 4HIOA 1XMQL 4LF9Q 3MEFA 2OQ0A 2XTIA 2R7DA 1X56A 4QL5A 3HOVG 1RL2A 1VQIA 1N36Q 1XJVA 1P16A 3HOXH 3OTOL 5IYBG 2I0QA 3T1YL 1VQBA 1NTGA 2ZJPA 1QUQA 4JI0L 1EWIA 3DLLA 3W5OA 5IYDG 4DV6L 4AYBG 1VQDA 4GKJQ 4A3CH 4X6AH 2Z0SA 4JCVE 2VQFQ 1VQCA 3NENA 1OXXK 3A5ZB 5M3MG 4X65L 3A5UA 1HNWQ 5M5YH 1QZGA 1X54A 4KLKA 4APVA 3G6EA 1EUJA 4NXML 2EQSA 2UXBQ 4P75A 5M3MH 3G48A 1Q7YC 4DR3Q 4DV2L 1IBKQ 1XTDA 2IX0A 5LMNW 1DGSA 2K50A 2KCMA 2JA8G 5IP7G 1Q86C 3I4MG 2A8VA 1MJCA 1NY4A 5C4XH 3CP0A 3F2CA 4C2MH 3I7FA 3CCUA 1P8LA 3PUXA 3J81j 1XMQQ 4DV7L 4JG2A 1Q1BA 2R93G 4GN3B 1VQKA 5C4XG 5IYDH 2K52A 2F4VQ 1E1TA 3PF4A 1VQ8A 3F8TA 5IE8A 4BBRH 5HGQA 4LF5L 1LYLA 1XPUA 3HOYH 3EN2A 4LFCQ 4B3ML 4IPHA 4A3BG 1VQFA 1B8AA 1WCMG 2Q2HA 4R4QA 4YWMA 2NVXH 2UUCQ 4B3TL 2CWPA 2JK8A 3ULLA 4X66Q 5M3FG 1QZHA 4TVAB 1D7QA 4MTNA 1XNRQ 1ASZA 5IWAL 1VQAA 3PUWA 4P72A 1I94Q 4LW1A 4PG3A 2PNHA 1WCMH 1Q81C 4DUZQ 1KAWA 4B3RL 4B3MQ 3CC7A 4LF7L 4OX9L 2UUBL 3F2DA 1BBUA 4JI5Q 1YJNA 3CCQA 4GNXB 5IWAQ 3RN2A 2JA7G 3RZOH 1UE1A 2UXCQ 2CQOA 1I6HH 5LMUL 3L0OA 1JE5A 4DPGA 3EBEA 4JI1Q 3KJOA 1ASYA 1N34Q 4X64L 1YVCA 4POGA 4DUYQ 4C3HH 4OO1I 1SN8A 2D0OA 4DV7Q 3GTOH 4JI5L 4LFCL 4DK6C 1QVFA 3PO3H 2JA5G 4H02A 4A4IA 4A3IG 1TWCH 2E2JH 4DR1Q 4DR4L 4B3SL 1G51A 1S72A 1OXSC 2CWAA 2VQEL 4A76A 2IY5B 4IFDI 3TS0A 5BR8Q 1VQPA 3BZCA 1CKNA 1KRSA 2KHIA 1PHJA 2UUCL 5E7NA 2WAQG 2YTVA 5GAHC 4GLAC 2DGYA 1YJ9A 2WB1G 3S2DH 3S1RH 2D62A 1Q1EA 4A93H 3PGZA 4LF8Q 4BY7H 4ALPA 3I55A 3PCOB 2IHEA 5LMNQ 1SLJA 1BBWA 1SRUA 1N32L 3J80c 5IYBH 2BA0A 3A0JA 3ULPA 4JI1L 3S14H 2WP8J 4UP9A 3S16H 1E24A 3J7A5 1Z47A 3GDEA 3CCEA 4DR7Q 1CSPA 4HIDA 1GVPA 4JI7Q 5C4JH 4LUOA 2HQLA 5LMNL 4DR1L 4JBMA 1SROA 2UUAL 1IYJB 4XIGS 1JJ2A 3HOXG 2ALYB 3UDFA 4LF6Q 4NXNQ 2V1CC 2CKZB 1AE2A 3GTMH 2YU9H 2I5LX 4JI8Q 3STBC 2VW9A 3CW2C 1Y1VG 4YHHL 3CPWA 4OWWB 4R4CA 2B29A 2NVTH 1PH4A 1L0WA 2F3IA 2ZTCA 4LF5Q 3PO2G 2OWOA 3HFZB 1M1KC 4A3DG 2KBNA 4DV1Q 4P71A 2I5MX 5IT9c 1L2FA 3A74A 4YCVA 3CCJA 3U4ZA 1BKBA 3NBHB 2E8GA 2PI2A 1JJGA 1FL0A 2K5NA 3FHWA 2KHJA 1WFQA 3VDYA 4LF8L 3HOVH 5IYCH 4EX5A 4YCWA 2HHHL 4GNXA 4K0KL 4O2DA 1PH8A 5FLMG 2RHQB 1IZ6A 4HJAA 2Q2UA 3CPFA 4LF9L 4KHPL 3CCVA 3KDFA 3UDXA 2UUBQ 5IP7H 1XPOA 4A3KG 1I3QH 3H3VH 3OTOQ 4JI3Q 1XMOL 3FKIG 4R1JA 3E9IA 2HT1A 1J6QA 4YHHQ 1KC8C 4X64Q 2JEAI 3AEVA 3PUVA 1OXVA 3PIOA 2JA6G 3CF5A 1R9TH 3RLFA 1HZBA 4A3DH 1K8GA 2ID0A 2OQKA 4JI2L 3OW2A 1PA6A 5GROA 2AKWB 1N33L 3PO2H 1HZ9A 3KF6A 3ERSX 4WJ4A 4R4OA 3GTJH 4R4IA 1Q8KA 1YEZA 4AIMA 2OTJA 3HKZG 3T1HL 2UU9L 3KFUA 5C3EH 1FVIA 1G6PA 4GKKQ 4RG1A 2JJQA 1EIFA 1OXUA 3KF8B 3RR5A 1X55A 4EQ5A 4DV4L 3AQQA 2EIFA 1W2BA 2BA1A 4BY1H 4OO1G 3DM3A 2R7ZG 3GTKH 4JI4L 3TEHB 1AH9A 4IPDA 3S1QH 2K14A 3WWVA 3S1MH 1KXLA 3M3YH 3RNUA 1C7YA 1HZAA 5C44H 1XNQQ 2VL6A 5FLXc 4L5TA 1GD7A 4YCUA 2HIVA 3CXCA 2PMZE 1YHAA 5JJLA 1TWGH 4C3IH 1XPRA 1QUQB 2QGQA 4AQYL 1GKHA 2NZHA 3PF5A 1N36L 4PZ8A 5GADC 1EFWA 3M85A 5FJ8G 3STBD 5H1SE 1PH2A 1K83H 1EOVA 3MXNB 3PUZA 1PVOA 1KHIA 4RMFA 2R7FA 4AQYQ 2JA5H 2UU9Q 4BXXH 3H15A 1SE8A 1NMFA 1EIYB 4DV0Q 3CMAA 1PV4A 2F52A 4L5RC 4A3JG 1HNWL 1WI5A 1PH3A 2YTYA 2Z6KA 3K0XA 1Q82C 1TWAH 4BA2I 5K36G 2GVAA 2D0PA 1B7YB 3D31A 3CCMA 4UY8C 5ELOA 4PZ6A 1WYDA 1G291 1PYSB 4DK3C 4A3EG 5M5WH 4J15A 4GKJL 4LFBL 2Q2IA 2YTXA 5M5XH 3UDIA 1VQ5A 4JBKA 4BY7G 2R6GA 2VY3A 3JAMc 2ZTEA 3RLOA 3J81c 5BR8L 1VQ9A 1VQ6A 4QQBX 1VQMA 1N9WA 4L5QA 5GAGC 2Y0SE 4DR5Q 1IBML 4OWXB 2MNAA 1QVCA 4B3TQ 2ES2A 3PUYA 2ZM6L 4DV3L 1OXTA 4KI0A 4PZ7A 4GOPA 1PH5A 4FDBA 4L5SA 3S17H 1YI2A 4JBJA 4PMWA 4TQUS 4BBRG 2NVYH 1NMGA 2FXQA 4Y7NH 1N32Q 1X3GA 4GN5A 2RF4A 5JEAJ 3HOUG 4LF4Q 5IYCG 4DR5L 1IBMQ 4A3CG 3M4OH 1KRTA 3GTQH 4DAYB 3HKZE 3UDGA 4DV5Q 1X3EA 4JI6Q 4LF7Q 4A3GH 2YYZA 1YBYA 4DV0L 3T1HQ 2R92H 4DV3Q 2JA6H 1EQRA 1I50H 2CFMA 2F4VL 3JC66 4A3EH 1SFOH 4GOPC 1Y14B 2JE6I 3E9HA 4IPGA 2OTLA 1A0IA 4OX9Q 2NVQH 3AYHB 1VQOA 2IX1A 4NXMQ 1YZ6A 3UE0A 2UXBL 1EQQA 4WJ3M 4JV5Q 1HNXL 1A63A 3KDFB 3H0GH 4LFBQ 3NELA 1K73C 2WB1E 4A3MG 1FGUA 3SGIA 3UE1A 1I94L 2ZM6Q 4AH6A 4YY3Q 5JEAG 4B3SQ 5JJKA 3CAMA 3K81C 1EYGA 1WOCA 2PQAB 3OYYA 3PV0A 4X65Q 1HR0W 4DV6Q 4DV1L 4IOAA 3GO5A 1CUKA 1HH2P 2WAQE 3D0FA 4IPCA 3LGJA 1A62A 5C0XI 4DR4Q 4KHZA 4O0AA 3F1ZA 2PI2E 4OONA 5GQOA 3HOYG 4BBSH 1X6OA 3BJUA 4MZ9A 4UP7A 1HNZQ 4JOIA 4UP8A 1FJGQ 5C44G 4IOCA 4DR2L 2AWNA 4P73A 1VQ4A 2JQOA 3K8AA 3W1BA 2BH8A 3K7UC 3F2BA 4IO9A 5C3EG 4A3FH 1PH1A 4JYAL 3KF6B 5J3BA 4DNIA 2BH2A 1K3RA 4AYBE 1VQ7A 4QIWE 1PYBA 1V1QA 1SMXA 3K80C 3I4OA 3K7AH 2N8NA 4GS3A 3AFQA 4DV2Q 3H0GG 2CCZA 1L1OB 2NN6G 4A93G 1KL9A 4NB3A 2OCEA 4BA1I 3CMEA 4JI7L 1VQJA 1UE7A 1X65A 5FJ8H 1IBLQ 2E2IH 2NZOA 3S1NH 2VUMH 1NE3A 4JOIC 1IL2A 1X9NA 1V9PA 1HJPA 4JV5L 2E5LQ 4DAMA 2ZJRA 4NXNL 4LF6L 3CQZH 2LXKA 1C0AA 3M4QA 5AJ3L 3CCRA 1YJWA 3IRBA 4QGUA 1C9OA 2VUMG 3GTPH 1UE5A 4A3JH 1UEBA 3M7NA 3GTGH 4IFDJ 1CKOA 1UWVA 3TQYA 2VNUD 3B6YA 1D8LA 4BY1G 4LNQA 1LUZA 3CC4A 2K4KA 2VS1A 1Q12A 2N78A 2YV5A 1Y1WG 4JI0Q 1X3FA 4GKKL 1XNRL 1E7ZA 5C0XG 4BXXG 1QVGA 4DR7L 3I4NH 1U0LA 2VQEQ 2UXCL 2ZJQA 4DR2Q 4LFAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP A;  2UXD L;  5DLQ E;  2VQF L;  2UUA Q;  3NEM A;  1WJJ A;  3ICE A;  4A3L G;  2NN6 I;  4ME3 A;  1GO3 E;  1S40 A;  2ZTD A;  1PH6 A;  1MJE A;  2E5L L;  3PO3 G;  3HOZ H;  3S24 A;  1H95 A;  4JI8 L;  1I5F A;  4X62 Q;  2Z6K C;  3W1G A;  1IBL L;  4OXP A;  1KIX A;  3KOJ A;  4IJH A;  3HOU H;  4GLV B;  1B70 B;  1VQG A;  2XGT A;  3E0E A;  1OTC A;  2B63 H;  2H5X A;  1MIU A;  4C3J H;  3H3V I;  4A75 A;  2A19 A;  1JT8 A;  4UPA A;  1PH9 A;  4P74 A;  3AFP A;  1VQE A;  2AWO A;  3Q8D A;  3FKI H;  2Q2T A;  1VS0 A;  2EXD A;  4GLX A;  1YIJ A;  2B3G A;  5ELN A;  1MKH A;  2Y0S G;  3L2P A;  2GN5 A;  2UXD Q;  1NJI C;  1BVS A;  2DUD A;  1M90 C;  3RLN A;  3RN5 A;  3J80 i;  4GNX C;  1HR0 L;  3CC2 A;  1UE6 A;  5JJI A;  2E2H H;  3L7Z C;  3HOZ G;  3TRE A;  1K8A C;  2R92 G;  3TS2 A;  3GD7 A;  1CKN B;  4A3G G;  1NBW A;  1PH7 A;  1T9H A;  1RIP A;  4DUZ L;  2JA8 H;  3I4M H;  4QY7 A;  1E22 A;  4POF A;  4DR6 L;  4B3R Q;  2GVB A;  4HIM A;  1A8V A;  4IFD G;  4YWK A;  1JB7 A;  4GN4 B;  4JI2 Q;  2R93 H;  4X62 L;  3CCL A;  2K5H A;  3KYH C;  4QJF A;  2N49 A;  2HHH Q;  4K0K Q;  4Y52 H;  3TRZ A;  3EIV