2UXDQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxdQ00
4HJ7A 3ZJYC 4X62L 2E5LL 4DV5L 2RHQB 4OONA 3I4OA 2OQ0A 3CQZH 1VQ9A 4HIDA 4B3TQ 2EIFA 2Q2HA 2ZJPA 4JI6Q 4MNOA 2FXQA 3M4QA 2YTXA 1QVFA 1XMOL 2ASBA 3GTMH 3STBD 4DR4Q 2YTVA 4BBSG 1HNXQ 3RN2A 5IYCG 4P75A 2R6GA 3Q8DA 5GAHC 2HT1A 4XTCS 4POGA 3HKZG 2Q2UA 3HOXG 2R7DA 1RIPA 2YU9H 4B3ML 4MTNA 5ELOA 1XMQL 1X9NA 4JI7Q 1KD1C 4YCVA 1Q82C 4OO1G 1A0IA 3GTLH 1LM0A 5LMUQ 1XJVA 3CPFA 2RHSB 1Q81C 2I0QA 4GKKQ 3B6YA 4DV4L 1PFSA 4BA1I 3GD7A 3DM3A 1VQ8A 3KF6A 2K75A 2L15A 4LW1A 2B3GA 2KBNA 2ZM6L 4DUYQ 1Y1WH 3A0JA 3CW2C 4C3HH 3CCJA 1SFOH 3I4MH 3OTOL 1PH5A 5IP9H 3S1MH 1YBYA 4X65L 3RNUA 1VQBA 4LF4L 3HOZH 1PH8A 5M3FH 3GTOH 3H3VI 4A93G 1RL2A 1KRTA 1FVIA 1XMQQ 4BBRG 2JA6G 4YCWA 1A63A 4KHPQ 4JI0L 1HNWQ 1KIXA 1VQMA 4NXNQ 1I6HH 3S24A 4JI2Q 1B70B 1UE6A 2WFWA 2PI2A 1Y14B 3TEHB 5C0XI 5LMNQ 2K5HA 4JI1Q 3UDGA 4A3JH 2NVXH 2D0OA 1Q7YC 1KQSA 4DR7L 4FDBA 1MJEA 2ZM6Q 3JC66 4YWKA 4DUYL 1OXUA 1I5FA 1VQ5A 2N78A 2F4VQ 2JJQA 4JYAQ 2PNHA 3CCRA 1K9MC 4DK6C 1YI2A 4JI3L 4EX5A 2CWAA 3CC4A 2ZTCA 4IPCA 4BY1G 5JEAJ 2E2JH 4JI8L 4GOPB 1VQ7A 3EBEA 1E1TA 1SE8A 3W5OA 3BZCA 2MQHA 2Z6KA 4HJAA 1K8GA 2QGQA 2UXCQ 2RCNA 4A3FH 3U58A 3ERSX 2AMCB 2JA7H 1I3QH 3OYYA 4GKKL 2LSSA 4R1JA 3ULPA 1L1OC 5C3EG 2OQKA 4K0KQ 4GOPA 5GAEC 1GD7A 2UUAL 5C44G 2OTLA 4IOAA 1K83H 4R4IA 3RLOA 4APVA 4R4OA 3CC2A 4DR5L 1IBLL 1NY4A 1XTDA 2ZTEA 3T1YL 4LF4Q 3HOWH 5K36G 1Z47A 4A3IG 4LFCQ 1E3PA 1U5KA 1IXRA 2JE6I 4IJHA 3PUWA 3UDIA 5IYDG 1XNQL 4A3GG 3ER0A 1SLJA 3HKSA 2AKWB 3G71A 1KL9A 3T1HQ 2VQEQ 4LUZA 3M7NA 2N3SA 3I4NG 1JJ2A 4LFCL 5C4JH 4NXML 5C4XG 3CXCA 3M4PA 4DR1Q 1K3RA 4LF8Q 1VQAA 4LUOA 1AH9A 1PH7A 2R92G 3PF5A 2MO1A 4X64Q 3HOUH 1VQFA 3A5ZB 1S40A 1YVCA 4JBWA 2JA8G 4GNXB 2ATWA 1L2FA 2PQAA 2CFMA 3JAMc 1UEBA 1CKOA 4PZ7A 4RMFA 4JBJA 3SGIA 3F2DA 1PA6A 5EAYA 2E5LQ 3PUXA 3PF4A 4LFBQ 3G48A 1Q1EA 5AJ3Q 1EIYB 4L5SA 2VNUD 1HZAA 1PHJA 3PGZA 1DGSA 1G291 3UE0A 5C0XJ 4LUVA 5M5XH 2BH8A 4KLKA 1V9PA 4UPAA 3M3YH 3D0FA 2NVTH 4AYBG 4A3BH 1Y1WG 2VUMG 3I4MG 3HOVG 4DV3L 1UE1A 1VQCA 3K7AH 3KJPA 3PUVA 4A3DG 2GVBA 4OWTB 3CCQA 3M9BA 1U0LA 1VQPA 3LGJA 1ASZA 3CF5A 4GN4B 1B8AA 2K4KA 1S3OA 2OCEA 2AWOA 2UUCQ 4GKJL 2UXBQ 3K80C 3ULJA 4A93H 5GADC 4B3MQ 1EOVA 1TWGH 2UU9L 4OX9Q 3CD6A 4DV4Q 1W2BA 3J81i 4JCVE 2MNAA 2NVYH 3J81c 5LMUL 3H3VH 1OXSC 3IRBA 4PG3A 1L1OB 1X54A 4WJ4A 3TQYA 4HIOA 1VQIA 3A5UA 2VQEL 1C9OA 1AE2A 1B7YB 1A62A 1VQGA 1YHQA 2NN6I 1E7ZA 1HR0W 2UU9Q 3PIOA 1WYDA 4UP7A 2JEAI 3U4ZA 3GTPH 3HOYG 3FHWA 3S16H 4X64L 1YIJA 1I50H 4ALPA 4X66Q 2I5HA 5M3MH 3KJOA 1VQDA 4DR6Q 4X65Q 4MZ9A 2Z6KC 4UP8A 2IHFA 4IPDA 2GN5A 1KAWA 2R93G 4ME3A 2NZOA 3E9HA 1CSPA 1X3GA 4C3JH 1K73C 2JA5H 3CCUA 2Y0SG 4AQYQ 2LXJA 2JEBI 4DR7Q 5FJ8G 3PCOB 4A3FG 2IY5B 2RF4A 3G4SA 3CCLA 4LF7Q 2CWPA 4QIWE 2BA1A 2YTYA 3H0GG 4YCUA 3J80i 1VS0A 4BXXG 4IFDI 2MO0A 3AYHB 1TWCH 2IT1A 4RG1A 1P8LA 4AYBE 1FGUA 4HJ5A 1IBML 5C44H 1NJIC 1HNZQ 2K52A 3PUYA 2PI2E 4DUZQ 3KFUA 1Z9FA 1T9HA 2EQSA 3E9IA 3PO3H 4WJ3M 4BA2I 4A3IH 5JJLA 5FLMG 4A3LG 3KDFB 4JI6L 1EIFA 2YV5A 5J3BA 3TS0A 1YJNA 1M1KC 1TWFH 2KCTA 3G6EA 4A3GH 1FJGL 1HJPA 1TWAH 1Y1VG 4DPGA 4IO9A 5IY0A 4JI1L 4NPSA 2D62A 3TREA 3T1YQ 2JK8A 3STBC 4QL5A 4A3EH 5M5WH 4DR5Q 1LYLA 2R92H 1CUKA 2UUAQ 1VQEA 4GS3A 5JEAG 4L5RC 4LWCA 4P73A 1P16A 4JBMA 1N34L 4HIKA 1XPOA 1N36Q 3RZOH 1YJ9A 3GTJH 4IFDJ 5JJKA 2A1AA 1BBUA 2B63H 5ELNA 4YHHL 4DV3Q 4JI3Q 3UDFA 1I94Q 3DLLA 2CCZA 5IYCH 1IBKL 2N8NA 4GNXC 1UE7A 4DV7L 1VQLA 1TXYA 2HQLA 3E0EA 4JI5L 4A3KH 3HOXH 2AHOB 1VCIA 1Q8KA 5GROA 4L5TA 3I56A 3K81C 4DV2Q 2R7ZH 2UXDL 2Z0SA 2K14A 4DNIA 1HNXL 2R7FA 4OWWB 2Q2IA 5C4XH 4QGUA 4QY7A 1EUJA 1VQKA 5IP7G 1HNZL 2K5VA 1GM5A 2K50A 3F2BA 4DV0L 3S1NH 3KOJA 4IJLA 1HNWL 5IWAL 1XNRL 2JA9A 3PO2H 1LUZA 2F4VL 1IBKQ 4Y52H 1XPUA 4IFDG 5IYBG 1SR3A 4DAMA 1LTLA 2KHJA 4A3CG 5GAGC 4POFA 2AWNA 4GLAC 3RR5A 2ID0A 4HIMA 3J7A5 4BBSH 2WAQG 3S1RH 1BKBA 3OW2A 4JV5Q 5M3FG 3T1HL 3FKIG 1FJGQ 2VQFQ 3EIVA 1E24A 3S15H 3CMAA 3CCMA 3GTGH 1HZBA 4AH6A 4PMWA 2UXBL 1E22A 3CP0A 4DK3C 3U50C 1YEZA 5M3MG 1A8VA 3AEVA 3A74A 2BH2A 3PSIA 2R93H 4OXPA 2QA4A 4JG2A 4TVAB 5M5YH 4JI0Q 3PIPA 1JJGA 3L7ZC 1N8RC 5GQOA 2LXKA 3CMEA 1I94L 4P71A 5FJ8H 1EWIA 1OXVA 1SN8A 1QZGA 3CAMA 4YHHQ 3J7ZC 4BY1H 4DR4L 2A8VA 4QQBX 1D7QA 4A76A 4BBRH 1X56A 5DLQE 2ZJRA 1N33Q 2JA6H 3S1QH 4DAYB 4JI5Q 4YY3Q 1PH3A 4A75A 4DR2L 2ALYB 1MKHA 4DV5Q 3NEMA 3CC7A 4DV0Q 3CCVA 1VQ4A 1ASYA 4LF5L 1C0AA 1XNQQ 1PH2A 4KHZA 4A3JG 2WAQE 3FP9A 1YJWA 4YWMA 2KCMA 5E7NA 1IYJB 2WB1G 4H02A 3NBHB 4A3LH 5C3EH 1E1OA 3RLNA 1VQJA 3K7UC 4DV1L 5FLXc 4BY7G 3HKZE 3EN2A 1Y1VH 2XGTA 1EFWA 1WCMG 4GOPC 4IOCA 3GTQH 1HH2P 2A19A 3HOWG 4LFBL 4UY8C 4JI2L 1N36L 4LNQA 4OX9L 4DR2Q 3M4OH 1UE5A 3W1GA 4DV1Q 3K8AA 3PV0A 1SMXA 2UUBL 3J80c 2JA7G 1WJJA 1W3SA 1CKNA 2F3IA 4LF6L 1HZCA 2EXDA 2KENA 3H15A 3S2HH 4YWLA 2OTJA 4BY7H 1EQRA 4R4CA 1GKHA 4GLVB 4A3MG 1QUQA 2Y0SE 2MFIA 2YYZA 3OTOQ 1R9TH 3KLWA 1EYGA 3NENA 2HIXA 4NB3A 5IWAQ 2F52A 1XNRQ 4B3TL 2VW9A 1GO3E 1HZ9A 5BR8L 2JA8H 4OWXB 3KYHC 4GN5A 2I5LX 1N33L 3UDXA 2E2IH 2WP8J 2PQAB 1WI5A 2UUCL 1WFQA 1D8LA 4C2MH 5IT9c 3HFZB 4LF7L 1JE5A 3BU2A 3W1BA 1V43A 4B3SQ 4LF6Q 4NXMQ 5IYDH 3F2CA 1VQHA 2VS1A 1KXLA 5IP7H 4PZ8A 4NXNL 3F1ZA 2UUBQ 5JJIA 2GVAA 3L0OA 5BR8Q 4JBKA 1Q86C 4KHPL 3PO2G 1X3EA 2B29A 2NZHA 2JQOA 2NVQH 2IX1A 3I4NH 2HHHL 4A3BG 5IYBH 1S72A 4PZ6A 5LMNL 2BA0A 1O7IA 4A3DH 4A3CH 1KRSA 3GO5A 4DUZL 2IX0A 5AJ3L 1PH1A 1QZHA 1PYSB 1X3FA 2DUDA 2I5MX 1PH6A 1YNXA 2HIVA 1IBLQ 3I2ZA 3CCSA 3HOUG 4B3RQ 3FKIH 4TQUS 4DR3L 3AQQA 2ZJQA 1YHAA 2V1CC 4GLXA 4GKJQ 1YHBA 4XIGS 4AIMA 1YITA 1JJCB 1FL0A 1Q12A 2E8GA 2Q2TA 1G51A 1HR0L 4R4TA 5HGQA 1XPRA 4R4QA 3CPWA 1J5EQ 2VUMH 2WB1E 1IZ6A 3HOVH 3HOYH 1X6OA 4GNXA 2XTIA 4GN3B 3KF6B 4LF8L 3PUZA 1V1QA 5C0XG 1XMOQ 1CKNB 4LF5Q 4JI7L 4LF9Q 1GVPA 2N49A 2UXDQ 5H1SE 4JI4Q 1TWHH 1VQNA 4C3IH 4DV7Q 2VL6A 2NN6G 1HR0Q 2JA5G 4K0KL 1QVGA 2PMZE 5IP9G 4Y7NH 1M90C 4O0AA 1PV4A 3RN5A 1NTGA 5IE8A 4LF9L 4JI8Q 3HOZG 4DV6Q 4IPGA 1L0WA 3BJUA 3H0GH 4DR6L 1CSQA 1MJCA 1JB7A 4DV2L 3ICEA 4JOIC 4LFAQ 1J5EL 3TRZA 4UP9A 3AFPA 3S14H 4BXXH 4JYAL 3I7FA 1SRUA 1NE3A 1OXXK 1K0RA 2CKZB 3MXNB 2UXCL 5HY6A 4JI4L 1C7YA 3MEFA 4P72A 1X65A 4HJ8A 3S2DH 1OTCA 4DV6L 1WCMH 4EQ5A 4O2DA 2QEXA 1CKMA 4OO1I 1PH4A 2IHEA 5FLMH 1N34Q 1IBMQ 2D0PA 4DR3Q 3WWVA 3ULLA 3D31A 4JC0A 4YY3L 3KDFA 1KHIA 2ES2A 1VQ6A 1AE3A 3TS2A 4KI0A 1BBWA 4IPHA 5LMNW 2H5XA 3J81j 1OXTA 2VY3A 1QVCA 1K8AC 1Q46A 3NELA 1N32Q 4P74A 1N9WA 2CQOA 1NMGA 2DGYA 3UE1A 4A4IA 2KHIA 4B3SL 1IL2A 3S17H 3GDEA 1WOCA 4L5QA 4X66L 4QJFA 3VDYA 1JMCA 1Q1BA 4A3MH 2E2HH 2OWOA 4A3EG 3F8TA 1UWVA 1NBWA 1J6QA 1H95A 1BVSA 1SROA 1X55A 1EQQA 1KC8C 1QUQB 3RLFA 3U4VA 4X62Q 3L2PA 4JV5L 3PO3G 3CCEA 3BZKA 4X6AH 1YZ6A 2B63G 1N32L 3JAMi 1JT8A 3RZDH 2HHHQ 1NMFA 1MIUA 2VZAA 3KF8B 3AFQA 2C35B 4JOIA 4AQYL 1L1OA 4J15A 4HJ9A 1G6PA 3I55A 2VQFL 4A3KG 1VQOA 4B3RL 3GTKH 4LFAL 3M85A 1PH9A 2ZTDA 2R7ZG 2K5NA 3K0XA 4DKAC 4DR1L 1PYBA 1PVOA
chains in the Genus database with same CATH superfamily
