2UXDL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 12
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxdL00
4NPSA 1NY4A 4A3DG 2KHIA 4DAMA 1E1OA 4BBRH 1PH6A 4Y7NH 5IYDG 4DUZQ 4DR4L 3FHWA 4GS3A 2UU9Q 4C2MH 1IBLL 3CD6A 2CQOA 1VQCA 1B8AA 3BJUA 4X62L 3M7NA 1X6OA 4OO1I 4LF9Q 3F1ZA 4NXNL 4A3KH 1L1OB 2YU9H 2IX0A 3PO3G 4DR7L 3A74A 5IWAQ 1SRUA 2CKZB 1VS0A 2E8GA 4ME3A 1KRSA 1OXVA 4B3TQ 1VQ6A 2R92G 2V1CC 3KLWA 4R4CA 3KJPA 2MFIA 2OTLA 4GOPC 1LTLA 4JI1L 1IXRA 3HOYG 3UE0A 1Q81C 4DUZL 1TWHH 4LWCA 4HJ9A 4ALPA 4AQYQ 4QJFA 2OTJA 1C9OA 1S72A 1EUJA 1W2BA 1X54A 2JE6I 2OQ0A 4JBJA 3S15H 1UE1A 3PUWA 2HHHQ 4X65Q 4YY3L 4JI6Q 1C7YA 3HOUG 3HOWG 4JI0L 3PUYA 1PH7A 1JE5A 2WAQE 4IFDJ 1CKNA 1PHJA 1VQ7A 2B63G 3CMEA 3S17H 2GVBA 3HKZG 1WCMG 4P73A 3GTGH 2B3GA 1YHBA 1VQKA 3FP9A 4P74A 3F2BA 1NE3A 4BXXH 3CQZH 3AYHB 5LMUQ 1XMQQ 2XGTA 1IBLQ 4A3CH 4A3EH 1Q1BA 3FKIG 4O0AA 3A5ZB 1OXUA 2JA7H 1FGUA 3U50C 4HIKA 4OX9Q 3I4NH 1UWVA 4DR3L 1Y1WG 1A0IA 2NVQH 3RLNA 1WFQA 4LUOA 1SLJA 3TRZA 5M3MG 2UXBL 1T9HA 1X56A 4IPHA 5M3FG 4X6AH 4R4QA 3K7UC 5JEAG 1Q46A 1UE6A 3JC66 3M4QA 1JMCA 2ASBA 1OXTA 2YTVA 1A8VA 3W1GA 1VQJA 4X64Q 3RN5A 1S40A 4JBKA 4GN3B 2R6GA 2WP8J 3L0OA 3GTQH 5JJKA 1H95A 3TREA 1XNQQ 1C0AA 1TWGH 2JA9A 1E7ZA 2LXKA 5IYCG 4GNXA 1IZ6A 1YITA 3UDXA 2JA8G 3LGJA 1SMXA 2JA8H 1E1TA 1IBMQ 4LF8Q 4EX5A 4OONA 1SE8A 5IP9G 1HR0Q 1CKMA 4YWKA 2HQLA 4PMWA 4JI2Q 1HZBA 4JI7L 4YCVA 3PO3H 2KCMA 3CW2C 1XNRL 2R7DA 2UUBL 3RZOH 5GQOA 5BR8Q 4DV2L 2IT1A 3SGIA 4LF6L 5LMNQ 4DR4Q 1TWFH 2F3IA 4P75A 3UDFA 2JA6G 1VQPA 1R9TH 1EQQA 1E24A 4B3SQ 1KQSA 4J15A 4EQ5A 3H15A 4AH6A 1OXXK 4LFAL 2HHHL 3S16H 1YZ6A 4L5TA 1NMGA 1SROA 3NENA 2VY3A 1VQLA 2Q2TA 2Z6KA 4IPDA 1RIPA 2B29A 1X9NA 2UXBQ 4GKKL 1JJGA 4LUZA 4H02A 1MJCA 1PH2A 4YCUA 3TEHB 4HJAA 4JI0Q 2OQKA 2K4KA 2D0OA 2NZOA 3K0XA 4JI8L 5FLXc 3KDFB 3CCMA 1CKNB 4JI1Q 4DV6Q 2UXDQ 3CCUA 1QZGA 5AJ3L 4B3RL 1OTCA 4JG2A 5EAYA 4B3MQ 1WI5A 4DK3C 2FXQA 3A0JA 3D0FA 4JBMA 4YHHQ 2EQSA 4YHHL 4JOIA 4KI0A 4NXNQ 4DR7Q 4OX9L 1KC8C 4LNQA 4DV5Q 4HIOA 3CCEA 4LW1A 4C3IH 3TQYA 1E3PA 1TXYA 4DV0Q 1JT8A 1I3QH 4DV3L 3CF5A 4DV6L 4OWTB 1EOVA 2ZM6L 4DV1Q 4KHPQ 2PNHA 1GVPA 3RN2A 4OWWB 4BY7G 1J5EQ 4A3LG 1LYLA 4C3JH 4JOIC 3J80c 1XNQL 2XTIA 4DK6C 1SR3A 1TWCH 1V1QA 4XIGS 4BY1G 3CCRA 1XTDA 4LUVA 4DUYL 4DV7Q 1PFSA 2EXDA 4QIWE 5JEAJ 1O7IA 4X65L 3KJOA 4BA2I 4BBRG 3I56A 5HY6A 1PH5A 4BBSG 3S2HH 1Q7YC 3CAMA 5IP7G 3M9BA 2C35B 3U58A 5C4JH 1VQOA 1HR0W 1FJGQ 2ZM6Q 4IPCA 1YVCA 2BH8A 1PYSB 1PH4A 3S1MH 1V43A 5LMNL 4DAYB 4JI5L 3KF6B 4JI3Q 4L5QA 3S24A 4OXPA 5IWAL 4DR5L 3IRBA 2F4VQ 2N8NA 4JC0A 1N34Q 3E9IA 2AHOB 4A3JH 4A3GG 3ERSX 4PZ6A 2F52A 4XTCS 1VQ4A 1U5KA 1ASZA 3FKIH 5C0XI 3I4MG 3S2DH 1N9WA 3I4MH 3J7ZC 4A76A 5FLMH 1EIFA 1BKBA 4JYAL 1UE5A 5M3MH 2WB1E 4X66Q 1Z47A 2KENA 1HNWQ 2H5XA 1EYGA 3F8TA 3GDEA 4DV5L 2E5LL 2N78A 2WB1G 3I2ZA 1TWAH 5M5XH 2F4VL 2HIVA 4JI2L 5GROA 4PZ7A 1JJCB 4A3EG 3GTPH 1DGSA 4TQUS 1K8GA 4JI7Q 1QVCA 1X55A 3T1YL 3GD7A 1I94L 3M4PA 4IOCA 1CKOA 2CFMA 2YTYA 1IBKQ 4A93G 3BZCA 4DPGA 5IP9H 3KF6A 2VQFL 4A3BH 1HNWL 3RLOA 3BU2A 1XMOQ 4JV5L 2R93H 5K36G 2PI2A 3CC4A 2E5LQ 3G71A 3PUXA 1Y1VH 1YJNA 1JJ2A 1I5FA 2PQAA 4IJLA 2KHJA 4GLXA 4A3MG 1LUZA 3W1BA 3GO5A 5LMNW 5H1SE 1KAWA 3F2DA 3RZDH 1M1KC 1GM5A 4BA1I 2E2HH 3HKZE 2VS1A 2UUBQ 3MXNB 5GAEC 1J5EL 5IYDH 3K80C 1XPRA 2WAQG 1VQDA 3EBEA 4Y52H 1Q12A 2RF4A 1CSQA 2VQEL 4B3SL 4DR1Q 1HNZL 2HT1A 1IBML 4DR2Q 4C3HH 2N3SA 1HNZQ 2R7ZG 3E0EA 1FVIA 2R7ZH 2ATWA 3CC2A 2ZTCA 3PIOA 2YV5A 1HZ9A 1HH2P 1UE7A 1MIUA 3PSIA 4AIMA 2QA4A 1QVGA 2Y0SG 1IL2A 3ICEA 2NVYH 3Q8DA 2K5HA 4JCVE 1P16A 3PF5A 1L1OC 4UP8A 1L0WA 2PMZE 1K83H 4GLAC 1Y1WH 2I0QA 5AJ3Q 4B3RQ 1PH3A 4JI4L 1VQMA 3CPWA 3TS2A 4JI6L 4LF5Q 3OW2A 3HOXG 3L7ZC 2IHFA 5C3EG 4HJ8A 1SFOH 4DR3Q 3UDIA 3K7AH 3HOZG 4BY7H 1Y14B 2OCEA 1Y1VG 3WWVA 2VZAA 4DV0L 3J80i 1Q86C 2E2IH 1Z9FA 1PA6A 4KHPL 5IYCH 3OYYA 2ES2A 5GADC 4A3FG 5LMUL 1HNXL 3JAMi 1AE2A 2D62A 3D31A 1HZCA 1BBWA 2RHSB 4UY8C 4IOAA 1KXLA 4HIDA 5FJ8G 5C0XG 1V9PA 4A75A 4UP9A 5IP7H 5M5WH 1K8AC 1Q1EA 4DR1L 4LF9L 2MNAA 3I4OA 3HOVG 1YBYA 1WYDA 2R7FA 3PV0A 1VQGA 5C4XH 4HIMA 4LF4L 4LFBL 1E22A 1VQAA 5JJLA 4A3FH 4A3BG 1Q8KA 4LFCQ 4JI8Q 1VQBA 1BVSA 2ZJPA 1K0RA 1GD7A 4X64L 4KHZA 4RG1A 3H3VI 2A19A 2E2JH 5J3BA 1XJVA 1S3OA 2UUAL 4DR6L 4K0KL 4JI4Q 4MZ9A 2Q2IA 1QUQA 4DV4L 2JJQA 4JBWA 2JQOA 4LFAQ 3G6EA 2K5NA 1VQHA 2EIFA 2NN6G 5ELOA 3J81i 1VQ9A 4LF5L 1HJPA 1XPUA 2L15A 1G51A 1B7YB 4JYAQ 4DR5Q 3ZJYC 5ELNA 4LFBQ 1EWIA 1VCIA 3CCLA 2Z0SA 2LSSA 4WJ4A 3NELA 4LFCL 5GAGC 2VUMG 3F2CA 1G6PA 1GKHA 4OWXB 1LM0A 1X3EA 4A3IG 3GTMH 1N32Q 4GOPB 1HNXQ 5BR8L 1N8RC 4WJ3M 2HIXA 3AFQA 1N33Q 2BH2A 3T1HQ 1I94Q 4B3ML 1YHAA 4MTNA 4A3GH 3E9HA 1WJJA 3H0GH 5IE8A 3M85A 4DV7L 4R4IA 1N36Q 4GLVB 4IFDI 3KYHC 1XPOA 3S1QH 2K5VA 3KFUA 1J6QA 2CWPA 4R4TA 4A93H 4GKJL 1W3SA 1NMFA 4GKJQ 1IYJB 1VQEA 4IO9A 2ZJRA 3K81C 4P72A 3A5UA 3CCQA 3HOYH 1PVOA 1NJIC 3GTKH 2MO0A 1KL9A 2AWNA 4APVA 1IBKL 3J81j 4AQYL 5C44H 3GTOH 3U4VA 3T1YQ 1QZHA 4DV2Q 4LF6Q 3H3VH 3KF8B 5IYBH 1K3RA 1D8LA 1K9MC 1ASYA 2NVXH 4YWMA 4DR2L 1N36L 1XMOL 4A3DH 2MO1A 1YEZA 3HOWH 2VL6A 2K50A 4DV3Q 1KRTA 4UP7A 1WCMH 3K8AA 3CMAA 2R93G 2AMCB 1FJGL 4OO1G 3OTOQ 3EN2A 1YHQA 1I6HH 1NTGA 4P71A 2QGQA 5C4XG 1PV4A 1PH9A 2UUAQ 4QL5A 4L5SA 4DR6Q 3HFZB 4HJ7A 3S1RH 5DLQE 2QEXA 4A3CG 1VQNA 1PH1A 3TS0A 1YJWA 3ULLA 2CWAA 1VQ5A 2K52A 2ZJQA 4GN4B 1BBUA 4POFA 4TVAB 1A63A 3CC7A 2ALYB 3S1NH 1AE3A 2YYZA 1KD1C 2YTXA 4AYBE 4GNXC 1Q82C 2KCTA 4GKKQ 1VQFA 3RNUA 4A4IA 3KOJA 1N33L 2UXCL 5C44G 3I7FA 1XMQL 4JI5Q 2NVTH 2RCNA 2A1AA 2UU9L 2OWOA 2JEBI 1L1OA 1VQIA 3CPFA 1KHIA 2D0PA 4QGUA 1X3GA 4HJ5A 2LXJA 2DGYA 4LF7Q 2WFWA 4IJHA 2NN6I 3PIPA 3UDGA 2BA0A 3STBD 2JA6H 1HR0L 2N49A 3H0GG 4UPAA 3HOUH 2K75A 2JA7G 3GTJH 4AYBG 4DKAC 5HGQA 5C3EH 3I4NG 3HOZH 4X66L 3PO2H 4L5RC 2PI2E 1WOCA 3CCJA 4QY7A 3MEFA 1X65A 3KDFA 4GN5A 3W5OA 4A3MH 4DNIA 1B70B 4DUYQ 1YIJA 1CUKA 4PZ8A 2ID0A 2K14A 3G48A 1FL0A 3CXCA 1QUQB 3STBC 4FDBA 3S14H 4RMFA 1PYBA 3RLFA 3G4SA 1QVFA 4BBSH 1N34L 2I5HA 3PCOB 4PG3A 2GVAA 3AEVA 4LF4Q 2NZHA 4GNXB 4R4OA 4A3KG 3J81c 1D7QA 1XNRQ 4NXMQ 2I5MX 4POGA 3JAMc 3NBHB 2I5LX 3ULJA 4YCWA 5M3FH 1CSPA 3T1HL 2UUCQ 4JI3L 2JA5G 5IT9c 2VQEQ 1EQRA 4DV4Q 3UE1A 1SN8A 4YWLA 1YI2A 4IPGA 1PH8A 2KBNA 1AH9A 1MJEA 2GN5A 3CP0A 3PGZA 3PUZA 4LF8L 2JEAI 2IY5B 1I50H 1P8LA 2AWOA 4BY1H 1EFWA 4QQBX 4IFDG 3J7A5 2AKWB 1A62A 3HOXH 4R1JA 1RL2A 3OTOL 3M4OH 1G291 3M3YH 4K0KQ 4A3LH 2BA1A 3CCVA 2UUCL 2PQAB 2B63H 3DM3A 5JJIA 4JV5Q 3PUVA 2Q2UA 1MKHA 4O2DA 2VQFQ 2RHQB 5IY0A 2JK8A 4KLKA 4GOPA 3HOVH 4B3TL 4BXXG 4LF7L 2VNUD 1L2FA 2CCZA 2R92H 2UXCQ 1NBWA 3BZKA 5FJ8H 1X3FA 2VW9A 2DUDA 3EIVA 3NEMA 3ULPA 2Z6KC 1N32L 5IYBG 4NB3A 3VDYA 2IHEA 3U4ZA 5E7NA 1EIYB 4NXML 2UXDL 3RR5A 3AFPA 1YJ9A 1VQ8A 2Q2HA 1U0LA 4MNOA 4X62Q 1YNXA 3CCSA 1HZAA 2Y0SE 3ER0A 3L2PA 4A3JG 1KIXA 2ZTDA 1JB7A 1GO3E 1K73C 2JA5H 3PF4A 3B6YA 3HKSA 1M90C 3DLLA 2ZTEA 1OXSC 5M5YH 2A8VA 5FLMG 4YY3Q 3GTLH 2IX1A 3I55A 1UEBA 3PO2G 2MQHA 5GAHC 5C0XJ 4DV1L 2VUMH 3AQQA 4A3IH
chains in the Genus database with same CATH superfamily
1B53A 4NPSA 1S4ZA 1Y1VB 4RAUC 4CKBA 5I4DA 4N9TA 3FHWA 1ZYRD 1IBLL 3CD6A 1VQCA 1B8AA 4X62L 3SE0A 3IL8A 2IX0A 2CKZB 4HCSA 4ME3A 1VQ6A 2R92G 2K04A 2V1CC 3KLWA 4ODGA 5JAVA 3HOYG 3UE0A 1Q81C 1SDFA 3K5LA 4HJ9A 1O78A 4QJFA 5C4ZA 3D4RA 5ELDA 1X54A 4RCNA 5IT9E 4K14A 3S15H 1UE1A 3PUWA 2EOTA 4JI6Q 3HOWG 1AP0A 4IFDJ 4KMUC 3FPPA 1SXTA 2JA8B 1EYAA 2XRQD 5C5MA 1GUSA 2K32A 4WFN3 1HRJA 5C6AA 3IFTA 4NKLA 1Q1BA 1FGUA 2F3WA 2CHBD 1TS4A 4HAEA 3RLNA 1SLJA 3TSSA 2E75C 5ELBA 5JVH3 3K7UC 1UE6A 2ASBA 3M4QA 2YTVA 1B9NA 1A8VA 4JBKA 1EYCA 1VQJA 1HUMA 1Z6HA 1BCPF 1EZ6A 5IGEA 1XNQQ 1TWGH 2JA9A 4XT1B 5IYCG 1YITA 3FMCA 1SJHD 2JA8H 4LF8Q 1WTHA 4PMWA 4JI2Q 1HZBA 4JI7L 4YCVA 1XNRL 2R7DA 1VF5C 1JORA 1ML0D 5LMNQ 4OEMB 2F3IA 4P75A 3UDFA 2JA6G 3VR3A 1E24A 4B3SQ 1KQSA 4EQ5A 4AH6A 1ET6A 2Q2TA 1VQLA 2VY3A 5HURA 1Q3LA 1X9NA 5DM63 5I9OA 1JJGA 4LUZA 4R8NA 1MJCA 1PH2A 3TEHB 4HJAA 2EJGC 5FLXc 1XWEA 4IURA 1CKNB 5CV8A 1B50A 1QZGA 3LWEA 5EAYA 2MP1A 1TS2A 3OIPA 1PXUA 4QF4A 2EQSA 1TWFB 2QDBA 4NXNQ 1KC8C 4DV5Q 4HIOA 3E0JA 1R4PB 2K05A 1I3QH 3R93A 4DV6L 3KK7A 4OWWB 4PMBA 4WJWA 4C3JH 3KLSX 1SR3A 1DONA 1V1QA 3MWYW 4BA2I 2KQ3A 5HY6A 1K3BC 3M9BA 4BWGB 4H7BA 2EVBA 1LTRD 4CGYB 2JA7B 1V43A 3OWEB 2K7VA 1EFID 4JI5L 4JI3Q 3VR2A 4DR5L 3CQZB 3S9WA 5C3WA 4JC0A 1D5ZC 2JXMB 1FYCA 2HCCA 1JE4A 4XTCS 1U5KA 4CKEA 4O42A 2RA4A 4OL7A 1UE5A 2WB1E 2NVYB 1LTTD 1HNWQ 4DXFA 2KEEA 3GDEA 3F2UA 2A69C 2N78A 3I2ZA 5M5XH 4K5VA 4FF3A 4JI2L 1EOTA 1H9SB 4C3JB 1QVCA 3GD7A 4IUPA 1C48A 4RHSA 1I94L 1CKOA 1G91A 4ZKCB 3K5MA 2EY5A 1XYIA 3RLOA 3BU2A 4HN7A 3QWNA 2R93H 2F0LA 3GTMB 1PZID 3G71A 3PUXA 2Z6BA 1YJNA 1JJ2A 3A54A 2PQAA 3BYYB 4A3IB 5LMNW 3I4MB 1NR4A 1M1KC 3V05A 5TSSA 4BA1I 2A6EC 2DJFC 2P5ZX 2E2HH 1QJOA 1XPRA 3EBEA 1Q12A 4I7ZC 4WORA 4IALA 1A15A 2KVMA 3SK8A 1HNZQ 3FVQA 2ZTCA 5KNCA 2YV5A 1IL2A 3T4AC 1QVGA 5C4JB 3SXHA 3Q8DA 1WTVA 4LAAA 2NYZD 4EQPA 4UP8A 3MHBA 2VB2X 2CQAA 4FXDA 3PO3B 1E2VA 3OPOA 2A6HD 3TS2A 1KDBA 4LF5Q 3OW2A 2F0UA 1V1PB 2TMPA 3L7ZC 1STEA 5EJWA 1QE6A 3J81L 1CHPD 4YIJA 2LMCB 2K03A 2A74C 1PA6A 4KHPL 2ES2A 1QG7A 2D62A 4DK0A 3GP7A 4QB4A 2K1BA 4HMIA 5C44B 4UP9A 2WKCA 3HOVG 1STAA 4CDEC 3BS1A 4HIMA 1E22A 4HMJA 1JR0D 4C3HB 4LFCQ 2ZJPA 1BQQT 1TU2B 1GD7A 3H3VI 4DR6L 3C1EA 3URYA 4DV4L 3KF8A 5G3LD 