A;  3M9B A;  2LSS A;  2MO0 A;  1JMC A;  4A3F G;  1U5K A;  4JI4 Q;  4LUV A;  4A3K H;  1L1O C;  2RCN A;  4DKA C;  1CSQ A;  4DUY L;  3U58 A;  1O7I A;  1W3S A;  3BZK A;  4NPS A;  1J5E L;  4YWL A;  1S3O A;  5IP9 H;  2ASB A;  1XNQ L;  3U4V A;  2JA7 H;  1K0R A;  5M3F H;  3CD6 A;  1HR0 Q;  1LTL A;  4HJ5 A;  4HJ8 A;  2IT1 A;  1XMO Q;  3BU2 A;  2WFW A;  4LF4 L;  1TWH H;  4A3B H;  3G71 A;  4BBS G;  2ATW A;  1HZC A;  5IP9 G;  3PSI A;  1YIT A;  2QA4 A;  4JI6 L;  2KCT A;  2K5V A;  5FLM H;  2A1A A;  2VZA A;  2I5H A;  4A3M H;  2MFI A;  1VQH A;  5IY0 A;  1YHQ A;  4XTC S;  4HJ7 A;  3JAM i;  5GAE C;  3J81 i;  4HJ9 A;  3FP9 A;  3CCS A;  4LFA L;  4DR6 Q;  3M4P A;  1VCI A;  2L15 A;  1TXY A;  4JC0 A;  1HNX Q;  3HOW G;  1SR3 A;  2PQA A;  1VQN A;  2N3S A;  1CKM A;  2LXJ A;  1J5E Q;  2K75 A;  2KEN A;  5C0X J;  4MNO A;  4YY3 L;  1V43 A;  4JI3 L;  2IHF A;  3HOW H;  2R7Z H;  2JA9 A;  1Z9F A;  3I56 A;  3S2H H;  3T1Y Q;  2HIX A;  2AMC B;  2QEX A;  1IXR A;  4X66 L;  2AHO B;  1AE3 A;  1Q46 A;  4OWT B;  5HY6 A;  1Y1W H;  1GM5 A;  1E1O A;  1FJG L;  1N33 Q;  1HNZ L;  1KD1 C;  3GTL H;  1N8R C;  4LWC A;  4KHP Q;  1L1O A;  2RHS B;  3ER0 A;  3U50 C;  5EAY A;  1LM0 A;  4JYA Q;  4HIK A;  3KJP A;  3G4S A;  2MO1 A;  4JBW A;  4DV5 L;  3I4N G;  4A3I H;  2B63 G;  2C35 B;  1YHB A;  3S15 H;  5LMU Q;  1JJC B;  1KQS A;  4R4T A;  4DV4 Q;  1K9M C;  3ULJ A;  1N34 L;  1Y1V H;  2MQH A;  4GOP B;  3KLW A;  3J7Z C;  4A3L H;  3I2Z A;  4DR3 L;  1IBK L;  1YNX A;  3HKS A;  3RZD H;  1PFS A;  4IJL A;  1VQL A;  1E3P A;  2JEB I;  1TWF H;  3ZJY C;  5AJ3 Q;  4LUZ A;  4HIO A;  1XMQ L;  4LF9 Q;  3MEF A;  2OQ0 A;  2XTI A;  2R7D A;  1X56 A;  4QL5 A;  3HOV G;  1RL2 A;  1VQI A;  1N36 Q;  1XJV A;  1P16 A;  3HOX H;  3OTO L;  5IYB G;  2I0Q A;  3T1Y L;  1VQB A;  1NTG A;  2ZJP A;  1QUQ A;  4JI0 L;  1EWI A;  3DLL A;  3W5O A;  5IYD G;  4DV6 L;  4AYB G;  1VQD A;  4GKJ Q;  4A3C H;  4X6A H;  2Z0S A;  4JCV E;  2VQF Q;  1VQC A;  3NEN A;  1OXX K;  3A5Z B;  5M3M G;  4X65 L;  3A5U A;  1HNW Q;  5M5Y H;  1QZG A;  1X54 A;  4KLK A;  4APV A;  3G6E A;  1EUJ A;  4NXM L;  2EQS A;  2UXB Q;  4P75 A;  5M3M H;  3G48 A;  1Q7Y C;  4DR3 Q;  4DV2 L;  1IBK Q;  1XTD A;  2IX0 A;  5LMN W;  1DGS A;  2K50 A;  2KCM A;  2JA8 G;  5IP7 G;  1Q86 C;  3I4M G;  2A8V A;  1MJC A;  1NY4 A;  5C4X H;  3CP0 A;  3F2C A;  4C2M H;  3I7F A;  3CCU A;  1P8L A;  3PUX A;  3J81 j;  1XMQ Q;  4DV7 L;  4JG2 A;  1Q1B A;  2R93 G;  4GN3 B;  1VQK A;  5C4X G;  5IYD H;  2K52 A;  2F4V Q;  1E1T A;  3PF4 A;  1VQ8 A;  3F8T A;  5IE8 A;  4BBR H;  5HGQ A;  4LF5 L;  1LYL A;  1XPU A;  3HOY H;  3EN2 A;  4LFC Q;  4B3M L;  4IPH A;  4A3B G;  1VQF A;  1B8A A;  1WCM G;  2Q2H A;  4R4Q A;  4YWM A;  2NVX H;  2UUC Q;  4B3T L;  2CWP A;  2JK8 A;  3ULL A;  4X66 Q;  5M3F G;  1QZH A;  4TVA B;  1D7Q A;  4MTN A;  1XNR Q;  1ASZ A;  5IWA L;  1VQA A;  3PUW A;  4P72 A;  1I94 Q;  4LW1 A;  4PG3 A;  2PNH A;  1WCM H;  1Q81 C;  4DUZ Q;  1KAW A;  4B3R L;  4B3M Q;  3CC7 A;  4LF7 L;  4OX9 L;  2UUB L;  3F2D A;  1BBU A;  4JI5 Q;  1YJN A;  3CCQ A;  4GNX B;  5IWA Q;  3RN2 A;  2JA7 G;  3RZO H;  1UE1 A;  2UXC Q;  2CQO A;  1I6H H;  5LMU L;  3L0O A;  1JE5 A;  4DPG A;  3EBE A;  4JI1 Q;  3KJO A;  1ASY A;  1N34 Q;  4X64 L;  1YVC A;  4POG A;  4DUY Q;  4C3H H;  4OO1 I;  1SN8 A;  2D0O A;  4DV7 Q;  3GTO H;  4JI5 L;  4LFC L;  4DK6 C;  1QVF A;  3PO3 H;  2JA5 G;  4H02 A;  4A4I A;  4A3I G;  1TWC H;  2E2J H;  4DR1 Q;  4DR4 L;  4B3S L;  1G51 A;  1S72 A;  1OXS C;  2CWA A;  2VQE L;  4A76 A;  2IY5 B;  4IFD I;  3TS0 A;  5BR8 Q;  1VQP A;  3BZC A;  1CKN A;  1KRS A;  2KHI A;  1PHJ A;  2UUC L;  5E7N A;  2WAQ G;  2YTV A;  5GAH C;  4GLA C;  2DGY A;  1YJ9 A;  2WB1 G;  3S2D H;  3S1R H;  2D62 A;  1Q1E A;  4A93 H;  3PGZ A;  4LF8 Q;  4BY7 H;  4ALP A;  3I55 A;  3PCO B;  2IHE A;  5LMN Q;  1SLJ A;  1BBW A;  1SRU A;  1N32 L;  3J80 c;  5IYB H;  2BA0 A;  3A0J A;  3ULP A;  4JI1 L;  3S14 H;  2WP8 J;  4UP9 A;  3S16 H;  1E24 A;  3J7A 5;  1Z47 A;  3GDE A;  3CCE A;  4DR7 Q;  1CSP A;  4HID A;  1GVP A;  4JI7 Q;  5C4J H;  4LUO A;  2HQL A;  5LMN L;  4DR1 L;  4JBM A;  1SRO A;  2UUA L;  1IYJ B;  4XIG S;  1JJ2 A;  3HOX G;  2ALY B;  3UDF A;  4LF6 Q;  4NXN Q;  2V1C C;  2CKZ B;  1AE2 A;  3GTM H;  2YU9 H;  2I5L X;  4JI8 Q;  3STB C;  2VW9 A;  3CW2 C;  1Y1V G;  4YHH L;  3CPW A;  4OWW B;  4R4C A;  2B29 A;  2NVT H;  1PH4 A;  1L0W A;  2F3I A;  2ZTC A;  4LF5 Q;  3PO2 G;  2OWO A;  3HFZ B;  1M1K C;  4A3D G;  2KBN A;  4DV1 Q;  4P71 A;  2I5M X;  5IT9 c;  1L2F A;  3A74 A;  4YCV A;  3CCJ A;  3U4Z A;  1BKB A;  3NBH B;  2E8G A;  2PI2 A;  1JJG A;  1FL0 A;  2K5N A;  3FHW A;  2KHJ A;  1WFQ A;  3VDY A;  4LF8 L;  3HOV H;  5IYC H;  4EX5 A;  4YCW A;  2HHH L;  4GNX A;  4K0K L;  4O2D A;  1PH8 A;  5FLM G;  2RHQ B;  1IZ6 A;  4HJA A;  2Q2U A;  3CPF A;  4LF9 L;  4KHP L;  3CCV A;  3KDF A;  3UDX A;  2UUB Q;  5IP7 H;  1XPO A;  4A3K G;  1I3Q H;  3H3V H;  3OTO Q;  4JI3 Q;  1XMO L;  3FKI G;  4R1J A;  3E9I A;  2HT1 A;  1J6Q A;  4YHH Q;  1KC8 C;  4X64 Q;  2JEA I;  3AEV A;  3PUV A;  1OXV A;  3PIO A;  2JA6 G;  3CF5 A;  1R9T H;  3RLF A;  1HZB A;  4A3D H;  1K8G A;  2ID0 A;  2OQK A;  4JI2 L;  3OW2 A;  1PA6 A;  5GRO A;  2AKW B;  1N33 L;  3PO2 H;  1HZ9 A;  3KF6 A;  3ERS X;  4WJ4 A;  4R4O A;  3GTJ H;  4R4I A;  1Q8K A;  1YEZ A;  4AIM A;  2OTJ A;  3HKZ G;  3T1H L;  2UU9 L;  3KFU A;  5C3E H;  1FVI A;  1G6P A;  4GKK Q;  4RG1 A;  2JJQ A;  1EIF A;  1OXU A;  3KF8 B;  3RR5 A;  1X55 A;  4EQ5 A;  4DV4 L;  3AQQ A;  2EIF A;  1W2B A;  2BA1 A;  4BY1 H;  4OO1 G;  3DM3 A;  2R7Z G;  3GTK H;  4JI4 L;  3TEH B;  1AH9 A;  4IPD A;  3S1Q H;  2K14 A;  3WWV A;  3S1M H;  1KXL A;  3M3Y H;  3RNU A;  1C7Y A;  1HZA A;  5C44 H;  1XNQ Q;  2VL6 A;  5FLX c;  4L5T A;  1GD7 A;  4YCU A;  2HIV A;  3CXC A;  2PMZ E;  1YHA A;  5JJL A;  1TWG H;  4C3I H;  1XPR A;  1QUQ B;  2QGQ A;  4AQY L;  1GKH A;  2NZH A;  3PF5 A;  1N36 L;  4PZ8 A;  5GAD C;  1EFW A;  3M85 A;  5FJ8 G;  3STB D;  5H1S E;  1PH2 A;  1K83 H;  1EOV A;  3MXN B;  3PUZ A;  1PVO A;  1KHI A;  4RMF A;  2R7F A;  4AQY Q;  2JA5 H;  2UU9 Q;  4BXX H;  3H15 A;  1SE8 A;  1NMF A;  1EIY B;  4DV0 Q;  3CMA A;  1PV4 A;  