1PZJD 4X62L 1SYGA 1SYCA 1EWCA 4I65A 2EJMA 3A8IE 4RAUC 4NW2A 4JI6Q 2FXQA 2JSOA 3BYYB 2ASBA 3GTMH 3P7JA 1Y1WB 2QDBA 3RN2A 5IYCG 4P75A 3S2DB 2R6GA 3MC0B 3Q8DA 2KECA 5GAHC 2XRSD 4G7ZC 4MHEA 4JI7Q 5M3FB 2HQEA 2DY8A 1WD0A 1LM0A 2IX3A 3DMUA 1PFSA 1WTRA 3GD7A 3DM3A 3HOWB 2K75A 2F0VA 2B2VC 3NWSA 1SXTA 3P20A 2F0HA 2NVXB 1LV9A 3OTOL 4K5XA 3S1MH 2Z4IA 4X65L 1HA6A 1VQBA 3HOZH 4K14A 5M3FH 1FVIA 1S4ZA 1SJED 5KYLA 1GHJA 1EY6A 2SEBD 3EFXD 1HNWQ 1KIXA 3K59A 3S24A 1VF7A 4I7AA 5DM73 3VYUA 4Q0FA 1Y14B 4A3JH 3OIQA 4DR7L 1KQSA 1Q7YC 2LMCB 1SBBB 4FDBA 2ZM6Q 3JC66 2XRQD 5C5MA 2X69A 3G6JB 4EX5A 1GUSA 4BY1G 2E2JH 4JI8L 4GOPB 1VQ7A 3EBEA 4R8NA 3BZCA 2RDFA 3K7AB 2O5JC 1XXGA 4DN4M 2YU9B 4R1JA 2E76C 4FXDA 1ET6A 1V8QA 2PW5A 4K0KQ 4DNTB 4GOPA 5J39A 3DWQA 1GD7A 4R4IA 2RKSA 3L3OC 1PRTC 4BWGB 4K6DA 1B2TA 1Z47A 1H9MA 3HKZB 4LFCQ 1YNNC 1IXRA 4A3FB 1XNQL 3PUWA 1SLJA 1R4QB 2F0OA 2AKWB 1R4PB 3T1HQ 2WINB 2A74C 3D4WA 3MTSA 3M7NA 3I4LA 3CXCA 1QCBD 3M4PA 4DR1Q 1K3RA 2NVTB 1PTOF 3DWAA 5IGFA 4X64Q 1S40A 5F2DA 5JEAH 1AW7A 2JA8G 2CFMA 1UEBA 2OF1A 3PUXA 4WJWA 1Q1EA 4KKTA 5EQ0A 1K8MA 2RSOA 3PGZA 2B2YC 5EPJA 2NVYB 1V9PA 1ET9A 3M3YH 2LFNA 1KNAA 2NVTH 4GZYC 3I4MG 1B9MA 3PUVA 2GVBA 4JV5Q 3LGJA 4XT1B 3CF5A 4GN4B 2F4IA 1T5XD 4A93H 3MXUA 1TU2B 4HSVA 3J81i 2MNAA 3ERQA 3J81c 3H3VH 3SK6A 4HIOA 3A5UA 1JR0D 4A3BB 1C9OA 1AE2A 1B7YB 2Z6BA 1YHQA 1E7ZA 3Q23A 2UU9Q 1EU4A 3OHXC 1RTNA 4MN3A 3HOYG 4X64L 1I50H 4IPDA 4ME3A 2A68D 3E9HA 1KNEA 1SE2A 5CV8A 4C3IG 4X3SA 2Y0SG 2LXJA 1JWUD 1D1KA 4C1NI 3H0GG 4F7XA 1VS0A 4BXXG 1LTGD 4IFDI 2IT1A 4AYBE 3O13A 4HJ5A 1LTBD 1NJIC 2K32A 2K52A 2DY7A 2F0FA 2PI2E 2PPBC 4DUZQ 3MXNA 3GTGB 1IYVA 3E9IA 3JAME 1IKLA 4BA2I 5FO7B 1UNSA 2K5WA 3KDFB 2YV5A 3GTJB 2MJ8A 2EY1A 2ZT9C 3FMCA 1B44D 3I8ZA 3E6ZX 5JVH3 4CJ2C 4DNRB 3T1YQ 1FGBD 2E75C 2L5TA 1CUKA 3K58A 1KAAA 4CJ0B 2MPMA 5E4WC 4GS3A 5IODA 5JEAG 4JBMA 5D3DA 3HEJA 4FXGC 3MVVA 1I4HA 2B2TC 2XIWA 1STBA 3H09A 3GTJH 3RZOH 1BBUA 1EIGA 4YHHL 1PTOB 5A2QE 3UDFA 4JI3Q 2RQXA 1QG7A 3HOXH 5CBAE 2NTTA 4IUTA 2UXDL 5IGDA 1HNXL 3IKJA 5C4XH 4QGUA 4QY7A 1HNZL 1GM5A 3D4DA 3FPUB 3KOJA 3GTQB 2FMMA 1XPUA 1CHPD 1AP0A 2SOBA 2AQ3B 2KHJA 5IT9L 4A3CG 2AWNA 1GUTA 2ID0A 4BBSH 5FK9C 2F0WA 3FKIG 2VQFQ 4BY1B 5D14A 1VMPA 5C4XB 4IUQA 1PDQA 2UXBL 4IN3A 1CK1A 3GP7A 1PFMA 1TWAB 3PSIA 2QA4A 3KUPA 3PIPA 3L7ZC 1GUWA 5GQOA 4P71A 1EWIA 1SN8A 1TY0A 1QZGA 4G57A 4IQZA 4LAAA 4QQBX 1D7QA 1L0YB 1X56A 1M4VA 2ZJRA 3S1QH 4JI5Q 1LTRD 2A73B 4YY3Q 3NEMA 3TP7A 4ODGA 4A3JG 1YJWA 1LT5D 1IYJB 4H02A 1GOZA 2BOSA 3NBHB 1E1OA 1JOQA 3LWUA 5FLXc 4M8AA 2KOLA 4RHSA 3E3XA 1SNOA 4JPBW 3S1NB 2A19A 5K36H 4UY8C 2NB0A 3M4OH 1UE5A 5EPKA 3K8AA 1NNXA 1SMXA 2NUCA 2UUBL 4YIJA 1BCPF 1W3SA 2XSCA 1HZCA 2EXDA 5COYA 4YWLA 1WTXA 1EQRA 1RDPD 4GLVB 1EYGA 1HRJA 2ZXPA 3FPPA 2HIXA 4A3DB 5IWAQ 2F0JA 1MHWC 1GO3E 5BR8L 5E1FA 4OWXB 4GN5A 3ZYYX 1LO5D 3UDXA 2EYLA 1JWSD 5M5YB 1WFQA 5IT9c 1QOHA 2SNMA 1JE5A 3F2CA 1VQHA 2VS1A 1KXLA 4PZ8A 4NXNL 1FNVA 1J9OA 3F1ZA 2UUBQ 3HRZC 4RGMA 4MIUA 1R9TB 4FF4A 2NVQH 2JA6B 3I4NH 4N9PA 4OGQC 5IYBH 4A3BG 4PZ6A 5D3IB 4A3DH 1KRSA 3GO5A 1BR9A 2IX0A 2KA7A 5AJ3L 1SYFA 1B53A 3I2ZA 5KEEA 2F1MA 3FKIH 4DR3L 4ZK9B 5IGCA 3S17B 1K0SA 1LLRD 1MGSA 4GKJQ 3L9AX 4IUPA 3T53B 1Q12A 1BXTA 5EJWA 2I46A 1MD2D 4R4TA 3H94A 5ELFA 4R4QA 3KF8A 4KMUC 3HOVH 2KJXA 1X6OA 5T1GA 1A6XA 3PUZA 1V1QA 4LF5Q 1KLGD 2KQ3A 2UXDQ 2OT2A 1WCMB 3LWEA 1VQNA 4DK0A 2JA5G 2HD3A 1Y8NB 5FO9B 4Y7NH 2L0CA 1PV4A 3SDZA 3RN5A 3CQZB 5IE8A 4JI8Q 4DV6Q 1RODA 1SNQA 1JB7A 2F0MA 3ICEA 5IT9E 3S14H 1O78A 2EYFA 3I7FA 4C2MB 2UXCL 2CKZB 4CDFC 4V190 1U4PA 1C7YA 2G9HD 4DV6L 2RCFA 3H6MA 2HCCA 3VA7A 1TWHB 4O2DA 1SNMA 2QEXA 1CKMA 5IGGA 1BOSA 1ICFB 4Y7NB 3T13A 5FLMH 4IALA 1IBMQ 3WWVA 1HUNA 3KDFA 5G3LF 5ELBA 4KI0A 5LMNW 3EQLC 3J81j 3MA2B 2PO4A 1K8AC 2K5QA 2DGYA 1NMGA 2KHIA 3VR3A 1WOCA 4X66L 1JMCA 2HCIA 1UWVA 1LT4D 1K28A 3HOZB 1QILA 3GTOB 1SROA 1EQQA 5CGKA 2R3ZA 3L2PA 3DXJC 3PO3G 2B2YA 3BZKA 5IGBA 1N32L 2FFKB 3KBGA 2VUMB 1GUNA 2Z4HA 2EYJA 2LY7A 3QOJA 3AFQA 3QO2A 4JOIA 1L1OA 3N52A 3I55A 1Y69U 3UI2A 3NTHA 1BDOA 2ZTDA 4N8X1 5I6YA 1PH9A 2R7ZG 3EVQA 2FMCA 2EYMA 4C3IB 1PVOA 4HJ7A 3VYRA 4DV5L 2RHQB 3H3VC 1TS4A 2OQ0A 5BN4A 1G2TA 2EIFA 5CV5A 3SK5A 2Q2HA 1BUVT 5CR3A 2F0GA 2YTXA 1QB5D 1XMOL 5FLXE 3MFGA 4DR4Q 5CORA 5DEHA 2BE5C 2HT1A 4POGA 2B8GA 3HOXG 2R7DA 1RIPA 4QMGA 3I73A 3TSSA 4LMQD 3TP6A 1Q82C 4OO1G 1A0IA 2EY2A 4B08A 4GKKQ 3TP5A 4BA1I 1SEBD 3KF6A 4LW1A 2L15A 5CBEE 2B3GA 2KBNA 4DUYQ 4A3JB 3A0JA 4C3HH 3CCJA 1EQVA 1YBYA 3K6OA 3H3VI 4BBRG 4YCWA 3GQBA 4C1NK 3GTLB 1PFNA 4JI0L 4IUUA 2KCNA 1B70B 1D5ZC 2PI2A 4ZKBB 4JI1Q 3GTKB 2I07B 4M1UB 1K3BC 3J7YW 1QE6A 1I5FA 4IURA 2ZTCA 1JCKB 2FJ2A 3FDTA 1BCPB 4ABNA 2E74C 3DEPA 4HTHA 3W5OA 1G6ZA 4HR7B 2F0KA 4HJAA 1K8GA 4ZUIA 1II3A 2UXCQ 1EWHA 3BZDB 3RD4A 2QW7A 4A3FH 3U58A 2AMCB 3NP8A 2BCOA 1I3QH 3W3AA 1VF5C 4K2KA 1PFBA 5ELDA 1NSNS 1L1OC 2RBMA 3TZUA 3I91A 1I4GA 4EQPA 5C3WA 4IOAA 4R4OA 2DNCA 1XTDA 2CH4A 3T1YL 4LF4Q 5K36G 2PZWA 3X3NA 3EROA 1I50B 4A3GG 4PMBA 1C8CA 1KL9A 1HQMC 2VQEQ 2CH4W 1JJ2A 4LFCL 1H9RA 3M3YB 4LF8Q 4LUOA 1WTOA 2R92G 3PF5A 1FD7D 4JBWA 5CV7A 4K6LA 4GNXB 3JAMc 4RMFA 3SGIA 1PA6A 2E5LQ 1AZPA 3PF4A 4LFBQ 3G48A 5AJ3Q 4ZLTF 2MHVA 5K5PA 4JK1C 1DGSA 5C44B 3UE0A 5C0XJ 3MHBA 1V1PA 2LKVA 1MSHA 4A3BH 4RGTA 2VUMG 1Q8IA 4DV3L 4A3DG 1C48A 3CCQA 1VQPA 3D4RA 1B8AA 2OCEA 3S9WA 4GKJL 1G91A 5EBCA 4LK1C 1EYCA 2F0DA 2UU9L 4IFDH 4KN4C 1F2LA 1Q90A 4UAIA 4C3JB 3IRBA 4WJ4A 4J6HA 3T56B 3V2TA 1VQGA 1HR0W 3RZOB 2G5DA 2WACA 1WYDA 4QUFA 4UP7A 4KY6A 3U4ZA 2JEAI 3GTPH 3S16H 1ZXTA 3J81E 1X32A 2I5HA 5M3MH 3KJOA 4DR6Q 4X65Q 4MZ9A 4UP8A 1TWGB 2K04A 2GN5A 3T51B 3R2TA 2NZOA 2R7ZB 1EYAA 3A7LA 1X3GA 4HCEA 4C3JH 4AQYQ 5FJ8G 4PMCA 3HOUB 1EOTA 2RF4A 4QIWE 3AB9A 1A15A 3KLRA 4YCUA 3S16B 4OIKA 2HUGA 3BS1A 3AYHB 1TWCH 2AUKA 4RG1A 1O7ZA 1WTWA 4QCLA 3HP3A 1BO0A 5JJLA 5FLMG 4A3LG 3BDLA 4JI6L 1EIFA 3TS0A 1WTHA 4HMIA 1TWFH 1FJGL 1TWAH 2B8FA 4NPSA 3TREA 4A3KB 4FYDA 3VA5A 4WFN3 2CW0C 3TN2A 5M5WH 5L37A 3PO3B 2B2WA 1GUOA 4LWCA 1RJTA 1N36Q 3NQIA 1TWFB 4XT3B 2B63H 4FVMA 4F87A 5J22A 2M9VA 2KEEA 5J1ZA 1BF4A 4DV3Q 3OWEB 4N9TA 1WTPA 4DV7L 1VQLA 2HQLA 4A3KH 3E0EA 3OOCA 4JI5L 2AHOB 1VCIA 1Q8KA 5GROA 4L5TA 3I56A 1ZEQX 1JOOA 5ELCA 4DNIA 1M8AA 4OWWB 2Q2IA 2A6EC 1EUJA 5IP7G 2C9OA 1A3TA 2K50A 3HG9A 4BS9A 3S1NH 4IJLA 1XNRL 1LUZA 4Y52H 3FRPB 1LTLA 3E5SA 4HIMA 4POFA 3RR5A 2WAQG 1I4RA 5NUCA 1E24A 3CMAA 1WD1A 5EKIA 3DUZA 1STHA 4A3IB 2XNAC 4PMWA 3LX0A 4BBRB 4NMZA 1ZKOA 5M3MG 3NBIA 2BH2A 4TVAB 3IAYA 1EEFD 1N8RC 3R3OA 2LXKA 3CMEA 5FJ8H 1OXVA 4YHHQ 1MI2A 2A8VA 2ZXOA 4A76A 4BBRH 2JA6H 3I4NB 1SE4A 2NVQB 4K5VA 1PH3A 1D6EC 4DR2L 2LS01 4RKBA 1VQ4A 5I2XA 3CC7A 3CCVA 1ASYA 1NUCA 4LF5L 1C0AA 1V1OA 1DXMA 4KHZA 2ICEC 3FP9A 1GXDC 4A3LH 5C3EH 1AZQA 4FNFA 1EY7A 3HKZE 1EFWA 4GOPC 1HH2P 2QKIC 3PO2B 3HOWG 2JA8B 3AU7A 4HEDA 3HOVB 1N36L 1HTPA 4LNQA 2NBFA 1SYEA 3PV0A 1WJJA 4CBVA 4WRDA 2F3IA 2PMZB 4ZAIA 4LF6L 1VMCA 3S2HH 2P5ZX 2OTJA 1GKHA 4A3MG 2Y0SE 1R9TH 2MFIA 3KLWA 3NENA 4NB3A 1XNRQ 2F52A 2VW9A 2JA8H 3KYHC 1PRTF 2KUMA 1N33L 3A7AB 2R93B 1QWYA 3HFZB 3BU2A 1V43A 4NXMQ 2EYHA 2O5IC 1D2BA 5IP7H 3PMFA 1CT1D 2NZ1D 2J0TD 2GVAA 3L0OA 5BR8Q 4JBKA 4KHPL 3PIP3 1NR2A 2B29A 4HN7A 2IX1A 1O7IA 5IIFA 2MUYA 1PYSB 1X3FA 2I5MX 1YNXA 2KHSA 4B3RQ 2E2IB 2JXMB 1ONLA 4NP5A 1TS3A 4TQUS 1LT6D 3AQQA 2ZJQA 1UAPA 3DM1A 4DAVA 4GLXA 1YHBA 1RF2D 2A68C 5KNDA 4DF7A 4EQNA 2Q2TA 4L63B 3OSOA 1O7LA 2J7ZA 4KJNA 2VUMH 1PRTB 1IZ6A 2WB1E 4RGNA 4GNXA 3D6CA 1SMYD 5C0XG 3URYA 2JP1A 1KDCA 1IHZA 4JI4Q 5JOBA 1TWHH 4C3IH 3F2UA 2NN6G 3TP8A 4O42A 4K0KL 1M90C 4LF9L 4IPGA 2RDHA 4DV2L 4BXXH 1J5EL 4JYAL 1SRUA 1SYDA 3MXNB 5HY6A 1U4RA 2N55A 4A3MB 4HJ8A 3QB3A 3S2DH 2HDMA 1OTCA 3M7GA 4EQ5A 3R8BA 1N34Q 1A3UA 1MBYA 1XX8A 3D31A 3ULLA 1B50A 1HHVA 1E2ZA 5JAVA 1N32Q 4IUVA 2KEDA 2K03A 3MAQA 3UE1A 4B3SL 3ND8A 2B2UA 4L5QA 3VDYA 4ZQ3A 4A3MH 1BBXC 3BG3A 1NBWA 2BDOA 1SNPA 3V05A 2RA4A 1X55A 2Z1CA 3RLFA 1NR4A 1YZ6A 1DJRD 3JAMi 3RZDH 2VZAA 3HZXA 1G6PA 3GTKH 2QCPX 4TRDA 1HQRD 3ITPA 2K5NA 1C4QA 1DZ1A 2TMPA 2E5LL 3U9OA 2KCCA 4OONA 4XQQA 3I4OA 1VQ9A 1IW7C 2EZVA 3RZDB 1HFNA 2VB2X 2OXPA 3MXGA 4ZYSA 2R61A 2O2LD 4BBSG 1SFOB 4XDXA 3KBXA 3T16A 1I4PA 2Q2UA 1QNKA 2D2CC 2YU9H 4MTNA 5ELOA 4H7BA 2K01A 4FXKC 2E2DC 3Q24A 1E2VA 3GTLH 5LMUQ 1EY5A 4R8IA 3U9SA 1Q81C 4QUCA 3VR6A 4K2LA 5G3LD 3DWPA 2CQAA 1I4XA 4ZKCB 3SR1A 3I4MH 3CW2C 1SFOH 2D9UA 4XQJA 3C2PA 5C4ZA 3RNUA 1PH8A 4A93G 2N88A 1RL2A 5I2YA 3LNNA 3N6RA 1BQQT 4B9XA 1A63A 4KHPQ 4LJZC 4PQXA 2K6AA 1EYDA 1UE6A 5C0XI 3UDGA 3BYTB 2D5DA 1I3QB 1MJEA 4DUYL 4YWKA 1B3AA 1OXUA 1VQ5A 2PNHA 3CCRA 5EKLA 1ZYRC 4CGYB 2OEOA 2CWAA 3CC4A 3CKIB 4IPCA 2RSNA 5JEAJ 2EOTA 4RCNA 1E1TA 2WKCA 1SYBA 2MQHA 3BDCA 5KGUA 2QGQA 3P1HA 1QJOA 2JA7H 2WIIB 5CYUA 3OYYA 2L11A 2LSSA 5C6AA 3ULPA 3OMGA 3Q6SA 5C3EG 2OQKA 5C3XA 1SNCA 5GAEC 2UUAL 1EY8A 2OTLA 1IBLL 3HOWH 3TZDA 1E3PA 1U5KA 3NK9A 3GTPB 2EYOA 2JE6I 4IJHA 2CVRA 3UDIA 5IYDG 4ZRZA 3S1MB 3ER0A 1BNZA 1VDZA 2N3SA 5M5XB 3I4NG 