4JBWA 4FO2A 1AN8A 1IL8A 1HJPA 4IUQA 3RUZA 1G51A 2Z0SA 3NELA 1B4OA 3VA7A 2VUMG 1G6PA 1LM0A 1X3EA 4ZQ3A 3GTMH 4GOPB 4NW2A 1HNXQ 3AFQA 1SNPA 5EBCA 1N33Q 1HCZA 1D5XC 4A3GH 5M5YB 2BE5C 2DNEA 4GLVB 4IFDI 1HA6A 2K5VA 5M5XB 1MHWC 1SYBA 4GKJQ 1NMFA 2WB1B 4FVMA 3BVGA 2ZJRA 2F0MA 3GTKH 4FYDA 1DOMA 4LF6Q 3A55A 3H3VH 5IYBH 5BN4A 4A3DH 2NN6H 1N36L 4DNRB 1EY4A 3HOWH 2NB0A 1ET9A 4L63B 3E6ZX 2E2IB 2Q8RE 2JA5B 1JOQA 3EQLC 3T16A 2WKDA 3K8AA 2R93G 2AMCB 1E2ZA 1YHQA 1I6HH 1NTGA 4P71A 2QGQA 5C4XG 1S5DD 1RCVD 1PH9A 3S1RH 1JOOA 2RCFA 1PH1A 3ULLA 1A63A 3S1NH 2B2YA 1WVLA 3BDOA 4AYBE 4GNXC 2KCTA 2F0HA 3HEJA 1YNJC 3KUPA 4PNYA 1SE2A 3ONAB 3A7AB 2O4XA 4JI5Q 4JVZA 1L1OA 1ESFA 5CORA 4QGUA 4HJ5A 3J7AF 1DD2A 1DYQA 1PYWD 4LF7Q 1I4QA 2NN6I 1Y69U 1TY2A 1PTOC 5C3EB 1D1KA 2BCOA 3H0GG 3CRKC 1WTRA 1TWHB 4RGTA 3SDZA 4DK1A 2PI2E 1Y8NB 1SBBB 4GN5A 1JWUD 1B70B 4DUYQ 1CUKA 2F0FA 3C3LA 2K14A 1BCPD 3G4SA 4BBSH 1N34L 1E2WA 2GVAA 4LF4Q 2K28A 2NZHA 1D2BA 5I2YA 4R4OA 1AEXA 1D7QA 4TKOB 4NXMQ 5L37A 1D1IA 1PFBA 4YCWA 3ULJA 1CSPA 1NCVA 5IT9c 1EQRA 5K36H 1O7YA 4DV4Q 2B2VC 2GN5A 1I4PA 5CV9A 3H3VC 5CV6A 2JEAI 1TS3A 1I50H 1RJTA 2AWOA 1TR5A 5JPMC 1ZEQX 1U4PA 3HOXH 4F87A 5F2DA 1PTOH 1KABA 2Z9HA 1CZWA 4MN3A 2ZXRA 2UUCL 1CQVA 1MKHA 1V1OA 4GOPA 3C1FA 3MTSA 3S2HB 2CCZA 2R92H 2UXCQ 3SR1A 1X3FA 3D4WA 1TT2A 3EIVA 3ULPA 2WV6D 1VQ8A 2FHTA 1U0LA 1KIXA 4X62Q 4JYAQ 2Y0SE 1JCKB 1JB7A 1GO3E 2JA5H 3B6YA 3DLLA 2ZTEA 3HOWB 2MQHA 2Z4HA 4A3DB 1F2ZA 5GAHC 1B3AA 4A3IH 1S5ED 2CH4W 1NY4A 2KCNA 3LNNA 4DAMA 1E1OA 4UAIA 5EGTA 3X3MA 4BBRH 1QOHA 4DUZQ 4DR4L 1I4HA 4GS3A 3VR4A 3NK9A 2CQOA 3BJUA 2QEJC 1HFGA 1T5XD 4OO1I 5COYA 3F1ZA 3PO3G 3DWPA 2A69D 3A74A 1SRUA 4B3TQ 1KRSA 1OXVA 4IN3A 3SVMA 4QUCA 3KJPA 2OTLA 1L0XB 3P20A 4JI1L 4F7XA 4IQZA 5C4XB 4DUZL 4AQYQ 4ALPA 3I3CA 3QB3A 1R9TB 1C9OA 3R3OA 1S72A 4BBRB 1PZJD 1EUJA 4QMGA 2OQ0A 1MD2D 4JBJA 1B2TA 2HHHQ 4X65Q 4YY3L 3HOUG 4JI0L 1PH7A 2WAQE 1PHJA 2F4IA 3A56A 3HKZG 4KJNA 1O80A 2OT2A 1YHBA 1VQKA 3FP9A 3MXNA 3F2BA 3MAQA 3DHQA 1ILQA 3CQZH 3AYHB 3MEHA 1IBLQ 4A3CH 1DCZA 4A3EH 1F77A 2IW3A 3U50C 4HIKA 4OX9Q 4PMCA 4DR3L 1Y1WG 1A0IA 1PFNA 3H6MA 2NVQH 4OO1H 1WFQA 3TRZA 1CM9A 2LY7A 2D9UA 4X6AH 1ICWA 1Q46A 1JMCA 3NUCA 3W1GA 1WD0A 2WP8J 3MC0B 3GTQH 1TS5A 1STNA 1TWCB 1C0AA 1KAAA 3Q24A 2LXKA 5KNDA 4U673 1IZ6A 1SMXA 1E1TA 2D5DA 3HG9A 4OONA 4A3GB 1HR0Q 3M4YA 3PO3H 2B2UC 2G9DA 2KCMA 1U4MA 2UUBL 5GQOA 2F1MA 5BR8Q 2Z4IA 2IT1A 3DEPA 4C3JG 1STBA 1EQQA 1SNCA 3H15A 1OXXK 2HHHL 1YZ6A 5JOBA 3JAME 1EQVA 1H9JA 3NENA 2B8GA 2XWBB 4IPDA 3S1QB 2UXBQ 1RF2D 5E4WC 2A73B 3SK6A 1HFNA 1JQYD 1PTOD 4FF1A 5JEAH 3K0XA 2NZOA 2D0OA 4A3FG 4DV6Q 3QJYA 4GKJL 1MGSA 4JI1Q 2HQEA 1G2SA 5AJ3L 2YU9B 1CA5A 4B3MQ 3A0JA 2RSNA 2XRSD 4PV1C 3MXUA 5E4XA 1C8CA 4JOIA 5AFWA 2EY2A 4KKUA 4LW1A 5C0XH 1TXYA 3FRPB 4DV0Q 2N55A 2LS01 4OWTB 2L12A 2ZM6L 4RGNA 2PNHA 1GVPA 5EKIA 3GTLB 1DOLA 2O2LD 1J5EQ 4A3LG 1LYLA 3A8KE 1UEAB 4MTKA 5BN5A 1BNZA 2FFKB 1TWCH 1VDZA 4DV7Q 3J81E 4DUYL 4LUVA 2EXDA 4BBRG 2WIIB 3I56A 4BBSG 5EPKA 3K5NA 1Q7YC 5IP7G 1ICFB 3U58A 1FJGQ 4IPCA 2BH8A 4ZCKA 1PYSB 4LMQD 1PH4A 5LMNL 2FINB 2OEOA 4Q5VA 1HQMC 2EYOA 3IRBA 4KD3A 4AYBB 1ONLA 2AHOB 3BVMA 4A3JH 3ZYYX 3ERSX 2PMZB 2JN4A 2E2HB 1SJED 5IIFA 3BDCA 1G8ZD 5C0XI 4CJ0B 3I4MG 2XIWA 1N9WA 3I4MH 4ZUJA 5FLMH 1EIFA 5A2QL 3A8IE 4NDXA 1BKBA 2QCPX 1GUNA 4RCOA 3KLSA 2H5XA 3TP7A 2F3VA 2E5LL 2WB1G 1TWAH 4A3EB 2F4VL 2SOBA 1SNOA 2DY8A 4KN4C 3GTPH 1IW7C 4TQUS 1K8GA 3HRZC 4KHVA 1X55A 2F0EA 3CKIB 2YTYA 4A93G 3OHXC 4DAPA 5IGBA 1BF4A 3KF6A 3S16B 1I3QB 4J1MA 1WD1A 2G5DA 1EL0A 4B9WA 1Y1VH 5BN3A 3RZOB 5CV5A 3NTHA 3KBXA 4ZRZA 3W1BA 2PZTA 5IGCA 1J9OA 3OWFA 1W6JA 3HKZE 2VS1A 2UUBQ 3MXNB 4V190 4Y52H 2VQEL 4CDDC 4K5XA 1A3UA 3TP6A 4DR2Q 4C3HH 2R7ZG 3E0EA 1E0BA 2ATWA 3K0YA 3PIOA 1HZ9A 2UXCL 1HH2P 1UE7A 2Y0SG 2R92B 4JCVE 1L0WA 4GLAC 1GJXA 2EYHA 1QNUA 3CPWA 3N52A 4HJ8A 5C3EG 4DR3Q 4BY7H 1Y14B 4G7ZC 1Q86C 3J80i 5DEHA 2Z1CA 3A7LA 3Q6SA 2KA7A 1S5CD 3DM1A 3OYYA 5GADC 4CKCA 2F0IA 3JAMi 3BG3A 3D31A 2RHSB 5C0XG 4XXEA 5DNFA 3WOFA 4A75A 3W2DA 1Q1EA 4LF9L 4XQNA 3I4OA 5J22A 3PV0A 2R7FA 1QILA 5C5LA 4LF4L 1U4LA 5JJLA 1VQBA 2E76C 1K0RA 1PRTD 3S14B 4DAVA 3H0GB 2E2JH 2UUAL 4K0KL 2O5IC 1LT6D 5G3LF 2JJQA 3G6EA 4LF5L 1VQHA 2EIFA 2NN6G 3DUZA 5ELOA 4C3IB 2L15A 1B7YB 3GTJB 5ELNA 4LFBQ 3CCLA 4P2CB 3EA6A 5GAGC 1EIHA 3F2CA 2MPMA 3MZ5A 1GKHA 4A3IG 1ESRA 2F0TA 3NBHA 2R93B 1N8RC 3I72A 2HIXA 1MSHA 1I94Q 5D3IB 1YHAA 4B3ML 4GZYC 4WRDA 3I90A 5LHY1 4XT3B 3SEBA 1K0SA 1NSNS 2RBMA 1TWGB 2LKVA 3PIO3 4ID6A 2E74C 3KFUA 1J6QA 2CWPA 2OXPA 1JWMD 1VQEA 2F0VA 2I46A 3AU7A 4FP5D 3CCQA 1PRTF 1PVOA 1J8IA 4K8JA 3GTOH 1KDAA 5D14A 2EDGA 4DR2L 2AQ2B 2BDOA 1YEZA 2MO1A 1EEFD 1I6HB 1LT4D 1LABA 2CH4A 3P75A 4DV3Q 3OOCA 1KRTA 1RD9D 3OMGA 1FJGL 4OO1G 3EN2A 2EPBA 4OIKA 4QL5A 3S1MB 1KLGD 4A3CG 1SNDA 1VQNA 3S1NB 2F0PA 1VQ5A 2CWAA 2K52A 1B1ZA 4GN4B 4TVAB 4RA8A 3HS0C 1KD1C 4OGQC 2YTXA 1YNND 3K5OA 4GKKQ 2Z8LA 1JB3A 4A4IA 5JPNC 1B3QA 3VYUA 4BY1B 2RCNA 2A1AA 2UU9L 1VQIA 3CPFA 3PO2B 2DGYA 3CU7A 4O1NA 2WFWA 3UDGA 3J80E 1BDOA 1FNVA 2N49A 2IJ0A 5IGDA 4UPAA 4DKAC 5HGQA 3I4NG 4XYQA 4X66L 4RGOS 1SE3A 3K59A 4A3MH 4PZ8A 2A68D 1QUQB 1ILPA 3UI2A 4RMFA 1PYBA 1QVFA 3PCOB 3P7JA 2EXZA 4HSPA 4A3KG 2F0DA 4X3TA 1GUGA 4POGA 3JAMc 3H09A 1SE4A 3T1HL 3NWSA 3U9SA 3UE1A 1SN8A 1TVXA 1YI2A 4IPGA 1AH9A 3CP0A 4LF8L 2EJMA 2C5CA 4A3JB 1NNXA 1YNNC 3FEWX 4QQBX 3J7A5 2B8FA 3A8JE 1A62A 1IKMA 1I50B 1RL2A 1G291 1A2TA 3DM3A 2IX3A 4H0LC 3MFYA 4O2DA 2VQFQ 2RHQB 4I7AA 3I4LA 4XQQA 1CZGA 1CTMA 3N6RA 2CW0D 5M3FB 1NBWA 3BZKA 1U9RA 2DUDA 5T1GA 4XYOA 3RMHA 5IYBG 2PCFB 1EY6A 2IHEA 1SMYD 1GHJA 5E7NA 2Q2HA 1BCPB 4MNOA 3CCSA 1QNKA 1YNXA 3PF4A 3NSWA 4ZAIA 3HKSA 1M90C 2NBFA 1SSOA 4DF7A 4YY3Q 3GTLH 5KGUA 3D6WA 3EROA 1EWHA 2VUMH 3AQQA 1GOZA 3HKZB 3ITPA 4Y7NH 2UU9Q 4C2MH 2O5JC 1HPCA 1JC7A 3M7NA 5CYUA 4LF9Q 4A3KH 4NXNL 1L1OB 3HZXA 1L0YB 5IWAQ 4BBSB 1VS0A 2E8GA 4IUUA 4DAYA 2ICIA 4JPBW 4GOPC 4KN7C 4CBVA 2OTJA 5ELFA 3V2TA 4J6HA 1W2BA 3PUYA 1Y8PB 1JE5A 3NPPA 3H91A 2B63G 2GVBA 4HTHA 1WCMG 3S17H 3NHHA 3BDLA 3Q0AA 1H9KA 5DAUA 5IOCA 1STHA 4O0AA 1OXUA 1DJRD 5KYLA 2JA7H 2RQXA 3I4NH 4F8MA 4R4QA 4RH6A 5JEAG 3JC66 3ERQA 2NVQB 5ISRA 1FNWA 3TP8A 1OXTA 4X64Q 3I4NB 1BUVT 4G4KA 3RN5A 4G7HC 1S5BD 1XX8A 2R6GA 1H95A 1JWSD 4NMZA 1F9PA 2JA8G 3LGJA 3K7AB 5FOBB 1PRTB 5IP9G 3TZDA 4N8X1 3CW2C 1CI3M 1SNQA 3SGIA 4LF6L 1TWFH 2F0WA 1VQPA 2QDLA 5HGTA 3S16H 4L5TA 1SROA 2F0GA 3C2PA 2Z6KA 2B29A 1K8MA 4YCUA 4EVOA 2L1BA 2K4KA 3CCMA 3IKJA 2JYOA 2WAQB 5CV4A 4B3RL 1OTCA 4JG2A 1TWAB 2XNAC 1WI5A 2RDHA 4DK3C 1HHVA 4YHHQ 5A35A 4KI0A 2IL8A 1LV9A 1WTWA 2PZWA 3GV6A 2JA6B 4C3IH 3TQYA 2B39A 2J4XA 2AQ3B 1EOVA 4KHPQ 2K6AA 3RN2A 4BY7G 2NVTB 1F2LA 2EYFA 3DXJC 1V1PA 1XNQL 4DK6C 1GHKA 2PPBC 1IYVA 4XIGS 4BY1G 1XTDA 3W3AA 2K5DA 3CRLC 3OW7A 4QIWE 1O7IA 3KJOA 1D6EC 5KIXA 5I9PA 1PH5A 5FLXE 4K2LA 1STYA 3ND8A 4Z9CB 5ELEA 1DXMA 1R4QB 4FF4A 2C35B 1VQOA 5C4JH 1HR0W 4KKSA 3SK4A 2ZM6Q 1YVCA 5EPLA 3FKIB 2ENBA 1F9QA 4DAYB 3KF6B 2KJXA 1PTOB 4L5QA 2RKSA 3HOXB 2ICEC 5IWAL 3H94A 4TRDA 4FNFA 2IWHA 4C1NK 3E9IA 4A3GG 2L11A 4PZ6A 1UNSA 1VQ4A 3G6JB 3FKIH 1G6ZA 1IYUA 2D2CC 3EFXD 4K2KA 2B2WC 3TMEA 1TQOA 2K01A 2XSCA 2AUJD 5M3MH 4X66Q 4RHRA 1Z47A 3HOYB 1MSGA 4S3SA 4DV5L 4R8IA 5LL6S 4Q0FA 2AUKA 5J39A 4IZ8A 1ZXTA 3CHBD 5GROA 4PZ7A 1JJCB 3QO2A 1VMPA 3SK5A 3M4PA 4A3MB 1IBKQ 4MHEA 4DPGA 1CA6A 2L5TA 1HNWL 4I65A 1T5EA 4JV5L 5K36G 2E5LQ 1QCBD 3S15B 4NP5A 1WTQA 1EEID 5CV7A 4A3MG 5H1SE 1KAWA 2WACA 1H9MA 1ZKOA 5GAEC 3K80C 2WAQG 1VQDA 3RD4A 2RF4A 1CSQA 2ZXPA 4B3SL 2HT1A 4ULLA 2N3SA 1RODA 1HTLD 1X3PA 1FVIA 4QCLA 3CC2A 1NR2A 2QA4A 3PSIA 4AIMA 3ICEA 2K5HA 1P16A 4OELB 1LTGD 2PMZE 5IT9L 1Y1WH 3HOVB 4B3RQ 4G7OC 3GV3A 4JI4L 4M8AA 2RDGA 2B63B 3LWUA 4UHVA 4KK7A 2V4DA 3HOZG 3UDIA 2DNCA 4G57A 1Y1VG 3WWVA 4B08A 4DV0L 2E2IH 1LO5D 1Y8OB 1Z9FA 1BXTA 1K28A 2M9VA 1H9SA 1HNXL 1H9RA 1AE2A 4UY8C 1HZCA 1BBWA 2RDFA 4IUTA 5FJ8G 4HIDA 1M4VA 1V9PA 2L4NA 4DNTB 1MI2A 5IP7H 3TZUA 5M5WH 1K8AC 2Q8IB 1YBYA 1VQGA 1EIGA 5C4XH 4LFBL 1UUPA 4A3FH 2F0KA 4RG1A 2A19A 5LL6X 4PQXA 5J3BA 4JI4Q 4MZ9A 5CR3A 3IAYA 4ME5A 2JQOA 1PTOF 2K5NA 1VQ9A 2ZXOA 2FJ2A 3ZJYC 1EWIA 1VCIA 5IGGA 4LFCL 2KOLA 2BE5D 1LACA 2F0QA 2VUMB 5BR8L 2BH2A 5IGFA 5I2XA 4M1UB 3E9HA 2G9HD 1WJJA 2F03A 1RTOA 2R3ZA 3H0GH 5IE8A 4R4IA 3VYTA 4U68A 2X69A 5FLXL 1XPOA 3S1QH 3DMUA 4A93H 3Q23A 1W3SA 1IYJB 4IO9A 3GQBA 4K5WA 4C2MB 3K81C 3A5UA 3QIAA 3HOYH 2EY6A 1KL9A 2AWNA 3HGBA 5M3MB 5C44H 3T1YQ 4JK1C 1ASYA 1K3RA 1D8LA 3NTKA 2NVXH 3BYTB 4YWMA 5CBEE 1XMOL 2M00A 2VL6A 4CDFC 2K50A 4K6LA 1SYEA 1X3QA 4UP7A 1WCMH 3CMAA 5EKKA 1NUCA 2EY1A 5FK9C 3OTOQ 3D8GA 3GTQB 1PV4A 2UUAQ 4L5SA 3HFZB 3JAML 3TS0A 4IFDH 1BBUA 3O13A 2ALYB 5EBDA 3SHLA 3S1RB 1Q82C 4N8FA 1VQFA 2DN8A 1SNMA 1EY7A 1O7ZA 4ABNA 3KOJA 4EQNA 2F0OA 3P1HA 1N33L 1IHZA 3TP5A 3I7FA 2NVTH 2OWOA 5K5PA 1EZ8A 1KHIA 2XVSA 1PLFA 1EU4A 1X3GA 4ZK9B 1LTSD 2JA6H 3STBD 4AYBG 3HOZH 3PO2H 2AQ1B 3D6CA 3T56B 3FDTA 3MEFA 4DN4M 3W5OA 1YIJA 2PZUA 3K6OA 4DGZA 3STBC 2BDNA 2FMMA 4QUFA 3RLFA 2JP1A 3AEVA 3NQIA 4GNXB 1K8OA 3NQTA 1BR9A 3J81c 1XNRQ 1PZKD 2I5MX 4RKLA 2QF7A 2I5LX 1I4RA 3BZDB 3MFGA 4JI3L 2UUCQ 3VA5A 2L0CA 1PH8A 1CHQD 1MJEA 3PGZA 3PUZA 5DM73 2RVLA 4X3SA 2VB3X 5CMDA 2PQEA 2A5HA 4BY1H 4IFDG 4KD4A 2AKWB 4R1JA 1EY8A 3M3YH 2HD3A 3CCVA 2EZVA 2PQAB 3M7GA 4JV5Q 2Q2UA 4CHTB 1K83B 5IY0A 