2F52 A;  4L5R C;  4A3J G;  1HNW L;  1WI5 A;  1PH3 A;  2YTY A;  2Z6K A;  3K0X A;  1Q82 C;  1TWA H;  4BA2 I;  5K36 G;  2GVA A;  2D0P A;  1B7Y B;  3D31 A;  3CCM A;  4UY8 C;  5ELO A;  4PZ6 A;  1WYD A;  1G29 1;  1PYS B;  4DK3 C;  4A3E G;  5M5W H;  4J15 A;  4GKJ L;  4LFB L;  2Q2I A;  2YTX A;  5M5X H;  3UDI A;  1VQ5 A;  4JBK A;  4BY7 G;  2R6G A;  2VY3 A;  3JAM c;  2ZTE A;  3RLO A;  3J81 c;  5BR8 L;  1VQ9 A;  1VQ6 A;  4QQB X;  1VQM A;  1N9W A;  4L5Q A;  5GAG C;  2Y0S E;  4DR5 Q;  1IBM L;  4OWX B;  2MNA A;  1QVC A;  4B3T Q;  2ES2 A;  3PUY A;  2ZM6 L;  4DV3 L;  1OXT A;  4KI0 A;  4PZ7 A;  4GOP A;  1PH5 A;  4FDB A;  4L5S A;  3S17 H;  1YI2 A;  4JBJ A;  4PMW A;  4TQU S;  4BBR G;  2NVY H;  1NMG A;  2FXQ A;  4Y7N H;  1N32 Q;  1X3G A;  4GN5 A;  2RF4 A;  5JEA J;  3HOU G;  4LF4 Q;  5IYC G;  4DR5 L;  1IBM Q;  4A3C G;  3M4O H;  1KRT A;  3GTQ H;  4DAY B;  3HKZ E;  3UDG A;  4DV5 Q;  1X3E A;  4JI6 Q;  4LF7 Q;  4A3G H;  2YYZ A;  1YBY A;  4DV0 L;  3T1H Q;  2R92 H;  4DV3 Q;  2JA6 H;  1EQR A;  1I50 H;  2CFM A;  2F4V L;  3JC6 6;  4A3E H;  1SFO H;  4GOP C;  1Y14 B;  2JE6 I;  3E9H A;  4IPG A;  2OTL A;  1A0I A;  4OX9 Q;  2NVQ H;  3AYH B;  1VQO A;  2IX1 A;  4NXM Q;  1YZ6 A;  3UE0 A;  2UXB L;  1EQQ A;  4WJ3 M;  4JV5 Q;  1HNX L;  1A63 A;  3KDF B;  3H0G H;  4LFB Q;  3NEL A;  1K73 C;  2WB1 E;  4A3M G;  1FGU A;  3SGI A;  3UE1 A;  1I94 L;  2ZM6 Q;  4AH6 A;  4YY3 Q;  5JEA G;  4B3S Q;  5JJK A;  3CAM A;  3K81 C;  1EYG A;  1WOC A;  2PQA B;  3OYY A;  3PV0 A;  4X65 Q;  1HR0 W;  4DV6 Q;  4DV1 L;  4IOA A;  3GO5 A;  1CUK A;  1HH2 P;  2WAQ E;  3D0F A;  4IPC A;  3LGJ A;  1A62 A;  5C0X I;  4DR4 Q;  4KHZ A;  4O0A A;  3F1Z A;  2PI2 E;  4OON A;  5GQO A;  3HOY G;  4BBS H;  1X6O A;  3BJU A;  4MZ9 A;  4UP7 A;  1HNZ Q;  4JOI A;  4UP8 A;  1FJG Q;  5C44 G;  4IOC A;  4DR2 L;  2AWN A;  4P73 A;  1VQ4 A;  2JQO A;  3K8A A;  3W1B A;  2BH8 A;  3K7U C;  3F2B A;  4IO9 A;  5C3E G;  4A3F H;  1PH1 A;  4JYA L;  3KF6 B;  5J3B A;  4DNI A;  2BH2 A;  1K3R A;  4AYB E;  1VQ7 A;  4QIW E;  1PYB A;  1V1Q A;  1SMX A;  3K80 C;  3I4O A;  3K7A H;  2N8N A;  4GS3 A;  3AFQ A;  4DV2 Q;  3H0G G;  2CCZ A;  1L1O B;  2NN6 G;  4A93 G;  1KL9 A;  4NB3 A;  2OCE A;  4BA1 I;  3CME A;  4JI7 L;  1VQJ A;  1UE7 A;  1X65 A;  5FJ8 H;  1IBL Q;  2E2I H;  2NZO A;  3S1N H;  2VUM H;  1NE3 A;  4JOI C;  1IL2 A;  1X9N A;  1V9P A;  1HJP A;  4JV5 L;  2E5L Q;  4DAM A;  2ZJR A;  4NXN L;  4LF6 L;  3CQZ H;  2LXK A;  1C0A A;  3M4Q A;  5AJ3 L;  3CCR A;  1YJW A;  3IRB A;  4QGU A;  1C9O A;  2VUM G;  3GTP H;  1UE5 A;  4A3J H;  1UEB A;  3M7N A;  3GTG H;  4IFD J;  1CKO A;  1UWV A;  3TQY A;  2VNU D;  3B6Y A;  1D8L A;  4BY1 G;  4LNQ A;  1LUZ A;  3CC4 A;  2K4K A;  2VS1 A;  1Q12 A;  2N78 A;  2YV5 A;  1Y1W G;  4JI0 Q;  1X3F A;  4GKK L;  1XNR L;  1E7Z A;  5C0X G;  4BXX G;  1QVG A;  4DR7 L;  3I4N H;  1U0L A;  2VQE Q;  2UXC L;  2ZJQ A;  4DR2 Q;  4LFA Q; 
#chains in the Genus database with same CATH topology
 2UXD L;  5DLQ E;  5JJZ A;  2ZXO A;  1U4M A;  3NK9 A;  2F0K A;  5G3L D;  3ERQ A;  3W1G A;  4UAI A;  1DYQ A;  3KOJ A;  1VQG A;  4IFD H;  2B63 H;  1PTO D;  2MJ8 A;  1JIC A;  4UPA A;  3MFG A;  4P74 A;  3AFP A;  3Q8D A;  4DN4 M;  1DZ1 A;  3T16 A;  1LTB D;  3X3M A;  2K1B A;  1MKH A;  2J7Z A;  1PZK D;  2C5C A;  1ZYR D;  3J80 i;  3CC2 A;  3M4O B;  2H4O A;  2E2H H;  3TRE A;  5ELF A;  3O13 A;  2R92 G;  1H9S A;  3R2T A;  4K8I A;  4A3G G;  4DUZ L;  3ND9 A;  4KY7 A;  4X62 L;  2K5H A;  2K5D A;  3KYH C;  2N49 A;  2HHH Q;  1A2T A;  1EYG A;  3BZK A;  1IYV A;  3OWF A;  1S3O A;  3HZX A;  2ASB A;  1LTR D;  5D3I B;  1SYE A;  1LTL A;  1HR0 Q;  1E2V A;  5JVG 3;  4HJ8 A;  2WFW A;  4BBS G;  4HN7 A;  2K33 A;  5IP9 G;  2G9H D;  2QA4 A;  2WV6 D;  2VZA A;  1LAB A;  2SDF A;  1HHV A;  1S5D D;  1VQH A;  5DEH A;  5IY0 A;  4HJ9 A;  1HTL D;  3FP9 A;  1A15 A;  4IN3 A;  4X3U A;  3M4P A;  1YNN D;  2PQA A;  2OEO A;  3VYU A;  2PZU A;  5IGC A;  2M9V A;  1IL8 A;  4YY3 L;  1ILQ A;  4JI3 L;  4R8I A;  4N9T A;  3WOF A;  2JA9 A;  2Z4I A;  1ZYR C;  1FD7 D;  1SBB B;  3I72 A;  1IXR A;  4O42 A;  2AHO B;  2AUK A;  1Q46 A;  5C44 B;  4IUT A;  1Y1W H;  3SVM A;  1EY9 A;  1FJG L;  1J9O A;  1HNZ L;  3GTL H;  2F0T A;  4LWC A;  3JAM L;  3J81 L;  1Y69 U;  3U50 C;  5ELB A;  2Z1C A;  1CZG A;  4HIK A;  3BYT B;  1Y1V B;  3KJP A;  4FF3 A;  1YHB A;  2EY5 A;  1RCV D;  2VB2 X;  2RSN A;  1JJC B;  3NTK A;  1KQS A;  3OMC A;  1F9R A;  1N34 L;  4CKB A;  3KLW A;  1VQL A;  3RZD H;  1XMQ L;  1TWF H;  3G7L A;  3GV3 A;  1LT4 D;  2J0T D;  2OQ0 A;  2XTI A;  5D65 A;  2R7D A;  1XX8 A;  5CMD A;  1RL2 A;  1VQI A;  2XIW A;  1XJV A;  3C1E A;  2L12 A;  2I0Q A;  2CVR A;  2F0G A;  1I6H B;  1LT6 D;  1PLF A;  4A3C H;  2B2W A;  1VDZ A;  1B44 D;  2JA6 B;  3NEN A;  1M8A A;  4FXK C;  4A3E B;  4KLK A;  3QWN A;  1IBK Q;  1CTM A;  4DV2 L;  1XTD A;  2EYO A;  3AB9 A;  5LMN W;  2F0L A;  2K50 A;  3NP8 A;  1EY0 A;  4UHV A;  5IP7 G;  5M9O A;  1MJC A;  4HSP A;  2K6A A;  3ERO A;  3F2C A;  1B2T A;  1P8L A;  3PUX A;  5LL6 S;  4DV7 L;  2AQ2 B;  3BVM A;  2KA7 A;  4FF4 A;  1K83 B;  1E1T A;  2DY7 A;  3D4R A;  3F8T A;  4BBR H;  1D5X C;  5HGQ A;  3HOX B;  4B3M L;  4A3B G;  3K5O A;  5E1F A;  4EVO A;  2JK8 A;  3ULL A;  4FXD A;  1D7Q A;  4ZK9 B;  1CQV A;  1WCM H;  1ZKO A;  2X69 A;  2F3W A;  4DUZ Q;  1KAW A;  4B3M Q;  3DM1 A;  1EFI D;  4CGY B;  4CHT B;  5M5Y B;  2UUB L;  1PTO F;  3F2D A;  2CQO A;  4K6D A;  5LMU L;  1ONL A;  3K5L A;  5E4W C;  2NB0 A;  3FRP B;  1BCP B;  2R61 A;  4OEM B;  2D0O A;  1YNJ C;  3GTO H;  4LFC L;  1TU2 B;  4H02 A;  1CFM A;  3D6C A;  2QIL A;  1OXS C;  2VQE L;  5EPJ A;  1E0B A;  4A76 A;  5BR8 Q;  2EPB A;  2KHI A;  1PHJ A;  3Q6S A;  2UUC L;  4BY7 B;  1HUM A;  5GAH C;  2IPK D;  3HG9 A;  5A35 A;  1JWM D;  3S1R H;  1Q1E A;  2E75 C;  3I55 A;  1N32 L;  5A2Q L;  2NBF A;  1IW7 D;  1WTX A;  5IGG A;  4O1N A;  4JI1 L;  3S14 H;  1DD2 A;  1BF4 A;  1C4Q A;  1Z47 A;  4H7B A;  2BOS A;  1BCP C;  4DR1 L;  1ET6 A;  1SRO A;  2KHS A;  2ALY B;  4ODG A;  1Q8I A;  2CW0 C;  5C5M A;  2V1C C;  1AE2 A;  1K8M A;  3GTM H;  2HD3 A;  3R2I A;  2VW9 A;  1F77 A;  4OWW B;  4C3J B;  3T4A C;  3S1Q B;  4PMB A;  