1A2TA 5C4JH 1UUPA 4UDUC 1W6JA 1STYA 2F0EA 2QILA 2A6ED 3QJYA 1PH7A 2X6LA 3HOUH 2RVLA 3AMUA 1L2FA 1CFMA 2PQAA 1TQOA 1CKOA 4O1NA 4PZ7A 3OPOA 1U4MA 4JBJA 3F2DA 1CHQD 1ESFA 1STAA 2L4NA 5EAYA 1EIYB 2F0PA 4L5SA 2PYKA 1H9SB 1PHJA 3NTKA 2VB3X 1G291 5BN3A 5M5XH 1AN8A 4RWSC 2BH8A 4KLKA 4AYBG 3HOVG 1VQCA 2F3VA 1ASZA 5C4XG 1U0LA 2UXBQ 1LT3D 1A3VA 1HPCA 3ULJA 4OEMB 1I4QA 5LL6S 4B3MQ 1TWGH 2Q8TA 1A2UA 4OX9Q 3CD6A 4DV4Q 1ESRA 1H9SA 3K5OA 2F0UA 1OXSC 2CHBD 3BDOA 1X54A 3TQYA 1VQIA 2VQEL 2NN6I 1HFGA 2X6GA 4DFAA 3PIOA 3ONAB 3FHWA 1PTOH 4ALPA 3NQTA 1VQDA 5KIXA 2BDNA 4RHRA 1KAWA 5FOBB 1K73C 2NN6H 2MGSA 1RKNA 4DR7Q 2IY5B 1X3PA 3CCLA 2CWPA 5KNCA 5FO8B 3J80i 3VR4A 5E4XA 2MO0A 1FR3A 1P8LA 4KN7C 1FGUA 2PQEA 4A3EB 3PUYA 1IKMA 1TR5A 1W6KA 1Z9FA 3KFUA 1T9HA 3K0YA 2EQSA 3PO3H 1E2WA 2JA5B 3TDQA 3IL8A 1X3QA 2GA4B 5J3BA 1YJNA 2XVSA 3I70A 1KLUD 1YNJD 3G6EA 1HJPA 4IO9A 4JI1L 4A93B 5CV6A 2DN8A 5CC4A 4K5WA 5EGTA 3OWFA 4RFBA 2L55A 3DEOA 4QL5A 4A3EH 4DR5Q 1JB3A 1LYLA 4KK7A 1VQEA 2K7VA 1JQYD 5T1IA 4IFDJ 5ELNA 1JORA 1CI3M 5DAUA 1I94Q 3DLLA 1GJXA 2N8NA 4EGVA 1UE7A 4H13C 1KDBA 4GNXC 2IWHA 3K81C 1TKWB 2XN9C 2K14A 2R7FA 2CW0D 3J81L 5TSSA 2K5VA 3SK4A 3F2BA 4FO2A 1L0XB 5IWAL 3PO2H 1ZYRD 2F4VL 1IBKQ 2M2LA 3QIAA 4C3HG 5IYBG 1PYWD 3J7A5 1I6VC 1BKBA 2Y0SB 3T1HL 2DJFC 3S15H 1ICWA 3CCMA 3S2HB 2A6HD 4AH6A 2A69D 1KDAA 3U50C 3K5LA 1YEZA 1ILQA 1A8VA 3A74A 1G2SA 4K8JA 5M5YH 3HS0C 3IFDA 1DOMA 4DR4L 2R92B 4UHVA 4FF2A 4DAYB 5FKAC 1E0BA 4A75A 1DONA 3BVMA 2F0LA 1ENAA 1ML0D 4DA2A 4DV5Q 1PH2A 2IPKD 2A5HA 4YWMA 2KCMA 5E7NA 2WB1G 1CQFA 3RLNA 3K7UC 4DV1L 4OHJA 2XGTA 4ID6A 4KTAA 1BCPC 3NUCA 4LFBL 4V0BA 3HGBA 1SE3A 1STEA 4H44C 4K8IA 3Q22A 4OX9L 4DR2Q 1EL0A 4DV1Q 1EU3A 3K57A 2A6HC 5EBDA 4CKBA 2JA7G 3CRLC 4X3UA 2XWBB 4BY7H 2Z9HA 3A8KE 4R4CA 3OMCA 3OTOQ 4FP5D 1MSGA 3SXHA 2C5CA 4B3TL 1HZ9A 3QOLA 4QF4A 2I5LX 3TMEA 2E2IH 2WP8J 2PQAB 1WI5A 2UUCL 1D8LA 4C2MH 3V96A 4Z9CB 1CQVA 2H4OA 4LF7L 3W1BA 5IYDH 1CTMA 1DD2A 1Z6HA 1Q86C 2B2UC 3PO2G 5A35A 4OELB 1ILPA 2HHHL 1S72A 4JVZA 1IL8A 5BN5A 4A3CH 2SDFA 4DUZL 1PH1A 2Q8RE 1TS2A 1PH6A 1IBLQ 2DUDA 3HOUG 3CCSA 2G9DA 1YHAA 4EQOA 2V1CC 2EJGC 2EPBA 5ELEA 2KVMA 1Y1VB 4CKEA 2L12A 1HR0L 1JOKA 3R2IA 4ZUJA 3NXWA 1J5EQ 3J7AV 2WB1B 2DNEA 4OO1H 1XMOQ 5JVG3 1TVXA 4JI7L 1GVPA 2N49A 5H1SE 4CDCC 1HR0Q 5FLXL 1QVGA 5IP9G 4O0AA 1NTGA 4AYBB 1L0WA 3BJUA 1YNND 4Q5VA 1CSQA 1MJCA 3MEHA 3CHBD 4RKLA 4DR6L 1IYUA 4JOIC 5I9PA 4UP9A 3AFPA 1PLFA 1SDFA 1NE3A 1K0RA 1STNA 1B9NA 3MEFA 4P72A 3T4AC 1X65A 5EPLA 1HA5A 1HUMA 1S5DD 4E6IA 1S5CD 4OO1I 1PH4A 3EA6A 3MWYW 1HXYD 2EY6A 2ES2A 4YY3L 3A56A 1KHIA 4WORA 1AE3A 4IPHA 1OXTA 2VY3A 2EJFC 3NELA 5CV4A 4ZCKA 1HTLD 4P74A 1XWEA 3CU7A 3MFYA 4BY7G 4C3HB 4NKLA 4OL7A 1Q1BA 1JWMD 4DAPA 2E2HH 2OWOA 1F9SA 1FNWA 3NSWA 2EXZA 1UEAB 4F8MA 2QF7A 4JV5L 2JN4A 4KY7A 2B63G 1JT8A 2HHHQ 3HOYB 5EKKA 1NMFA 3NE5B 2C35B 4HJ9A 4A3KG 2VQFL 3KLSA 4RCOA 2K1BA 3FVQA 1AEXA 2IL8A 4RA8A 4DPGA 4TKOB 5E3FA 3ZJYC 3QR8A 2TSSA 3EJIA 3CQZH 4HIDA 4B3TQ 2ZJPA 4MNOA 2HDLA 3S14B 3M4QA 3WOFA 3C1FA 1QVFA 3STBD 1V1PB 2YTVA 1TT2A 1HNXQ 3I4MB 3GV6A 1F2YA 1CZGA 4XTCS 1B3QA 2Z8LA 3HKZG 2WAQB 4B3ML 3NWTA 1XMQL 1X9NA 1LTID 3D6WA 3WOEA 3OW7A 1KD1C 4G4KA 4YCVA 1XJVA 3CPFA 2RHSB 2I0QA 1U4LA 3B6YA 4IZ8A 4DV4L 4CKCA 1VQ8A 3E0JA 3GTMB 2WV6D 2ZM6L 1Y1WH 2L9HA 1PH5A 5IP9H 1F9QA 4LF4L 3SK8A 3MZ5A 2F0QA 3GTOH 1KRTA 1XMQQ 2JA6G 3QG1A 1F77A 1EIHA 5AFWA 2XWJB 1DOKA 1VQMA 4NXNQ 1I6HH 4JI2Q 5LMNQ 3AEVA 2WFWA 3TEHB 4LF9Q 3I90A 2K5HA 2NVXH 2D0OA 1RHPA 3K5MA 2JA7B 1EFID 4X3TA 2F4VQ 2N78A 2JJQA 1Z7TA 4JYAQ 5KRUA 4RH6A 1K9MC 4DK6C 1YI2A 4JI3L 2PCFB 1G8ZD 1EEID 1LABA 1K83B 1SE8A 5C5LA 2Z6KA 2Q8IB 4B9WA 4C3JG 4DK1A 5JJZA 2RCNA 4CDDC 5KYIA 3ERSX 4GKKL 1FYCA 1FNUA 3DHQA 2M00A 1OO9B 5C4JB 2E2JB 5C44G 1K83H 3RLOA 4APVA 3CC2A 1F2MA 3NBHA 4DR5L 2ENBA 1NY4A 2ZTEA 4A3IG 1NCVA 2F0TA 1TY2A 3HKSA 3G71A 4LUZA 2EE1A 4NXML 1T5EA 1KABA 4L6TB 1VQAA 1U9RA 2B2VA 3KK7A 1AH9A 2MO1A 3WDNA 5LL6X 1VQFA 2FHTA 3A5ZB 2MP1A 1YVCA 1DCZA 4H0LC 2ATWA 4DU9A 1O80A 2VNUD 1HZAA 2F03A 1H9KA 1QNUA 4LUVA 2PZTA 4U68A 5IGEA 1XTCD 4UPAA 3D0FA 1Y1WG 1F9PA 1UE1A 3K7AH 3KJPA 3K5NA 4OWTB 5M9OA 3M9BA 5C0XH 2K4KA 1S3OA 2AWOA 2UUCQ 3K80C 1LTSD 4KD3A 5GADC 3SE0A 3G7LA 1EOVA 3PQIA 1F2ZA 3IFTA 1W2BA 4JCVE 2NVYH 1O7YA 5LMUL 1EZ6A 4PG3A 1L1OB 4KJOA 1J8IA 4NDXA 3GV3A 1CA6A 1A62A 1CA5A 1EY4A 3SEBA 3RMHA 2B63B 1CZWA 1WTVA 4TSSA 1YIJA 1PZKD 1Y8OB 4X66Q 2FINB 4DXFA 2Z6KC 2PNRC 2IHFA 2ICIA 3ND9A 2R93G 1S5BD 4KY5A 1CSPA 4CJ1B 5A2QL 4IUNA 2JA5H 3CCUA 1S5FD 2JEBI 3PCOB 4KKSA 4A3FG 3G4SA 4LF7Q 2BA1A 2YTYA 2AUJD 1S5ED 3BVGA 5DM63 5ISRA 1TIID 4DXGA 1IBML 5C44H 1HNZQ 2NYZD 1SAPA 3S15B 4WJ3M 2ZXRA 4HSPA 4A3IH 1M1KC 5I9OA 1LTAD 2KCTA 4A3GH 2WKDA 2PW7A 2PZUA 1Y1VG 5LHY1 4CHTB 3JAML 5IY0A 1DOLA 2D62A 1KTKA 1ENFA 4U673 2K28A 1F9RA 2JK8A 3STBC 4JW0A 1JICA 2B2TA 4FF1A 2R92H 5I6WA 2UUAQ 4L5RC 4P73A 1P16A 1N34L 4HIKA 1XPOA 1SMYC 1YJ9A 4J8QA 4A3GB 5JJKA 2A1AA 1WVLA 2QEJC 1Y8PB 2NWGA 2CCZA 5IYCH 1IBKL 5M3MB 1H9JA 4PNYA 1TXYA 3A8JE 1AFPA 4DV2Q 2R7ZH 2Z0SA 1VQKA 2J4XA 4DV0L 1HNWL 1EY0A 2SNSA 2JA9A 4HCSA 4G7HC 4IFDG 1Q3LA 1SR3A 4DAMA 1EQTA 1TWCB 1BCPD 5GAGC 4GLAC 4MTKA 5HGTA 3C46A 2QDLA 3D3RA 3HOXB 3S1RH 3OW2A 1LACA 5M3FG 3X3MA 3VYSA 1FJGQ 3EIVA 3W2DA 3GTGH 1GHKA 2EYPA 2B2WC 1HZBA 1RTOA 1IW7D 1E22A 1NAPA 2F0NA 3CP0A 4DK3C 1SJHD 3J7AF 2R93H 4OXPA 4JG2A 4X3KA 4JI0Q 4HMJA 2BE5D 1JJGA 2A69C 1EZ8A 3S1RB 2V4DA 1I94L 2K33A 5M5WB 3CAMA 3J7ZC 4BY1H 1TS5A 1JE4A 5DLQE 1N33Q 1D5XC 1PXUA 1DYQA 3NPPA 3KLSX 2ALYB 1MKHA 2NTSA 4DV0Q 4KD4A 3A54A 3P75A 4DGZA 1XNQQ 2WAQE 1ENCA 1B1ZA 3QWNA 5CV9A 1K8OA 1D1IA 2F3WA 4G7OC 5C4HA 2L1BA 1VQJA 4BY7B 2O4XA 3EN2A 1Y1VH 3CRKC 1WCMG 3S1QB 4IOCA 3GTQH 2EY5A 5DNFA 4JI2L 2IW3A 2AQ1B 3W1GA 4KKUA 3PIO3 4BBSB 4HAEA 3J80c 4RGOS 2H1EA 4R9WA 1CKNA 2B39A 2F0IA 2KENA 3H15A 3I3CA 2RDGA 4S3SA 4N8FA 1QUQA 2YYZA 3Q0AA 5JPMC 4P2CB 3R93A 3OIPA 5I4DA 2AQ2B 4L8JA 1EY9A 1YNJC 4B3SQ 3RUZA 4LF6Q 1SNDA 3MXPA 4OIJA 4J1MA 5JJIA 4KV6A 5IOCA 4ULLA 1X3EA 2NZHA 2F0SA 2JQOA 1JC7A 3D8GA 5LMNL 2BA0A 3TBIB 3NHHA 4ILWA 1PZID 1QZHA 2HIVA 1PRTD 4QIWB 5KNBA 5CMDA 5C3EB 2VXWA 4AIMA 4XIGS 5JPNC 1YITA 1JJCB 1FL0A 1RCVD 4I7ZC 2E8GA 3VR5A 1G51A 5HGQA 1XPRA 3CPWA 3H0GB 2IJ0A 1GUGA 3A55A 3FEWX 4F88A 4XYQA 3HOYH 2XTIA 4GN3B 1D5MC 3KF6B 4KHVA 4LF8L 3M4OB 4XQNA 1CKNB 1PTOD 2JYOA 3C1EA 1CM9A 4DV7Q 1HCZA 2VL6A 2PMZE 2EVBA 3BVZA 2K05A 3HOZG 3H0GH 3I72A 3C3LA 1STGA 4LFAQ 1DM0B 1PTOC 5D65A 3TRZA 1B4OA 1OXXK 5HURA 4ME5A 4JI4L 2DJGC 3J80L 4PV1C 2E2HB 4DAYA 3VYTA 3SHLA 1WCMH 1WTQA 1XYIA 4XYOA 3H91A 4QB4A 2IHEA 1SSOA 2D0PA 4DR3Q 4JC0A 4FF3A 1VQ6A 3TS2A 1BBWA 2K5DA 2H5XA 4EVOA 1QVCA 1Q46A 1N9WA 3FKIB 2CQOA 4A4IA 3VR2A 3M4YA 1PMRA 1IL2A 3S17H 3GDEA 4QJFA 1LTTD 2EDGA 4A3EG 3F8TA 1J6QA 4CDEC 1H95A 1BVSA 1KC8C 1QUQB 4X62Q 3U4VA 4C56C 3SVMA 3CCEA 4X6AH 1MIUA 3KF8B 1I6HB 4AQYL 1RD9D 4J15A 1VQOA 4B3RL 4LFAL 3NTIA 3M85A 4XXEA 3K0XA 4DKAC 4DR1L 1PYBA 3J80E
chains in the Genus database with same CATH topology