2MUYA 4K6DA 2EYLA 4B3TL 4BXXG 4KV6A 3QOJA 1U4RA 1I4XA 2K5QA 1QB5D 2Z6KC 2BOSA 4NB3A 3VDYA 3X3NA 1WTPA 2R7ZB 2C9OA 4NXML 1Z7TA 3AFPA 3RR5A 3M4OB 2FMCA 4RGMA 3CC4A 3T51B 3L2PA 5I6YA 2ZTDA 5FO8B 1EQTA 2IPKD 1OXSC 5M5YH 1SFOB 2A8VA 2IX1A 2DY7A 3I55A 3S17B 1TY0A 5KNBA 4KY7A 3PO2G 3MXPA 5ELCA 4C56C 4FF2A 1X32A 3EJIA 3ND9A 2M2LA 2X6GA 4A3DG 2KHIA 3BVZA 3FPUB 4BS9A 1PH6A 5IYDG 1LTID 1X6OA 2YU9H 1GXDC 4DR7L 5EPJA 1RHPA 2MHVA 2X6LA 4R4CA 2MFIA 2EYPA 4ILWA 1LTLA 3I70A 5J1ZA 1IXRA 4A3KB 1A6XA 1I6VC 4L8JA 3RZDB 1TWHH 2K5WA 4LWCA 2KUMA 4HCEA 1A3VA 1BCPC 1C4QA 2EJFC 2GA4B 2JE6I 2J7ZA 1C7YA 5NUCA 3S2DB 1CKNA 1VQ7A 1QWYA 3CMEA 3GTGH 4P73A 2CW0C 2N88A 2B3GA 2DJGC 4P74A 2E2JB 1NE3A 4BXXH 5LMUQ 1XMQQ 2XGTA 2KHSA 3DWAA 3FKIG 4B9XA 3A5ZB 2J0TD 1GUOA 2HCIA 1UWVA 1A2UA 4LUOA 5KYIA 5M3MG 2UXBL 1T9HA 1X56A 1LT5D 4IPHA 5M3FG 3MVVA 2ZT9C 3NP8A 1CT1D 1EWCA 1S40A 3NE5B 4GN3B 3J80L 1LT3D 3L0OA 4R9WA 5JJKA 4V0BA 3TREA 3L3OC 1E7ZA 4LJZC 4GNXA 3UDXA 1EY9A 2NTTA 1BOSA 4H44C 1IBMQ 4EX5A 1SE8A 3OIQA 1FNUA 4IUVA 1CKMA 4YWKA 2HQLA 3G7LA 3RZOH 4DV2L 2E2DC 2HDMA 3GTKB 5FO9B 4DR4Q 1FD7D 1R9TH 2KEDA 4RFBA 4LFAL 4J15A 2MGSA 2EYJA 1NMGA 4DU9A 1RIPA 1CK1A 4GKKL 4H02A 2OQKA 4JI8L 3KDFB 2UXDQ 1HXYD 3CCUA 4A3FB 1D5MC 1ENFA 1PMRA 2FXQA 1F9RA 3K58A 3D0FA 4JBMA 1W6KA 5KEEA 4YHHL 5M5WB 4DR7Q 4OX9L 4LNQA 3CCEA 3OSOA 1XTCD 1JT8A 1E3PA 3NTIA 4DV3L 3CF5A 4DV1Q 2H1EA 5T1IA 4JOIC 3VYSA 3PQIA 3J80c 1SYFA 1STGA 2XTIA 3MXGA 2F0SA 2PW5A 3CCRA 4JI0Q 2PW7A 1PFSA 5JEAJ 2HUGA 4K8IA 4X65L 5JVG3 1A3TA 2XN9C 3S2HH 3CAMA 1HA5A 3AMUA 1S5FD 4KY6A 1AFPA 1SMYC 4TSSA 4C3HG 3S1MH 3PMFA 3TN2A 4DXGA 3IFDA 3S24A 4OXPA 1WCMB 2NUCA 4OIJA 1G2TA 2F4VQ 2N8NA 4IUNA 1N34Q 1HTPA 1BO0A 2SEBD 3J7AV 2F52A 1NAPA 4OHJA 1ASZA 3S2DH 4HEDA 3J7ZC 4A76A 3R2IA 1GUWA 4X3UA 4HSVA 1DOKA 4JYAL 3GTOB 1HUNA 2KENA 1SYDA 1EYGA 3AB9A 4RKBA 3F8TA 1FR3A 4JW0A 4XQJA 1B9MA 2HIVA 1XXGA 1EY5A 4A3EG 2B2WA 1DGSA 1SYGA 4JI7Q 1ENCA 3T1YL 4IOCA 1Q8IA 2CFMA 3BZCA 5IP9H 1RDPD 2VQFL 1PDQA 4A3BH 1XMOQ 2PI2A 1DM0B 1ENAA 5EQ0A 5EKLA 4CJ2C 1I5FA 4IJLA 2A6ED 1SYCA 2KHJA 3VR6A 4CJ1B 1LUZA 4GLXA 3GO5A 4KY5A 3RZDH 3F2DA 2I07B 1MBYA 1GM5A 5KRUA 1J5EL 5CC4A 5IYDH 1B44D 5D65A 1AZQA 1EYDA 4J8QA 2PO4A 1F2YA 4DR1Q 1HNZL 2H4OA 1IBML 2TSSA 1KDCA 2QW7A 2R7ZH 3KBGA 2Y0SB 1VF7A 2LFNA 1MIUA 1PFMA 3C46A 2NVYH 4ZUIA 3R2TA 4DFAA 3PF5A 1KTKA 1L1OC 4C1NI 1SEBD 2I0QA 1K83H 5AJ3Q 1PH3A 2R61A 1VQMA 2CVRA 2F0NA 4JI6L 5M9OA 3HOXG 1SFOH 2IHFA 4KJOA 3K7AH 2OCEA 2VZAA 4BY7B 2B2TC 5IYCH 4MIUA 5LMUL 4IOAA 1Q90A 1KXLA 4ZKBB 3V96A 5CBAE 2Q8TA 4DR1L 3EVQA 2A68C 2MNAA 3MA2B 1WYDA 3HP3A 3QR8A 1VQAA 3E3XA 4A3BG 1Q8KA 3M3YB 4JI8Q 4EQOA 1BVSA 2PYKA 5E3FA 2QILA 3VYRA 4KHZA 4X64L 1HQRD 4E6IA 1XJVA 1S3OA 3U9OA 5I6WA 1CQFA 1KNEA 2VXWA 2Q2IA 1QUQA 4LK1C 4LFAQ 2JSOA 3J81i 1XPUA 4DR5Q 4WJ4A 4C3IG 2LSSA 1AZPA 5C3XA 2L9HA 4OWXB 2F0JA 1IW7D 1N32Q 3I91A 1EY0A 4WJ3M 3T1HQ 4MTNA 3LX0A 5FKAC 1DZ1A 1ZYRC 4XDXA 1BBXC 4DV7L 2XWJB 5IODA 3M85A 3GTPB 1N36Q 1TIID 3QOLA 3KYHC 4KTAA 2L55A 1JOKA 4R4TA 4DA2A 1JICA 4P72A 2RSOA 1NJIC 1PRTC 2MO0A 5JJZA 1IBKL 4APVA 3J81j 4AQYL 2KCCA 4X3KA 3U4VA 1QZHA 4DV2Q 3KF8B 1IKLA 2SNSA 2KECA 5E1FA 1K9MC 3D4DA 1TKWB 5CGKA 4FXGC 4QIWB 4N9PA 3GTGB 4RWSC 3Q22A 4DR6Q 4HJ7A 5DLQE 1LLRD 2QEXA 3QG1A 5D3DA 1YJWA 2ZJQA 1RTNA 2HDLA 4POFA 1EU3A 4L6TB 4F88A 3CC7A 1AE3A 2YYZA 1I4GA 2OF1A 3RNUA 2B2YC 3DWQA 2K33A 1V8QA 2B2VA 5C44G 2WINB 1XMQL 2QKIC 4CDCC 2JEBI 1WTXA 4ZLTF 5FO7B 2D0PA 1M8AA 2LXJA 2NVXB 1LTBD 4IJHA 3PIPA 2BA0A 4Y7NB 1HR0L 3HOUB 1AW7A 2MJ8A 1VMCA 3HOUH 2K75A 2JA7G 3GTJH 5C3EH 4H13C 3PIP3 4A3BB 3R8BA 4L5RC 5A2QE 1WOCA 3CCJA 4QY7A 4A93B 1X65A 3KDFA 3NWTA 4DNIA 3WOEA 2ID0A 3G48A 4KKTA 1FL0A 3CXCA 2B2UA 4EGVA 4FDBA 3S14H 1GUTA 3D3RA 3L9AX 3WDNA 2EE1A 2I5HA 4PG3A 3E5SA 4FXKC 1UAPA 1II3A 3J7YW 3NBHB 5M3FH 1FGBD 2PNRC 2SDFA 1F2MA 1SAPA 2JA5G 2VQEQ 3NBIA 3TDQA 4YWLA 2KBNA 2NTSA 1YNJD 2A6HC 2IY5B 2EYMA 1P8LA 1EFWA 3I8ZA 5C4HA 1OO9B 3I73A 3OTOL 3DEOA 3M4OH 1KNAA 1LTAD 4K0KQ 4A3LH 1F9SA 2BA1A 3TBIB 3OMCA 4HR7B 2B63H 5JJIA 2SNMA 3PUVA 2NZ1D 4ZYSA 2B2TA 1RKNA 1Y1WB 2JK8A 4KLKA 3HOVH 4LF7L 3T53B 1L2FA 2VNUD 5FJ8H 3T13A 1WTOA 2VW9A 4UDUC 3NEMA 2NWGA 1N32L 3U4ZA 1CFMA 1EIYB 2UXDL 3K57A 1YJ9A 1O7LA 4A3JG 1HZAA 3ER0A 1KLUD 3KLRA 1K73C 3NXWA 5FLMG 1UEBA 3VR5A 5C0XJ 4DV1L 3HOZB
chains in the Genus database with same CATH topology
4NPSA 1NY4A 4A3DG 2KHIA 4DAMA 1E1OA 4BBRH 1PH6A 4Y7NH 5IYDG 4DUZQ 4DR4L 3FHWA 4GS3A 2UU9Q 4C2MH 1IBLL 3CD6A 2CQOA 1VQCA 1B8AA 3BJUA 4X62L 3M7NA 1X6OA 4OO1I 4LF9Q 3F1ZA 4NXNL 4A3KH 1L1OB 2YU9H 2IX0A 3PO3G 4DR7L 3A74A 5IWAQ 1SRUA 2CKZB 1VS0A 2E8GA 4ME3A 1KRSA 1OXVA 4B3TQ 1VQ6A 2R92G 2V1CC 3KLWA 4R4CA 3KJPA 2MFIA 2OTLA 4GOPC 1LTLA 4JI1L 1IXRA 3HOYG 3UE0A 1Q81C 4DUZL 1TWHH 4LWCA 4HJ9A 4ALPA 4AQYQ 4QJFA 2OTJA 1C9OA 1S72A 1EUJA 1W2BA 1X54A 2JE6I 2OQ0A 4JBJA 3S15H 1UE1A 3PUWA 2HHHQ 4X65Q 4YY3L 4JI6Q 1C7YA 3HOUG 3HOWG 4JI0L 3PUYA 1PH7A 1JE5A 2WAQE 4IFDJ 1CKNA 1PHJA 1VQ7A 2B63G 3CMEA 3S17H 2GVBA 3HKZG 1WCMG 4P73A 3GTGH 2B3GA 1YHBA 1VQKA 3FP9A 4P74A 3F2BA 1NE3A 4BXXH 3CQZH 3AYHB 5LMUQ 1XMQQ 2XGTA 1IBLQ 4A3CH 4A3EH 1Q1BA 3FKIG 4O0AA 3A5ZB 1OXUA 2JA7H 1FGUA 3U50C 4HIKA 4OX9Q 3I4NH 1UWVA 4DR3L 1Y1WG 1A0IA 2NVQH 3RLNA 1WFQA 4LUOA 1SLJA 3TRZA 5M3MG 2UXBL 1T9HA 1X56A 4IPHA 5M3FG 4X6AH 4R4QA 3K7UC 5JEAG 1Q46A 1UE6A 3JC66 3M4QA 1JMCA 2ASBA 1OXTA 2YTVA 1A8VA 3W1GA 1VQJA 4X64Q 3RN5A 1S40A 4JBKA 4GN3B 2R6GA 2WP8J 3L0OA 3GTQH 5JJKA 1H95A 3TREA 1XNQQ 1C0AA 1TWGH 2JA9A 1E7ZA 2LXKA 5IYCG 4GNXA 1IZ6A 1YITA 3UDXA 2JA8G 3LGJA 1SMXA 2JA8H 1E1TA 1IBMQ 4LF8Q 4EX5A 4OONA 1SE8A 5IP9G 1HR0Q 1CKMA 4YWKA 2HQLA 4PMWA 4JI2Q 1HZBA 4JI7L 4YCVA 3PO3H 2KCMA 3CW2C 1XNRL 2R7DA 2UUBL 3RZOH 5GQOA 5BR8Q 4DV2L 2IT1A 3SGIA 4LF6L 5LMNQ 4DR4Q 1TWFH 2F3IA 4P75A 3UDFA 2JA6G 1VQPA 1R9TH 1EQQA 1E24A 4B3SQ 1KQSA 4J15A 4EQ5A 3H15A 4AH6A 1OXXK 4LFAL 2HHHL 3S16H 1YZ6A 4L5TA 1NMGA 1SROA 3NENA 2VY3A 1VQLA 2Q2TA 2Z6KA 4IPDA 1RIPA 2B29A 1X9NA 2UXBQ 4GKKL 1JJGA 4LUZA 4H02A 1MJCA 1PH2A 4YCUA 3TEHB 4HJAA 4JI0Q 2OQKA 2K4KA 2D0OA 2NZOA 3K0XA 4JI8L 5FLXc 3KDFB 3CCMA 1CKNB 4JI1Q 4DV6Q 2UXDQ 3CCUA 1QZGA 5AJ3L 4B3RL 1OTCA 4JG2A 5EAYA 4B3MQ 1WI5A 4DK3C 2FXQA 3A0JA 3D0FA 4JBMA 4YHHQ 2EQSA 4YHHL 4JOIA 4KI0A 4NXNQ 4DR7Q 4OX9L 1KC8C 4LNQA 4DV5Q 4HIOA 3CCEA 4LW1A 4C3IH 3TQYA 1E3PA 1TXYA 4DV0Q 1JT8A 1I3QH 4DV3L 3CF5A 4DV6L 4OWTB 1EOVA 2ZM6L 4DV1Q 4KHPQ 2PNHA 1GVPA 3RN2A 4OWWB 4BY7G 1J5EQ 4A3LG 1LYLA 4C3JH 4JOIC 3J80c 1XNQL 2XTIA 4DK6C 1SR3A 1TWCH 1V1QA 4XIGS 4BY1G 3CCRA 1XTDA 4LUVA 4DUYL 4DV7Q 1PFSA 2EXDA 4QIWE 5JEAJ 1O7IA 4X65L 3KJOA 4BA2I 4BBRG 3I56A 5HY6A 1PH5A 4BBSG 3S2HH 1Q7YC 3CAMA 5IP7G 3M9BA 2C35B 3U58A 5C4JH 1VQOA 1HR0W 1FJGQ 2ZM6Q 4IPCA 1YVCA 2BH8A 1PYSB 1PH4A 3S1MH 1V43A 5LMNL 4DAYB 4JI5L 3KF6B 4JI3Q 4L5QA 3S24A 4OXPA 5IWAL 4DR5L 3IRBA 2F4VQ 2N8NA 4JC0A 1N34Q 3E9IA 2AHOB 4A3JH 4A3GG 3ERSX 4PZ6A 2F52A 4XTCS 1VQ4A 1U5KA 1ASZA 3FKIH 5C0XI 3I4MG 3S2DH 1N9WA 3I4MH 3J7ZC 4A76A 5FLMH 1EIFA 1BKBA 4JYAL 1UE5A 5M3MH 2WB1E 4X66Q 1Z47A 2KENA 1HNWQ 2H5XA 1EYGA 3F8TA 3GDEA 4DV5L 2E5LL 2N78A 2WB1G 3I2ZA 1TWAH 5M5XH 2F4VL 2HIVA 4JI2L 5GROA 4PZ7A 1JJCB 4A3EG 3GTPH 1DGSA 4TQUS 1K8GA 4JI7Q 1QVCA 1X55A 3T1YL 3GD7A 1I94L 3M4PA 4IOCA 1CKOA 2CFMA 2YTYA 1IBKQ 4A93G 3BZCA 4DPGA 5IP9H 3KF6A 2VQFL 4A3BH 1HNWL 3RLOA 3BU2A 1XMOQ 4JV5L 2R93H 5K36G 2PI2A 3CC4A 2E5LQ 3G71A 3PUXA 1Y1VH 1YJNA 1JJ2A 1I5FA 2PQAA 4IJLA 2KHJA 4GLXA 4A3MG 1LUZA 3W1BA 3GO5A 5LMNW 5H1SE 1KAWA 3F2DA 3RZDH 1M1KC 1GM5A 4BA1I 2E2HH 3HKZE 2VS1A 2UUBQ 3MXNB 5GAEC 1J5EL 5IYDH 3K80C 1XPRA 2WAQG 1VQDA 3EBEA 4Y52H 1Q12A 2RF4A 1CSQA 2VQEL 4B3SL 4DR1Q 1HNZL 2HT1A 1IBML 4DR2Q 4C3HH 2N3SA 1HNZQ 2R7ZG 3E0EA 1FVIA 2R7ZH 2ATWA 3CC2A 2ZTCA 3PIOA 2YV5A 1HZ9A 1HH2P 1UE7A 1MIUA 3PSIA 4AIMA 2QA4A 1QVGA 2Y0SG 1IL2A 3ICEA 2NVYH 3Q8DA 2K5HA 4JCVE 1P16A 3PF5A 1L1OC 4UP8A 1L0WA 2PMZE 1K83H 4GLAC 1Y1WH 2I0QA 5AJ3Q 4B3RQ 1PH3A 4JI4L 1VQMA 3CPWA 3TS2A 4JI6L 4LF5Q 3OW2A 3HOXG 3L7ZC 2IHFA 5C3EG 4HJ8A 1SFOH 4DR3Q 3UDIA 3K7AH 3HOZG 4BY7H 1Y14B 2OCEA 1Y1VG 3WWVA 2VZAA 4DV0L 3J80i 1Q86C 2E2IH 1Z9FA 1PA6A 4KHPL 5IYCH 3OYYA 2ES2A 5GADC 4A3FG 5LMUL 1HNXL 3JAMi 1AE2A 2D62A 3D31A 1HZCA 1BBWA 2RHSB 4UY8C 4IOAA 1KXLA 4HIDA 5FJ8G 5C0XG 1V9PA 4A75A 4UP9A 5IP7H 5M5WH 1K8AC 1Q1EA 4DR1L 4LF9L 2MNAA 3I4OA 3HOVG 1YBYA 1WYDA 2R7FA 3PV0A 1VQGA 5C4XH 4HIMA 4LF4L 4LFBL 1E22A 1VQAA 5JJLA 4A3FH 4A3BG 1Q8KA 4LFCQ 4JI8Q 1VQBA 1BVSA 2ZJPA 1K0RA 1GD7A 4X64L 4KHZA 4RG1A 3H3VI 2A19A 2E2JH 5J3BA 1XJVA 1S3OA 2UUAL 4DR6L 4K0KL 4JI4Q 4MZ9A 2Q2IA 1QUQA 4DV4L 2JJQA 4JBWA 2JQOA 4LFAQ 3G6EA 2K5NA 1VQHA 2EIFA 2NN6G 5ELOA 3J81i 1VQ9A 4LF5L 1HJPA 1XPUA 2L15A 1G51A 1B7YB 4JYAQ 4DR5Q 3ZJYC 5ELNA 4LFBQ 1EWIA 1VCIA 3CCLA 2Z0SA 2LSSA 4WJ4A 3NELA 4LFCL 5GAGC 2VUMG 3F2CA 1G6PA 1GKHA 4OWXB 1LM0A 1X3EA 4A3IG 3GTMH 1N32Q 4GOPB 1HNXQ 5BR8L 1N8RC 4WJ3M 2HIXA 3AFQA 1N33Q 2BH2A 3T1HQ 1I94Q 4B3ML 1YHAA 4MTNA 4A3GH 3E9HA 1WJJA 3H0GH 5IE8A 3M85A 4DV7L 4R4IA 1N36Q 4GLVB 4IFDI 3KYHC 1XPOA 3S1QH 2K5VA 3KFUA 1J6QA 2CWPA 4R4TA 4A93H 4GKJL 1W3SA 1NMFA 4GKJQ 1IYJB 1VQEA 4IO9A 2ZJRA 3K81C 4P72A 3A5UA 3CCQA 3HOYH 1PVOA 1NJIC 3GTKH 2MO0A 1KL9A 2AWNA 4APVA 1IBKL 3J81j 4AQYL 5C44H 3GTOH 3U4VA 3T1YQ 1QZHA 4DV2Q 4LF6Q 3H3VH 3KF8B 5IYBH 1K3RA 1D8LA 1K9MC 1ASYA 2NVXH 4YWMA 4DR2L 1N36L 1XMOL 