3ZYY X;  2OWO A;  2AUJ D;  3HFZ B;  1M1K C;  1C48 A;  2KBN A;  4A3M B;  2I5M X;  1L2F A;  3A74 A;  3U4Z A;  2E8G A;  2PI2 A;  1FL0 A;  2KHJ A;  5KYI A;  3MEH A;  1DON A;  4EX5 A;  3SK4 A;  4K0K L;  4GNX A;  1Y1W B;  1STY A;  2HDL A;  4O2D A;  5I9P A;  1PH8 A;  1SE4 A;  3CPF A;  3KDF A;  1I3Q H;  3H3V H;  1BQQ T;  1I4R A;  1EEI D;  3SHL A;  1XMO L;  3FKI G;  5KNC A;  1ESR A;  1CHP D;  3E9I A;  1OXV A;  4QB4 A;  2JA6 G;  1R9T H;  1HZB A;  1LT3 D;  4A3D H;  4ZKB B;  5JEA H;  1RKN A;  1PA6 A;  5GRO A;  3PO2 H;  3VYR A;  3KF6 A;  3I90 A;  4K14 A;  4RGN A;  4R4I A;  1Q8K A;  3T1H L;  5C3E H;  3PIP 3;  1FVI A;  1G6P A;  4GKK Q;  2F0D A;  2JJQ A;  2PZW A;  5ISR A;  2DJF C;  1EIF A;  3RR5 A;  1LO5 D;  2DNC A;  2HDM A;  3SK8 A;  5COR A;  2BA1 A;  4BY1 H;  1WD1 A;  3TEH B;  4IPD A;  1C7Y A;  3BZD B;  4QIW B;  5FLX c;  4L5T A;  4YCU A;  3CXC A;  5EKI A;  1X3P A;  5JJL A;  1TWG H;  2QGQ A;  2E76 C;  4CKE A;  2NZH A;  3PF5 A;  1EYA A;  1WTW A;  5C6A A;  1EIG A;  2LY7 A;  4V0B A;  5KEE A;  1PH2 A;  2PMZ B;  1K83 H;  3MXG A;  1HQR D;  1PXU A;  2JA5 H;  2F0O A;  1Z7T A;  3CMA A;  2YTY A;  1H9M A;  2KEE A;  2Z6K A;  4AYB B;  5M5W B;  1SNQ A;  3A56 A;  5K36 G;  3OOC A;  1B7Y B;  3D31 A;  1G29 1;  4A3E G;  4J15 A;  1GXD C;  5M5X H;  4BY7 G;  2R6G A;  2VY3 A;  3GTM B;  3RLO A;  5BR8 L;  2R3Z A;  4L5Q A;  5FOB B;  4QF4 A;  4OWX B;  2MNA A;  3QOL A;  4B3T Q;  2KQ3 A;  3DWP A;  4L5S A;  3S17 H;  4FDB A;  5IOC A;  2CH4 A;  2FXQ A;  3SEB A;  4Y7N H;  4GN5 A;  1N32 Q;  3MFY A;  5JEA J;  2Y0S B;  1KRT A;  4DAY B;  4J1M A;  4A3G H;  1YBY A;  4DV0 L;  3ITP A;  4NDX A;  4WOR A;  3TP8 A;  1QIL A;  1SNO A;  2EYH A;  3JC6 6;  1D5Z C;  4HSV A;  1SFO H;  2L0C A;  1ZEQ X;  1X32 A;  1PDQ A;  5CBA E;  2HCI A;  2DJG C;  3PO3 B;  1EWH A;  1EQQ A;  4JV5 Q;  1JC7 A;  1A63 A;  3KDF B;  4DFA A;  4LFB Q;  2DN8 A;  1K73 C;  2NVX B;  4MTK A;  2K7V A;  4HCS A;  1A3T A;  3C2P A;  4X3S A;  1EL0 A;  3CAM A;  1LTI D;  3PV0 A;  3NSW A;  2PW7 A;  3GO5 A;  2CW0 D;  4IPC A;  2IW3 A;  3LGJ A;  4DR4 Q;  1DM0 B;  5GQO A;  3W3A A;  4M8A A;  1X6O A;  3C3L A;  4UP7 A;  4JOI A;  4UP8 A;  2I46 A;  2AWN A;  2LKV A;  2JQO A;  3K8A A;  3W1B A;  3FKI B;  5ELC A;  5IGF A;  2Z9H A;  1JWS D;  4QIW E;  3K80 C;  4GS3 A;  1V1Q A;  1SMX A;  3K7A H;  2RBM A;  2N8N A;  2EJG C;  4DAP A;  3NUC A;  4DV2 Q;  2CCZ A;  1L1O B;  2NN6 G;  4A93 G;  1KL9 A;  1A2U A;  2OCE A;  4NB3 A;  3CME A;  4JI7 L;  1X65 A;  1IBL Q;  2NZO A;  2B63 B;  1IL2 A;  4JOI C;  1PRT D;  1KLU D;  4OEL B;  3CQZ H;  4MN3 A;  1C0A A;  4YIJ A;  2A6H C;  3FPP A;  4IUN A;  3IRB A;  5J39 A;  4QGU A;  1DXM A;  4BS9 A;  3VYT A;  3GTG H;  2I07 B;  3B6Y A;  1D2B A;  1LUZ A;  3CC4 A;  3E5S A;  2D9U A;  2B39 A;  2N78 A;  2VS1 A;  2YV5 A;  4LJZ C;  1SYC A;  4GKK L;  1SAP A;  4BXX G;  1II3 A;  4RWS C;  5I6Y A;  1U0L A;  5D14 A;  1Y8N B;  4BBS B;  4LFA Q;  3Q24 A;  1Q90 A;  3QG1 A;  3NEM A;  3IFD A;  3I4N B;  4A3L G;  1EIH A;  5IOD A;  1GO3 E;  1S40 A;  1H95 A;  2E5L L;  3PO3 G;  4KHV A;  3DHQ A;  4JI8 L;  3V2T A;  1TT2 A;  1CM9 A;  2K32 A;  2QKI C;  5T1G A;  4OXP A;  1KIX A;  4DAY A;  2BCO A;  2F0I A;  4GLV B;  2XGT A;  1G2T A;  1MIU A;  2E2D C;  3MHB A;  3OIQ A;  4RFB A;  5L37 A;  5C5L A;  1PH9 A;  2CH4 W;  3P20 A;  2Q2T A;  1VS0 A;  2EXD A;  2F0H A;  2BE5 C;  2F0V A;  2A73 B;  5C4H A;  1NJI C;  2DUD A;  4XQQ A;  3RLN A;  3RN5 A;  1M90 C;  2IL8 A;  1HR0 L;  1RDP D;  1WTO A;  1HTP A;  3L7Z C;  1BOS A;  1K8A C;  3TS2 A;  1KTK A;  1CKN B;  1KDC A;  1PH7 A;  2JA8 H;  3I4M H;  4QY7 A;  1E22 A;  1F2Z A;  4POF A;  4DR6 L;  3KF8 A;  4LK1 C;  5IGD A;  4IFD G;  4OIK A;  4YWK A;  3J80 L;  3HEJ A;  2F1M A;  4QJF A;  3URY A;  4Y52 H;  1GJX A;  3M9B A;  3BVZ A;  2LSS A;  2MO0 A;  1L1O C;  4DKA C;  4DUY L;  1CSQ A;  2YU9 H;  1W3S A;  4N8X 1;  1VMC A;  1XNQ L;  2JA7 H;  2IT1 A;  2L9H A;  1TWH H;  3LWU A;  3L9A X;  1GUW A;  5I2Y A;  2KCT A;  5FLM H;  1E2W A;  4J6H A;  4F88 A;  1HUN A;  3IL8 A;  5GAE C;  1ESF A;  1TS4 A;  2CHB D;  3CCS A;  1Y8O B;  1PTO B;  1VCI A;  1TXY A;  3HOW G;  1HCZ A;  4RCO A;  2LXJ A;  4RKL A;  3ONA B;  3SXH A;  4MNO A;  1LTA D;  3HOW H;  3DEO A;  2R7Z H;  3S2H H;  4K6L A;  4X66 L;  3GTG B;  1SFO B;  2A69 D;  1FYC A;  2M2L A;  1EEF D;  1SJH D;  1D1I A;  2FIN B;  4C3I G;  5KGU A;  3GTQ B;  3SDZ A;  3M7G A;  4RGM A;  4A93 B;  3G4S A;  4KK7 A;  4DNT B;  1G91 A;  4DV5 L;  2B2V A;  3I4N G;  2B63 G;  3S15 H;  1EY8 A;  3ULJ A;  3J7Z C;  4A3L H;  1IBK L;  3HKS A;  1PFS A;  3MXN A;  3ZJY C;  1H9J A;  4QL5 A;  3HOV G;  3HOX H;  5IYB G;  1FNV A;  3T1Y L;  4DGZ A;  3DLL A;  1RJT A;  1MSH A;  1SSO A;  1GUT A;  4GKJ Q;  4L63 B;  5KND A;  4MIU A;  4DU9 A;  5HGT A;  5M3M G;  1OXX K;  3A5U A;  2ZXR A;  3IFT A;  3GTK B;  5BN3 A;  5M5Y H;  4ZCK A;  3G6E A;  1CZW A;  4FXG C;  2UXB Q;  5M3M H;  3G48 A;  1JB3 A;  1STE A;  2KCM A;  2JA8 G;  3I4M G;  1VF5 C;  3CCU A;  3BDC A;  5EKL A;  2F4V Q;  3PF4 A;  5E3F A;  1XPU A;  3HOY H;  4LFC Q;  3H0G B;  1B8A A;  4YWM A;  4B3T L;  2KJX A;  5M3F G;  5EPL A;  2EYL A;  4TVA B;  4MTN A;  1SYD A;  1XNR Q;  4LW1 A;  4PG3 A;  2ENB A;  3KUP A;  1EY4 A;  3NWS A;  1Z6H A;  2EY2 A;  2B8G A;  2FHT A;  1BBU A;  4JI5 Q;  2UXC Q;  1UE1 A;  1PTO H;  5COY A;  4XT1 B;  1R4Q B;  4JI1 Q;  1N34 Q;  4X64 L;  1YVC A;  3A54 A;  4A3J B;  4DUY Q;  4OO1 I;  1SN8 A;  2R7Z B;  1SE2 A;  4JI5 L;  1QVF A;  4A4I A;  2PPB C;  4DR1 Q;  4DR4 L;  1G51 A;  5CGK A;  4IFD I;  1VQP A;  1U4R A;  1KRS A;  1YNN C;  2WAQ G;  3DXJ C;  5EBD A;  4L8J A;  4DAV A;  3S2D H;  4TSS A;  4ALP A;  1SLJ A;  1BBW A;  4I65 A;  2BA0 A;  3ULP A;  2O5J C;  1E24 A;  3J7A 5;  1BO0 A;  3MA2 B;  1PRT F;  2RCF A;  2R93 B;  3DEP A;  2EJF C;  2F0F A;  4JI7 Q;  2UUA L;  4XIG S;  2EDG A;  1EOT A;  3Q0A A;  4N9P A;  1S5F D;  2ZT9 C;  3STB C;  3E0J A;  1Y1V G;  3CPW A;  4HMI A;  4XDX A;  4R4C A;  4X3K A;  4L6T B;  2NVT H;  3RZO B;  2F3I A;  4KN7 C;  4J8Q A;  2F0S A;  2DNE A;  2QF7 A;  5FO7 B;  2NYZ D;  3M3Y B;  2MGS A;  2O2L D;  3J7Y W;  1XXG A;  5IT9 c;  4YCV A;  3CCJ A;  1BKB A;  1JJG A;  2K5N A;  3FHW A;  1I6V C;  4LF8 L;  4QCL A;  1SXT A;  3HGB A;  4YCW A;  5ELE A;  2HHH L;  4XT3 B;  3D3R A;  3NBH A;  2E2J B;  1IZ6 A;  1F2L A;  4ILW A;  3GTP B;  2E2H B;  2Z4H A;  3UDX A;  2UUB Q;  2NZ1 D;  3R93 A;  3NQT A;  3MXU A;  2PW5 A;  1JWU D;  1SDF A;  4KKT A;  4R1J A;  5C4J B;  3OSO A;  4YHH Q;  1KC8 C;  3AEV A;  4A3B B;  1MD2 D;  4CDD C;  3RLF A;  1D1K A;  2ID0 A;  2OQK A;  3EQL C;  2FMC A;  1AZQ A;  4JI2 L;  1N33 L;  4G7Z C;  4C56 C;  2XWB B;  2B2U C;  3J80 E;  1CK1 A;  1WVL A;  1VF7 A;  2EY6 A;  4WJ4 A;  3TBI B;  1F2M A;  1YEZ A;  1F9P A;  3KFU A;  5FLX E;  5DM7 3;  4QMG A;  1ICF B;  1HFG A;  4DV4 L;  3KF8 B;  1HRJ A;  1EYD A;  4OGQ C;  2QDB A;  2K28 A;  1JQY D;  3DM3 A;  2R7Z G;  1HFN A;  3GTK H;  4C3H G;  4IUP A;  4U68 A;  1XNQ Q;  1IHZ A;  2F0M A;  4U67 3;  4FYD A;  2PMZ E;  1XPR A;  4C3I H;  1ET9 A;  3TDQ A;  4AQY L;  2A74 C;  3RUZ A;  5BN5 A;  2A6E C;  4RH6 A;  4GZY C;  2O4X A;  1AZP A;  1EFW A;  2WII B;  5H1S E;  1NCV A;  3MAQ A;  1D6E C;  1PVO A;  2UU9 Q;  2R7F A;  4AQY Q;  3GTL B;  1B3A A;  2WKC A;  1HNW L;  5CV4 A;  1KNA A;  1NR2 A;  4CJ0 B;  4N8F A;  4BA2 I;  1TY2 A;  2L11 A;  5A2Q E;  2QDL A;  4DK3 C;  3J7A F;  3SR1 A;  2ZTE A;  1VQ9 A;  1N9W A;  1ICW A;  1K3B C;  1BBX C;  2Y0S E;  4DR5 Q;  1IBM L;  4KTA A;  1UEA B;  3PUY A;  2SOB A;  4DV3 L;  4PZ7 A;  1PH5 A;  1YI2 A;  4CBV A;  1JOK A;  4BBR G;  1NMG A;  4ZKC B;  3UI2 A;  2WKD A;  3D4W A;  3GV6 A;  3H09 A;  5DNF A;  4DR5 L;  1IBM Q;  2EZV A;  3HKZ E;  3UDG A;  4DV5 Q;  4LF7 Q;  1J8I A;  4EQN A;  3T1H Q;  4ZUJ A;  4DV3 Q;  4QUC A;  2JA6 H;  2CFM A;  3LNN A;  4A3E H;  1ENF A;  4FO2 A;  2L5T A;  2IX3 A;  4GOP C;  1O80 A;  2PNR C;  2OTL A;  4OX9 Q;  2IX1 A;  4NXM Q;  2RDH A;  4JW0 A;  3K57 A;  1A3V A;  1FGU A;  4B3S Q;  5JEA G;  2SNS A;  1FGB D;  3OYY A;  1LTG D;  1HR0 W;  1CUK A;  3D0F A;  4ZYS A;  5C0X I;  1O7L A;  1ML0 D;  4KHZ A;  4BBS H;  2PI2 E;  3BJU A;  4MZ9 A;  4KHP L;  4DR2 L;  1LAC A;  1VQ4 A;  2BH8 A;  2JYO A;  2NUC A;  4UDU C;  1GHK A;  1PYB A;  1QNK A;  3F2U A;  3AFQ A;  2R92 B;  1G2S A;  1UE7 A;  3DWQ A;  2E2I H;  4FNF A;  1OO9 B;  2VUM H;  3S1N H;  1NE3 A;  1TS3 A;  3FPU B;  1X9N A;  1V9P A;  2E5L Q;  4NXN L;  2LXK A;  3M4Q A;  2OT2 A;  5AJ3 L;  1YJW A;  2VUM G;  3J7A V;  4CDF C;  4ME5 A;  1UE5 A;  3GTP H;  1CKO A;  2RA4 A;  3TQY A;  4BBR B;  4OO1 H;  1WD0 A;  1Y1W G;  2F0J A;  5KRU A;  4OHJ A;  1V8Q A;  1XNR L;  3I4N H;  4ULL A;  2UXC L;  2ZJQ A;  1LTT D;  3PIP A;  1STG A;  3R3O A;  2F0U A;  2RQX A;  2NN6 I;  1PH6 A;  3PIO 3;  4NMZ A;  4KN4 C;  3S24 A;  3MWY W;  4X62 Q;  1B1Z A;  2VB3 X;  2Z6K C;  4X3T A;  4IJH A;  5CV9 A;  4ZQ3 A;  1B70 B;  1BUV T;  4XQJ A;  3E0E A;  1WTR A;  3QB3 A;  3H3V I;  1ENA A;  4A75 A;  2A19 A;  1JT8 A;  3JAM E;  3J81 E;  4GLX A;  2A68 C;  3GTJ B;  5ELN A;  3WDN A;  2Y0S G;  3L2P A;  2GN5 A;  4GNX C;  2KCC A;  4Q5V A;  3CKI B;  4HCE A;  1NBW A;  2EYJ A;  2PYK A;  2JP1 A;  4B3R Q;  2K01 A;  1B4O A;  1MI2 A;  3IKJ A;  3VR2 A;  2GVB A;  4HIM A;  1A8V A;  3T56 B;  2RSO A;  4GN4 B;  2EVB A;  1QOH A;  2K04 A;  1EQV A;  2JA7 B;  4G7O C;  1CI3 M;  3PO2 G;  4JI4 Q;  3Q22 A;  3HOU B;  3U58 A;  1O7I A;  4JPB W;  4NPS A;  4YWL A;  2KEC A;  1PMR A;  3U4V A;  5M3F H;  3CD6 A;  3DMU A;  3PMF A;  2ATW A;  1HZC A;  1SJE D;  1JE4 A;  5D3D A;  2K5V A;  3NWT A;  2A1A A;  5EGT A;  3VR6 A;  3H3V C;  2I5H A;  4A3M H;  2KOL A;  2MFI A;  5I6W A;  1CQF A;  4B9W A;  4HJ7 A;  3JAM i;  3J81 i;  4LFA L;  2L15 A;  1SR3 A;  1VQN A;  1CKM A;  1J5E Q;  1NNX A;  1QB5 D;  2K75 A;  2ZXP A;  1F2Y A;  1V43 A;  2IHF A;  2Q8R E;  3KBG A;  2P5Z X;  1Z9F A;  1S5C D;  1STN A;  1YNJ D;  2AMC B;  1EQT A;  1AE3 A;  4A3K B;  1UNS A;  1Q3L A;  4H0L C;  4OWT B;  5HY6 A;  1GM5 A;  3CRK C;  3Q23 A;  1N33 Q;  4KHP Q;  1L1O A;  2L4N A;  2RHS B;  3ER0 A;  5EBC A;  1O78 A;  4ZAI A;  3KK7 A;  4A3I H;  2C35 B;  1KAA A;  4B08 A;  4DV4 Q;  3RMH A;  3S16 B;  3VYS A;  5F2D A;  3EJI A;  1GOZ A;  3I2Z A;  1K28 A;  1I4P A;  5JVH 3;  5AJ3 Q;  4HIO A;  2EYF A;  4RA8 A;  3MEF A;  1X56 A;  3HOY B;  5LL6 X;  3OTO L;  2ZJP A;  1QUQ A;  1EZ6 A;  4K5W A;  5IYD G;  1LT5 D;  1VQD A;  3TP6 A;  4X6A H;  5FKA C;  3NHH A;  1TS5 A;  2MP1 A;  2XWJ B;  4JK1 C;  5M3M B;  2CQA A;  5T1I A;  4JCV E;  3MTS A;  4RHS A;  1HNW Q;  4X65 L;  1X54 A;  2B2T A;  1NR4 A;  3S17 B;  1EUJ A;  2VXW A;  4P75 A;  3VR4 A;  5LHY 1;  1Q7Y C;  2AQ1 B;  4DR3 Q;  2IX0 A;  1B50 A;  1DGS A;  2JA8 B;  3I4M B;  1Q86 C;  2A8V A;  5C4X H;  1KNE A;  1CT1 D;  1GUO A;  2RDF A;  3R8B A;  3J81 j;  4E6I A;  1DOL A;  1XMQ Q;  3NQI A;  2R93 G;  1Q1B A;  4GN3 B;  4OL7 A;  1VQK A;  5IYD H;  2K52 A;  3ND8 A;  1VQ8 A;  4C2M B;  2A5H A;  2LMC B;  1BNZ A;  1S4Z A;  4LF5 L;  2UUC Q;  2Q2H A;  4R4Q A;  2NVX H;  1XYI A;  2CWP A;  4X66 Q;  1TWA B;  3OWE B;  2PCF B;  3S2D B;  1ASZ A;  2M00 A;  4P72 A;  1I94 Q;  1RHP A;  4B3R L;  3TSS A;  4LF7 L;  2MHV A;  4NP5 A;  4OX9 L;  3P75 A;  3A55 A;  3CHB D;  5C0X H;  4GNX B;  3RN2 A;  2JA7 G;  1KAB A;  1I6H H;  3A8J E;  3T53 B;  3MC0 B;  3EBE A;  1ASY A;  4DV7 Q;  2A68 D;  3PO3 H;  4A3I G;  1TWC H;  1GHJ A;  4B3S L;  3BS1 A;  1CA5 A;  3TS0 A;  1SNP A;  1EU3 A;  4GLA C;  4H13 C;  3V96 A;  5KNB A;  2WB1 G;  2J4X A;  2D62 A;  4A93 H;  5NUC A;  3PGZ A;  1R9T B;  2Z8L A;  3PCO B;  2IHE A;  3E3X A;  1PFN A;  4LMQ D;  3J80 c;  3IAY A;  3KLS A;  5IYB H;  1IKM A;  2WP8 J;  3S16 H;  3GDE A;  4DR7 Q;  3CRL C;  5IGB A;  3FDT A;  1RD9 D;  4NW2 A;  4F8M A;  5C4J H;  4LUO A;  5C3E B;  5K36 H;  4EQP A;  4WFN 3;  1IKL A;  1JJ2 A;  3HOX G;  4NXN Q;  4KMU C;  4C3H B;  3A8K E;  5CV6 A;  1M4V A;  2B8F A;  2I5L X;  3CQZ B;  4YHH L;  1SND A;  2MPM A;  5EQ0 A;  3NPP A;  2ZTC A;  2OF1 A;  1WTQ A;  3N52 A;  3NBH B;  4CKC A;  3VDY A;  1W6J A;  5IYC H;  3GTO B;  1I4H A;  2Q8T A;  1W6K A;  4IUR A;  4ZLT F;  1EZ8 A;  3BG3 A;  5FLM G;  2XNA C;  2A69 C;  4DK0 A;  1FNU A;  4Q0F A;  3NE5 B;  2JA5 B;  3OTO Q;  2HT1 A;  4C3I B;  1J6Q A;  2FFK B;  1AP0 A;  4X64 Q;  1I4X A;  3U9O A;  3QIA A;  1QNU A;  3CU7 A;  4RHR A;  4DK1 A;  2XSC A;  2AKW B;  4V19 0;  1HZ9 A;  5DAU A;  3ERS X;  1O7Y