4HJ7A 3ZJYC 4X62L 2E5LL 4DV5L 2RHQB 4OONA 3I4OA 2OQ0A 3CQZH 1VQ9A 4HIDA 4B3TQ 2EIFA 2Q2HA 2ZJPA 4JI6Q 4MNOA 2FXQA 3M4QA 2YTXA 1QVFA 1XMOL 2ASBA 3GTMH 3STBD 4DR4Q 2YTVA 4BBSG 1HNXQ 3RN2A 5IYCG 4P75A 2R6GA 3Q8DA 5GAHC 2HT1A 4XTCS 4POGA 3HKZG 2Q2UA 3HOXG 2R7DA 1RIPA 2YU9H 4B3ML 4MTNA 5ELOA 1XMQL 1X9NA 4JI7Q 1KD1C 4YCVA 1Q82C 4OO1G 1A0IA 3GTLH 1LM0A 5LMUQ 1XJVA 3CPFA 2RHSB 1Q81C 2I0QA 4GKKQ 3B6YA 4DV4L 1PFSA 4BA1I 3GD7A 3DM3A 1VQ8A 3KF6A 2K75A 2L15A 4LW1A 2B3GA 2KBNA 2ZM6L 4DUYQ 1Y1WH 3A0JA 3CW2C 4C3HH 3CCJA 1SFOH 3I4MH 3OTOL 1PH5A 5IP9H 3S1MH 1YBYA 4X65L 3RNUA 1VQBA 4LF4L 3HOZH 1PH8A 5M3FH 3GTOH 3H3VI 4A93G 1RL2A 1KRTA 1FVIA 1XMQQ 4BBRG 2JA6G 4YCWA 1A63A 4KHPQ 4JI0L 1HNWQ 1KIXA 1VQMA 4NXNQ 1I6HH 3S24A 4JI2Q 1B70B 1UE6A 2WFWA 2PI2A 1Y14B 3TEHB 5C0XI 5LMNQ 2K5HA 4JI1Q 3UDGA 4A3JH 2NVXH 2D0OA 1Q7YC 1KQSA 4DR7L 4FDBA 1MJEA 2ZM6Q 3JC66 4YWKA 4DUYL 1OXUA 1I5FA 1VQ5A 2N78A 2F4VQ 2JJQA 4JYAQ 2PNHA 3CCRA 1K9MC 4DK6C 1YI2A 4JI3L 4EX5A 2CWAA 3CC4A 2ZTCA 4IPCA 4BY1G 5JEAJ 2E2JH 4JI8L 4GOPB 1VQ7A 3EBEA 1E1TA 1SE8A 3W5OA 3BZCA 2MQHA 2Z6KA 4HJAA 1K8GA 2QGQA 2UXCQ 2RCNA 4A3FH 3U58A 3ERSX 2AMCB 2JA7H 1I3QH 3OYYA 4GKKL 2LSSA 4R1JA 3ULPA 1L1OC 5C3EG 2OQKA 4K0KQ 4GOPA 5GAEC 1GD7A 2UUAL 5C44G 2OTLA 4IOAA 1K83H 4R4IA 3RLOA 4APVA 4R4OA 3CC2A 4DR5L 1IBLL 1NY4A 1XTDA 2ZTEA 3T1YL 4LF4Q 3HOWH 5K36G 1Z47A 4A3IG 4LFCQ 1E3PA 1U5KA 1IXRA 2JE6I 4IJHA 3PUWA 3UDIA 5IYDG 1XNQL 4A3GG 3ER0A 1SLJA 3HKSA 2AKWB 3G71A 1KL9A 3T1HQ 2VQEQ 4LUZA 3M7NA 2N3SA 3I4NG 1JJ2A 4LFCL 5C4JH 4NXML 5C4XG 3CXCA 3M4PA 4DR1Q 1K3RA 4LF8Q 1VQAA 4LUOA 1AH9A 1PH7A 2R92G 3PF5A 2MO1A 4X64Q 3HOUH 1VQFA 3A5ZB 1S40A 1YVCA 4JBWA 2JA8G 4GNXB 2ATWA 1L2FA 2PQAA 2CFMA 3JAMc 1UEBA 1CKOA 4PZ7A 4RMFA 4JBJA 3SGIA 3F2DA 1PA6A 5EAYA 2E5LQ 3PUXA 3PF4A 4LFBQ 3G48A 1Q1EA 5AJ3Q 1EIYB 4L5SA 2VNUD 1HZAA 1PHJA 3PGZA 1DGSA 1G291 3UE0A 5C0XJ 4LUVA 5M5XH 2BH8A 4KLKA 1V9PA 4UPAA 3M3YH 3D0FA 2NVTH 4AYBG 4A3BH 1Y1WG 2VUMG 3I4MG 3HOVG 4DV3L 1UE1A 1VQCA 3K7AH 3KJPA 3PUVA 4A3DG 2GVBA 4OWTB 3CCQA 3M9BA 1U0LA 1VQPA 3LGJA 1ASZA 3CF5A 4GN4B 1B8AA 2K4KA 1S3OA 2OCEA 2AWOA 2UUCQ 4GKJL 2UXBQ 3K80C 3ULJA 4A93H 5GADC 4B3MQ 1EOVA 1TWGH 2UU9L 4OX9Q 3CD6A 4DV4Q 1W2BA 3J81i 4JCVE 2MNAA 2NVYH 3J81c 5LMUL 3H3VH 1OXSC 3IRBA 4PG3A 1L1OB 1X54A 4WJ4A 3TQYA 4HIOA 1VQIA 3A5UA 2VQEL 1C9OA 1AE2A 1B7YB 1A62A 1VQGA 1YHQA 2NN6I 1E7ZA 1HR0W 2UU9Q 3PIOA 1WYDA 4UP7A 2JEAI 3U4ZA 3GTPH 3HOYG 3FHWA 3S16H 4X64L 1YIJA 1I50H 4ALPA 4X66Q 2I5HA 5M3MH 3KJOA 1VQDA 4DR6Q 4X65Q 4MZ9A 2Z6KC 4UP8A 2IHFA 4IPDA 2GN5A 1KAWA 2R93G 4ME3A 2NZOA 3E9HA 1CSPA 1X3GA 4C3JH 1K73C 2JA5H 3CCUA 2Y0SG 4AQYQ 2LXJA 2JEBI 4DR7Q 5FJ8G 3PCOB 4A3FG 2IY5B 2RF4A 3G4SA 3CCLA 4LF7Q 2CWPA 4QIWE 2BA1A 2YTYA 3H0GG 4YCUA 3J80i 1VS0A 4BXXG 4IFDI 2MO0A 3AYHB 1TWCH 2IT1A 4RG1A 1P8LA 4AYBE 1FGUA 4HJ5A 1IBML 5C44H 1NJIC 1HNZQ 2K52A 3PUYA 2PI2E 4DUZQ 3KFUA 1Z9FA 1T9HA 2EQSA 3E9IA 3PO3H 4WJ3M 4BA2I 4A3IH 5JJLA 5FLMG 4A3LG 3KDFB 4JI6L 1EIFA 2YV5A 5J3BA 3TS0A 1YJNA 1M1KC 1TWFH 2KCTA 3G6EA 4A3GH 1FJGL 1HJPA 1TWAH 1Y1VG 4DPGA 4IO9A 5IY0A 4JI1L 4NPSA 2D62A 3TREA 3T1YQ 2JK8A 3STBC 4QL5A 4A3EH 5M5WH 4DR5Q 1LYLA 2R92H 1CUKA 2UUAQ 1VQEA 4GS3A 5JEAG 4L5RC 4LWCA 4P73A 1P16A 4JBMA 1N34L 4HIKA 1XPOA 1N36Q 3RZOH 1YJ9A 3GTJH 4IFDJ 5JJKA 2A1AA 1BBUA 2B63H 5ELNA 4YHHL 4DV3Q 4JI3Q 3UDFA 1I94Q 3DLLA 2CCZA 5IYCH 1IBKL 2N8NA 4GNXC 1UE7A 4DV7L 1VQLA 1TXYA 2HQLA 3E0EA 4JI5L 4A3KH 3HOXH 2AHOB 1VCIA 1Q8KA 5GROA 4L5TA 3I56A 3K81C 4DV2Q 2R7ZH 2UXDL 2Z0SA 2K14A 4DNIA 1HNXL 2R7FA 4OWWB 2Q2IA 5C4XH 4QGUA 4QY7A 1EUJA 1VQKA 5IP7G 1HNZL 2K5VA 1GM5A 2K50A 3F2BA 4DV0L 3S1NH 3KOJA 4IJLA 1HNWL 5IWAL 1XNRL 2JA9A 3PO2H 1LUZA 2F4VL 1IBKQ 4Y52H 1XPUA 4IFDG 5IYBG 1SR3A 4DAMA 1LTLA 2KHJA 4A3CG 5GAGC 4POFA 2AWNA 4GLAC 3RR5A 2ID0A 4HIMA 3J7A5 4BBSH 2WAQG 3S1RH 1BKBA 3OW2A 4JV5Q 5M3FG 3T1HL 3FKIG 1FJGQ 2VQFQ 3EIVA 1E24A 3S15H 3CMAA 3CCMA 3GTGH 1HZBA 4AH6A 4PMWA 2UXBL 1E22A 3CP0A 4DK3C 3U50C 1YEZA 5M3MG 1A8VA 3AEVA 3A74A 2BH2A 3PSIA 2R93H 4OXPA 2QA4A 4JG2A 4TVAB 5M5YH 4JI0Q 3PIPA 1JJGA 3L7ZC 1N8RC 5GQOA 2LXKA 3CMEA 1I94L 4P71A 5FJ8H 1EWIA 1OXVA 1SN8A 1QZGA 3CAMA 4YHHQ 3J7ZC 4BY1H 4DR4L 2A8VA 4QQBX 1D7QA 4A76A 4BBRH 1X56A 5DLQE 2ZJRA 1N33Q 2JA6H 3S1QH 4DAYB 4JI5Q 4YY3Q 1PH3A 4A75A 4DR2L 2ALYB 1MKHA 4DV5Q 3NEMA 3CC7A 4DV0Q 3CCVA 1VQ4A 1ASYA 4LF5L 1C0AA 1XNQQ 1PH2A 4KHZA 4A3JG 2WAQE 3FP9A 1YJWA 4YWMA 2KCMA 5E7NA 1IYJB 2WB1G 4H02A 3NBHB 4A3LH 5C3EH 1E1OA 3RLNA 1VQJA 3K7UC 4DV1L 5FLXc 4BY7G 3HKZE 3EN2A 1Y1VH 2XGTA 1EFWA 1WCMG 4GOPC 4IOCA 3GTQH 1HH2P 2A19A 3HOWG 4LFBL 4UY8C 4JI2L 1N36L 4LNQA 4OX9L 4DR2Q 3M4OH 1UE5A 3W1GA 4DV1Q 3K8AA 3PV0A 1SMXA 2UUBL 3J80c 2JA7G 1WJJA 1W3SA 1CKNA 2F3IA 4LF6L 1HZCA 2EXDA 2KENA 3H15A 3S2HH 4YWLA 2OTJA 4BY7H 1EQRA 4R4CA 1GKHA 4GLVB 4A3MG 1QUQA 2Y0SE 2MFIA 2YYZA 3OTOQ 1R9TH 3KLWA 1EYGA 3NENA 2HIXA 4NB3A 5IWAQ 2F52A 1XNRQ 4B3TL 2VW9A 1GO3E 1HZ9A 5BR8L 2JA8H 4OWXB 3KYHC 4GN5A 2I5LX 1N33L 3UDXA 2E2IH 2WP8J 2PQAB 1WI5A 2UUCL 1WFQA 1D8LA 4C2MH 5IT9c 3HFZB 4LF7L 1JE5A 3BU2A 3W1BA 1V43A 4B3SQ 4LF6Q 4NXMQ 5IYDH 3F2CA 1VQHA 2VS1A 1KXLA 5IP7H 4PZ8A 4NXNL 3F1ZA 2UUBQ 5JJIA 2GVAA 3L0OA 5BR8Q 4JBKA 1Q86C 4KHPL 3PO2G 1X3EA 2B29A 2NZHA 2JQOA 2NVQH 2IX1A 3I4NH 2HHHL 4A3BG 5IYBH 1S72A 4PZ6A 5LMNL 2BA0A 1O7IA 4A3DH 4A3CH 1KRSA 3GO5A 4DUZL 2IX0A 5AJ3L 1PH1A 1QZHA 1PYSB 1X3FA 2DUDA 2I5MX 1PH6A 1YNXA 2HIVA 1IBLQ 3I2ZA 3CCSA 3HOUG 4B3RQ 3FKIH 4TQUS 4DR3L 3AQQA 2ZJQA 1YHAA 2V1CC 4GLXA 4GKJQ 1YHBA 4XIGS 4AIMA 1YITA 1JJCB 1FL0A 1Q12A 2E8GA 2Q2TA 1G51A 1HR0L 4R4TA 5HGQA 1XPRA 4R4QA 3CPWA 1J5EQ 2VUMH 2WB1E 1IZ6A 3HOVH 3HOYH 1X6OA 4GNXA 2XTIA 4GN3B 3KF6B 4LF8L 3PUZA 1V1QA 5C0XG 1XMOQ 1CKNB 4LF5Q 4JI7L 4LF9Q 1GVPA 2N49A 2UXDQ 5H1SE 4JI4Q 1TWHH 1VQNA 4C3IH 4DV7Q 2VL6A 2NN6G 1HR0Q 2JA5G 4K0KL 1QVGA 2PMZE 5IP9G 4Y7NH 1M90C 4O0AA 1PV4A 3RN5A 1NTGA 5IE8A 4LF9L 4JI8Q 3HOZG 4DV6Q 4IPGA 1L0WA 3BJUA 3H0GH 4DR6L 1CSQA 1MJCA 1JB7A 4DV2L 3ICEA 4JOIC 4LFAQ 1J5EL 3TRZA 4UP9A 3AFPA 3S14H 4BXXH 4JYAL 3I7FA 1SRUA 1NE3A 1OXXK 1K0RA 2CKZB 3MXNB 2UXCL 5HY6A 4JI4L 1C7YA 3MEFA 4P72A 1X65A 4HJ8A 3S2DH 1OTCA 4DV6L 1WCMH 4EQ5A 4O2DA 2QEXA 1CKMA 4OO1I 1PH4A 2IHEA 5FLMH 1N34Q 1IBMQ 2D0PA 4DR3Q 3WWVA 3ULLA 3D31A 4JC0A 4YY3L 3KDFA 1KHIA 2ES2A 1VQ6A 1AE3A 3TS2A 4KI0A 1BBWA 4IPHA 5LMNW 2H5XA 3J81j 1OXTA 2VY3A 1QVCA 1K8AC 1Q46A 3NELA 1N32Q 4P74A 1N9WA 2CQOA 1NMGA 2DGYA 3UE1A 4A4IA 2KHIA 4B3SL 1IL2A 3S17H 3GDEA 1WOCA 4L5QA 4X66L 4QJFA 3VDYA 1JMCA 1Q1BA 4A3MH 2E2HH 2OWOA 4A3EG 3F8TA 1UWVA 1NBWA 1J6QA 1H95A 1BVSA 1SROA 1X55A 1EQQA 1KC8C 1QUQB 3RLFA 3U4VA 4X62Q 3L2PA 4JV5L 3PO3G 3CCEA 3BZKA 4X6AH 1YZ6A 2B63G 1N32L 3JAMi 1JT8A 3RZDH 2HHHQ 1NMFA 1MIUA 2VZAA 3KF8B 3AFQA 2C35B 4JOIA 4AQYL 1L1OA 4J15A 4HJ9A 1G6PA 3I55A 2VQFL 4A3KG 1VQOA 4B3RL 3GTKH 4LFAL 3M85A 1PH9A 2ZTDA 2R7ZG 2K5NA 3K0XA 4DKAC 4DR1L 1PYBA 1PVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ7 A;  3ZJY C;  4X62 L;  2E5L L;  4DV5 L;  2RHQ B;  4OON A;  3I4O A;  2OQ0 A;  3CQZ H;  1VQ9 A;  4HID A;  4B3T Q;  2EIF A;  2Q2H A;  2ZJP A;  4JI6 Q;  4MNO A;  2FXQ A;  3M4Q A;  2YTX A;  1QVF A;  1XMO L;  2ASB A;  3GTM H;  3STB D;  4DR4 Q;  2YTV A;  4BBS G;  1HNX Q;  3RN2 A;  5IYC G;  4P75 A;  2R6G A;  3Q8D A;  5GAH C;  2HT1 A;  4XTC S;  4POG A;  3HKZ G;  2Q2U A;  3HOX G;  2R7D A;  1RIP A;  2YU9 H;  4B3M L;  4MTN A;  5ELO A;  1XMQ L;  1X9N A;  4JI7 Q;  1KD1 C;  4YCV A;  1Q82 C;  4OO1 G;  1A0I A;  3GTL H;  1LM0 A;  5LMU Q;  1XJV A;  3CPF A;  2RHS B;  1Q81 C;  2I0Q A;  4GKK Q;  3B6Y A;  4DV4 L;  1PFS A;  4BA1 I;  3GD7 A;  3DM3 A;  1VQ8 A;  3KF6 A;  2K75 A;  2L15 A;  4LW1 A;  2B3G A;  2KBN A;  2ZM6 L;  4DUY Q;  1Y1W H;  3A0J A;  3CW2 C;  4C3H H;  3CCJ A;  1SFO H;  3I4M H;  3OTO L;  1PH5 A;  5IP9 H;  3S1M H;  1YBY A;  4X65 L;  3RNU A;  1VQB A;  4LF4 L;  3HOZ H;  1PH8 A;  5M3F H;  3GTO H;  3H3V I;  4A93 G;  1RL2 A;  1KRT A;  1FVI A;  1XMQ Q;  4BBR G;  2JA6 G;  4YCW A;  1A63 A;  4KHP Q;  4JI0 L;  1HNW Q;  1KIX A;  1VQM A;  4NXN Q;  1I6H H;  3S24 A;  4JI2 Q;  1B70 B;  1UE6 A;  2WFW A;  2PI2 A;  1Y14 B;  3TEH B;  5C0X I;  5LMN Q;  2K5H A;  4JI1 Q;  3UDG A;  4A3J H;  2NVX H;  2D0O A;  1Q7Y C;  1KQS A;  4DR7 L;  4FDB A;  1MJE A;  2ZM6 Q;  3JC6 6;  4YWK A;  4DUY L;  1OXU A;  1I5F A;  1VQ5 A;  2N78 A;  2F4V Q;  2JJQ A;  4JYA Q;  2PNH A;  3CCR A;  1K9M C;  4DK6 C;  1YI2 A;  4JI3 L;  4EX5 A;  2CWA A;  3CC4 A;  2ZTC A;  4IPC A;  4BY1 G;  5JEA J;  2E2J H;  4JI8 L;  4GOP B;  1VQ7 A;  3EBE A;  1E1T A;  1SE8 A;  3W5O A;  3BZC A;  2MQH A;  2Z6K A;  4HJA A;  1K8G A;  2QGQ A;  2UXC Q;  2RCN A;  4A3F H;  3U58 A;  3ERS X;  2AMC B;  2JA7 H;  1I3Q H;  3OYY A;  4GKK L;  2LSS A;  4R1J A;  3ULP A;  1L1O C;  5C3E G;  2OQK A;  4K0K Q;  4GOP A;  5GAE C;  1GD7 A;  2UUA L;  5C44 G;  2OTL A;  4IOA A;  1K83 H;  4R4I A;  3RLO A;  4APV A;  4R4O A;  3CC2 A;  4DR5 L;  1IBL L;  1NY4 A;  1XTD A;  2ZTE A;  3T1Y L;  4LF4 Q;  3HOW