4A3DH 2MO1A 1YEZA 3HOWH 2VL6A 2K50A 4DV3Q 1KRTA 4UP7A 1WCMH 3K8AA 3CMAA 2R93G 2AMCB 1FJGL 4OO1G 3OTOQ 3EN2A 1YHQA 1I6HH 1NTGA 4P71A 2QGQA 5C4XG 1PV4A 1PH9A 2UUAQ 4QL5A 4L5SA 4DR6Q 3HFZB 4HJ7A 3S1RH 5DLQE 2QEXA 4A3CG 1VQNA 1PH1A 3TS0A 1YJWA 3ULLA 2CWAA 1VQ5A 2K52A 2ZJQA 4GN4B 1BBUA 4POFA 4TVAB 1A63A 3CC7A 2ALYB 3S1NH 1AE3A 2YYZA 1KD1C 2YTXA 4AYBE 4GNXC 1Q82C 2KCTA 4GKKQ 1VQFA 3RNUA 4A4IA 3KOJA 1N33L 2UXCL 5C44G 3I7FA 1XMQL 4JI5Q 2NVTH 2RCNA 2A1AA 2UU9L 2OWOA 2JEBI 1L1OA 1VQIA 3CPFA 1KHIA 2D0PA 4QGUA 1X3GA 4HJ5A 2LXJA 2DGYA 4LF7Q 2WFWA 4IJHA 2NN6I 3PIPA 3UDGA 2BA0A 3STBD 2JA6H 1HR0L 2N49A 3H0GG 4UPAA 3HOUH 2K75A 2JA7G 3GTJH 4AYBG 4DKAC 5HGQA 5C3EH 3I4NG 3HOZH 4X66L 3PO2H 4L5RC 2PI2E 1WOCA 3CCJA 4QY7A 3MEFA 1X65A 3KDFA 4GN5A 3W5OA 4A3MH 4DNIA 1B70B 4DUYQ 1YIJA 1CUKA 4PZ8A 2ID0A 2K14A 3G48A 1FL0A 3CXCA 1QUQB 3STBC 4FDBA 3S14H 4RMFA 1PYBA 3RLFA 3G4SA 1QVFA 4BBSH 1N34L 2I5HA 3PCOB 4PG3A 2GVAA 3AEVA 4LF4Q 2NZHA 4GNXB 4R4OA 4A3KG 3J81c 1D7QA 1XNRQ 4NXMQ 2I5MX 4POGA 3JAMc 3NBHB 2I5LX 3ULJA 4YCWA 5M3FH 1CSPA 3T1HL 2UUCQ 4JI3L 2JA5G 5IT9c 2VQEQ 1EQRA 4DV4Q 3UE1A 1SN8A 4YWLA 1YI2A 4IPGA 1PH8A 2KBNA 1AH9A 1MJEA 2GN5A 3CP0A 3PGZA 3PUZA 4LF8L 2JEAI 2IY5B 1I50H 1P8LA 2AWOA 4BY1H 1EFWA 4QQBX 4IFDG 3J7A5 2AKWB 1A62A 3HOXH 4R1JA 1RL2A 3OTOL 3M4OH 1G291 3M3YH 4K0KQ 4A3LH 2BA1A 3CCVA 2UUCL 2PQAB 2B63H 3DM3A 5JJIA 4JV5Q 3PUVA 2Q2UA 1MKHA 4O2DA 2VQFQ 2RHQB 5IY0A 2JK8A 4KLKA 4GOPA 3HOVH 4B3TL 4BXXG 4LF7L 2VNUD 1L2FA 2CCZA 2R92H 2UXCQ 1NBWA 3BZKA 5FJ8H 1X3FA 2VW9A 2DUDA 3EIVA 3NEMA 3ULPA 2Z6KC 1N32L 5IYBG 4NB3A 3VDYA 2IHEA 3U4ZA 5E7NA 1EIYB 4NXML 2UXDL 3RR5A 3AFPA 1YJ9A 1VQ8A 2Q2HA 1U0LA 4MNOA 4X62Q 1YNXA 3CCSA 1HZAA 2Y0SE 3ER0A 3L2PA 4A3JG 1KIXA 2ZTDA 1JB7A 1GO3E 1K73C 2JA5H 3PF4A 3B6YA 3HKSA 1M90C 3DLLA 2ZTEA 1OXSC 5M5YH 2A8VA 5FLMG 4YY3Q 3GTLH 2IX1A 3I55A 1UEBA 3PO2G 2MQHA 5GAHC 5C0XJ 4DV1L 2VUMH 3AQQA 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPS A;  1NY4 A;  4A3D G;  2KHI A;  4DAM A;  1E1O A;  4BBR H;  1PH6 A;  4Y7N H;  5IYD G;  4DUZ Q;  4DR4 L;  3FHW A;  4GS3 A;  2UU9 Q;  4C2M H;  1IBL L;  3CD6 A;  2CQO A;  1VQC A;  1B8A A;  3BJU A;  4X62 L;  3M7N A;  1X6O A;  4OO1 I;  4LF9 Q;  3F1Z A;  4NXN L;  4A3K H;  1L1O B;  2YU9 H;  2IX0 A;  3PO3 G;  4DR7 L;  3A74 A;  5IWA Q;  1SRU A;  2CKZ B;  1VS0 A;  2E8G A;  4ME3 A;  1KRS A;  1OXV A;  4B3T Q;  1VQ6 A;  2R92 G;  2V1C C;  3KLW A;  4R4C A;  3KJP A;  2MFI A;  2OTL A;  4GOP C;  1LTL A;  4JI1 L;  1IXR A;  3HOY G;  3UE0 A;  1Q81 C;  4DUZ L;  1TWH H;  4LWC A;  4HJ9 A;  4ALP A;  4AQY Q;  4QJF A;  2OTJ A;  1C9O A;  1S72 A;  1EUJ A;  1W2B A;  1X54 A;  2JE6 I;  2OQ0 A;  4JBJ A;  3S15 H;  1UE1 A;  3PUW A;  2HHH Q;  4X65 Q;  4YY3 L;  4JI6 Q;  1C7Y A;  3HOU G;  3HOW G;  4JI0 L;  3PUY A;  1PH7 A;  1JE5 A;  2WAQ E;  4IFD J;  1CKN A;  1PHJ A;  1VQ7 A;  2B63 G;  3CME A;  3S17 H;  2GVB A;  3HKZ G;  1WCM G;  4P73 A;  3GTG H;  2B3G A;  1YHB A;  1VQK A;  3FP9 A;  4P74 A;  3F2B A;  1NE3 A;  4BXX H;  3CQZ H;  3AYH B;  5LMU Q;  1XMQ Q;  2XGT A;  1IBL Q;  4A3C H;  4A3E H;  1Q1B A;  3FKI G;  4O0A A;  3A5Z B;  1OXU A;  2JA7 H;  1FGU A;  3U50 C;  4HIK A;  4OX9 Q;  3I4N H;  1UWV A;  4DR3 L;  1Y1W G;  1A0I A;  2NVQ H;  3RLN A;  1WFQ A;  4LUO A;  1SLJ A;  3TRZ A;  5M3M G;  2UXB L;  1T9H A;  1X56 A;  4IPH A;  5M3F G;  4X6A H;  4R4Q A;  3K7U C;  5JEA G;  1Q46 A;  1UE6 A;  3JC6 6;  3M4Q A;  1JMC A;  2ASB A;  1OXT A;  2YTV A;  1A8V A;  3W1G A;  1VQJ A;  4X64 Q;  3RN5 A;  1S40 A;  4JBK A;  4GN3 B;  2R6G A;  2WP8 J;  3L0O A;  3GTQ H;  5JJK A;  1H95 A;  3TRE A;  1XNQ Q;  1C0A A;  1TWG H;  2JA9 A;  1E7Z A;  2LXK A;  5IYC G;  4GNX A;  1IZ6 A;  1YIT A;  3UDX A;  2JA8 G;  3LGJ A;  1SMX A;  2JA8 H;  1E1T A;  1IBM Q;  4LF8 Q;  4EX5 A;  4OON A;  1SE8 A;  5IP9 G;  1HR0 Q;  1CKM A;  4YWK A;  2HQL A;  4PMW A;  4JI2 Q;  1HZB A;  4JI7 L;  4YCV A;  3PO3 H;  2KCM A;  3CW2 C;  1XNR L;  2R7D A;  2UUB L;  3RZO H;  5GQO A;  5BR8 Q;  4DV2 L;  2IT1 A;  3SGI A;  4LF6 L;  5LMN Q;  4DR4 Q;  1TWF H;  2F3I A;  4P75 A;  3UDF A;  2JA6 G;  1VQP A;  1R9T H;  1EQQ A;  1E24 A;  4B3S Q;  1KQS A;  4J15 A;  4EQ5 A;  3H15 A;  4AH6 A;  1OXX K;  4LFA L;  2HHH L;  3S16 H;  1YZ6 A;  4L5T A;  1NMG A;  1SRO A;  3NEN A;  2VY3 A;  1VQL A;  2Q2T A;  2Z6K A;  4IPD A;  1RIP A;  2B29 A;  1X9N A;  2UXB Q;  4GKK L;  1JJG A;  4LUZ A;  4H02 A;  1MJC A;  1PH2 A;  4YCU A;  3TEH B;  4HJA A;  4JI0 Q;  2OQK A;  2K4K A;  2D0O A;  2NZO A;  3K0X A;  4JI8 L;  5FLX c;  3KDF B;  3CCM A;  1CKN B;  4JI1 Q;  4DV6 Q;  2UXD Q;  3CCU A;  1QZG A;  5AJ3 L;  4B3R L;  1OTC A;  4JG2 A;  5EAY A;  4B3M Q;  1WI5 A;  4DK3 C;  2FXQ A;  3A0J A;  3D0F A;  4JBM A;  4YHH Q;  2EQS A;  4YHH L;  4JOI A;  4KI0 A;  4NXN Q;  4DR7 Q;  4OX9 L;  1KC8 C;  4LNQ A;  4DV5 Q;  4HIO A;  3CCE A;  4LW1 A;  4C3I H;  3TQY A;  1E3P A;  1TXY A;  4DV0 Q;  1JT8 A;  1I3Q H;  4DV3 L;  3CF5 A;  4DV6 L;  4OWT B;  1EOV A;  2ZM6 L;  4DV1 Q;  4KHP Q;  2PNH A;  1GVP A;  3RN2 A;  4OWW B;  4BY7 G;  1J5E Q;  4A3L G;  1LYL A;  4C3J H;  4JOI C;  3J80 c;  1XNQ L;  2XTI A;  4DK6 C;  1SR3 A;  1TWC H;  1V1Q A;  4XIG S;  4BY1 G;  3CCR A;  1XTD A;  4LUV A;  4DUY L;  4DV7 Q;  1PFS A;  2EXD A;  4QIW E;  5JEA J;  1O7I A;  4X65 L;  3KJO A;  4BA2 I;  4BBR G;  3I56 A;  5HY6 A;  1PH5 A;  4BBS G;  3S2H H;  1Q7Y C;  3CAM A;  5IP7 G;  3M9B A;  2C35 B;  3U58 A;  5C4J H;  1VQO A;  1HR0 W;  1FJG Q;  2ZM6 Q;  4IPC A;  1YVC A;  2BH8 A;  1PYS B;  1PH4 A;  3S1M H;  1V43 A;  5LMN L;  4DAY B;  4JI5 L;  3KF6 B;  4JI3 Q;  4L5Q A;  3S24 A;  4OXP A;  5IWA L;  4DR5 L;  3IRB A;  2F4V Q;  2N8N A;  4JC0 A;  1N34 Q;  3E9I A;  2AHO B;  4A3J H;  4A3G G;  3ERS X;  4PZ6 A;  2F52 A;  4XTC S;  1VQ4 A;  1U5K A;  1ASZ A;  3FKI H;  5C0X I;  3I4M G;  3S2D H;  1N9W A;  3I4M H;  3J7Z C;  4A76 A;  5FLM H;  1EIF A;  1BKB A;  4JYA L;  1UE5 A;  5M3M H;  2WB1 E;  4X66 Q;  1Z47 A;  2KEN A;  1HNW Q;  2H5X A;  1EYG A;  3F8T A;  3GDE A;  4DV5 L;  2E5L L;  2N78 A;  2WB1 G;  3I2Z A;  1TWA H;  5M5X H;  2F4V L;  2HIV A;  4JI2 L;  5GRO A;  4PZ7 A;  1JJC B;  4A3E G;  3GTP H;  1DGS A;  4TQU S;  1K8G A;  4JI7 Q;  1QVC A;  1X55 A;  3T1Y L;  3GD7 A;  1I94 L;  3M4P A;  4IOC A;  1CKO A;  2CFM A;  2YTY A;  1IBK Q;  4A93 G;  3BZC A;  4DPG A;  5IP9 H;  3KF6 A;  2VQF L;  4A3B H;  1HNW L;  3RLO A;  3BU2 A;  1XMO Q;  4JV5 L;  2R93 H;  5K36 G;  2PI2 A;  3CC4 A;  2E5L Q;  3G71 A;  3PUX A;  1Y1V H;  1YJN A;  1JJ2 A;  1I5F A;  2PQA A;  4IJL A;  2KHJ A;  4GLX A;  4A3M G;  1LUZ A;  3W1B A;  3GO5 A;  5LMN W;  5H1S E;  1KAW A;  3F2D A;  3RZD H;  1M1K C;  1GM5 A;  4BA1 I;  2E2H H;  3HKZ E;  2VS1 A;  2UUB Q;  3MXN B;  5GAE C;  1J5E L;  5IYD H;  3K80 C;  1XPR A;  2WAQ G;  1VQD A;  3EBE A;  4Y52 H;  1Q12 A;  2RF4 A;  1CSQ A;  2VQE L;  4B3S L;  4DR1 Q;  1HNZ L;  2HT1 A;  1IBM L;  4DR2 Q;  4C3H H;  2N3S A;  1HNZ Q;  2R7Z G;  3E0E A;  1FVI A;  2R7Z H;  2ATW A;  3CC2 A;  2ZTC A;  3PIO A;  2YV5 A;  1HZ9 A;  1HH2 P;  1UE7 A;  1MIU A;  3PSI A;  4AIM A;  2QA4 A;  1QVG A;  2Y0S G;  1IL2 A;  3ICE A;  2NVY H;  3Q8D A;  2K5H A;  4JCV E;  1P16 A;  3PF5 A;  1L1O C;  4UP8 A;  1L0W A;  2PMZ E;  1K83 H;  4GLA C;  1Y1W H;  2I0Q A;  5AJ3 Q;  4B3R Q;  1PH3 A;  4JI4 L;  1VQM A;  3CPW A;  3TS2 A;  4JI6 L;  4LF5 Q;  3OW2 A;  3HOX G;  3L7Z C;  2IHF A;  5C3E G;  4HJ8 A;  1SFO H;  4DR3 Q;  3UDI A;  3K7A H;  3HOZ G;  4BY7 H;  1Y14 B;  2OCE A;  1Y1V G;  3WWV A;  2VZA A;  4DV0 L;  3J80 i;  1Q86 C;  2E2I H;  1Z9F A;  1PA6 A;  4KHP L;  5IYC H;  3OYY A;  2ES2 A;  5GAD C;  4A3F G;  5LMU L;  1HNX L;  3JAM i;  1AE2 A;  2D62 A;  3D31 A;  1HZC A;  1BBW A;  2RHS B;  4UY8 C;  4IOA A;  1KXL A;  4HID A;  5FJ8 G;  5C0X G;  1V9P A;  4A75 A;  4UP9 A;  5IP7 H;  5M5W H;  1K8A C;  1Q1E A;  4DR1 L;  4LF9 L;  2MNA A;  3I4O A;  3HOV G;  1YBY A;  1WYD A;  2R7F A;  3PV0 A;  1VQG A;  5C4X H;  4HIM A;  4LF4 L;  4LFB L;  1E22 A;  1VQA A;  5JJL A;  4A3F H;  4A3B G;  1Q8K A;  4LFC Q;  4JI8 Q;  1VQB A;  1BVS A;  2ZJP A;  1K0R A;  1GD7 A;  4X64 L;  4KHZ A;  4RG1 A;  3H3V I;  2A19 A;  2E2J H;  5J3B A;  1XJV A;  1S3O A;  2UUA L;  4DR6 L;  4K0K L;  4JI4 Q;  4MZ9 A;  2Q2I A;  1QUQ A;  4DV4 L;  2JJQ A;  4JBW A;  2JQO A;  4LFA Q;  3G6E A;  2K5N A;  1VQH A;  2EIF A;  2NN6 G;  5ELO A;  3J81 i;  1VQ9 A;  4LF5 L;  1HJP A;  1XPU A;  2L15 A;  1G51 A;  1B7Y B;  4JYA Q;  4DR5 Q;  3ZJY C;  5ELN A;  4LFB Q;  1EWI A;  1VCI A;  3CCL A;  2Z0S A;  2LSS A;  4WJ4 A;  3NEL A;  4LFC L;  5GAG C;  2VUM G;  3F2C A;  1G6P A;  1GKH A;  4OWX B;  1LM0 A;  1X3E A;  4A3I G;  3GTM H;  1N32 Q;  4GOP B;  1HNX Q;  5BR8 L;  1N8R C;  4WJ3 M;  2HIX A;  3AFQ A;  1N33 Q;  2BH2 A;  3T1H Q;  1I94 Q;  4B3M L;  1YHA A;  4MTN A;  4A3G H;  3E9H A;  1WJJ A;  3H0G H;  5IE8 A;  3M85 A;  4DV7 L;  4R4I A;  1N36 Q;  4GLV B;  4IFD I;  3KYH C;  1XPO A;  3S1Q H;  2K5V A;  3KFU A;  1J6Q A;  2CWP A;  4R4T A;  4A93 H;  4GKJ L;  1W3S A;  1NMF A;  4GKJ Q;  1IYJ B;  1VQE A;  4IO9 A;  2ZJR A;  3K81 C;  4P72 A;  3A5U A;  3CCQ A;  3HOY H;  1PVO A;  1NJI C;  3GTK H;  2MO0 A;  1KL9 A;  2AWN A;  4APV A;  1IBK L;  3J81 j;  4AQY L;  5C44 H;  3GTO H;  3U4V A;  3T1Y Q;  1QZH A;  4DV2 Q;  4LF6 Q;  3H3V H;  3KF8 B;  5IYB H;  1K3R A;  1D8L A;  1K9M C;  1ASY