A;  2WB1 B;  1PRT B;  5CV5 A;  4PNY A;  1X55 A;  2QCP X;  4FVM A;  3AQQ A;  2EIF A;  1W2B A;  5JPM C;  2PZT A;  1H9S B;  4KKU A;  4CJ2 C;  4JI4 L;  5EKK A;  2EJM A;  3S1Q H;  2K14 A;  4K2K A;  2JN4 A;  3A7L A;  2F0W A;  3WOE A;  3RNU A;  4A3G B;  1ROD A;  5C44 H;  2HIV A;  1HA5 A;  1DJR D;  1GUS A;  4FF1 A;  1MSG A;  1EWC A;  1G8Z D;  1QUQ B;  3VR5 A;  1GKH A;  1N36 L;  1STB A;  5JPN C;  2B2W C;  4CDE C;  5FJ8 G;  3STB D;  1QJO A;  1UUP A;  3A7A B;  1NUC A;  3PUZ A;  4F7X A;  4G7H C;  2FMM A;  1STA A;  3D6W A;  2TMP A;  1SE8 A;  1EIY B;  4DV0 Q;  1PV4 A;  2F52 A;  3TN2 A;  4A3J G;  1WI5 A;  1TWF B;  2RKS A;  3K0X A;  1TWA H;  2IJ0 A;  4ABN A;  3HOZ B;  2HUG A;  5CV8 A;  1MGS A;  3CCM A;  4UY8 C;  1WYD A;  1ENC A;  1IW7 C;  1PYS B;  4LFB L;  4IUV A;  4GKJ L;  1VQ5 A;  3JAM c;  3J81 c;  1VQ6 A;  1QWY A;  4LAA A;  4QQB X;  1VQM A;  3HOW B;  4WJW A;  1RTO A;  5K5P A;  3X3N A;  5CYU A;  1BXT A;  4KI0 A;  5C3X A;  2NVT B;  1XTC D;  4JBJ A;  3KBX A;  4BY1 B;  2NVY H;  4PV1 C;  5FK9 C;  1X3G A;  3HOU G;  4LF4 Q;  4G57 A;  4A3C G;  1EYC A;  3GTQ H;  4JI6 Q;  3TZU A;  2R92 H;  1EQR A;  2F4V L;  1QCB D;  3DUZ A;  3OHX C;  2JE6 I;  3E9H A;  5DM6 3;  4IPG A;  1A0I A;  3QOJ A;  5FO9 B;  2EE1 A;  2NVQ H;  3AYH B;  1VQO A;  1ZXT A;  1K0S A;  1JOR A;  1JCK B;  1YZ6 A;  2N88 A;  3QR8 A;  1HNX L;  3NEL A;  2WB1 E;  2XRQ D;  3SGI A;  1TS2 A;  5AFW A;  1PFB A;  4AH6 A;  2ZM6 Q;  5JJK A;  3K81 C;  1WOC A;  2PQA B;  4TRD A;  4IOA A;  4X65 Q;  2F0N A;  1HH2 P;  2WAQ E;  1A62 A;  4RCN A;  3F1Z A;  1HXY D;  4OON A;  3NTH A;  5C3W A;  5C44 G;  3K5N A;  4IOC A;  4A3F H;  3K7U C;  5FO8 B;  4JYA L;  4DNI A;  1K3R A;  2E2I B;  3K59 A;  1VQ7 A;  1N8R C;  2EYP A;  1SEB D;  5ELD A;  2BDO A;  4KY5 A;  3K0Y A;  4JV5 L;  2C9O A;  2ZJR A;  4LF6 L;  4K2L A;  1C9O A;  5EPK A;  1SYG A;  4A3J H;  1UEB A;  3M7N A;  3FVQ A;  3H6M A;  1VMP A;  3SE0 A;  2NWG A;  4BY1 G;  4KY6 A;  1L0X B;  3EA6 A;  1Q12 A;  1TKW B;  4JI0 Q;  1E7Z A;  1WTP A;  5J22 A;  1TR5 A;  3VR3 A;  1QVG A;  3K6O A;  2VQE Q;  3HOV H;  1PZI D;  2VQF L;  2K05 A;  4OIJ A;  2UUA Q;  1U4P A;  1WJJ A;  3ICE A;  3SK6 A;  1I3Q B;  4ME3 A;  4CDC C;  3HOZ H;  2ZTD A;  1MJE A;  1G6Z A;  1DOK A;  1HPC A;  3RZD B;  1I5F A;  2KVM A;  1KDA A;  4HTH A;  1SMY D;  3C46 A;  1O7Z A;  1IBL L;  2E74 C;  2RVL A;  3HOU H;  1OTC A;  2H5X A;  4C3J H;  4KKS A;  2QEJ C;  4MHE A;  2WAC A;  5E4X A;  4RGT A;  1VQE A;  2AWO A;  4DXG A;  3FKI H;  4F87 A;  1YIJ A;  2B3G A;  1EY6 A;  3K7A B;  5IIF A;  2KUM A;  2FJ2 A;  1V1P B;  2UXD Q;  1XWE A;  3OPO A;  1BVS A;  3KLR A;  2IWH A;  2F0E A;  1Y8P B;  3E6Z X;  3MVV A;  1UE6 A;  5JJI A;  3BYY B;  3QO2 A;  3HOZ G;  3EVQ A;  3GD7 A;  2X6G A;  1SYB A;  4ID6 A;  3LX0 A;  3VA7 A;  5EJW A;  1T9H A;  1RIP A;  1RF2 D;  4C3J G;  1V1P A;  1JB7 A;  4JI2 Q;  2R93 H;  3CCL A;  3AMU A;  4K0K Q;  3V05 A;  3TRZ A;  3EIV A;  3S15 B;  1JMC A;  2XVS A;  1NAP A;  1U5K A;  4A3F G;  4LUV A;  4A3K H;  2RCN A;  1J5E L;  1D5M C;  5IGE A;  3OMG A;  5IP9 H;  1K0R A;  4HJ5 A;  3W2D A;  1LTS D;  3BU2 A;  3MXP A;  1XMO Q;  4LF4 L;  4A3B H;  1B53 A;  3G71 A;  3AU7 A;  1BCP D;  1EY5 A;  3BDL A;  3PSI A;  1YIT A;  1UAP A;  1LV9 A;  1WCM B;  4FP5 D;  4JI6 L;  2K5Q A;  1HQM C;  1YHQ A;  2A6E D;  4XTC S;  2F0Q A;  3M4Y A;  4DR6 Q;  4JC0 A;  1HNX Q;  2ICI A;  2O5I C;  3H91 A;  2F03 A;  1SE3 A;  2N3S A;  4XXE A;  1TWG B;  3TP5 A;  3D8G A;  2KEN A;  1MHW C;  5C0X J;  2VUM B;  1GUG A;  1FNW A;  1DCZ A;  4IQZ A;  3I56 A;  1E2Z A;  2HIX A;  4IUU A;  3T1Y Q;  2QEX A;  2PO4 A;  2NVQ B;  1E1O A;  1KD1 C;  3L3O C;  1CHQ D;  2EXZ A;  5EAY A;  1LM0 A;  4JYA Q;  2MO1 A;  4JBW A;  3OIP A;  2AQ3 B;  4EGV A;  3LWE A;  5LMU Q;  4R4T A;  5CV7 A;  5IT9 L;  1K9M C;  1Y1V H;  2MQH A;  4GOP B;  3BDO A;  4DR3 L;  1YNX A;  4IJL A;  1E3P A;  2JEB I;  4LF9 Q;  4LUZ A;  1I4G A;  1U4L A;  1PZJ D;  2ICE C;  1PYW D;  5CBE E;  1N36 Q;  1P16 A;  2JXM B;  1JOO A;  1F9Q A;  1VQB A;  1JOQ A;  1NTG A;  4JI0 L;  1V1O A;  1EWI A;  3W5O A;  4DV6 L;  1X3Q A;  2LFN A;  4AYB G;  1PFM A;  2Z0S A;  1BCP F;  2OXP A;  1CA6 A;  3U9S A;  2VQF Q;  1VQC A;  4HED A;  3A5Z B;  1TVX A;  2A6H D;  2L1B A;  1QZG A;  4APV A;  3I70 A;  1C8C A;  4NXM L;  2EQS A;  2F4I A;  1AEX A;  5CR3 A;  4C1N K;  1TY0 A;  1NY4 A;  1H9K A;  3CP0 A;  4C2M H;  3I7F A;  4JG2 A;  1WTH A;  1LLR D;  5C4X G;  1HA6 A;  3C1F A;  5IE8 A;  4I7Z C;  1LYL A;  3EN2 A;  4IPH A;  1VQF A;  1WCM G;  5M3F B;  4RKB A;  5KYL A;  3P1H A;  3KLS X;  1QZH A;  5IWA L;  1VQA A;  3PUW A;  2PQE A;  1Q81 C;  2PNH A;  2G5D A;  3CC7 A;  3HKZ B;  5HUR A;  1YJN A;  3CCQ A;  5IWA Q;  3RZO H;  3QJY A;  3L0O A;  1TWC B;  1JE5 A;  4DPG A;  3KJO A;  4POG A;  1BR9 A;  4C3H H;  2NN6 H;  1MBY A;  4RGO S;  4DK6 C;  4WRD A;  5I4D A;  2JA5 G;  2SEB D;  4B9X A;  2E2J H;  1SYF A;  3S1N B;  1S72 A;  2CWA A;  3I73 A;  4TKO B;  2X6L A;  2IY5 B;  4H44 C;  2G9D A;  2KCN A;  3GP7 A;  1TQO A;  3BZC A;  1CKN A;  3HS0 C;  5E7N A;  3G6J B;  2YTV A;  3TP7 A;  3TZD A;  4P2C B;  2DGY A;  4JVZ A;  1YJ9 A;  1BDO A;  4HR7 B;  3HRZ C;  1EY7 A;  2BDN A;  4LF8 Q;  4BY7 H;  2QW7 A;  5LMN Q;  1SRU A;  2JSO A;  3A0J A;  3A8I E;  4K5V A;  3I3C A;  4UP9 A;  2H1E A;  3CCE A;  3BVG A;  1ILP A;  3S9W A;  1CSP A;  4HID A;  1GVP A;  4G4K A;  2B2U A;  2B2T C;  5LMN L;  2HQL A;  4JBM A;  3S14 B;  1B9N A;  1IYJ B;  5M5X B;  3UDF A;  4LF6 Q;  4ZRZ A;  2CKZ B;  2XN9 C;  5FLX L;  4C1N I;  1STH A;  3HP3 A;  1AW7 A;  5JOB A;  4JI8 Q;  3CW2 C;  4I7A A;  4FF2 A;  1B9M A;  2B29 A;  2NTT A;  4CJ1 B;  1PH4 A;  1L0W A;  5IT9 E;  4LF5 Q;  4M1U B;  4A3D G;  4DV1 Q;  4P71 A;  4PQX A;  1SNC A;  4IZ8 A;  3EFX D;  1TII D;  3PQI A;  1WFQ A;  3S1R B;  2N55 A;  3T13 A;  3OW7 A;  1I50 B;  2RHQ B;  4HJA A;  2Q2U A;  1IYU A;  4LF9 L;  4DA2 A;  3CCV A;  5IP7 H;  1XPO A;  5C4X B;  1QE6 A;  4A3K G;  4JI3 Q;  3K5M A;  3S2H B;  2LS0 1;  2JEA I;  2K03 A;  1TWH B;  3PUV A;  5TSS A;  1H9R A;  3PIO A;  3CF5 A;  5CC4 A;  1K8G A;  3OW2 A;  1WTV A;  2GA4 B;  1SMY C;  3NBI A;  5J1Z A;  4R4O A;  1A6X A;  3GTJ H;  3D4D A;  4AIM A;  