H;  5K36 G;  1Z47 A;  4A3I G;  4LFC Q;  1E3P A;  1U5K A;  1IXR A;  2JE6 I;  4IJH A;  3PUW A;  3UDI A;  5IYD G;  1XNQ L;  4A3G G;  3ER0 A;  1SLJ A;  3HKS A;  2AKW B;  3G71 A;  1KL9 A;  3T1H Q;  2VQE Q;  4LUZ A;  3M7N A;  2N3S A;  3I4N G;  1JJ2 A;  4LFC L;  5C4J H;  4NXM L;  5C4X G;  3CXC A;  3M4P A;  4DR1 Q;  1K3R A;  4LF8 Q;  1VQA A;  4LUO A;  1AH9 A;  1PH7 A;  2R92 G;  3PF5 A;  2MO1 A;  4X64 Q;  3HOU H;  1VQF A;  3A5Z B;  1S40 A;  1YVC A;  4JBW A;  2JA8 G;  4GNX B;  2ATW A;  1L2F A;  2PQA A;  2CFM A;  3JAM c;  1UEB A;  1CKO A;  4PZ7 A;  4RMF A;  4JBJ A;  3SGI A;  3F2D A;  1PA6 A;  5EAY A;  2E5L Q;  3PUX A;  3PF4 A;  4LFB Q;  3G48 A;  1Q1E A;  5AJ3 Q;  1EIY B;  4L5S A;  2VNU D;  1HZA A;  1PHJ A;  3PGZ A;  1DGS A;  1G29 1;  3UE0 A;  5C0X J;  4LUV A;  5M5X H;  2BH8 A;  4KLK A;  1V9P A;  4UPA A;  3M3Y H;  3D0F A;  2NVT H;  4AYB G;  4A3B H;  1Y1W G;  2VUM G;  3I4M G;  3HOV G;  4DV3 L;  1UE1 A;  1VQC A;  3K7A H;  3KJP A;  3PUV A;  4A3D G;  2GVB A;  4OWT B;  3CCQ A;  3M9B A;  1U0L A;  1VQP A;  3LGJ A;  1ASZ A;  3CF5 A;  4GN4 B;  1B8A A;  2K4K A;  1S3O A;  2OCE A;  2AWO A;  2UUC Q;  4GKJ L;  2UXB Q;  3K80 C;  3ULJ A;  4A93 H;  5GAD C;  4B3M Q;  1EOV A;  1TWG H;  2UU9 L;  4OX9 Q;  3CD6 A;  4DV4 Q;  1W2B A;  3J81 i;  4JCV E;  2MNA A;  2NVY H;  3J81 c;  5LMU L;  3H3V H;  1OXS C;  3IRB A;  4PG3 A;  1L1O B;  1X54 A;  4WJ4 A;  3TQY A;  4HIO A;  1VQI A;  3A5U A;  2VQE L;  1C9O A;  1AE2 A;  1B7Y B;  1A62 A;  1VQG A;  1YHQ A;  2NN6 I;  1E7Z A;  1HR0 W;  2UU9 Q;  3PIO A;  1WYD A;  4UP7 A;  2JEA I;  3U4Z A;  3GTP H;  3HOY G;  3FHW A;  3S16 H;  4X64 L;  1YIJ A;  1I50 H;  4ALP A;  4X66 Q;  2I5H A;  5M3M H;  3KJO A;  1VQD A;  4DR6 Q;  4X65 Q;  4MZ9 A;  2Z6K C;  4UP8 A;  2IHF A;  4IPD A;  2GN5 A;  1KAW A;  2R93 G;  4ME3 A;  2NZO A;  3E9H A;  1CSP A;  1X3G A;  4C3J H;  1K73 C;  2JA5 H;  3CCU A;  2Y0S G;  4AQY Q;  2LXJ A;  2JEB I;  4DR7 Q;  5FJ8 G;  3PCO B;  4A3F G;  2IY5 B;  2RF4 A;  3G4S A;  3CCL A;  4LF7 Q;  2CWP A;  4QIW E;  2BA1 A;  2YTY A;  3H0G G;  4YCU A;  3J80 i;  1VS0 A;  4BXX G;  4IFD I;  2MO0 A;  3AYH B;  1TWC H;  2IT1 A;  4RG1 A;  1P8L A;  4AYB E;  1FGU A;  4HJ5 A;  1IBM L;  5C44 H;  1NJI C;  1HNZ Q;  2K52 A;  3PUY A;  2PI2 E;  4DUZ Q;  3KFU A;  1Z9F A;  1T9H A;  2EQS A;  3E9I A;  3PO3 H;  4WJ3 M;  4BA2 I;  4A3I H;  5JJL A;  5FLM G;  4A3L G;  3KDF B;  4JI6 L;  1EIF A;  2YV5 A;  5J3B A;  3TS0 A;  1YJN A;  1M1K C;  1TWF H;  2KCT A;  3G6E A;  4A3G H;  1FJG L;  1HJP A;  1TWA H;  1Y1V G;  4DPG A;  4IO9 A;  5IY0 A;  4JI1 L;  4NPS A;  2D62 A;  3TRE A;  3T1Y Q;  2JK8 A;  3STB C;  4QL5 A;  4A3E H;  5M5W H;  4DR5 Q;  1LYL A;  2R92 H;  1CUK A;  2UUA Q;  1VQE A;  4GS3 A;  5JEA G;  4L5R C;  4LWC A;  4P73 A;  1P16 A;  4JBM A;  1N34 L;  4HIK A;  1XPO A;  1N36 Q;  3RZO H;  1YJ9 A;  3GTJ H;  4IFD J;  5JJK A;  2A1A A;  1BBU A;  2B63 H;  5ELN A;  4YHH L;  4DV3 Q;  4JI3 Q;  3UDF A;  1I94 Q;  3DLL A;  2CCZ A;  5IYC H;  1IBK L;  2N8N A;  4GNX C;  1UE7 A;  4DV7 L;  1VQL A;  1TXY A;  2HQL A;  3E0E A;  4JI5 L;  4A3K H;  3HOX H;  2AHO B;  1VCI A;  1Q8K A;  5GRO A;  4L5T A;  3I56 A;  3K81 C;  4DV2 Q;  2R7Z H;  2UXD L;  2Z0S A;  2K14 A;  4DNI A;  1HNX L;  2R7F A;  4OWW B;  2Q2I A;  5C4X H;  4QGU A;  4QY7 A;  1EUJ A;  1VQK A;  5IP7 G;  1HNZ L;  2K5V A;  1GM5 A;  2K50 A;  3F2B A;  4DV0 L;  3S1N H;  3KOJ A;  4IJL A;  1HNW L;  5IWA L;  1XNR L;  2JA9 A;  3PO2 H;  1LUZ A;  2F4V L;  1IBK Q;  4Y52 H;  1XPU A;  4IFD G;  5IYB G;  1SR3 A;  4DAM A;  1LTL A;  2KHJ A;  4A3C G;  5GAG C;  4POF A;  2AWN A;  4GLA C;  3RR5 A;  2ID0 A;  4HIM A;  3J7A 5;  4BBS H;  2WAQ G;  3S1R H;  1BKB A;  3OW2 A;  4JV5 Q;  5M3F G;  3T1H L;  3FKI G;  1FJG Q;  2VQF Q;  3EIV A;  1E24 A;  3S15 H;  3CMA A;  3CCM A;  3GTG H;  1HZB A;  4AH6 A;  4PMW A;  2UXB L;  1E22 A;  3CP0 A;  4DK3 C;  3U50 C;  1YEZ A;  5M3M G;  1A8V A;  3AEV A;  3A74 A;  2BH2 A;  3PSI A;  2R93 H;  4OXP A;  2QA4 A;  4JG2 A;  4TVA B;  5M5Y H;  4JI0 Q;  3PIP A;  1JJG A;  3L7Z C;  1N8R C;  5GQO A;  2LXK A;  3CME A;  1I94 L;  4P71 A;  5FJ8 H;  1EWI A;  1OXV A;  1SN8 A;  1QZG A;  3CAM A;  4YHH Q;  3J7Z C;  4BY1 H;  4DR4 L;  2A8V A;  4QQB X;  1D7Q A;  4A76 A;  4BBR H;  1X56 A;  5DLQ E;  2ZJR A;  1N33 Q;  2JA6 H;  3S1Q H;  4DAY B;  4JI5 Q;  4YY3 Q;  1PH3 A;  4A75 A;  4DR2 L;  2ALY B;  1MKH A;  4DV5 Q;  3NEM A;  3CC7 A;  4DV0 Q;  3CCV A;  1VQ4 A;  1ASY A;  4LF5 L;  1C0A A;  1XNQ Q;  1PH2 A;  4KHZ A;  4A3J G;  2WAQ E;  3FP9 A;  1YJW A;  4YWM A;  2KCM A;  5E7N A;  1IYJ B;  2WB1 G;  4H02 A;  3NBH B;  4A3L H;  5C3E H;  1E1O A;  3RLN A;  1VQJ A;  3K7U C;  4DV1 L;  5FLX c;  4BY7 G;  3HKZ E;  3EN2 A;  1Y1V H;  2XGT A;  1EFW A;  1WCM G;  4GOP C;  4IOC A;  3GTQ H;  1HH2 P;  2A19 A;  3HOW G;  4LFB L;  4UY8 C;  4JI2 L;  1N36 L;  4LNQ A;  4OX9 L;  4DR2 Q;  3M4O H;  1UE5 A;  3W1G A;  4DV1 Q;  3K8A A;  3PV0 A;  1SMX A;  2UUB L;  3J80 c;  2JA7 G;  1WJJ A;  1W3S A;  1CKN A;  2F3I A;  4LF6 L;  1HZC A;  2EXD A;  2KEN A;  3H15 A;  3S2H H;  4YWL A;  2OTJ A;  4BY7 H;  1EQR A;  4R4C A;  1GKH A;  4GLV B;  4A3M G;  1QUQ A;  2Y0S E;  2MFI A;  2YYZ A;  3OTO Q;  1R9T H;  3KLW A;  1EYG A;  3NEN A;  2HIX A;  4NB3 A;  5IWA Q;  2F52 A;  1XNR Q;  4B3T L;  2VW9 A;  1GO3 E;  1HZ9 A;  5BR8 L;  2JA8 H;  4OWX B;  3KYH C;  4GN5 A;  2I5L X;  1N33 L;  3UDX A;  2E2I H;  2WP8 J;  2PQA B;  1WI5 A;  2UUC L;  1WFQ A;  1D8L A;  4C2M H;  5IT9 c;  3HFZ B;  4LF7 L;  1JE5 A;  3BU2 A;  3W1B A;  1V43 A;  4B3S Q;  4LF6 Q;  4NXM Q;  5IYD H;  3F2C A;  1VQH A;  2VS1 A;  1KXL A;  5IP7 H;  4PZ8 A;  4NXN L;  3F1Z A;  2UUB Q;  5JJI A;  2GVA A;  3L0O A;  5BR8 Q;  4JBK A;  1Q86 C;  4KHP L;  3PO2 G;  1X3E A;  2B29 A;  2NZH A;  2JQO A;  2NVQ H;  2IX1 A;  3I4N H;  2HHH L;  4A3B G;  5IYB H;  1S72 A;  4PZ6 A;  5LMN L;  2BA0 A;  1O7I A;  4A3D H;  4A3C H;  1KRS A;  3GO5 A;  4DUZ L;  2IX0 A;  5AJ3 L;  1PH1 A;  1QZH A;  1PYS B;  1X3F A;  2DUD A;  2I5M X;  1PH6 A;  1YNX A;  2HIV A;  1IBL Q;  3I2Z A;  3CCS A;  3HOU G;  4B3R Q;  3FKI H;  4TQU S;  4DR3 L;  3AQQ A;  2ZJQ A;  1YHA A;  2V1C C;  4GLX A;  4GKJ Q;  1YHB A;  4XIG S;  4AIM A;  1YIT A;  1JJC B;  1FL0 A;  1Q12 A;  2E8G A;  2Q2T A;  1G51 A;  1HR0 L;  4R4T A;  5HGQ A;  1XPR A;  4R4Q A;  3CPW A;  1J5E Q;  2VUM H;  2WB1 E;  1IZ6 A;  3HOV H;  3HOY H;  1X6O A;  4GNX A;  2XTI A;  4GN3 B;  3KF6 B;  4LF8 L;  3PUZ A;  1V1Q A;  5C0X G;  1XMO Q;  1CKN B;  4LF5 Q;  4JI7 L;  4LF9 Q;  1GVP A;  2N49 A;  2UXD Q;  5H1S E;  4JI4 Q;  1TWH H;  1VQN A;  4C3I H;  4DV7 Q;  2VL6 A;  2NN6 G;  1HR0 Q;  2JA5 G;  4K0K L;  1QVG A;  2PMZ E;  5IP9 G;  4Y7N H;  1M90 C;  4O0A A;  1PV4 A;  3RN5 A;  1NTG A;  5IE8 A;  4LF9 L;  4JI8 Q;  3HOZ G;  4DV6 Q;  4IPG A;  1L0W A;  3BJU A;  3H0G H;  4DR6 L;  1CSQ A;  1MJC A;  1JB7 A;  4DV2 L;  3ICE A;  4JOI C;  4LFA Q;  1J5E L;  3TRZ A;  4UP9 A;  3AFP A;  3S14 H;  4BXX H;  4JYA L;  3I7F A;  1SRU A;  1NE3 A;  1OXX K;  1K0R A;  2CKZ B;  3MXN B;  2UXC L;  5HY6 A;  4JI4 L;  1C7Y A;  3MEF A;  4P72 A;  1X65 A;  4HJ8 A;  3S2D H;  1OTC A;  4DV6 L;  1WCM H;  4EQ5 A;  4O2D A;  2QEX A;  1CKM A;  4OO1 I;  1PH4 A;  2IHE A;  5FLM H;  1N34 Q;  1IBM Q;  2D0P A;  4DR3 Q;  3WWV A;  3ULL A;  3D31 A;  4JC0 A;  4YY3 L;  3KDF A;  1KHI A;  2ES2 A;  1VQ6 A;  1AE3 A;  3TS2 A;  4KI0 A;  1BBW A;  4IPH A;  5LMN W;  2H5X A;  3J81 j;  1OXT A;  2VY3 A;  1QVC A;  1K8A C;  1Q46 A;  3NEL A;  1N32 Q;  4P74 A;  1N9W A;  2CQO A;  1NMG A;  2DGY A;  3UE1 A;  4A4I A;  2KHI A;  4B3S L;  1IL2 A;  3S17 H;  3GDE A;  1WOC A;  4L5Q A;  4X66 L;  4QJF A;  3VDY A;  1JMC A;  1Q1B A;  4A3M H;  2E2H H;  2OWO A;  4A3E G;  3F8T A;  1UWV A;  1NBW A;  1J6Q A;  1H95 A;  1BVS A;  1SRO A;  1X55 A;  1EQQ A;  1KC8 C;  1QUQ B;  3RLF A;  3U4V A;  4X62 Q;  3L2P A;  4JV5 L;  3PO3 G;  3CCE A;  3BZK A;  4X6A H;  1YZ6 A;  2B63 G;  1N32 L;  3JAM i;  1JT8 A;  3RZD H;  2HHH Q;  1NMF A;  1MIU A;  2VZA A;  3KF8 B;  3AFQ A;  2C35 B;  4JOI A;  4AQY L;  1L1O A;  4J15 A;  4HJ9 A;  1G6P A;  3I55 A;  2VQF L;  4A3K G;  1VQO A;  4B3R L;  3GTK H;  4LFA L;  3M85 A;  1PH9 A;  2ZTD A;  2R7Z G;  2K5N A;  3K0X A;  4DKA C;  4DR1 L;  1PYB A;  1PVO A; 