A;  2NVX H;  4YWM A;  4DR2 L;  1N36 L;  1XMO L;  4A3D H;  2MO1 A;  1YEZ A;  3HOW H;  2VL6 A;  2K50 A;  4DV3 Q;  1KRT A;  4UP7 A;  1WCM H;  3K8A A;  3CMA A;  2R93 G;  2AMC B;  1FJG L;  4OO1 G;  3OTO Q;  3EN2 A;  1YHQ A;  1I6H H;  1NTG A;  4P71 A;  2QGQ A;  5C4X G;  1PV4 A;  1PH9 A;  2UUA Q;  4QL5 A;  4L5S A;  4DR6 Q;  3HFZ B;  4HJ7 A;  3S1R H;  5DLQ E;  2QEX A;  4A3C G;  1VQN A;  1PH1 A;  3TS0 A;  1YJW A;  3ULL A;  2CWA A;  1VQ5 A;  2K52 A;  2ZJQ A;  4GN4 B;  1BBU A;  4POF A;  4TVA B;  1A63 A;  3CC7 A;  2ALY B;  3S1N H;  1AE3 A;  2YYZ A;  1KD1 C;  2YTX A;  4AYB E;  4GNX C;  1Q82 C;  2KCT A;  4GKK Q;  1VQF A;  3RNU A;  4A4I A;  3KOJ A;  1N33 L;  2UXC L;  5C44 G;  3I7F A;  1XMQ L;  4JI5 Q;  2NVT H;  2RCN A;  2A1A A;  2UU9 L;  2OWO A;  2JEB I;  1L1O A;  1VQI A;  3CPF A;  1KHI A;  2D0P A;  4QGU A;  1X3G A;  4HJ5 A;  2LXJ A;  2DGY A;  4LF7 Q;  2WFW A;  4IJH A;  2NN6 I;  3PIP A;  3UDG A;  2BA0 A;  3STB D;  2JA6 H;  1HR0 L;  2N49 A;  3H0G G;  4UPA A;  3HOU H;  2K75 A;  2JA7 G;  3GTJ H;  4AYB G;  4DKA C;  5HGQ A;  5C3E H;  3I4N G;  3HOZ H;  4X66 L;  3PO2 H;  4L5R C;  2PI2 E;  1WOC A;  3CCJ A;  4QY7 A;  3MEF A;  1X65 A;  3KDF A;  4GN5 A;  3W5O A;  4A3M H;  4DNI A;  1B70 B;  4DUY Q;  1YIJ A;  1CUK A;  4PZ8 A;  2ID0 A;  2K14 A;  3G48 A;  1FL0 A;  3CXC A;  1QUQ B;  3STB C;  4FDB A;  3S14 H;  4RMF A;  1PYB A;  3RLF A;  3G4S A;  1QVF A;  4BBS H;  1N34 L;  2I5H A;  3PCO B;  4PG3 A;  2GVA A;  3AEV A;  4LF4 Q;  2NZH A;  4GNX B;  4R4O A;  4A3K G;  3J81 c;  1D7Q A;  1XNR Q;  4NXM Q;  2I5M X;  4POG A;  3JAM c;  3NBH B;  2I5L X;  3ULJ A;  4YCW A;  5M3F H;  1CSP A;  3T1H L;  2UUC Q;  4JI3 L;  2JA5 G;  5IT9 c;  2VQE Q;  1EQR A;  4DV4 Q;  3UE1 A;  1SN8 A;  4YWL A;  1YI2 A;  4IPG A;  1PH8 A;  2KBN A;  1AH9 A;  1MJE A;  2GN5 A;  3CP0 A;  3PGZ A;  3PUZ A;  4LF8 L;  2JEA I;  2IY5 B;  1I50 H;  1P8L A;  2AWO A;  4BY1 H;  1EFW A;  4QQB X;  4IFD G;  3J7A 5;  2AKW B;  1A62 A;  3HOX H;  4R1J A;  1RL2 A;  3OTO L;  3M4O H;  1G29 1;  3M3Y H;  4K0K Q;  4A3L H;  2BA1 A;  3CCV A;  2UUC L;  2PQA B;  2B63 H;  3DM3 A;  5JJI A;  4JV5 Q;  3PUV A;  2Q2U A;  1MKH A;  4O2D A;  2VQF Q;  2RHQ B;  5IY0 A;  2JK8 A;  4KLK A;  4GOP A;  3HOV H;  4B3T L;  4BXX G;  4LF7 L;  2VNU D;  1L2F A;  2CCZ A;  2R92 H;  2UXC Q;  1NBW A;  3BZK A;  5FJ8 H;  1X3F A;  2VW9 A;  2DUD A;  3EIV A;  3NEM A;  3ULP A;  2Z6K C;  1N32 L;  5IYB G;  4NB3 A;  3VDY A;  2IHE A;  3U4Z A;  5E7N A;  1EIY B;  4NXM L;  2UXD L;  3RR5 A;  3AFP A;  1YJ9 A;  1VQ8 A;  2Q2H A;  1U0L A;  4MNO A;  4X62 Q;  1YNX A;  3CCS A;  1HZA A;  2Y0S E;  3ER0 A;  3L2P A;  4A3J G;  1KIX A;  2ZTD A;  1JB7 A;  1GO3 E;  1K73 C;  2JA5 H;  3PF4 A;  3B6Y A;  3HKS A;  1M90 C;  3DLL A;  2ZTE A;  1OXS C;  5M5Y H;  2A8V A;  5FLM G;  4YY3 Q;  3GTL H;  2IX1 A;  3I55 A;  1UEB A;  3PO2 G;  2MQH A;  5GAH C;  5C0X J;  4DV1 L;  2VUM H;  3AQQ A;  4A3I H; 
#chains in the Genus database with same CATH topology
 1B53 A;  4NPS A;  1S4Z A;  1Y1V B;  4RAU C;  4CKB A;  5I4D A;  4N9T A;  3FHW A;  1ZYR D;  1IBL L;  3CD6 A;  1VQC A;  1B8A A;  4X62 L;  3SE0 A;  3IL8 A;  2IX0 A;  2CKZ B;  4HCS A;  4ME3 A;  1VQ6 A;  2R92 G;  2K04 A;  2V1C C;  3KLW A;  4ODG A;  5JAV A;  3HOY G;  3UE0 A;  1Q81 C;  1SDF A;  3K5L A;  4HJ9 A;  1O78 A;  4QJF A;  5C4Z A;  3D4R A;  5ELD A;  1X54 A;  4RCN A;  5IT9 E;  4K14 A;  3S15 H;  1UE1 A;  3PUW A;  2EOT A;  4JI6 Q;  3HOW G;  1AP0 A;  4IFD J;  4KMU C;  3FPP A;  1SXT A;  2JA8 B;  1EYA A;  2XRQ D;  5C5M A;  1GUS A;  2K32 A;  4WFN 3;  1HRJ A;  5C6A A;  3IFT A;  4NKL A;  1Q1B A;  1FGU A;  2F3W A;  2CHB D;  1TS4 A;  4HAE A;  3RLN A;  1SLJ A;  3TSS A;  2E75 C;  5ELB A;  5JVH 3;  3K7U C;  1UE6 A;  2ASB A;  3M4Q A;  2YTV A;  1B9N A;  1A8V A;  4JBK A;  1EYC A;  1VQJ A;  1HUM A;  1Z6H A;  1BCP F;  1EZ6 A;  5IGE A;  1XNQ Q;  1TWG H;  2JA9 A;  4XT1 B;  5IYC G;  1YIT A;  3FMC A;  1SJH D;  2JA8 H;  4LF8 Q;  1WTH A;  4PMW A;  4JI2 Q;  1HZB A;  4JI7 L;  4YCV A;  1XNR L;  2R7D A;  1VF5 C;  1JOR A;  1ML0 D;  5LMN Q;  4OEM B;  2F3I A;  4P75 A;  3UDF A;  2JA6 G;  3VR3 A;  1E24 A;  4B3S Q;  1KQS A;  4EQ5 A;  4AH6 A;  1ET6 A;  2Q2T A;  1VQL A;  2VY3 A;  5HUR A;  1Q3L A;  1X9N A;  5DM6 3;  5I9O A;  1JJG A;  4LUZ A;  4R8N A;  1MJC A;  1PH2 A;  3TEH B;  4HJA A;  2EJG C;  5FLX c;  1XWE A;  4IUR A;  1CKN B;  5CV8 A;  1B50 A;  1QZG A;  3LWE A;  5EAY A;  2MP1 A;  1TS2 A;  3OIP A;  1PXU A;  4QF4 A;  2EQS A;  1TWF B;  2QDB A;  4NXN Q;  1KC8 C;  4DV5 Q;  4HIO A;  3E0J A;  1R4P B;  2K05 A;  1I3Q H;  3R93 A;  4DV6 L;  3KK7 A;  4OWW B;  4PMB A;  4WJW A;  4C3J H;  3KLS X;  1SR3 A;  1DON A;  1V1Q A;  3MWY W;  4BA2 I;  2KQ3 A;  5HY6 A;  1K3B C;  3M9B A;  4BWG B;  4H7B A;  2EVB A;  1LTR D;  4CGY B;  2JA7 B;  1V43 A;  3OWE B;  2K7V A;  1EFI D;  4JI5 L;  4JI3 Q;  3VR2 A;  4DR5 L;  3CQZ B;  3S9W A;  5C3W A;  4JC0 A;  1D5Z C;  2JXM B;  1FYC A;  2HCC A;  1JE4 A;  4XTC S;  1U5K A;  4CKE A;  4O42 A;  2RA4 A;  4OL7 A;  1UE5 A;  2WB1 E;  2NVY B;  1LTT D;  1HNW Q;  4DXF A;  2KEE A;  3GDE A;  3F2U A;  2A69 C;  2N78 A;  3I2Z A;  5M5X H;  4K5V A;  4FF3 A;  4JI2 L;  1EOT A;  1H9S B;  4C3J B;  1QVC A;  3GD7 A;  4IUP A;  1C48 A;  4RHS A;  1I94 L;  1CKO A;  1G91 A;  4ZKC B;  3K5M A;  2EY5 A;  1XYI A;  3RLO A;  3BU2 A;  4HN7 A;  3QWN A;  2R93 H;  2F0L A;  3GTM B;  1PZI D;  3G71 A;  3PUX A;  2Z6B A;  1YJN A;  1JJ2 A;  3A54 A;  2PQA A;  3BYY B;  4A3I B;  5LMN W;  3I4M B;  1NR4 A;  1M1K C;  3V05 A;  5TSS A;  4BA1 I;  2A6E C;  2DJF C;  2P5Z X;  2E2H H;  1QJO A;  1XPR A;  3EBE A;  1Q12 A;  4I7Z C;  4WOR A;  4IAL A;  1A15 A;  2KVM A;  3SK8 A;  1HNZ Q;  3FVQ A;  2ZTC A;  5KNC A;  2YV5 A;  1IL2 A;  3T4A C;  1QVG A;  5C4J B;  3SXH A;  3Q8D A;  1WTV A;  4LAA A;  2NYZ D;  4EQP A;  4UP8 A;  3MHB A;  2VB2 X;  2CQA A;  4FXD A;  3PO3 B;  1E2V A;  3OPO A;  2A6H D;  3TS2 A;  1KDB A;  4LF5 Q;  3OW2 A;  2F0U A;  1V1P B;  2TMP A;  3L7Z C;  1STE A;  5EJW A;  1QE6 A;  3J81 L;  1CHP D;  4YIJ A;  2LMC B;  2K03 A;  2A74 C;  1PA6 A;  4KHP L;  2ES2 A;  1QG7 A;  2D62 A;  4DK0 A;  3GP7 A;  4QB4 A;  2K1B A;  4HMI A;  5C44 B;  4UP9 A;  2WKC A;  3HOV G;  1STA A;  4CDE C;  3BS1 A;  4HIM A;  1E22 A;  4HMJ A;  1JR0 D;  4C3H B;  4LFC Q;  2ZJP A;  1BQQ T;  1TU2 B;  1GD7 A;  3H3V I;  4DR6 L;  3C1E A;  3URY A;  4DV4 L;  3KF8 A;  5G3L D;  4JBW A;  4FO2 A;  1AN8 A;  1IL8 A;  1HJP A;  4IUQ A;  3RUZ A;  1G51 A;  2Z0S A;  3NEL A;  1B4O A;  3VA7 A;  2VUM G;  1G6P A;  1LM0 A;  1X3E A;  4ZQ3 A;  3GTM H;  4GOP B;  4NW2 A;  1HNX Q;  3AFQ A;  1SNP A;  5EBC A;  1N33 Q;  1HCZ A;  1D5X C;  4A3G H;  5M5Y B;  2BE5 C;  2DNE A;  4GLV B;  4IFD I;  1HA6 A;  2K5V A;  5M5X B;  1MHW C;  1SYB A;  4GKJ Q;  1NMF A;  2WB1 B;  4FVM A;  3BVG A;  2ZJR A;  2F0M A;  3GTK H;  4FYD A;  1DOM A;  4LF6 Q;  3A55 A;  3H3V H;  5IYB H;  5BN4 A;  4A3D H;  2NN6 H;  1N36 L;  4DNR B;  1EY4 A;  3HOW H;  2NB0 A;  1ET9 A;  4L63 B;  3E6Z X;  2E2I B;  2Q8R E;  2JA5 B;  1JOQ A;  3EQL C;  3T16 A;  2WKD A;  3K8A A;  2R93 G;  2AMC B;  1E2Z A;  1YHQ A;  1I6H H;  1NTG A;  4P71 A;  2QGQ A;  5C4X G;  1S5D D;  1RCV D;  1PH9 A;  3S1R H;  1JOO A;  2RCF A;  1PH1 A;  3ULL A;  1A63 A;  3S1N H;  2B2Y A;  1WVL A;  3BDO A;  4AYB E;  4GNX C;  2KCT A;  2F0H A;  3HEJ A;  1YNJ C;  3KUP A;  4PNY A;  1SE2 A;  3ONA B;  3A7A B;  2O4X A;  4JI5 Q;  4JVZ A;  1L1O A;  1ESF A;  5COR A;  4QGU A;  4HJ5 A;  3J7A F;  1DD2 A;  1DYQ A;  1PYW D;  4LF7 Q;  1I4Q A;  2NN6 I;  1Y69 U;  1TY2 A;  1PTO C;  5C3E B;  1D1K A;  2BCO A;  3H0G G;  3CRK C;  1WTR A;  1TWH B;  4RGT A;  3SDZ A;  4DK1 A;  2PI2 E;  1Y8N B;  1SBB B;  4GN5 A;  1JWU D;  1B70 B;  4DUY Q;  1CUK A;  2F0F A;  3C3L A;  2K14 A;  1BCP D;  3G4S A;  4BBS H;  1N34 L;  1E2W A;  2GVA A;  4LF4 Q;  2K28 A;  2NZH A;  1D2B A;  5I2Y A;  4R4O A;  1AEX A;  1D7Q A;  4TKO B;  4NXM Q;  5L37 A;  1D1I A;  1PFB A;  4YCW A;  3ULJ A;  1CSP A;  1NCV A;  5IT9 c;  1EQR A;  5K36 H;  1O7Y A;  4DV4 Q;  2B2V C;  2GN5 A;  1I4P A;  5CV9 A;  3H3V C;  5CV6 A;  2JEA I;  1TS3 A;  1I50 H;  1RJT A;  2AWO A;  1TR5 A;  5JPM C;  1ZEQ X;  1U4P A;  3HOX H;  4F87 A;  5F2D A;  1PTO H;  1KAB A;  2Z9H A;  1CZW A;  4MN3 A;  2ZXR A;  2UUC L;  1CQV A;  1MKH A;  1V1O A;  4GOP A;  3C1F A;  3MTS A;  3S2H B;  2CCZ A;  2R92 H;  2UXC Q;  3SR1 A;  1X3F A;  3D4W A;  1TT2 A;  3EIV A;  3ULP A;  2WV6 D;  1VQ8 A;  2FHT A;  1U0L A;  1KIX A;  4X62 Q;  4JYA Q;  2Y0S E;  1JCK B;  1JB7 A;  1GO3 E;  2JA5 H;  3B6Y A;  3DLL A;  2ZTE A;  3HOW B;  2MQH A;  2Z4H A;  4A3D B;  1F2Z A;  5GAH C;  1B3A A;  4A3I H;  1S5E D;  2CH4 W;  1NY4 A;  2KCN A;  3LNN A;  4DAM A;  1E1O A;  4UAI A;  5EGT A;  3X3M A;  4BBR H;  1QOH A;  4DUZ Q;  4DR4 L;  1I4H A;  4GS3 A;  3VR4 A;  3NK9 A;  2CQO A;  3BJU A;  2QEJ C;  1HFG A;  1T5X D;  4OO1 I;  5COY A;  3F1Z A;  3PO3 G;  3DWP A;  2A69 D;  3A74 A;  1SRU A;  4B3T Q;  1KRS A;  1OXV A;  4IN3 A;  3SVM A;  4QUC A;  3KJP A;  2OTL A;  1L0X B;  3P20 A;  4JI1 L;  4F7X A;  4IQZ A;  5C4X B;  4DUZ L;  4AQY Q;  4ALP A;  3I3C A;  3QB3 A;  1R9T B;  1C9O A;  3R3O A;  1S72 A;  4BBR B;  1PZJ D;  1EUJ A;  4QMG A;  2OQ0 A;  1MD2 D;  4JBJ A;  1B2T A;  2HHH Q;  4X65 Q;  4YY3 L;  3HOU G;  4JI0 L;  1PH7 A;  2WAQ E;  1PHJ A;  2F4I A;  3A56 A;  3HKZ G;  4KJN A;  1O80 A;  2OT2 A;  1YHB A;  1VQK A;  3FP9 A;  3MXN A;  3F2B A;  3MAQ A;  3DHQ A;  1ILQ A;  3CQZ H;  3AYH B;  3MEH A;  1IBL Q;  4A3C H;  1DCZ A;  4A3E H;  1F77 A;  2IW3 A;  3U50 C;  4HIK A;  4OX9 Q;  4PMC A;  4DR3 L;  1Y1W G;  1A0I A;  1PFN A;  3H6M A;  2NVQ H;  4OO1 H;  1WFQ A;  3TRZ A;  1CM9 A;  2LY7 A;  2D9U A;  4X6A H;  1ICW A;  1Q46 A;  1JMC A;  3NUC A;  3W1G A;  1WD0 A;  2WP8 J;  3MC0 B;  3GTQ H;  1TS5 A;  1STN A;  1TWC B;  1C0A A;  1KAA A;  3Q24 A;  2LXK A;  5KND A;  4U67 3;  1IZ6 A;  1SMX A;  1E1T A;  2D5D A;  3HG9 A;  4OON A;  4A3G B;  1HR0 Q;  3M4Y A;  3PO3 H;  2B2U C;  2G9D A;  2KCM A;  1U4M A;  2UUB L;  5GQO A;  2F1M A;  5BR8 Q;  2Z4I A;  2IT1 A;  3DEP A;  4C3J G;  1STB A;  1EQQ A;  1SNC A;  3H15 A;  1OXX K;  2HHH L;  1YZ6 A;  5JOB A;  3JAM E;  1EQV A;  1H9J A;  3NEN A;  2B8G A;  2XWB B;  4IPD A;  3S1Q B;  2UXB Q;  1RF2 D;  5E4W C;  2A73 B;  3SK6 A;  1HFN A;  1JQY D;  1PTO D;  4FF1 A;  5JEA H;  3K0X A;  2NZO A;  2D0O A;  4A3F G;  4DV6 Q;  3QJY A;  4GKJ L;  1MGS A;  4JI1 Q;  2HQE A;  1G2S A;  5AJ3 L;  2YU9 B;  1CA5 A;  4B3M Q;  3A0J A;  2RSN A;  2XRS D;  4PV1 C;  3MXU A;  5E4X A;  1C8C A;  4JOI A;  5AFW A;  2EY2 A;  4KKU A;  4LW1 A;  5C0X H;  1TXY A;  3FRP B;  4DV0 Q;  2N55 A;  2LS0 1;  4OWT B;  2L12 A;  2ZM6 L;  4RGN A;  2PNH A;  1GVP A;  5EKI A;  3GTL B;  1DOL A;  2O2L D;  1J5E Q;  4A3L G;  1LYL A;  3A8K E;  1UEA B;  4MTK A;  5BN5 A;  1BNZ A;  2FFK B;  1TWC H;  1VDZ A;  4DV7 Q;  3J81 E;  4DUY L;  4LUV A;  2EXD A;  4BBR G;  2WII B;  3I56 A;  4BBS G;  5EPK A;  3K5N A;  1Q7Y C;  5IP7 G;  1ICF B;  3U58 A;  1FJG Q;  4IPC A;  2BH8 A;  4ZCK A;  1PYS B;  4LMQ D;  1PH4 A;  5LMN L;  2FIN B;  2OEO A;  4Q5V A;  1HQM C;  2EYO A;  3IRB A;  4KD3 A;  4AYB B;  1ONL A;  2AHO B;  3BVM A;  4A3J H;  3ZYY X;  3ERS X;  2PMZ B;  2JN4 A;  2E2H B;  1SJE D;  5IIF A;  3BDC A;  1G8Z D;  5C0X I;  4CJ0 B;  3I4M G;  2XIW A;  1N9W A;  3I4M H;  4ZUJ A;  5FLM H;  1EIF A;  5A2Q L;  3A8I E;  4NDX A;  1BKB A;  2QCP X;  1GUN A;  4RCO A;  3KLS A;  2H5X A;  3TP7 A;  2F3V A;  2E5L L;  2WB1 G;  1TWA H;  4A3E B;  2F4V L;  2SOB A;  1SNO A;  2DY8 A;  4KN4 C;  3GTP H;  1IW7 C;  4TQU S;  1K8G A;  3HRZ C;  4KHV A;  1X55 A;  2F0E A;  3CKI B;  2YTY A;  4A93 G;  3OHX C;  4DAP A;  5IGB A;  1BF4 A;  3KF6 A;  3S16 B;  1I3Q B;  4J1M A;  1WD1 A;  2G5D A;  1EL0 A;  4B9W A;  1Y1V H;  5BN3 A;  3RZO B;  5CV5 A;  3NTH A;  3KBX A;  4ZRZ A;  3W1B A;  2PZT A;  5IGC A;  1J9O A;  3OWF A;  1W6J A;  3HKZ E;  2VS1 A;  2UUB Q;  3MXN B;  4V19 0;  4Y52 H;  2VQE L;  4CDD C;  4K5X A;  1A3U A;  3TP6 A;  4DR2 Q;  4C3H H;  2R7Z G;  3E0E A;  1E0B A;  2ATW A;  3K0Y A;  3PIO A;  1HZ9 A;  2UXC L;  1HH2 P;  1UE7 A;  2Y0S G;  2R92 B;  4JCV E;  1L0W A;  4GLA C;  1GJX A;  2EYH A;  1QNU A;  3CPW A;  3N52 A;  4HJ8 A;  5C3E G;  4DR3 Q;  4BY7 H;  1Y14 B;  4G7Z C;  1Q86 C;  3J80 i;  5DEH A;  2Z1C A;  3A7L A;  3Q6S A;  2KA7 A;  1S5C D;  3DM1 A;  3OYY A;  5GAD C;  4CKC A;  2F0I A;  3JAM i;  3BG3 A;  3D31 A;  2RHS B;  5C0X G;  4XXE A;  5DNF A;  3WOF A;  4A75 A;  3W2D A;  1Q1E A;  4LF9 L;  4XQN A;  3I4O A;  5J22 A;  3PV0 A;  2R7F A;  1QIL A;  5C5L A;  4LF4 L;  1U4L A;  5JJL A;  1VQB A;  2E76 C;  1K0R A;  1PRT D;  3S14 B;  4DAV A;  3H0G B;  2E2J H;  2UUA L;  4K0K L;  2O5I C;  1LT6 D;  5G3L F;  2JJQ A;  3G6E A;  4LF5 L;  1VQH A;  2EIF A;  2NN6 G;  3DUZ A;  5ELO A;  4C3I B;  2L15 A;  1B7Y B;  3GTJ B;  5ELN A;  4LFB Q;  3CCL A;  4P2C B;  3EA6 A;  5GAG C;  1EIH A;  3F2C A;  2MPM A;  3MZ5 A;  1GKH A;  4A3I G;  1ESR A;  2F0T A;  3NBH A;  2R93 B;  1N8R C;  3I72 A;  2HIX A;  1MSH A;  1I94 Q;  5D3I B;  1YHA A;  4B3M L;  4GZY C;  4WRD A;  3I90 A;  5LHY 1;  4XT3 B;  3SEB A;  1K0S A;  1NSN S;  2RBM A;  1TWG B;  2LKV A;  3PIO 3;  4ID6 A;  2E74 C;  3KFU A;  1J6Q A;  2CWP A;  2OXP A;  1JWM D;  1VQE A;  2F0V A;  2I46 A;  3AU7 A;  4FP5 D;  3CCQ A;  1PRT F;  1PVO A;  1J8I A;  4K8J A;  3GTO H;  1KDA A;  5D14 A;  2EDG A;  4DR2 L;  2AQ2 B;  2BDO A;  1YEZ A;  2MO1 A;  1EEF D;  1I6H B;  1LT4 D;  1LAB A;  2CH4 A;  3P75 A;  4DV3 Q;  3OOC A;  1KRT A;  1RD9 D;  3OMG A;  1FJG L;  4OO1 G;  3EN2 A;  2EPB A;  4OIK A;  4QL5 A;  3S1M B;  1KLG D;  4A3C G;  1SND A;  1VQN A;  3S1N B;  2F0P A;  1VQ5 A;  2CWA A;  2K52 A;  1B1Z A;  4GN4 B;  4TVA B;  4RA8 A;  3HS0 C;  1KD1 C;  4OGQ C;  2YTX A;  1YNN D;  3K5O A;  4GKK Q;  2Z8L A;  1JB3 A;  4A4I A;  5JPN C;  1B3Q A;  3VYU A;  4BY1 B;  2RCN A;  2A1A A;  2UU9 L;  1VQI A;  3CPF A;  3PO2 B;  2DGY A;  3CU7 A;  4O1N A;  2WFW A;  3UDG A;  3J80 E;  1BDO A;  1FNV A;  2N49 A;  2IJ0 A;  5IGD A;  4UPA A;  4DKA C;  5HGQ A;  3I4N G;  4XYQ A;  4X66 L;  4RGO S;  1SE3 A;  3K59 A;  4A3M H;  4PZ8 A;  2A68 D;  1QUQ B;  1ILP A;  3UI2 A;  4RMF A;  1PYB A;  1QVF A;  3PCO B;  3P7J A;  2EXZ A;  4HSP A;  4A3K G;  2F0D A;  4X3T A;  1GUG A;  4POG A;  3JAM c;  3H09 A;  1SE4 A;  3T1H L;  3NWS A;  3U9S A;  3UE1 A;  1SN8 A;  1TVX A;  1YI2 A;  4IPG A;  1AH9 A;  3CP0 A;  4LF8 L;  2EJM A;  2C5C A;  4A3J B;  1NNX A;  1YNN C;  3FEW X;  4QQB X;  3J7A 5;  2B8F A;  3A8J E;  1A62 A;  1IKM A;  1I50 B;  1RL2 A;  1G29 1;  1A2T A;  3DM3 A;  2IX3 A;  4H0L C;  3MFY A;  4O2D A;  2VQF Q;  2RHQ B;  4I7A A;  3I4L A;  4XQQ A;  1CZG A;  1CTM A;  3N6R A;  2CW0 D;  5M3F B;  1NBW A;  3BZK A;  1U9R A;  2DUD A;  5T1G A;  4XYO A;  3RMH A;  5IYB G;  2PCF B;  1EY6 A;  2IHE A;  1SMY D;  1GHJ A;  5E7N A;  2Q2H A;  1BCP B;  4MNO A;  3CCS A;  1QNK A;  1YNX A;  3PF4 A;  3NSW A;  4ZAI A;  3HKS A;  1M90 C;  2NBF A;  1SSO A;  4DF7 A;  4YY3 Q;  3GTL H;  5KGU A;  3D6W A;  3ERO A;  1EWH A;  2VUM H;  3AQQ A;  1GOZ A;  3HKZ B;  3ITP A;  4Y7N H;  2UU9 Q;  4C2M H;  2O5J C;  1HPC A;  1JC7 A;  3M7N A;  5CYU A;  4LF9 Q;  4A3K H;  4NXN L;  1L1O B;  3HZX A;  1L0Y B;  5IWA Q;  4BBS B;  1VS0 A;  2E8G A;  4IUU A;  4DAY A;  2ICI A;  4JPB W;  4GOP C;  4KN7 C;  4CBV A;  2OTJ A;  5ELF A;  3V2T A;  4J6H A;  1W2B A;  3PUY A;  1Y8P B;  1JE5 A;  3NPP A;  3H91 A;  2B63 G;  2GVB A;  4HTH A;  1WCM G;  3S17 H;  3NHH A;  3BDL A;  3Q0A A;  1H9K A;  5DAU A;  5IOC A;  1STH A;  4O0A A;  1OXU A;  1DJR D;  5KYL A;  2JA7 H;  2RQX A;  3I4N H;  4F8M A;  4R4Q A;  4RH6 A;  5JEA G;  3JC6 6;  3ERQ A;  2NVQ B;  5ISR A;  1FNW A;  3TP8 A;  1OXT A;  4X64 Q;  3I4N B;  1BUV T;  4G4K A;  3RN5 A;  4G7H C;  1S5B D;  1XX8 A;  2R6G A;  1H95 A;  1JWS D;  4NMZ A;  1F9P A;  2JA8 G;  3LGJ A;  3K7A B;  5FOB B;  1PRT B;  5IP9 G;  3TZD A;  4N8X 1;  3CW2 C;  1CI3 M;  1SNQ A;  3SGI A;  4LF6 L;  1TWF H;  2F0W A;  1VQP A;  2QDL A;  5HGT A;  3S16 H;  4L5T A;  1SRO A;  2F0G A;  3C2P A;  2Z6K A;  2B29 A;  1K8M A;  4YCU A;  4EVO A;  2L1B A;  2K4K A;  3CCM A;  3IKJ A;  2JYO A;  2WAQ B;  5CV4 A;  4B3R L;  1OTC A;  4JG2 A;  1TWA B;  2XNA C;  1WI5 A;  2RDH A;  4DK3 C;  1HHV A;  4YHH Q;  5A35 A;  4KI0 A;  2IL8 A;  1LV9 A;  1WTW A;  2PZW A;  3GV6 A;  2JA6 B;  4C3I H;  3TQY A;  2B39 A;  2J4X A;  2AQ3 B;  1EOV A;  4KHP Q;  2K6A A;  3RN2 A;  4BY7 G;  2NVT B;  1F2L A;  2EYF A;  3DXJ C;  1V1P A;  1XNQ L;  4DK6 C;  1GHK A;  2PPB C;  1IYV A;  4XIG S;  4BY1 G;  1XTD A;  3W3A A;  2K5D A;  3CRL C;  3OW7 A;  4QIW E;  1O7I A;  3KJO A;  1D6E C;  5KIX A;  5I9P A;  1PH5 A;  5FLX E;  4K2L A;  1STY A;  3ND8 A;  4Z9C B;  5ELE A;  1DXM A;  1R4Q B;  4FF4 A;  2C35 B;  1VQO A;  5C4J H;  1HR0 W;  4KKS A;  3SK4 A;  2ZM6 Q;  1YVC A;  5EPL A;  3FKI B;  2ENB A;  1F9Q A;  4DAY B;  3KF6 B;  2KJX A;  1PTO B;  4L5Q A;  2RKS A;  3HOX B;  2ICE C;  5IWA L;  3H94 A;  4TRD A;  4FNF A;  2IWH A;  4C1N K;  3E9I A;  4A3G G;  2L11 A;  4PZ6 A;  1UNS A;  1VQ4 A;  3G6J B;  3FKI H;  1G6Z A;  1IYU A;  2D2C C;  3EFX D;  4K2K A;  2B2W C;  3TME A;  1TQO A;  2K01 A;  2XSC A;  2AUJ D;  5M3M H;  4X66 Q;  4RHR A;  1Z47 A;  3HOY B;  1MSG A;  4S3S A;  4DV5 L;  4R8I A;  5LL6 S;  4Q0F A;  2AUK A;  5J39 A;  4IZ8 A;  1ZXT A;  3CHB D;  5GRO A;  4PZ7 A;  1JJC B;  3QO2 A;  1VMP A;  3SK5 A;  3M4P A;  4A3M B;  1IBK Q;  4MHE A;  4DPG A;  1CA6 A;  2L5T A;  1HNW L;  4I65 A;  1T5E A;  4JV5 L;  5K36 G;  2E5L Q;  1QCB D;  3S15 B;  4NP5 A;  1WTQ A;  1EEI D;  5CV7 A;  4A3M G;  5H1S E;  1KAW A;  2WAC A;  1H9M A;  1ZKO A;  5GAE C;  3K80 C;  2WAQ G;  1VQD A;  3RD4 A;  2RF4 A;  1CSQ A;  2ZXP A;  4B3S L;  2HT1 A;  4ULL A;  2N3S A;  1ROD A;  1HTL D;  1X3P A;  1FVI A;  4QCL A;  3CC2 A;  1NR2 A;  2QA4 A;  3PSI A;  4AIM A;  3ICE A;  2K5H A;  1P16 A;  4OEL B;  1LTG D;  2PMZ E;  5IT9 L;  1Y1W H;  3HOV B;  4B3R Q;  4G7O C;  3GV3 A;  4JI4 L;  4M8A A;  2RDG A;  2B63 B;  3LWU A;  4UHV A;  4KK7 A;  2V4D A;  3HOZ G;  3UDI A;  2DNC A;  4G57 A;  1Y1V G;  3WWV A;  4B08 A;  4DV0 L;  2E2I H;  1LO5 D;  1Y8O B;  1Z9F A;  1BXT A;  1K28 A;  2M9V A;  1H9S A;  1HNX L;  1H9R A;  1AE2 A;  4UY8 C;  1HZC A;  1BBW A;  2RDF A;  4IUT A;  5FJ8 G;  4HID A;  1M4V A;  1V9P A;  2L4N A;  4DNT B;  1MI2 A;  5IP7 H;  3TZU A;  5M5W H;  1K8A C;  2Q8I B;  1YBY A;  1VQG A;  1EIG A;  5C4X H;  4LFB L;  1UUP A;  4A3F H;  2F0K A;  4RG1 A;  2A19 A;  5LL6 X;  4PQX A;  5J3B A;  4JI4 Q;  4MZ9 A;  5CR3 A;  3IAY A;  4ME5 A;  2JQO A;  1PTO F;  2K5N A;  1VQ9 A;  2ZXO A;  2FJ2 A;  3ZJY C;  1EWI A;  1VCI A;  5IGG A;  4LFC