1B3Q A;  4NKL A;  3HKZ G;  2OTJ A;  2UU9 L;  4QUF A;  3VA5 A;  2EY1 A;  4RG1 A;  1OXU A;  4EQ5 A;  1JR0 D;  4R8N A;  4OO1 G;  4K5X A;  1AH9 A;  1U9R A;  3WWV A;  3S1M H;  1KXL A;  3M3Y H;  1HZA A;  2TSS A;  4S3S A;  2VL6 A;  3N6R A;  4XQN A;  1GD7 A;  3K58 A;  1A3U A;  1YHA A;  1DOM A;  1K8O A;  1AFP A;  3FEW X;  1L0Y B;  1T5E A;  4PZ8 A;  4A3D B;  2NVY B;  2EOT A;  4R9W A;  5GAD C;  3M85 A;  2L55 A;  3PO2 B;  3I91 A;  4IUQ A;  1EOV A;  3MXN B;  3GQB A;  1S5E D;  4IAL A;  1KHI A;  4RMF A;  4BXX H;  3H15 A;  1I4Q A;  1NMF A;  1EU4 A;  4L5R C;  4ZUI A;  1PH3 A;  1Q82 C;  3DWA A;  4A3I B;  2GVA A;  2D0P A;  4HAE A;  3MZ5 A;  5ELO A;  4PZ6 A;  3I4L A;  5M5W H;  1PTO C;  4PMC A;  2Q2I A;  2YTX A;  3UDI A;  4JBK A;  2Q8I B;  5GAG C;  1FR3 A;  1QVC A;  3FMC A;  1F9S A;  2ES2 A;  3NXW A;  2ZM6 L;  1OXT A;  2Z6B A;  4GOP A;  4KD4 A;  4PMW A;  4TQU S;  5I9O A;  4A3F B;  3TME A;  2RF4 A;  3NTI A;  5C4Z A;  4EQO A;  5IYC G;  3M4O H;  4RAU C;  1X3E A;  2WIN B;  2YYZ A;  4XYO A;  3T51 B;  4DNR B;  2XRS D;  1I50 H;  2B2Y C;  2EYM A;  1Y14 B;  5I2X A;  4XYQ A;  1GUN A;  2D5D A;  1NSN S;  5KIX A;  3UE0 A;  2UXB L;  4WJ3 M;  1KDB A;  1KLG D;  3H0G H;  4K8J A;  2WAQ B;  2YU9 B;  4A3M G;  1PRT C;  3UE1 A;  1I94 L;  4DXF A;  5BN4 A;  4YY3 Q;  3P7J A;  2F3V A;  3RD4 A;  4DV6 Q;  4DV1 L;  2K5W A;  4HMJ A;  4O0A A;  3HOY G;  4KD3 A;  1QG7 A;  1FJG Q;  1HNZ Q;  4P73 A;  4Y7N B;  4KJO A;  4IO9 A;  3F2B A;  1PH1 A;  2HQE A;  2SNM A;  5C3E G;  4KV6 A;  3KF6 B;  5J3B A;  2F0P A;  2BH2 A;  2B2V C;  2MUY A;  4AYB E;  2HCC A;  3I4O A;  3H0G G;  3I8Z A;  5JAV A;  4BA1 I;  1VQJ A;  4DF7 A;  5FJ8 H;  2B2Y A;  3S1M B;  5G3L F;  2D2C C;  3H94 A;  1HJP A;  4DAM A;  1R4P B;  2NTS A;  3CCR A;  4IFD J;  3SK5 A;  1UWV A;  2VNU D;  1D8L A;  1T5X D;  4LNQ A;  3HOV B;  2KED A;  4KJN A;  2K4K A;  1RTN A;  1X3F A;  4Z9C B;  2RDG A;  5C0X G;  1S5B D;  2BE5 D;  4DR7 L;  2DY8 A;  1AN8 A;  2V4D A;  4BWG B;  4DR2 Q;  1SNM A; 
#chains in the Genus database with same CATH homology
 3PIP A;  2UXD L;  5DLQ E;  2VQF L;  2UUA Q;  3NEM A;  1WJJ A;  3ICE A;  4A3L G;  2NN6 I;  4ME3 A;  1GO3 E;  1S40 A;  2ZTD A;  1PH6 A;  1MJE A;  2E5L L;  3PO3 G;  3HOZ H;  3S24 A;  1H95 A;  4JI8 L;  1I5F A;  4X62 Q;  2Z6K C;  3W1G A;  1IBL L;  4OXP A;  1KIX A;  3KOJ A;  4IJH A;  3HOU H;  4GLV B;  1B70 B;  1VQG A;  2XGT A;  3E0E A;  1OTC A;  2B63 H;  2H5X A;  1MIU A;  4C3J H;  3H3V I;  4A75 A;  2A19 A;  1JT8 A;  4UPA A;  1PH9 A;  4P74 A;  3AFP A;  1VQE A;  2AWO A;  3Q8D A;  3FKI H;  2Q2T A;  1VS0 A;  2EXD A;  4GLX A;  1YIJ A;  2B3G A;  5ELN A;  1MKH A;  2Y0S G;  3L2P A;  2GN5 A;  2UXD Q;  1NJI C;  1BVS A;  2DUD A;  1M90 C;  3RLN A;  3RN5 A;  3J80 i;  4GNX C;  1HR0 L;  3CC2 A;  1UE6 A;  5JJI A;  2E2H H;  3L7Z C;  3HOZ G;  3TRE A;  1K8A C;  2R92 G;  3TS2 A;  3GD7 A;  1CKN B;  4A3G G;  1NBW A;  1PH7 A;  1T9H A;  1RIP A;  4DUZ L;  2JA8 H;  3I4M H;  4QY7 A;  1E22 A;  4POF A;  4DR6 L;  4B3R Q;  2GVB A;  4HIM A;  1A8V A;  4IFD G;  4YWK A;  1JB7 A;  4GN4 B;  4JI2 Q;  2R93 H;  4X62 L;  3CCL A;  2K5H A;  3KYH C;  4QJF A;  2N49 A;  2HHH Q;  4K0K Q;  4Y52 H;  3TRZ A;  3EIV A;  3M9B A;  2LSS A;  2MO0 A;  1JMC A;  4A3F G;  1U5K A;  4JI4 Q;  4LUV A;  4A3K H;  1L1O C;  2RCN A;  4DKA C;  1CSQ A;  4DUY L;  3U58 A;  1O7I A;  1W3S A;  3BZK A;  4NPS A;  1J5E L;  4YWL A;  1S3O A;  5IP9 H;  2ASB A;  1XNQ L;  3U4V A;  2JA7 H;  1K0R A;  5M3F H;  3CD6 A;  1HR0 Q;  1LTL A;  4HJ5 A;  4HJ8 A;  2IT1 A;  1XMO Q;  3BU2 A;  2WFW A;  4LF4 L;  1TWH H;  4A3B H;  3G71 A;  4BBS G;  2ATW A;  1HZC A;  5IP9 G;  3PSI A;  1YIT A;  2QA4 A;  4JI6 L;  2KCT A;  2K5V A;  5FLM H;  2A1A A;  2VZA A;  2I5H A;  4A3M H;  2MFI A;  1VQH A;  5IY0 A;  1YHQ A;  4XTC S;  4HJ7 A;  3JAM i;  5GAE C;  3J81 i;  4HJ9 A;  3FP9 A;  3CCS A;  4LFA L;  4DR6 Q;  3M4P A;  1VCI A;  2L15 A;  1TXY A;  4JC0 A;  1HNX Q;  3HOW G;  1SR3 A;  2PQA A;  1VQN A;  2N3S A;  1CKM A;  2LXJ A;  1J5E Q;  2K75 A;  2KEN A;  5C0X J;  4MNO A;  4YY3 L;  1V43 A;  4JI3 L;  2IHF A;  3HOW H;  2R7Z H;  2JA9 A;  1Z9F A;  3I56 A;  3S2H H;  3T1Y Q;  2HIX A;  2AMC B;  2QEX A;  1IXR A;  4X66 L;  2AHO B;  1AE3 A;  1Q46 A;  4OWT B;  5HY6 A;  1Y1W H;  1GM5 A;  1E1O A;  1FJG L;  1N33 Q;  1HNZ L;  1KD1 C;  3GTL H;  1N8R C;  4LWC A;  4KHP Q;  1L1O A;  2RHS B;  3ER0 A;  3U50 C;  5EAY A;  1LM0 A;  4JYA Q;  4HIK A;  3KJP A;  3G4S A;  2MO1 A;  4JBW A;  4DV5 L;  3I4N G;  4A3I H;  2B63 G;  2C35 B;  1YHB A;  3S15 H;  5LMU Q;  1JJC B;  1KQS A;  4R4T A;  4DV4 Q;  1K9M C;  3ULJ A;  1N34 L;  1Y1V H;  2MQH A;  4GOP B;  3KLW A;  3J7Z C;  4A3L H;  3I2Z A;  4DR3 L;  1IBK L;  1YNX A;  3HKS A;  3RZD H;  1PFS A;  4IJL A;  1VQL A;  1E3P A;  2JEB I;  1TWF H;  3ZJY C;  5AJ3 Q;  4LUZ A;  4HIO A;  1XMQ L;  4LF9 Q;  3MEF A;  2OQ0 A;  2XTI A;  2R7D A;  1X56 A;  4QL5 A;  3HOV G;  1RL2 A;  1VQI A;  1N36 Q;  1XJV A;  1P16 A;  3HOX H;  3OTO L;  5IYB G;  2I0Q A;  3T1Y L;  1VQB A;  1NTG A;  2ZJP A;  1QUQ A;  4JI0 L;  1EWI A;  3DLL A;  3W5O A;  5IYD G;  4DV6 L;  4AYB G;  1VQD A;  4GKJ Q;  4A3C H;  4X6A H;  2Z0S A;  4JCV E;  2VQF Q;  1VQC A;  3NEN A;  1OXX K;  3A5Z B;  5M3M G;  4X65 L;  3A5U A;  1HNW Q;  5M5Y H;  1QZG A;  1X54 A;  4KLK A;  4APV A;  3G6E A;  1EUJ A;  4NXM L;  2EQS A;  2UXB Q;  4P75 A;  5M3M H;  3G48 A;  1Q7Y C;  4DR3 Q;  4DV2 L;  1IBK Q;  1XTD A;  2IX0 A;  5LMN W;  1DGS A;  2K50 A;  2KCM A;  2JA8 G;  5IP7 G;  1Q86 C;  3I4M G;  2A8V A;  1MJC A;  1NY4 A;  5C4X H;  3CP0 A;  3F2C A;  4C2M H;  3I7F A;  3CCU A;  1P8L A;  3PUX A;  3J81 j;  1XMQ Q;  4DV7 L;  4JG2 A;  1Q1B A;  2R93 G;  4GN3 B;  1VQK A;  5C4X G;  5IYD H;  2K52 A;  2F4V Q;  1E1T A;  3PF4 A;  1VQ8 A;  3F8T A;  5IE8 A;  4BBR H;  5HGQ A;  4LF5 L;  1LYL A;  1XPU A;  3HOY H;  3EN2 A;  4LFC Q;  4B3M L;  4IPH A;  4A3B G;  1VQF A;  1B8A A;  1WCM G;  2Q2H A;  4R4Q A;  4YWM A;  2NVX H;  2UUC Q;  4B3T L;  2CWP A;  2JK8 A;  3ULL A;  4X66 Q;  5M3F G;  1QZH A;  4TVA B;  1D7Q A;  4MTN A;  1XNR Q;  1ASZ A;  5IWA L;  1VQA A;  3PUW A;  4P72 A;  1I94 Q;  4LW1 A;  4PG3 A;  2PNH A;  1WCM H;  1Q81 C;  4DUZ Q;  1KAW A;  