#chains in the Genus database with same CATH topology
 1PZJ D;  4X62 L;  1SYG A;  1SYC A;  1EWC A;  4I65 A;  2EJM A;  3A8I E;  4RAU C;  4NW2 A;  4JI6 Q;  2FXQ A;  2JSO A;  3BYY B;  2ASB A;  3GTM H;  3P7J A;  1Y1W B;  2QDB A;  3RN2 A;  5IYC G;  4P75 A;  3S2D B;  2R6G A;  3MC0 B;  3Q8D A;  2KEC A;  5GAH C;  2XRS D;  4G7Z C;  4MHE A;  4JI7 Q;  5M3F B;  2HQE A;  2DY8 A;  1WD0 A;  1LM0 A;  2IX3 A;  3DMU A;  1PFS A;  1WTR A;  3GD7 A;  3DM3 A;  3HOW B;  2K75 A;  2F0V A;  2B2V C;  3NWS A;  1SXT A;  3P20 A;  2F0H A;  2NVX B;  1LV9 A;  3OTO L;  4K5X A;  3S1M H;  2Z4I A;  4X65 L;  1HA6 A;  1VQB A;  3HOZ H;  4K14 A;  5M3F H;  1FVI A;  1S4Z A;  1SJE D;  5KYL A;  1GHJ A;  1EY6 A;  2SEB D;  3EFX D;  1HNW Q;  1KIX A;  3K59 A;  3S24 A;  1VF7 A;  4I7A A;  5DM7 3;  3VYU A;  4Q0F A;  1Y14 B;  4A3J H;  3OIQ A;  4DR7 L;  1KQS A;  1Q7Y C;  2LMC B;  1SBB B;  4FDB A;  2ZM6 Q;  3JC6 6;  2XRQ D;  5C5M A;  2X69 A;  3G6J B;  4EX5 A;  1GUS A;  4BY1 G;  2E2J H;  4JI8 L;  4GOP B;  1VQ7 A;  3EBE A;  4R8N A;  3BZC A;  2RDF A;  3K7A B;  2O5J C;  1XXG A;  4DN4 M;  2YU9 B;  4R1J A;  2E76 C;  4FXD A;  1ET6 A;  1V8Q A;  2PW5 A;  4K0K Q;  4DNT B;  4GOP A;  5J39 A;  3DWQ A;  1GD7 A;  4R4I A;  2RKS A;  3L3O C;  1PRT C;  4BWG B;  4K6D A;  1B2T A;  1Z47 A;  1H9M A;  3HKZ B;  4LFC Q;  1YNN C;  1IXR A;  4A3F B;  1XNQ L;  3PUW A;  1SLJ A;  1R4Q B;  2F0O A;  2AKW B;  1R4P B;  3T1H Q;  2WIN B;  2A74 C;  3D4W A;  3MTS A;  3M7N A;  3I4L A;  3CXC A;  1QCB D;  3M4P A;  4DR1 Q;  1K3R A;  2NVT B;  1PTO F;  3DWA A;  5IGF A;  4X64 Q;  1S40 A;  5F2D A;  5JEA H;  1AW7 A;  2JA8 G;  2CFM A;  1UEB A;  2OF1 A;  3PUX A;  4WJW A;  1Q1E A;  4KKT A;  5EQ0 A;  1K8M A;  2RSO A;  3PGZ A;  2B2Y C;  5EPJ A;  2NVY B;  1V9P A;  1ET9 A;  3M3Y H;  2LFN A;  1KNA A;  2NVT H;  4GZY C;  3I4M G;  1B9M A;  3PUV A;  2GVB A;  4JV5 Q;  3LGJ A;  4XT1 B;  3CF5 A;  4GN4 B;  2F4I A;  1T5X D;  4A93 H;  3MXU A;  1TU2 B;  4HSV A;  3J81 i;  2MNA A;  3ERQ A;  3J81 c;  3H3V H;  3SK6 A;  4HIO A;  3A5U A;  1JR0 D;  4A3B B;  1C9O A;  1AE2 A;  1B7Y B;  2Z6B A;  1YHQ A;  1E7Z A;  3Q23 A;  2UU9 Q;  1EU4 A;  3OHX C;  1RTN A;  4MN3 A;  3HOY G;  4X64 L;  1I50 H;  4IPD A;  4ME3 A;  2A68 D;  3E9H A;  1KNE A;  1SE2 A;  5CV8 A;  4C3I G;  4X3S A;  2Y0S G;  2LXJ A;  1JWU D;  1D1K A;  4C1N I;  3H0G G;  4F7X A;  1VS0 A;  4BXX G;  1LTG D;  4IFD I;  2IT1 A;  4AYB E;  3O13 A;  4HJ5 A;  1LTB D;  1NJI C;  2K32 A;  2K52 A;  2DY7 A;  2F0F A;  2PI2 E;  2PPB C;  4DUZ Q;  3MXN A;  3GTG B;  1IYV A;  3E9I A;  3JAM E;  1IKL A;  4BA2 I;  5FO7 B;  1UNS A;  2K5W A;  3KDF B;  2YV5 A;  3GTJ B;  2MJ8 A;  2EY1 A;  2ZT9 C;  3FMC A;  1B44 D;  3I8Z A;  3E6Z X;  5JVH 3;  4CJ2 C;  4DNR B;  3T1Y Q;  1FGB D;  2E75 C;  2L5T A;  1CUK A;  3K58 A;  1KAA A;  4CJ0 B;  2MPM A;  5E4W C;  4GS3 A;  5IOD A;  5JEA G;  4JBM A;  5D3D A;  3HEJ A;  4FXG C;  3MVV A;  1I4H A;  2B2T C;  2XIW A;  1STB A;  3H09 A;  3GTJ H;  3RZO H;  1BBU A;  1EIG A;  4YHH L;  1PTO B;  5A2Q E;  3UDF A;  4JI3 Q;  2RQX A;  1QG7 A;  3HOX H;  5CBA E;  2NTT A;  4IUT A;  2UXD L;  5IGD A;  1HNX L;  3IKJ A;  5C4X H;  4QGU A;  4QY7 A;  1HNZ L;  1GM5 A;  3D4D A;  3FPU B;  3KOJ A;  3GTQ B;  2FMM A;  1XPU A;  1CHP D;  1AP0 A;  2SOB A;  2AQ3 B;  2KHJ A;  5IT9 L;  4A3C G;  2AWN A;  1GUT A;  2ID0 A;  4BBS H;  5FK9 C;  2F0W A;  3FKI G;  2VQF Q;  4BY1 B;  5D14 A;  1VMP A;  5C4X B;  4IUQ A;  1PDQ A;  2UXB L;  4IN3 A;  1CK1 A;  3GP7 A;  1PFM A;  1TWA B;  3PSI A;  2QA4 A;  3KUP A;  3PIP A;  3L7Z C;  1GUW A;  5GQO A;  4P71 A;  1EWI A;  1SN8 A;  1TY0 A;  1QZG A;  4G57 A;  4IQZ A;  4LAA A;  4QQB X;  1D7Q A;  1L0Y B;  1X56 A;  1M4V A;  2ZJR A;  3S1Q H;  4JI5 Q;  1LTR D;  2A73 B;  4YY3 Q;  3NEM A;  3TP7 A;  4ODG A;  4A3J G;  1YJW A;  1LT5 D;  1IYJ B;  4H02 A;  1GOZ A;  2BOS A;  3NBH B;  1E1O A;  1JOQ A;  3LWU A;  5FLX c;  4M8A A;  2KOL A;  4RHS A;  3E3X A;  1SNO A;  4JPB W;  3S1N B;  2A19 A;  5K36 H;  4UY8 C;  2NB0 A;  3M4O H;  1UE5 A;  5EPK A;  3K8A A;  1NNX A;  1SMX A;  2NUC A;  2UUB L;  4YIJ A;  1BCP F;  1W3S A;  2XSC A;  1HZC A;  2EXD A;  5COY A;  4YWL A;  1WTX A;  1EQR A;  1RDP D;  4GLV B;  1EYG A;  1HRJ A;  2ZXP A;  3FPP A;  2HIX A;  4A3D B;  5IWA Q;  2F0J A;  1MHW C;  1GO3 E;  5BR8 L;  5E1F A;  4OWX B;  4GN5 A;  3ZYY X;  1LO5 D;  3UDX A;  2EYL A;  1JWS D;  5M5Y B;  1WFQ A;  5IT9 c;  1QOH A;  2SNM A;  1JE5 A;  3F2C A;  1VQH A;  2VS1 A;  1KXL A;  4PZ8 A;  4NXN L;  1FNV A;  1J9O A;  3F1Z A;  2UUB Q;  3HRZ C;  4RGM A;  4MIU A;  1R9T B;  4FF4 A;  2NVQ H;  2JA6 B;  3I4N H;  4N9P A;  4OGQ C;  5IYB H;  4A3B G;  4PZ6 A;  5D3I B;  4A3D H;  1KRS A;  3GO5 A;  1BR9 A;  2IX0 A;  2KA7 A;  5AJ3 L;  1SYF A;  1B53 A;  3I2Z A;  5KEE A;  2F1M A;  3FKI H;  4DR3 L;  4ZK9 B;  5IGC A;  3S17 B;  1K0S A;  1LLR D;  1MGS A;  4GKJ Q;  3L9A X;  4IUP A;  3T53 B;  1Q12 A;  1BXT A;  5EJW A;  2I46 A;  1MD2 D;  4R4T A;  3H94 A;  5ELF A;  4R4Q A;  3KF8 A;  4KMU C;  3HOV H;  2KJX A;  1X6O A;  5T1G A;  1A6X A;  3PUZ A;  1V1Q A;  4LF5 Q;  1KLG D;  2KQ3 A;  2UXD Q;  2OT2 A;  1WCM B;  3LWE A;  1VQN A;  4DK0 A;  2JA5 G;  2HD3 A;  1Y8N B;  5FO9 B;  4Y7N H;  2L0C A;  1PV4 A;  3SDZ A;  3RN5 A;  3CQZ B;  5IE8 A;  4JI8 Q;  4DV6 Q;  1ROD A;  1SNQ A;  1JB7 A;  2F0M A;  3ICE A;  5IT9 E;  3S14 H;  1O78 A;  2EYF A;  3I7F A;  4C2M B;  2UXC L;  2CKZ B;  4CDF C;  4V19 0;  1U4P A;  1C7Y A;  2G9H D;  4DV6 L;  2RCF A;  3H6M A;  2HCC A;  3VA7 A;  1TWH B;  4O2D A;  1SNM A;  2QEX A;  1CKM A;  5IGG A;  1BOS A;  1ICF B;  4Y7N B;  3T13 A;  5FLM H;  4IAL A;  1IBM Q;  3WWV A;  1HUN A;  3KDF A;  5G3L F;  5ELB A;  4KI0 A;  5LMN W;  3EQL C;  3J81 j;  3MA2 B;  2PO4 A;  1K8A C;  2K5Q A;  2DGY A;  1NMG A;  2KHI A;  3VR3 A;  1WOC A;  4X66 L;  1JMC A;  2HCI A;  1UWV A;  1LT4 D;  1K28 A;  3HOZ B;  1QIL A;  3GTO B;  1SRO A;  1EQQ A;  5CGK A;  2R3Z A;  3L2P A;  3DXJ C;  3PO3 G;  2B2Y A;  3BZK A;  5IGB A;  1N32 L;  2FFK B;  3KBG A;  2VUM B;  1GUN A;  2Z4H A;  2EYJ A;  2LY7 A;  3QOJ A;  3AFQ A;  3QO2 A;  4JOI A;  1L1O A;  3N52 A;  3I55 A;  1Y69 U;  3UI2 A;  3NTH A;  1BDO A;  2ZTD A;  4N8X 1;  5I6Y A;  1PH9 A;  2R7Z G;  3EVQ A;  2FMC A;  2EYM A;  4C3I B;  1PVO A;  4HJ7 A;  3VYR A;  4DV5 L;  2RHQ B;  3H3V C;  1TS4 A;  2OQ0 A;  5BN4 A;  1G2T A;  2EIF A;  5CV5 A;  3SK5 A;  2Q2H A;  1BUV T;  5CR3 A;  2F0G A;  2YTX A;  1QB5 D;  1XMO L;  5FLX E;  3MFG A;  4DR4 Q;  5COR A;  5DEH A;  2BE5 C;  2HT1 A;  4POG A;  2B8G A;  3HOX G;  2R7D A;  1RIP A;  4QMG A;  3I73 A;  3TSS A;  4LMQ D;  3TP6 A;  1Q82 C;  4OO1 G;  1A0I A;  2EY2 A;  4B08 A;  4GKK Q;  3TP5 A;  4BA1 I;  1SEB D;  3KF6 A;  4LW1 A;  2L15 A;  5CBE E;  2B3G A;  2KBN A;  4DUY Q;  4A3J B;  3A0J A;  4C3H H;  3CCJ A;  1EQV A;  1YBY A;  3K6O A;  3H3V I;  4BBR G;  4YCW A;  3GQB A;  4C1N K;  3GTL B;  1PFN A;  4JI0 L;  4IUU A;  2KCN A;  1B70 B;  1D5Z C;  2PI2 A;  4ZKB B;  4JI1 Q;  3GTK B;  2I07 B;  4M1U B;  1K3B C;  3J7Y W;  1QE6 A;  1I5F A;  4IUR A;  2ZTC A;  1JCK B;  2FJ2 A;  3FDT A;  1BCP B;  4ABN A;  2E74 C;  3DEP A;  4HTH A;  3W5O A;  1G6Z A;  4HR7 B;  2F0K A;  4HJA A;  1K8G A;  4ZUI A;  1II3 A;  2UXC Q;  1EWH A;  3BZD B;  3RD4 A;  2QW7 A;  4A3F H;  3U58 A;  2AMC B;  3NP8 A;  2BCO A;  1I3Q H;  3W3A A;  1VF5 C;  4K2K A;  1PFB A;  5ELD A;  1NSN S;  1L1O C;  2RBM A;  3TZU A;  3I91 A;  1I4G A;  4EQP A;  5C3W A;  4IOA A;  4R4O A;  2DNC A;  1XTD A;  2CH4 A;  3T1Y L;  4LF4 Q;  5K36 G;  2PZW A;  3X3N A;  3ERO A;  1I50 B;  4A3G G;  4PMB A;  1C8C A;  1KL9 A;  1HQM C;  2VQE Q;  2CH4 W;  1JJ2 A;  4LFC L;  1H9R A;  3M3Y B;  4LF8 Q;  4LUO A;  1WTO A;  2R92 G;  3PF5 