L;  2KOL A;  2BE5 D;  1LAC A;  2F0Q A;  2VUM B;  5BR8 L;  2BH2 A;  5IGF A;  5I2X A;  4M1U B;  3E9H A;  2G9H D;  1WJJ A;  2F03 A;  1RTO A;  2R3Z A;  3H0G H;  5IE8 A;  4R4I A;  3VYT A;  4U68 A;  2X69 A;  5FLX L;  1XPO A;  3S1Q H;  3DMU A;  4A93 H;  3Q23 A;  1W3S A;  1IYJ B;  4IO9 A;  3GQB A;  4K5W A;  4C2M B;  3K81 C;  3A5U A;  3QIA A;  3HOY H;  2EY6 A;  1KL9 A;  2AWN A;  3HGB A;  5M3M B;  5C44 H;  3T1Y Q;  4JK1 C;  1ASY A;  1K3R A;  1D8L A;  3NTK A;  2NVX H;  3BYT B;  4YWM A;  5CBE E;  1XMO L;  2M00 A;  2VL6 A;  4CDF C;  2K50 A;  4K6L A;  1SYE A;  1X3Q A;  4UP7 A;  1WCM H;  3CMA A;  5EKK A;  1NUC A;  2EY1 A;  5FK9 C;  3OTO Q;  3D8G A;  3GTQ B;  1PV4 A;  2UUA Q;  4L5S A;  3HFZ B;  3JAM L;  3TS0 A;  4IFD H;  1BBU A;  3O13 A;  2ALY B;  5EBD A;  3SHL A;  3S1R B;  1Q82 C;  4N8F A;  1VQF A;  2DN8 A;  1SNM A;  1EY7 A;  1O7Z A;  4ABN A;  3KOJ A;  4EQN A;  2F0O A;  3P1H A;  1N33 L;  1IHZ A;  3TP5 A;  3I7F A;  2NVT H;  2OWO A;  5K5P A;  1EZ8 A;  1KHI A;  2XVS A;  1PLF A;  1EU4 A;  1X3G A;  4ZK9 B;  1LTS D;  2JA6 H;  3STB D;  4AYB G;  3HOZ H;  3PO2 H;  2AQ1 B;  3D6C A;  3T56 B;  3FDT A;  3MEF A;  4DN4 M;  3W5O A;  1YIJ A;  2PZU A;  3K6O A;  4DGZ A;  3STB C;  2BDN A;  2FMM A;  4QUF A;  3RLF A;  2JP1 A;  3AEV A;  3NQI A;  4GNX B;  1K8O A;  3NQT A;  1BR9 A;  3J81 c;  1XNR Q;  1PZK D;  2I5M X;  4RKL A;  2QF7 A;  2I5L X;  1I4R A;  3BZD B;  3MFG A;  4JI3 L;  2UUC Q;  3VA5 A;  2L0C A;  1PH8 A;  1CHQ D;  1MJE A;  3PGZ A;  3PUZ A;  5DM7 3;  2RVL A;  4X3S A;  2VB3 X;  5CMD A;  2PQE A;  2A5H A;  4BY1 H;  4IFD G;  4KD4 A;  2AKW B;  4R1J A;  1EY8 A;  3M3Y H;  2HD3 A;  3CCV A;  2EZV A;  2PQA B;  3M7G A;  4JV5 Q;  2Q2U A;  4CHT B;  1K83 B;  5IY0 A;  2MUY A;  4K6D A;  2EYL A;  4B3T L;  4BXX G;  4KV6 A;  3QOJ A;  1U4R A;  1I4X A;  2K5Q A;  1QB5 D;  2Z6K C;  2BOS A;  4NB3 A;  3VDY A;  3X3N A;  1WTP A;  2R7Z B;  2C9O A;  4NXM L;  1Z7T A;  3AFP A;  3RR5 A;  3M4O B;  2FMC A;  4RGM A;  3CC4 A;  3T51 B;  3L2P A;  5I6Y A;  2ZTD A;  5FO8 B;  1EQT A;  2IPK D;  1OXS C;  5M5Y H;  1SFO B;  2A8V A;  2IX1 A;  2DY7 A;  3I55 A;  3S17 B;  1TY0 A;  5KNB A;  4KY7 A;  3PO2 G;  3MXP A;  5ELC A;  4C56 C;  4FF2 A;  1X32 A;  3EJI A;  3ND9 A;  2M2L A;  2X6G A;  4A3D G;  2KHI A;  3BVZ A;  3FPU B;  4BS9 A;  1PH6 A;  5IYD G;  1LTI D;  1X6O A;  2YU9 H;  1GXD C;  4DR7 L;  5EPJ A;  1RHP A;  2MHV A;  2X6L A;  4R4C A;  2MFI A;  2EYP A;  4ILW A;  1LTL A;  3I70 A;  5J1Z A;  1IXR A;  4A3K B;  1A6X A;  1I6V C;  4L8J A;  3RZD B;  1TWH H;  2K5W A;  4LWC A;  2KUM A;  4HCE A;  1A3V A;  1BCP C;  1C4Q A;  2EJF C;  2GA4 B;  2JE6 I;  2J7Z A;  1C7Y A;  5NUC A;  3S2D B;  1CKN A;  1VQ7 A;  1QWY A;  3CME A;  3GTG H;  4P73 A;  2CW0 C;  2N88 A;  2B3G A;  2DJG C;  4P74 A;  2E2J B;  1NE3 A;  4BXX H;  5LMU Q;  1XMQ Q;  2XGT A;  2KHS A;  3DWA A;  3FKI G;  4B9X A;  3A5Z B;  2J0T D;  1GUO A;  2HCI A;  1UWV A;  1A2U A;  4LUO A;  5KYI A;  5M3M G;  2UXB L;  1T9H A;  1X56 A;  1LT5 D;  4IPH A;  5M3F G;  3MVV A;  2ZT9 C;  3NP8 A;  1CT1 D;  1EWC A;  1S40 A;  3NE5 B;  4GN3 B;  3J80 L;  1LT3 D;  3L0O A;  4R9W A;  5JJK A;  4V0B A;  3TRE A;  3L3O C;  1E7Z A;  4LJZ C;  4GNX A;  3UDX A;  1EY9 A;  2NTT A;  1BOS A;  4H44 C;  1IBM Q;  4EX5 A;  1SE8 A;  3OIQ A;  1FNU A;  4IUV A;  1CKM A;  4YWK A;  2HQL A;  3G7L A;  3RZO H;  4DV2 L;  2E2D C;  2HDM A;  3GTK B;  5FO9 B;  4DR4 Q;  1FD7 D;  1R9T H;  2KED A;  4RFB A;  4LFA L;  4J15 A;  2MGS A;  2EYJ A;  1NMG A;  4DU9 A;  1RIP A;  1CK1 A;  4GKK L;  4H02 A;  2OQK A;  4JI8 L;  3KDF B;  2UXD Q;  1HXY D;  3CCU A;  4A3F B;  1D5M C;  1ENF A;  1PMR A;  2FXQ A;  1F9R A;  3K58 A;  3D0F A;  4JBM A;  1W6K A;  5KEE A;  4YHH L;  5M5W B;  4DR7 Q;  4OX9 L;  4LNQ A;  3CCE A;  3OSO A;  1XTC D;  1JT8 A;  1E3P A;  3NTI A;  4DV3 L;  3CF5 A;  4DV1 Q;  2H1E A;  5T1I A;  4JOI C;  3VYS A;  3PQI A;  3J80 c;  1SYF A;  1STG A;  2XTI A;  3MXG A;  2F0S A;  2PW5 A;  3CCR A;  4JI0 Q;  2PW7 A;  1PFS A;  5JEA J;  2HUG A;  4K8I A;  4X65 L;  5JVG 3;  1A3T A;  2XN9 C;  3S2H H;  3CAM A;  1HA5 A;  3AMU A;  1S5F D;  4KY6 A;  1AFP A;  1SMY C;  4TSS A;  4C3H G;  3S1M H;  3PMF A;  3TN2 A;  4DXG A;  3IFD A;  3S24 A;  4OXP A;  1WCM B;  2NUC A;  4OIJ A;  1G2T A;  2F4V Q;  2N8N A;  4IUN A;  1N34 Q;  1HTP A;  1BO0 A;  2SEB D;  3J7A V;  2F52 A;  1NAP A;  4OHJ A;  1ASZ A;  3S2D H;  4HED A;  3J7Z C;  4A76 A;  3R2I A;  1GUW A;  4X3U A;  4HSV A;  1DOK A;  4JYA L;  3GTO B;  1HUN A;  2KEN A;  1SYD A;  1EYG A;  3AB9 A;  4RKB A;  3F8T A;  1FR3 A;  4JW0 A;  4XQJ A;  1B9M A;  2HIV A;  1XXG A;  1EY5 A;  4A3E G;  2B2W A;  1DGS A;  1SYG A;  4JI7 Q;  1ENC A;  3T1Y L;  4IOC A;  1Q8I A;  2CFM A;  3BZC A;  5IP9 H;  1RDP D;  2VQF L;  1PDQ A;  4A3B H;  1XMO Q;  2PI2 A;  1DM0 B;  1ENA A;  5EQ0 A;  5EKL A;  4CJ2 C;  1I5F A;  4IJL A;  2A6E D;  1SYC A;  2KHJ A;  3VR6 A;  4CJ1 B;  1LUZ A;  4GLX A;  3GO5 A;  4KY5 A;  3RZD H;  3F2D A;  2I07 B;  1MBY A;  1GM5 A;  5KRU A;  1J5E L;  5CC4 A;  5IYD H;  1B44 D;  5D65 A;  1AZQ A;  1EYD A;  4J8Q A;  2PO4 A;  1F2Y A;  4DR1 Q;  1HNZ L;  2H4O A;  1IBM L;  2TSS A;  1KDC A;  2QW7 A;  2R7Z H;  3KBG A;  2Y0S B;  1VF7 A;  2LFN A;  1MIU A;  1PFM A;  3C46 A;  2NVY H;  4ZUI A;  3R2T A;  4DFA A;  3PF5 A;  1KTK A;  1L1O C;  4C1N I;  1SEB D;  2I0Q A;  1K83 H;  5AJ3 Q;  1PH3 A;  2R61 A;  1VQM A;  2CVR A;  2F0N A;  4JI6 L;  5M9O A;  3HOX G;  1SFO H;  2IHF A;  4KJO A;  3K7A H;  2OCE A;  2VZA A;  4BY7 B;  2B2T C;  5IYC H;  4MIU A;  5LMU L;  4IOA A;  1Q90 A;  1KXL A;  4ZKB B;  3V96 A;  5CBA E;  2Q8T A;  4DR1 L;  3EVQ A;  2A68 C;  2MNA A;  3MA2 B;  1WYD A;  3HP3 A;  3QR8 A;  1VQA A;  3E3X A;  4A3B G;  1Q8K A;  3M3Y B;  4JI8 Q;  4EQO A;  1BVS A;  2PYK A;  5E3F A;  2QIL A;  3VYR A;  4KHZ A;  4X64 L;  1HQR D;  4E6I A;  1XJV A;  1S3O A;  3U9O A;  5I6W A;  1CQF A;  1KNE A;  2VXW A;  2Q2I A;  1QUQ A;  4LK1 C;  4LFA Q;  2JSO A;  3J81 i;  1XPU A;  4DR5 Q;  4WJ4 A;  4C3I G;  2LSS A;  1AZP A;  5C3X A;  2L9H A;  4OWX B;  2F0J A;  1IW7 D;  1N32 Q;  3I91 A;  1EY0 A;  4WJ3 M;  3T1H Q;  4MTN A;  3LX0 A;  5FKA C;  1DZ1 A;  1ZYR C;  4XDX A;  1BBX C;  4DV7 L;  2XWJ B;  5IOD A;  3M85 A;  3GTP B;  1N36 Q;  1TII D;  3QOL A;  3KYH C;  4KTA A;  2L55 A;  1JOK A;  4R4T A;  4DA2 A;  1JIC A;  4P72 A;  2RSO A;  1NJI C;  1PRT C;  2MO0 A;  5JJZ A;  1IBK L;  4APV A;  3J81 j;  4AQY L;  2KCC A;  4X3K A;  3U4V A;  1QZH A;  4DV2 Q;  3KF8 B;  1IKL A;  2SNS A;  2KEC A;  5E1F A;  1K9M C;  3D4D A;  1TKW B;  5CGK A;  4FXG C;  4QIW B;  4N9P A;  3GTG B;  4RWS C;  3Q22 A;  4DR6 Q;  4HJ7 A;  5DLQ E;  1LLR D;  2QEX A;  3QG1 A;  5D3D A;  1YJW A;  2ZJQ A;  1RTN A;  2HDL A;  4POF A;  1EU3 A;  4L6T B;  4F88 A;  3CC7 A;  1AE3 A;  2YYZ A;  1I4G A;  2OF1 A;  3RNU A;  2B2Y C;  3DWQ A;  2K33 A;  1V8Q A;  2B2V A;  5C44 G;  2WIN B;  1XMQ L;  2QKI C;  4CDC C;  2JEB I;  1WTX A;  4ZLT F;  5FO7 B;  2D0P A;  1M8A A;  2LXJ A;  2NVX B;  1LTB D;  4IJH A;  3PIP A;  2BA0 A;  4Y7N B;  1HR0 L;  3HOU B;  1AW7 A;  2MJ8 A;  1VMC A;  3HOU H;  2K75 A;  2JA7 G;  3GTJ H;  5C3E H;  4H13 C;  3PIP 3;  4A3B B;  3R8B A;  4L5R C;  5A2Q E;  1WOC A;  3CCJ A;  4QY7 A;  4A93 B;  1X65 A;  3KDF A;  3NWT A;  4DNI A;  3WOE A;  2ID0 A;  3G48 A;  4KKT A;  1FL0 A;  3CXC A;  2B2U A;  4EGV A;  4FDB A;  3S14 H;  1GUT A;  3D3R A;  3L9A X;  3WDN A;  2EE1 A;  2I5H A;  4PG3 A;  3E5S A;  4FXK C;  1UAP A;  1II3 A;  3J7Y W;  3NBH B;  5M3F H;  1FGB D;  2PNR C;  2SDF A;  1F2M A;  1SAP A;  2JA5 G;  2VQE Q;  3NBI A;  3TDQ A;  4YWL A;  2KBN A;  2NTS A;  1YNJ D;  2A6H C;  2IY5 B;  2EYM A;  1P8L A;  1EFW A;  3I8Z A;  5C4H A;  1OO9 B;  3I73 A;  3OTO L;  3DEO A;  3M4O H;  1KNA A;  1LTA D;  4K0K Q;  4A3L H;  1F9S A;  2BA1 A;  3TBI B;  3OMC A;  4HR7 B;  2B63 H;  5JJI A;  2SNM A;  3PUV A;  2NZ1 D;  4ZYS A;  2B2T A;  1RKN A;  1Y1W B;  2JK8 A;  4KLK A;  3HOV H;  4LF7 L;  3T53 B;  1L2F A;  2VNU D;  5FJ8 H;  3T13 A;  1WTO A;  2VW9 A;  4UDU C;  3NEM A;  2NWG A;  1N32 L;  3U4Z A;  1CFM A;  1EIY B;  2UXD L;  3K57 A;  1YJ9 A;  1O7L A;  4A3J G;  1HZA A;  3ER0 A;  1KLU D;  3KLR A;  1K73 C;  3NXW A;  5FLM G;  1UEB A;  3VR5 A;  5C0X J;  4DV1 L;  3HOZ B; 
#chains in the Genus database with same CATH homology