4B3R L;  4B3M Q;  3CC7 A;  4LF7 L;  4OX9 L;  2UUB L;  3F2D A;  1BBU A;  4JI5 Q;  1YJN A;  3CCQ A;  4GNX B;  5IWA Q;  3RN2 A;  2JA7 G;  3RZO H;  1UE1 A;  2UXC Q;  2CQO A;  1I6H H;  5LMU L;  3L0O A;  1JE5 A;  4DPG A;  3EBE A;  4JI1 Q;  3KJO A;  1ASY A;  1N34 Q;  4X64 L;  1YVC A;  4POG A;  4DUY Q;  4C3H H;  4OO1 I;  1SN8 A;  2D0O A;  4DV7 Q;  3GTO H;  4JI5 L;  4LFC L;  4DK6 C;  1QVF A;  3PO3 H;  2JA5 G;  4H02 A;  4A4I A;  4A3I G;  1TWC H;  2E2J H;  4DR1 Q;  4DR4 L;  4B3S L;  1G51 A;  1S72 A;  1OXS C;  2CWA A;  2VQE L;  4A76 A;  2IY5 B;  4IFD I;  3TS0 A;  5BR8 Q;  1VQP A;  3BZC A;  1CKN A;  1KRS A;  2KHI A;  1PHJ A;  2UUC L;  5E7N A;  2WAQ G;  2YTV A;  5GAH C;  4GLA C;  2DGY A;  1YJ9 A;  2WB1 G;  3S2D H;  3S1R H;  2D62 A;  1Q1E A;  4A93 H;  3PGZ A;  4LF8 Q;  4BY7 H;  4ALP A;  3I55 A;  3PCO B;  2IHE A;  5LMN Q;  1SLJ A;  1BBW A;  1SRU A;  1N32 L;  3J80 c;  5IYB H;  2BA0 A;  3A0J A;  3ULP A;  4JI1 L;  3S14 H;  2WP8 J;  4UP9 A;  3S16 H;  1E24 A;  3J7A 5;  1Z47 A;  3GDE A;  3CCE A;  4DR7 Q;  1CSP A;  4HID A;  1GVP A;  4JI7 Q;  5C4J H;  4LUO A;  2HQL A;  5LMN L;  4DR1 L;  4JBM A;  1SRO A;  2UUA L;  1IYJ B;  4XIG S;  1JJ2 A;  3HOX G;  2ALY B;  3UDF A;  4LF6 Q;  4NXN Q;  2V1C C;  2CKZ B;  1AE2 A;  3GTM H;  2YU9 H;  2I5L X;  4JI8 Q;  3STB C;  2VW9 A;  3CW2 C;  1Y1V G;  4YHH L;  3CPW A;  4OWW B;  4R4C A;  2B29 A;  2NVT H;  1PH4 A;  1L0W A;  2F3I A;  2ZTC A;  4LF5 Q;  3PO2 G;  2OWO A;  3HFZ B;  1M1K C;  4A3D G;  2KBN A;  4DV1 Q;  4P71 A;  2I5M X;  5IT9 c;  1L2F A;  3A74 A;  4YCV A;  3CCJ A;  3U4Z A;  1BKB A;  3NBH B;  2E8G A;  2PI2 A;  1JJG A;  1FL0 A;  2K5N A;  3FHW A;  2KHJ A;  1WFQ A;  3VDY A;  4LF8 L;  3HOV H;  5IYC H;  4EX5 A;  4YCW A;  2HHH L;  4GNX A;  4K0K L;  4O2D A;  1PH8 A;  5FLM G;  2RHQ B;  1IZ6 A;  4HJA A;  2Q2U A;  3CPF A;  4LF9 L;  4KHP L;  3CCV A;  3KDF A;  3UDX A;  2UUB Q;  5IP7 H;  1XPO A;  4A3K G;  1I3Q H;  3H3V H;  3OTO Q;  4JI3 Q;  1XMO L;  3FKI G;  4R1J A;  3E9I A;  2HT1 A;  1J6Q A;  4YHH Q;  1KC8 C;  4X64 Q;  2JEA I;  3AEV A;  3PUV A;  1OXV A;  3PIO A;  2JA6 G;  3CF5 A;  1R9T H;  3RLF A;  1HZB A;  4A3D H;  1K8G A;  2ID0 A;  2OQK A;  4JI2 L;  3OW2 A;  1PA6 A;  5GRO A;  2AKW B;  1N33 L;  3PO2 H;  1HZ9 A;  3KF6 A;  3ERS X;  4WJ4 A;  4R4O A;  3GTJ H;  4R4I A;  1Q8K A;  1YEZ A;  4AIM A;  2OTJ A;  3HKZ G;  3T1H L;  2UU9 L;  3KFU A;  5C3E H;  1FVI A;  1G6P A;  4GKK Q;  4RG1 A;  2JJQ A;  1EIF A;  1OXU A;  3KF8 B;  3RR5 A;  1X55 A;  4EQ5 A;  4DV4 L;  3AQQ A;  2EIF A;  1W2B A;  2BA1 A;  4BY1 H;  4OO1 G;  3DM3 A;  2R7Z G;  3GTK H;  4JI4 L;  3TEH B;  1AH9 A;  4IPD A;  3S1Q H;  2K14 A;  3WWV A;  3S1M H;  1KXL A;  3M3Y H;  3RNU A;  1C7Y A;  1HZA A;  5C44 H;  1XNQ Q;  2VL6 A;  5FLX c;  4L5T A;  1GD7 A;  4YCU A;  2HIV A;  3CXC A;  2PMZ E;  1YHA A;  5JJL A;  1TWG H;  4C3I H;  1XPR A;  1QUQ B;  2QGQ A;  4AQY L;  1GKH A;  2NZH A;  3PF5 A;  1N36 L;  4PZ8 A;  5GAD C;  1EFW A;  3M85 A;  5FJ8 G;  3STB D;  5H1S E;  1PH2 A;  1K83 H;  1EOV A;  3MXN B;  3PUZ A;  1PVO A;  1KHI A;  4RMF A;  2R7F A;  4AQY Q;  2JA5 H;  2UU9 Q;  4BXX H;  3H15 A;  1SE8 A;  1NMF A;  1EIY B;  4DV0 Q;  3CMA A;  1PV4 A;  2F52 A;  4L5R C;  4A3J G;  1HNW L;  1WI5 A;  1PH3 A;  2YTY A;  2Z6K A;  3K0X A;  1Q82 C;  1TWA H;  4BA2 I;  5K36 G;  2GVA A;  2D0P A;  1B7Y B;  3D31 A;  3CCM A;  4UY8 C;  5ELO A;  4PZ6 A;  1WYD A;  1G29 1;  1PYS B;  4DK3 C;  4A3E G;  5M5W H;  4J15 A;  4GKJ L;  4LFB L;  2Q2I A;  2YTX A;  5M5X H;  3UDI A;  1VQ5 A;  4JBK A;  4BY7 G;  2R6G A;  2VY3 A;  3JAM c;  2ZTE A;  3RLO A;  3J81 c;  5BR8 L;  1VQ9 A;  1VQ6 A;  4QQB X;  1VQM A;  1N9W A;  4L5Q A;  5GAG C;  2Y0S E;  4DR5 Q;  1IBM L;  4OWX B;  2MNA A;  1QVC A;  4B3T Q;  2ES2 A;  3PUY A;  2ZM6 L;  4DV3 L;  1OXT A;  4KI0 A;  4PZ7 A;  4GOP A;  1PH5 A;  4FDB A;  4L5S A;  3S17 H;  1YI2 A;  4JBJ A;  4PMW A;  4TQU S;  4BBR G;  2NVY H;  1NMG A;  2FXQ A;  4Y7N H;  1N32 Q;  1X3G A;  4GN5 A;  2RF4 A;  5JEA J;  3HOU G;  4LF4 Q;  5IYC G;  4DR5 L;  1IBM Q;  4A3C G;  3M4O H;  1KRT A;  3GTQ H;  4DAY B;  3HKZ E;  3UDG A;  4DV5 Q;  1X3E A;  4JI6 Q;  4LF7 Q;  4A3G H;  2YYZ A;  1YBY A;  4DV0 L;  3T1H Q;  2R92 H;  4DV3 Q;  2JA6 H;  1EQR A;  1I50 H;  2CFM A;  2F4V L;  3JC6 6;  4A3E H;  1SFO H;  4GOP C;  1Y14 B;  2JE6 I;  3E9H A;  4IPG A;  2OTL A;  1A0I A;  4OX9 Q;  2NVQ H;  3AYH B;  1VQO A;  2IX1 A;  4NXM Q;  1YZ6 A;  3UE0 A;  2UXB L;  1EQQ A;  4WJ3 M;  4JV5 Q;  1HNX L;  1A63 A;  3KDF B;  3H0G H;  4LFB Q;  3NEL A;  1K73 C;  2WB1 E;  4A3M G;  1FGU A;  3SGI A;  3UE1 A;  1I94 L;  2ZM6 Q;  4AH6 A;  4YY3 Q;  5JEA G;  4B3S Q;  5JJK A;  3CAM A;  3K81 C;  1EYG A;  1WOC A;  2PQA B;  3OYY A;  3PV0 A;  4X65 Q;  1HR0 W;  4DV6 Q;  4DV1 L;  4IOA A;  3GO5 A;  1CUK A;  1HH2 P;  2WAQ E;  3D0F A;  4IPC A;  3LGJ A;  1A62 A;  5C0X I;  4DR4 Q;  4KHZ A;  4O0A A;  3F1Z A;  2PI2 E;  4OON A;  5GQO A;  3HOY G;  4BBS H;  1X6O A;  3BJU A;  4MZ9 A;  4UP7 A;  1HNZ Q;  4JOI A;  4UP8 A;  1FJG Q;  5C44 G;  4IOC A;  4DR2 L;  2AWN A;  4P73 A;  1VQ4 A;  2JQO A;  3K8A A;  3W1B A;  2BH8 A;  3K7U C;  3F2B A;  4IO9 A;  5C3E G;  4A3F H;  1PH1 A;  4JYA L;  3KF6 B;  5J3B A;  4DNI A;  2BH2 A;  1K3R A;  4AYB E;  1VQ7 A;  4QIW E;  1PYB A;  1V1Q A;  1SMX A;  3K80 C;  3I4O A;  3K7A H;  2N8N A;  4GS3 A;  3AFQ A;  4DV2 Q;  3H0G G;  2CCZ A;  1L1O B;  2NN6 G;  4A93 G;  1KL9 A;  4NB3 A;  2OCE A;  4BA1 I;  3CME A;  4JI7 L;  1VQJ A;  1UE7 A;  1X65 A;  5FJ8 H;  1IBL Q;  2E2I H;  2NZO A;  3S1N H;  2VUM H;  1NE3 A;  4JOI C;  1IL2 A;  1X9N A;  1V9P A;  1HJP A;  4JV5 L;  2E5L Q;  4DAM A;  2ZJR A;  4NXN L;  4LF6 L;  3CQZ H;  2LXK A;  1C0A A;  3M4Q A;  5AJ3 L;  3CCR A;  1YJW A;  3IRB A;  4QGU A;  1C9O A;  2VUM G;  3GTP H;  1UE5 A;  4A3J H;  1UEB A;  3M7N A;  3GTG H;  4IFD J;  1CKO A;  1UWV A;  3TQY A;  2VNU D;  3B6Y A;  1D8L A;  4BY1 G;  4LNQ A;  1LUZ A;  3CC4 A;  2K4K A;  2VS1 A;  1Q12 A;  2N78 A;  2YV5 A;  1Y1W G;  4JI0 Q;  1X3F A;  4GKK L;  1XNR L;  1E7Z A;  5C0X G;  4BXX G;  1QVG A;  4DR7 L;  3I4N H;  1U0L A;  2VQE Q;  2UXC L;  2ZJQ A;  4DR2 Q;  4LFA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...