A;  1FD7 D;  4JBW A;  5CV7 A;  4K6L A;  4GNX B;  3JAM c;  4RMF A;  3SGI A;  1PA6 A;  2E5L Q;  1AZP A;  3PF4 A;  4LFB Q;  3G48 A;  5AJ3 Q;  4ZLT F;  2MHV A;  5K5P A;  4JK1 C;  1DGS A;  5C44 B;  3UE0 A;  5C0X J;  3MHB A;  1V1P A;  2LKV A;  1MSH A;  4A3B H;  4RGT A;  2VUM G;  1Q8I A;  4DV3 L;  4A3D G;  1C48 A;  3CCQ A;  1VQP A;  3D4R A;  1B8A A;  2OCE A;  3S9W A;  4GKJ L;  1G91 A;  5EBC A;  4LK1 C;  1EYC A;  2F0D A;  2UU9 L;  4IFD H;  4KN4 C;  1F2L A;  1Q90 A;  4UAI A;  4C3J B;  3IRB A;  4WJ4 A;  4J6H A;  3T56 B;  3V2T A;  1VQG A;  1HR0 W;  3RZO B;  2G5D A;  2WAC A;  1WYD A;  4QUF A;  4UP7 A;  4KY6 A;  3U4Z A;  2JEA I;  3GTP H;  3S16 H;  1ZXT A;  3J81 E;  1X32 A;  2I5H A;  5M3M H;  3KJO A;  4DR6 Q;  4X65 Q;  4MZ9 A;  4UP8 A;  1TWG B;  2K04 A;  2GN5 A;  3T51 B;  3R2T A;  2NZO A;  2R7Z B;  1EYA A;  3A7L A;  1X3G A;  4HCE A;  4C3J H;  4AQY Q;  5FJ8 G;  4PMC A;  3HOU B;  1EOT A;  2RF4 A;  4QIW E;  3AB9 A;  1A15 A;  3KLR A;  4YCU A;  3S16 B;  4OIK A;  2HUG A;  3BS1 A;  3AYH B;  1TWC H;  2AUK A;  4RG1 A;  1O7Z A;  1WTW A;  4QCL A;  3HP3 A;  1BO0 A;  5JJL A;  5FLM G;  4A3L G;  3BDL A;  4JI6 L;  1EIF A;  3TS0 A;  1WTH A;  4HMI A;  1TWF H;  1FJG L;  1TWA H;  2B8F A;  4NPS A;  3TRE A;  4A3K B;  4FYD A;  3VA5 A;  4WFN 3;  2CW0 C;  3TN2 A;  5M5W H;  5L37 A;  3PO3 B;  2B2W A;  1GUO A;  4LWC A;  1RJT A;  1N36 Q;  3NQI A;  1TWF B;  4XT3 B;  2B63 H;  4FVM A;  4F87 A;  5J22 A;  2M9V A;  2KEE A;  5J1Z A;  1BF4 A;  4DV3 Q;  3OWE B;  4N9T A;  1WTP A;  4DV7 L;  1VQL A;  2HQL A;  4A3K H;  3E0E A;  3OOC A;  4JI5 L;  2AHO B;  1VCI A;  1Q8K A;  5GRO A;  4L5T A;  3I56 A;  1ZEQ X;  1JOO A;  5ELC A;  4DNI A;  1M8A A;  4OWW B;  2Q2I A;  2A6E C;  1EUJ A;  5IP7 G;  2C9O A;  1A3T A;  2K50 A;  3HG9 A;  4BS9 A;  3S1N H;  4IJL A;  1XNR L;  1LUZ A;  4Y52 H;  3FRP B;  1LTL A;  3E5S A;  4HIM A;  4POF A;  3RR5 A;  2WAQ G;  1I4R A;  5NUC A;  1E24 A;  3CMA A;  1WD1 A;  5EKI A;  3DUZ A;  1STH A;  4A3I B;  2XNA C;  4PMW A;  3LX0 A;  4BBR B;  4NMZ A;  1ZKO A;  5M3M G;  3NBI A;  2BH2 A;  4TVA B;  3IAY A;  1EEF D;  1N8R C;  3R3O A;  2LXK A;  3CME A;  5FJ8 H;  1OXV A;  4YHH Q;  1MI2 A;  2A8V A;  2ZXO A;  4A76 A;  4BBR H;  2JA6 H;  3I4N B;  1SE4 A;  2NVQ B;  4K5V A;  1PH3 A;  1D6E C;  4DR2 L;  2LS0 1;  4RKB A;  1VQ4 A;  5I2X A;  3CC7 A;  3CCV A;  1ASY A;  1NUC A;  4LF5 L;  1C0A A;  1V1O A;  1DXM A;  4KHZ A;  2ICE C;  3FP9 A;  1GXD C;  4A3L H;  5C3E H;  1AZQ A;  4FNF A;  1EY7 A;  3HKZ E;  1EFW A;  4GOP C;  1HH2 P;  2QKI C;  3PO2 B;  3HOW G;  2JA8 B;  3AU7 A;  4HED A;  3HOV B;  1N36 L;  1HTP A;  4LNQ A;  2NBF A;  1SYE A;  3PV0 A;  1WJJ A;  4CBV A;  4WRD A;  2F3I A;  2PMZ B;  4ZAI A;  4LF6 L;  1VMC A;  3S2H H;  2P5Z X;  2OTJ A;  1GKH A;  4A3M G;  2Y0S E;  1R9T H;  2MFI A;  3KLW A;  3NEN A;  4NB3 A;  1XNR Q;  2F52 A;  2VW9 A;  2JA8 H;  3KYH C;  1PRT F;  2KUM A;  1N33 L;  3A7A B;  2R93 B;  1QWY A;  3HFZ B;  3BU2 A;  1V43 A;  4NXM Q;  2EYH A;  2O5I C;  1D2B A;  5IP7 H;  3PMF A;  1CT1 D;  2NZ1 D;  2J0T D;  2GVA A;  3L0O A;  5BR8 Q;  4JBK A;  4KHP L;  3PIP 3;  1NR2 A;  2B29 A;  4HN7 A;  2IX1 A;  1O7I A;  5IIF A;  2MUY A;  1PYS B;  1X3F A;  2I5M X;  1YNX A;  2KHS A;  4B3R Q;  2E2I B;  2JXM B;  1ONL A;  4NP5 A;  1TS3 A;  4TQU S;  1LT6 D;  3AQQ A;  2ZJQ A;  1UAP A;  3DM1 A;  4DAV A;  4GLX A;  1YHB A;  1RF2 D;  2A68 C;  5KND A;  4DF7 A;  4EQN A;  2Q2T A;  4L63 B;  3OSO A;  1O7L A;  2J7Z A;  4KJN A;  2VUM H;  1PRT B;  1IZ6 A;  2WB1 E;  4RGN A;  4GNX A;  3D6C A;  1SMY D;  5C0X G;  3URY A;  2JP1 A;  1KDC A;  1IHZ A;  4JI4 Q;  5JOB A;  1TWH H;  4C3I H;  3F2U A;  2NN6 G;  3TP8 A;  4O42 A;  4K0K L;  1M90 C;  4LF9 L;  4IPG A;  2RDH A;  4DV2 L;  4BXX H;  1J5E L;  4JYA L;  1SRU A;  1SYD A;  3MXN B;  5HY6 A;  1U4R A;  2N55 A;  4A3M B;  4HJ8 A;  3QB3 A;  3S2D H;  2HDM A;  1OTC A;  3M7G A;  4EQ5 A;  3R8B A;  1N34 Q;  1A3U A;  1MBY A;  1XX8 A;  3D31 A;  3ULL A;  1B50 A;  1HHV A;  1E2Z A;  5JAV A;  1N32 Q;  4IUV A;  2KED A;  2K03 A;  3MAQ A;  3UE1 A;  4B3S L;  3ND8 A;  2B2U A;  4L5Q A;  3VDY A;  4ZQ3 A;  4A3M H;  1BBX C;  3BG3 A;  1NBW A;  2BDO A;  1SNP A;  3V05 A;  2RA4 A;  1X55 A;  2Z1C A;  3RLF A;  1NR4 A;  1YZ6 A;  1DJR D;  3JAM i;  3RZD H;  2VZA A;  3HZX A;  1G6P A;  3GTK H;  2QCP X;  4TRD A;  1HQR D;  3ITP A;  2K5N A;  1C4Q A;  1DZ1 A;  2TMP A;  2E5L L;  3U9O A;  2KCC A;  4OON A;  4XQQ A;  3I4O A;  1VQ9 A;  1IW7 C;  2EZV A;  3RZD B;  1HFN A;  2VB2 X;  2OXP A;  3MXG A;  4ZYS A;  2R61 A;  2O2L D;  4BBS G;  1SFO B;  4XDX A;  3KBX A;  3T16 A;  1I4P A;  2Q2U A;  1QNK A;  2D2C C;  2YU9 H;  4MTN A;  5ELO A;  4H7B A;  2K01 A;  4FXK C;  2E2D C;  3Q24 A;  1E2V A;  3GTL H;  5LMU Q;  1EY5 A;  4R8I A;  3U9S A;  1Q81 C;  4QUC A;  3VR6 A;  4K2L A;  5G3L D;  3DWP A;  2CQA A;  1I4X A;  4ZKC B;  3SR1 A;  3I4M H;  3CW2 C;  1SFO H;  2D9U A;  4XQJ A;  3C2P A;  5C4Z A;  3RNU A;  1PH8 A;  4A93 G;  2N88 A;  1RL2 A;  5I2Y A;  3LNN A;  3N6R A;  1BQQ T;  4B9X A;  1A63 A;  4KHP Q;  4LJZ C;  4PQX A;  2K6A A;  1EYD A;  1UE6 A;  5C0X I;  3UDG A;  3BYT B;  2D5D A;  1I3Q B;  1MJE A;  4DUY L;  4YWK A;  1B3A A;  1OXU A;  1VQ5 A;  2PNH A;  3CCR A;  5EKL A;  1ZYR C;  4CGY B;  2OEO A;  2CWA A;  3CC4 A;  3CKI B;  4IPC A;  2RSN A;  5JEA J;  2EOT A;  4RCN A;  1E1T A;  2WKC A;  1SYB A;  2MQH A;  3BDC A;  5KGU A;  2QGQ A;  3P1H A;  1QJO A;  2JA7 H;  2WII B;  5CYU A;  3OYY A;  2L11 A;  2LSS A;  5C6A A;  3ULP A;  3OMG A;  3Q6S A;  5C3E G;  2OQK A;  5C3X A;  1SNC A;  5GAE C;  2UUA L;  1EY8 A;  2OTL A;  1IBL L;  3HOW H;  3TZD A;  1E3P A;  1U5K A;  3NK9 A;  3GTP B;  2EYO A;  2JE6 I;  4IJH A;  2CVR A;  3UDI A;  5IYD G;  4ZRZ A;  3S1M B;  3ER0 A;  1BNZ A;  1VDZ A;  2N3S A;  5M5X B;  3I4N G;  1A2T A;  5C4J H;  1UUP A;  4UDU C;  1W6J A;  1STY A;  2F0E A;  2QIL A;  2A6E D;  3QJY A;  1PH7 A;  2X6L A;  3HOU H;  2RVL A;  3AMU A;  1L2F A;  1CFM A;  2PQA A;  1TQO A;  1CKO A;  4O1N A;  4PZ7 A;  3OPO A;  1U4M A;  4JBJ A;  3F2D A;  1CHQ D;  1ESF A;  1STA A;  2L4N A;  5EAY A;  1EIY B;  2F0P A;  4L5S A;  2PYK A;  1H9S B;  1PHJ A;  3NTK A;  2VB3 X;  1G29 1;  5BN3 A;  5M5X H;  1AN8 A;  4RWS C;  2BH8 A;  4KLK A;  4AYB G;  3HOV G;  1VQC A;  2F3V A;  1ASZ A;  5C4X G;  1U0L A;  2UXB Q;  1LT3 D;  1A3V A;  1HPC A;  3ULJ A;  4OEM B;  1I4Q A;  5LL6 S;  4B3M Q;  1TWG H;  2Q8T A;  1A2U A;  4OX9 Q;  3CD6 A;  4DV4 Q;  1ESR A;  1H9S A;  3K5O A;  2F0U A;  1OXS C;  2CHB D;  3BDO A;  1X54 A;  3TQY A;  1VQI A;  2VQE L;  2NN6 I;  1HFG A;  2X6G A;  4DFA A;  3PIO A;  3ONA B;  3FHW A;  1PTO H;  4ALP A;  3NQT A;  1VQD A;  5KIX A;  2BDN A;  4RHR A;  1KAW A;  5FOB B;  1K73 C;  2NN6 H;  2MGS A;  1RKN A;  4DR7 Q;  2IY5 B;  1X3P A;  3CCL A;  2CWP A;  5KNC A;  5FO8 B;  3J80 i;  3VR4 A;  5E4X A;  2MO0 A;  1FR3 A;  1P8L A;  4KN7 C;  1FGU A;  2PQE A;  4A3E B;  3PUY A;  1IKM A;  1TR5 A;  1W6K A;  1Z9F A;  3KFU A;  1T9H A;  3K0Y A;  2EQS A;  3PO3 H;  1E2W A;  2JA5 B;  3TDQ A;  3IL8 A;  1X3Q A;  2GA4 B;  5J3B A;  1YJN A;  2XVS A;  3I70 A;  1KLU D;  1YNJ D;  3G6E A;  1HJP A;  4IO9 A;  4JI1 L;  4A93 B;  5CV6 A;  2DN8 A;  5CC4 A;  4K5W A;  5EGT A;  3OWF A;  4RFB A;  2L55 A;  3DEO A;  4QL5 A;  4A3E H;  4DR5 Q;  1JB3 A;  1LYL A;  4KK7 A;  1VQE A;  2K7V A;  1JQY D;  5T1I A;  4IFD J;  5ELN A;  1JOR A;  1CI3 M;  5DAU A;  1I94 Q;  3DLL A;  1GJX A;  2N8N A;  4EGV A;  1UE7 A;  4H13 C;  1KDB A;  4GNX C;  2IWH A;  3K81 C;  1TKW B;  2XN9 C;  2K14 A;  2R7F A;  2CW0 D;  3J81 L;  5TSS A;  2K5V A;  3SK4 A;  3F2B A;  4FO2 A;  1L0X B;  5IWA L;  3PO2 H;  1ZYR D;  2F4V L;  1IBK Q;  2M2L A;  3QIA A;  4C3H G;  5IYB G;  1PYW D;  3J7A 5;  1I6V C;  1BKB A;  2Y0S B;  3T1H L;  2DJF C;  3S15 H;  1ICW A;  3CCM A;  3S2H B;  2A6H D;  4AH6 A;  2A69 D;  1KDA A;  3U50 C;  3K5L A;  1YEZ A;  1ILQ A;  1A8V A;  3A74 A;  1G2S A;  4K8J A;  5M5Y H;  3HS0 C;  3IFD A;  1DOM A;  4DR4 L;  