 4NPS A;  1NY4 A;  4A3D G;  2KHI A;  4DAM A;  1E1O A;  4BBR H;  1PH6 A;  4Y7N H;  5IYD G;  4DUZ Q;  4DR4 L;  3FHW A;  4GS3 A;  2UU9 Q;  4C2M H;  1IBL L;  3CD6 A;  2CQO A;  1VQC A;  1B8A A;  3BJU A;  4X62 L;  3M7N A;  1X6O A;  4OO1 I;  4LF9 Q;  3F1Z A;  4NXN L;  4A3K H;  1L1O B;  2YU9 H;  2IX0 A;  3PO3 G;  4DR7 L;  3A74 A;  5IWA Q;  1SRU A;  2CKZ B;  1VS0 A;  2E8G A;  4ME3 A;  1KRS A;  1OXV A;  4B3T Q;  1VQ6 A;  2R92 G;  2V1C C;  3KLW A;  4R4C A;  3KJP A;  2MFI A;  2OTL A;  4GOP C;  1LTL A;  4JI1 L;  1IXR A;  3HOY G;  3UE0 A;  1Q81 C;  4DUZ L;  1TWH H;  4LWC A;  4HJ9 A;  4ALP A;  4AQY Q;  4QJF A;  2OTJ A;  1C9O A;  1S72 A;  1EUJ A;  1W2B A;  1X54 A;  2JE6 I;  2OQ0 A;  4JBJ A;  3S15 H;  1UE1 A;  3PUW A;  2HHH Q;  4X65 Q;  4YY3 L;  4JI6 Q;  1C7Y A;  3HOU G;  3HOW G;  4JI0 L;  3PUY A;  1PH7 A;  1JE5 A;  2WAQ E;  4IFD J;  1CKN A;  1PHJ A;  1VQ7 A;  2B63 G;  3CME A;  3S17 H;  2GVB A;  3HKZ G;  1WCM G;  4P73 A;  3GTG H;  2B3G A;  1YHB A;  1VQK A;  3FP9 A;  4P74 A;  3F2B A;  1NE3 A;  4BXX H;  3CQZ H;  3AYH B;  5LMU Q;  1XMQ Q;  2XGT A;  1IBL Q;  4A3C H;  4A3E H;  1Q1B A;  3FKI G;  4O0A A;  3A5Z B;  1OXU A;  2JA7 H;  1FGU A;  3U50 C;  4HIK A;  4OX9 Q;  3I4N H;  1UWV A;  4DR3 L;  1Y1W G;  1A0I A;  2NVQ H;  3RLN A;  1WFQ A;  4LUO A;  1SLJ A;  3TRZ A;  5M3M G;  2UXB L;  1T9H A;  1X56 A;  4IPH A;  5M3F G;  4X6A H;  4R4Q A;  3K7U C;  5JEA G;  1Q46 A;  1UE6 A;  3JC6 6;  3M4Q A;  1JMC A;  2ASB A;  1OXT A;  2YTV A;  1A8V A;  3W1G A;  1VQJ A;  4X64 Q;  3RN5 A;  1S40 A;  4JBK A;  4GN3 B;  2R6G A;  2WP8 J;  3L0O A;  3GTQ H;  5JJK A;  1H95 A;  3TRE A;  1XNQ Q;  1C0A A;  1TWG H;  2JA9 A;  1E7Z A;  2LXK A;  5IYC G;  4GNX A;  1IZ6 A;  1YIT A;  3UDX A;  2JA8 G;  3LGJ A;  1SMX A;  2JA8 H;  1E1T A;  1IBM Q;  4LF8 Q;  4EX5 A;  4OON A;  1SE8 A;  5IP9 G;  1HR0 Q;  1CKM A;  4YWK A;  2HQL A;  4PMW A;  4JI2 Q;  1HZB A;  4JI7 L;  4YCV A;  3PO3 H;  2KCM A;  3CW2 C;  1XNR L;  2R7D A;  2UUB L;  3RZO H;  5GQO A;  5BR8 Q;  4DV2 L;  2IT1 A;  3SGI A;  4LF6 L;  5LMN Q;  4DR4 Q;  1TWF H;  2F3I A;  4P75 A;  3UDF A;  2JA6 G;  1VQP A;  1R9T H;  1EQQ A;  1E24 A;  4B3S Q;  1KQS A;  4J15 A;  4EQ5 A;  3H15 A;  4AH6 A;  1OXX K;  4LFA L;  2HHH L;  3S16 H;  1YZ6 A;  4L5T A;  1NMG A;  1SRO A;  3NEN A;  2VY3 A;  1VQL A;  2Q2T A;  2Z6K A;  4IPD A;  1RIP A;  2B29 A;  1X9N A;  2UXB Q;  4GKK L;  1JJG A;  4LUZ A;  4H02 A;  1MJC A;  1PH2 A;  4YCU A;  3TEH B;  4HJA A;  4JI0 Q;  2OQK A;  2K4K A;  2D0O A;  2NZO A;  3K0X A;  4JI8 L;  5FLX c;  3KDF B;  3CCM A;  1CKN B;  4JI1 Q;  4DV6 Q;  2UXD Q;  3CCU A;  1QZG A;  5AJ3 L;  4B3R L;  1OTC A;  4JG2 A;  5EAY A;  4B3M Q;  1WI5 A;  4DK3 C;  2FXQ A;  3A0J A;  3D0F A;  4JBM A;  4YHH Q;  2EQS A;  4YHH L;  4JOI A;  4KI0 A;  4NXN Q;  4DR7 Q;  4OX9 L;  1KC8 C;  4LNQ A;  4DV5 Q;  4HIO A;  3CCE A;  4LW1 A;  4C3I H;  3TQY A;  1E3P A;  1TXY A;  4DV0 Q;  1JT8 A;  1I3Q H;  4DV3 L;  3CF5 A;  4DV6 L;  4OWT B;  1EOV A;  2ZM6 L;  4DV1 Q;  4KHP Q;  2PNH A;  1GVP A;  3RN2 A;  4OWW B;  4BY7 G;  1J5E Q;  4A3L G;  1LYL A;  4C3J H;  4JOI C;  3J80 c;  1XNQ L;  2XTI A;  4DK6 C;  1SR3 A;  1TWC H;  1V1Q A;  4XIG S;  4BY1 G;  3CCR A;  1XTD A;  4LUV A;  4DUY L;  4DV7 Q;  1PFS A;  2EXD A;  4QIW E;  5JEA J;  1O7I A;  4X65 L;  3KJO A;  4BA2 I;  4BBR G;  3I56 A;  5HY6 A;  1PH5 A;  4BBS G;  3S2H H;  1Q7Y C;  3CAM A;  5IP7 G;  3M9B A;  2C35 B;  3U58 A;  5C4J H;  1VQO A;  1HR0 W;  1FJG Q;  2ZM6 Q;  4IPC A;  1YVC A;  2BH8 A;  1PYS B;  1PH4 A;  3S1M H;  1V43 A;  5LMN L;  4DAY B;  4JI5 L;  3KF6 B;  4JI3 Q;  4L5Q A;  3S24 A;  4OXP A;  5IWA L;  4DR5 L;  3IRB A;  2F4V Q;  2N8N A;  4JC0 A;  1N34 Q;  3E9I A;  2AHO B;  4A3J H;  4A3G G;  3ERS X;  4PZ6 A;  2F52 A;  4XTC S;  1VQ4 A;  1U5K A;  1ASZ A;  3FKI H;  5C0X I;  3I4M G;  3S2D H;  1N9W A;  3I4M H;  3J7Z C;  4A76 A;  5FLM H;  1EIF A;  1BKB A;  4JYA L;  1UE5 A;  5M3M H;  2WB1 E;  4X66 Q;  1Z47 A;  2KEN A;  1HNW Q;  2H5X A;  1EYG A;  3F8T A;  3GDE A;  4DV5 L;  2E5L L;  2N78 A;  2WB1 G;  3I2Z A;  1TWA H;  5M5X H;  2F4V L;  2HIV A;  4JI2 L;  5GRO A;  4PZ7 A;  1JJC B;  4A3E G;  3GTP H;  1DGS A;  4TQU S;  1K8G A;  4JI7 Q;  1QVC A;  1X55 A;  3T1Y L;  3GD7 A;  1I94 L;  3M4P A;  4IOC A;  1CKO A;  2CFM A;  2YTY A;  1IBK Q;  4A93 G;  3BZC A;  4DPG A;  5IP9 H;  3KF6 A;  2VQF L;  4A3B H;  1HNW L;  3RLO A;  3BU2 A;  1XMO Q;  4JV5 L;  2R93 H;  5K36 G;  2PI2 A;  3CC4 A;  2E5L Q;  3G71 A;  3PUX A;  1Y1V H;  1YJN A;  1JJ2 A;  1I5F A;  2PQA A;  4IJL A;  2KHJ A;  4GLX A;  4A3M G;  1LUZ A;  3W1B A;  3GO5 A;  5LMN W;  5H1S E;  1KAW A;  3F2D A;  3RZD H;  1M1K C;  1GM5 A;  4BA1 I;  2E2H H;  3HKZ E;  2VS1 A;  2UUB Q;  3MXN B;  5GAE C;  1J5E L;  5IYD H;  3K80 C;  1XPR A;  2WAQ G;  1VQD A;  3EBE A;  4Y52 H;  1Q12 A;  2RF4 A;  1CSQ A;  2VQE L;  4B3S L;  4DR1 Q;  1HNZ L;  2HT1 A;  1IBM L;  4DR2 Q;  4C3H H;  2N3S A;  1HNZ Q;  2R7Z G;  3E0E A;  1FVI A;  2R7Z H;  2ATW A;  3CC2 A;  2ZTC A;  3PIO A;  2YV5 A;  1HZ9 A;  1HH2 P;  1UE7 A;  1MIU A;  3PSI A;  4AIM A;  2QA4 A;  1QVG A;  2Y0S G;  1IL2 A;  3ICE A;  2NVY H;  3Q8D A;  2K5H A;  4JCV E;  1P16 A;  3PF5 A;  1L1O C;  4UP8 A;  1L0W A;  2PMZ E;  1K83 H;  4GLA C;  1Y1W H;  2I0Q A;  5AJ3 Q;  4B3R Q;  1PH3 A;  4JI4 L;  1VQM A;  3CPW A;  3TS2 A;  4JI6 L;  4LF5 Q;  3OW2 A;  3HOX G;  3L7Z C;  2IHF A;  5C3E G;  4HJ8 A;  1SFO H;  4DR3 Q;  3UDI A;  3K7A H;  3HOZ G;  4BY7 H;  1Y14 B;  2OCE A;  1Y1V G;  3WWV A;  2VZA A;  4DV0 L;  3J80 i;  1Q86 C;  2E2I H;  1Z9F A;  1PA6 A;  4KHP L;  5IYC H;  3OYY A;  2ES2 A;  5GAD C;  4A3F G;  5LMU L;  1HNX L;  3JAM i;  1AE2 A;  2D62 A;  3D31 A;  1HZC A;  1BBW A;  2RHS B;  4UY8 C;  4IOA A;  1KXL A;  4HID A;  5FJ8 G;  5C0X G;  1V9P A;  4A75 A;  4UP9 A;  5IP7 H;  5M5W H;  1K8A C;  1Q1E A;  4DR1 L;  4LF9 L;  2MNA A;  3I4O A;  3HOV G;  1YBY A;  1WYD A;  2R7F A;  3PV0 A;  1VQG A;  5C4X H;  4HIM A;  4LF4 L;  4LFB L;  1E22 A;  1VQA A;  5JJL A;  4A3F H;  4A3B G;  1Q8K A;  4LFC Q;  4JI8 Q;  1VQB A;  1BVS A;  2ZJP A;  1K0R A;  1GD7 A;  4X64 L;  4KHZ A;  4RG1 A;  3H3V I;  2A19 A;  2E2J H;  5J3B A;  1XJV A;  1S3O A;  2UUA L;  4DR6 L;  4K0K L;  4JI4 Q;  4MZ9 A;  2Q2I A;  1QUQ A;  4DV4 L;  2JJQ A;  4JBW A;  2JQO A;  4LFA Q;  3G6E A;  2K5N A;  1VQH A;  2EIF A;  2NN6 G;  5ELO A;  3J81 i;  1VQ9 A;  4LF5 L;  1HJP A;  1XPU A;  2L15 A;  1G51 A;  1B7Y B;  4JYA Q;  4DR5 Q;  3ZJY C;  5ELN A;  4LFB Q;  1EWI A;  1VCI A;  3CCL A;  2Z0S A;  2LSS A;  4WJ4 A;  3NEL A;  4LFC L;  5GAG C;  2VUM G;  3F2C A;  1G6P A;  1GKH A;  4OWX B;  1LM0 A;  1X3E A;  4A3I G;  3GTM H;  1N32 Q;  4GOP B;  1HNX Q;  5BR8 L;  1N8R C;  4WJ3 M;  2HIX A;  3AFQ A;  1N33 Q;  2BH2 A;  3T1H Q;  1I94 Q;  4B3M L;  1YHA A;  4MTN A;  4A3G H;  3E9H A;  1WJJ A;  3H0G H;  5IE8 A;  3M85 A;  4DV7 L;  4R4I A;  1N36 Q;  4GLV B;  4IFD I;  3KYH C;  1XPO A;  3S1Q H;  2K5V A;  3KFU A;  1J6Q A;  2CWP A;  4R4T A;  4A93 H;  4GKJ L;  1W3S A;  1NMF A;  4GKJ Q;  1IYJ B;  1VQE A;  4IO9 A;  2ZJR A;  3K81 C;  4P72 A;  3A5U A;  3CCQ A;  3HOY H;  1PVO A;  1NJI C;  3GTK H;  2MO0 A;  1KL9 A;  2AWN A;  4APV A;  1IBK L;  3J81 j;  4AQY L;  5C44 H;  3GTO H;  3U4V A;  3T1Y Q;  1QZH A;  4DV2 Q;  4LF6 Q;  3H3V H;  3KF8 B;  5IYB H;  1K3R A;  1D8L A;  1K9M C;  1ASY A;  2NVX H;  4YWM A;  4DR2 L;  1N36 L;  1XMO L;  4A3D H;  2MO1 A;  1YEZ A;  3HOW H;  2VL6 A;  2K50 A;  4DV3 Q;  1KRT A;  4UP7 A;  1WCM H;  3K8A A;  3CMA A;  2R93 G;  2AMC B;  1FJG L;  4OO1 G;  3OTO Q;  3EN2 A;  1YHQ A;  1I6H H;  1NTG A;  4P71 A;  2QGQ A;  5C4X G;  1PV4 A;  1PH9 A;  2UUA Q;  4QL5 A;  4L5S A;  4DR6 Q;  3HFZ B;  4HJ7 A;  3S1R H;  5DLQ E;  2QEX A;  4A3C G;  1VQN A;  1PH1 A;  3TS0 A;  1YJW A;  3ULL A;  2CWA A;  1VQ5 A;  2K52 A;  2ZJQ A;  4GN4 B;  1BBU A;  4POF A;  4TVA B;  1A63 A;  3CC7 A;  2ALY B;  3S1N H;  1AE3 A;  2YYZ A;  1KD1 C;  2YTX A;  4AYB E;  4GNX C;  1Q82 C;  2KCT A;  4GKK Q;  1VQF A;  3RNU A;  4A4I A;  3KOJ A;  1N33 L;  2UXC L;  5C44 G;  3I7F A;  1XMQ L;  4JI5 Q;  2NVT H;  2RCN A;  2A1A A;  2UU9 L;  2OWO A;  2JEB I;  1L1O A;  1VQI A;  3CPF A;  1KHI A;  2D0P A;  4QGU A;  1X3G A;  4HJ5 A;  2LXJ A;  2DGY A;  4LF7 Q;  2WFW A;  4IJH A;  2NN6 I;  3PIP A;  3UDG A;  2BA0 A;  3STB D;  2JA6 H;  1HR0 L;  2N49 A;  3H0G G;  4UPA A;  3HOU H;  2K75 A;  2JA7 G;  3GTJ H;  4AYB G;  4DKA C;  5HGQ A;  5C3E H;  3I4N G;  3HOZ H;  4X66 L;  3PO2 H;  4L5R C;  2PI2 E;  1WOC A;  3CCJ A;  4QY7 A;  3MEF A;  1X65 A;  3KDF A;  4GN5 A;  3W5O A;  4A3M H;  4DNI A;  1B70 B;  4DUY Q;  1YIJ A;  1CUK A;  4PZ8 A;  2ID0 A;  2K14 A;  3G48 A;  1FL0 A;  3CXC A;  1QUQ B;  3STB C;  4FDB A;  3S14 H;  4RMF A;  1PYB A;  3RLF A;  3G4S A;  1QVF A;  4BBS H;  1N34 L;  2I5H A;  3PCO B;  4PG3 A;  2GVA A;  3AEV A;  4LF4 Q;  2NZH A;  4GNX B;  4R4O A;  4A3K G;  3J81 c;  1D7Q A;  1XNR Q;  4NXM Q;  2I5M X;  4POG A;  3JAM c;  3NBH B;  2I5L X;  3ULJ A;  4YCW A;  5M3F H;  1CSP A;  3T1H L;  2UUC Q;  4JI3 L;  2JA5 G;  5IT9 c;  2VQE Q;  1EQR A;  4DV4 Q;  3UE1 A;  1SN8 A;  4YWL A;  1YI2 A;  4IPG A;  1PH8 A;  2KBN A;  1AH9 A;  1MJE A;  2GN5 A;  3CP0 A;  3PGZ A;  3PUZ A;  4LF8 L;  2JEA I;  2IY5 B;  1I50 H;  1P8L A;  2AWO A;  4BY1 H;  1EFW A;  4QQB X;  4IFD G;  3J7A 5;  2AKW B;  1A62 A;  3HOX H;  4R1J A;  1RL2 A;  3OTO L;  3M4O H;  1G29 1;  3M3Y H;  4K0K Q;  4A3L H;  2BA1 A;  3CCV A;  2UUC L;  2PQA B;  2B63 H;  3DM3 A;  5JJI A;  4JV5 Q;  3PUV A;  2Q2U A;  1MKH A;  4O2D A;  2VQF Q;  2RHQ B;  5IY0 A;  2JK8 A;  4KLK A;  4GOP A;  3HOV H;  4B3T L;  4BXX G;  4LF7 L;  2VNU D;  1L2F A;  2CCZ A;  2R92 H;  2UXC Q;  1NBW A;  3BZK A;  5FJ8 H;  1X3F A;  2VW9 A;  2DUD A;  3EIV A;  3NEM A;  3ULP A;  2Z6K C;  1N32 L;  5IYB G;  4NB3 A;  3VDY A;  2IHE A;  3U4Z A;  5E7N A;  1EIY B;  4NXM L;  2UXD L;  3RR5 A;  3AFP A;  1YJ9 A;  1VQ8 A;  2Q2H A;  1U0L A;  4MNO A;  4X62 Q;  1YNX A;  3CCS A;  1HZA A;  2Y0S E;  3ER0 A;  3L2P A;  4A3J G;  1KIX A;  2ZTD A;  1JB7 A;  1GO3 E;  1K73 C;  2JA5 H;  3PF4 A;  3B6Y A;  3HKS A;  1M90 C;  3DLL A;  2ZTE A;  1OXS C;  5M5Y H;  2A8V A;  5FLM G;  4YY3 Q;  3GTL H;  2IX1 A;  3I55 A;  1UEB A;  3PO2 G;  2MQH A;  5GAH C;  5C0X J;  4DV1 L;  2VUM H;  3AQQ A;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...