2R92 B;  4UHV A;  4FF2 A;  4DAY B;  5FKA C;  1E0B A;  4A75 A;  1DON A;  3BVM A;  2F0L A;  1ENA A;  1ML0 D;  4DA2 A;  4DV5 Q;  1PH2 A;  2IPK D;  2A5H A;  4YWM A;  2KCM A;  5E7N A;  2WB1 G;  1CQF A;  3RLN A;  3K7U C;  4DV1 L;  4OHJ A;  2XGT A;  4ID6 A;  4KTA A;  1BCP C;  3NUC A;  4LFB L;  4V0B A;  3HGB A;  1SE3 A;  1STE A;  4H44 C;  4K8I A;  3Q22 A;  4OX9 L;  4DR2 Q;  1EL0 A;  4DV1 Q;  1EU3 A;  3K57 A;  2A6H C;  5EBD A;  4CKB A;  2JA7 G;  3CRL C;  4X3U A;  2XWB B;  4BY7 H;  2Z9H A;  3A8K E;  4R4C A;  3OMC A;  3OTO Q;  4FP5 D;  1MSG A;  3SXH A;  2C5C A;  4B3T L;  1HZ9 A;  3QOL A;  4QF4 A;  2I5L X;  3TME A;  2E2I H;  2WP8 J;  2PQA B;  1WI5 A;  2UUC L;  1D8L A;  4C2M H;  3V96 A;  4Z9C B;  1CQV A;  2H4O A;  4LF7 L;  3W1B A;  5IYD H;  1CTM A;  1DD2 A;  1Z6H A;  1Q86 C;  2B2U C;  3PO2 G;  5A35 A;  4OEL B;  1ILP A;  2HHH L;  1S72 A;  4JVZ A;  1IL8 A;  5BN5 A;  4A3C H;  2SDF A;  4DUZ L;  1PH1 A;  2Q8R E;  1TS2 A;  1PH6 A;  1IBL Q;  2DUD A;  3HOU G;  3CCS A;  2G9D A;  1YHA A;  4EQO A;  2V1C C;  2EJG C;  2EPB A;  5ELE A;  2KVM A;  1Y1V B;  4CKE A;  2L12 A;  1HR0 L;  1JOK A;  3R2I A;  4ZUJ A;  3NXW A;  1J5E Q;  3J7A V;  2WB1 B;  2DNE A;  4OO1 H;  1XMO Q;  5JVG 3;  1TVX A;  4JI7 L;  1GVP A;  2N49 A;  5H1S E;  4CDC C;  1HR0 Q;  5FLX L;  1QVG A;  5IP9 G;  4O0A A;  1NTG A;  4AYB B;  1L0W A;  3BJU A;  1YNN D;  4Q5V A;  1CSQ A;  1MJC A;  3MEH A;  3CHB D;  4RKL A;  4DR6 L;  1IYU A;  4JOI C;  5I9P A;  4UP9 A;  3AFP A;  1PLF A;  1SDF A;  1NE3 A;  1K0R A;  1STN A;  1B9N A;  3MEF A;  4P72 A;  3T4A C;  1X65 A;  5EPL A;  1HA5 A;  1HUM A;  1S5D D;  4E6I A;  1S5C D;  4OO1 I;  1PH4 A;  3EA6 A;  3MWY W;  1HXY D;  2EY6 A;  2ES2 A;  4YY3 L;  3A56 A;  1KHI A;  4WOR A;  1AE3 A;  4IPH A;  1OXT A;  2VY3 A;  2EJF C;  3NEL A;  5CV4 A;  4ZCK A;  1HTL D;  4P74 A;  1XWE A;  3CU7 A;  3MFY A;  4BY7 G;  4C3H B;  4NKL A;  4OL7 A;  1Q1B A;  1JWM D;  4DAP A;  2E2H H;  2OWO A;  1F9S A;  1FNW A;  3NSW A;  2EXZ A;  1UEA B;  4F8M A;  2QF7 A;  4JV5 L;  2JN4 A;  4KY7 A;  2B63 G;  1JT8 A;  2HHH Q;  3HOY B;  5EKK A;  1NMF A;  3NE5 B;  2C35 B;  4HJ9 A;  4A3K G;  2VQF L;  3KLS A;  4RCO A;  2K1B A;  3FVQ A;  1AEX A;  2IL8 A;  4RA8 A;  4DPG A;  4TKO B;  5E3F A;  3ZJY C;  3QR8 A;  2TSS A;  3EJI A;  3CQZ H;  4HID A;  4B3T Q;  2ZJP A;  4MNO A;  2HDL A;  3S14 B;  3M4Q A;  3WOF A;  3C1F A;  1QVF A;  3STB D;  1V1P B;  2YTV A;  1TT2 A;  1HNX Q;  3I4M B;  3GV6 A;  1F2Y A;  1CZG A;  4XTC S;  1B3Q A;  2Z8L A;  3HKZ G;  2WAQ B;  4B3M L;  3NWT A;  1XMQ L;  1X9N A;  1LTI D;  3D6W A;  3WOE A;  3OW7 A;  1KD1 C;  4G4K A;  4YCV A;  1XJV A;  3CPF A;  2RHS B;  2I0Q A;  1U4L A;  3B6Y A;  4IZ8 A;  4DV4 L;  4CKC A;  1VQ8 A;  3E0J A;  3GTM B;  2WV6 D;  2ZM6 L;  1Y1W H;  2L9H A;  1PH5 A;  5IP9 H;  1F9Q A;  4LF4 L;  3SK8 A;  3MZ5 A;  2F0Q A;  3GTO H;  1KRT A;  1XMQ Q;  2JA6 G;  3QG1 A;  1F77 A;  1EIH A;  5AFW A;  2XWJ B;  1DOK A;  1VQM A;  4NXN Q;  1I6H H;  4JI2 Q;  5LMN Q;  3AEV A;  2WFW A;  3TEH B;  4LF9 Q;  3I90 A;  2K5H A;  2NVX H;  2D0O A;  1RHP A;  3K5M A;  2JA7 B;  1EFI D;  4X3T A;  2F4V Q;  2N78 A;  2JJQ A;  1Z7T A;  4JYA Q;  5KRU A;  4RH6 A;  1K9M C;  4DK6 C;  1YI2 A;  4JI3 L;  2PCF B;  1G8Z D;  1EEI D;  1LAB A;  1K83 B;  1SE8 A;  5C5L A;  2Z6K A;  2Q8I B;  4B9W A;  4C3J G;  4DK1 A;  5JJZ A;  2RCN A;  4CDD C;  5KYI A;  3ERS X;  4GKK L;  1FYC A;  1FNU A;  3DHQ A;  2M00 A;  1OO9 B;  5C4J B;  2E2J B;  5C44 G;  1K83 H;  3RLO A;  4APV A;  3CC2 A;  1F2M A;  3NBH A;  4DR5 L;  2ENB A;  1NY4 A;  2ZTE A;  4A3I G;  1NCV A;  2F0T A;  1TY2 A;  3HKS A;  3G71 A;  4LUZ A;  2EE1 A;  4NXM L;  1T5E A;  1KAB A;  4L6T B;  1VQA A;  1U9R A;  2B2V A;  3KK7 A;  1AH9 A;  2MO1 A;  3WDN A;  5LL6 X;  1VQF A;  2FHT A;  3A5Z B;  2MP1 A;  1YVC A;  1DCZ A;  4H0L C;  2ATW A;  4DU9 A;  1O80 A;  2VNU D;  1HZA A;  2F03 A;  1H9K A;  1QNU A;  4LUV A;  2PZT A;  4U68 A;  5IGE A;  1XTC D;  4UPA A;  3D0F A;  1Y1W G;  1F9P A;  1UE1 A;  3K7A H;  3KJP A;  3K5N A;  4OWT B;  5M9O A;  3M9B A;  5C0X H;  2K4K A;  1S3O A;  2AWO A;  2UUC Q;  3K80 C;  1LTS D;  4KD3 A;  5GAD C;  3SE0 A;  3G7L A;  1EOV A;  3PQI A;  1F2Z A;  3IFT A;  1W2B A;  4JCV E;  2NVY H;  1O7Y A;  5LMU L;  1EZ6 A;  4PG3 A;  1L1O B;  4KJO A;  1J8I A;  4NDX A;  3GV3 A;  1CA6 A;  1A62 A;  1CA5 A;  1EY4 A;  3SEB A;  3RMH A;  2B63 B;  1CZW A;  1WTV A;  4TSS A;  1YIJ A;  1PZK D;  1Y8O B;  4X66 Q;  2FIN B;  4DXF A;  2Z6K C;  2PNR C;  2IHF A;  2ICI A;  3ND9 A;  2R93 G;  1S5B D;  4KY5 A;  1CSP A;  4CJ1 B;  5A2Q L;  4IUN A;  2JA5 H;  3CCU A;  1S5F D;  2JEB I;  3PCO B;  4KKS A;  4A3F G;  3G4S A;  4LF7 Q;  2BA1 A;  2YTY A;  2AUJ D;  1S5E D;  3BVG A;  5DM6 3;  5ISR A;  1TII D;  4DXG A;  1IBM L;  5C44 H;  1HNZ Q;  2NYZ D;  1SAP A;  3S15 B;  4WJ3 M;  2ZXR A;  4HSP A;  4A3I H;  1M1K C;  5I9O A;  1LTA D;  2KCT A;  4A3G H;  2WKD A;  2PW7 A;  2PZU A;  1Y1V G;  5LHY 1;  4CHT B;  3JAM L;  5IY0 A;  1DOL A;  2D62 A;  1KTK A;  1ENF A;  4U67 3;  2K28 A;  1F9R A;  2JK8 A;  3STB C;  4JW0 A;  1JIC A;  2B2T A;  4FF1 A;  2R92 H;  5I6W A;  2UUA Q;  4L5R C;  4P73 A;  1P16 A;  1N34 L;  4HIK A;  1XPO A;  1SMY C;  1YJ9 A;  4J8Q A;  4A3G B;  5JJK A;  2A1A A;  1WVL A;  2QEJ C;  1Y8P B;  2NWG A;  2CCZ A;  5IYC H;  1IBK L;  5M3M B;  1H9J A;  4PNY A;  1TXY A;  3A8J E;  1AFP A;  4DV2 Q;  2R7Z H;  2Z0S A;  1VQK A;  2J4X A;  4DV0 L;  1HNW L;  1EY0 A;  2SNS A;  2JA9 A;  4HCS A;  4G7H C;  4IFD G;  1Q3L A;  1SR3 A;  4DAM A;  1EQT A;  1TWC B;  1BCP D;  5GAG C;  4GLA C;  4MTK A;  5HGT A;  3C46 A;  2QDL A;  3D3R A;  3HOX B;  3S1R H;  3OW2 A;  1LAC A;  5M3F G;  3X3M A;  3VYS A;  1FJG Q;  3EIV A;  3W2D A;  3GTG H;  1GHK A;  2EYP A;  2B2W C;  1HZB A;  1RTO A;  1IW7 D;  1E22 A;  1NAP A;  2F0N A;  3CP0 A;  4DK3 C;  1SJH D;  3J7A F;  2R93 H;  4OXP A;  4JG2 A;  4X3K A;  4JI0 Q;  4HMJ A;  2BE5 D;  1JJG A;  2A69 C;  1EZ8 A;  3S1R B;  2V4D A;  1I94 L;  2K33 A;  5M5W B;  3CAM A;  3J7Z C;  4BY1 H;  1TS5 A;  1JE4 A;  5DLQ E;  1N33 Q;  1D5X C;  1PXU A;  1DYQ A;  3NPP A;  3KLS X;  2ALY B;  1MKH A;  2NTS A;  4DV0 Q;  4KD4 A;  3A54 A;  3P75 A;  4DGZ A;  1XNQ Q;  2WAQ E;  1ENC A;  1B1Z A;  3QWN A;  5CV9 A;  1K8O A;  1D1I A;  2F3W A;  4G7O C;  5C4H A;  2L1B A;  1VQJ A;  4BY7 B;  2O4X A;  3EN2 A;  1Y1V H;  3CRK C;  1WCM G;  3S1Q B;  4IOC A;  3GTQ H;  2EY5 A;  5DNF A;  4JI2 L;  2IW3 A;  2AQ1 B;  3W1G A;  4KKU A;  3PIO 3;  4BBS B;  4HAE A;  3J80 c;  4RGO S;  2H1E A;  4R9W A;  1CKN A;  2B39 A;  2F0I A;  2KEN A;  3H15 A;  3I3C A;  2RDG A;  4S3S A;  4N8F A;  1QUQ A;  2YYZ A;  3Q0A A;  5JPM C;  4P2C B;  3R93 A;  3OIP A;  5I4D A;  2AQ2 B;  4L8J A;  1EY9 A;  1YNJ C;  4B3S Q;  3RUZ A;  4LF6 Q;  1SND A;  3MXP A;  4OIJ A;  4J1M A;  5JJI A;  4KV6 A;  5IOC A;  4ULL A;  1X3E A;  2NZH A;  2F0S A;  2JQO A;  1JC7 A;  3D8G A;  5LMN L;  2BA0 A;  3TBI B;  3NHH A;  4ILW A;  1PZI D;  1QZH A;  2HIV A;  1PRT D;  4QIW B;  5KNB A;  5CMD A;  5C3E B;  2VXW A;  4AIM A;  4XIG S;  5JPN C;  1YIT A;  1JJC B;  1FL0 A;  1RCV D;  4I7Z C;  2E8G A;  3VR5 A;  1G51 A;  5HGQ A;  1XPR A;  3CPW A;  3H0G B;  2IJ0 A;  1GUG A;  3A55 A;  3FEW X;  4F88 A;  4XYQ A;  3HOY H;  2XTI A;  4GN3 B;  1D5M C;  3KF6 B;  4KHV A;  4LF8 L;  3M4O B;  4XQN A;  1CKN B;  1PTO D;  2JYO A;  3C1E A;  1CM9 A;  4DV7 Q;  1HCZ A;  2VL6 A;  2PMZ E;  2EVB A;  3BVZ A;  2K05 A;  3HOZ G;  3H0G H;  3I72 A;  3C3L A;  1STG A;  4LFA Q;  1DM0 B;  1PTO C;  5D65 A;  3TRZ A;  1B4O A;  1OXX K;  5HUR A;  4ME5 A;  4JI4 L;  2DJG C;  3J80 L;  4PV1 C;  2E2H B;  4DAY A;  3VYT A;  3SHL A;  1WCM H;  1WTQ A;  1XYI A;  4XYO A;  3H91 A;  4QB4 A;  2IHE A;  1SSO A;  2D0P A;  4DR3 Q;  4JC0 A;  4FF3 A;  1VQ6 A;  3TS2 A;  1BBW A;  2K5D A;  2H5X A;  4EVO A;  1QVC A;  1Q46 A;  1N9W A;  3FKI B;  2CQO A;  4A4I A;  3VR2 A;  3M4Y A;  1PMR A;  1IL2 A;  3S17 H;  3GDE A;  4QJF A;  1LTT D;  2EDG A;  4A3E G;  3F8T A;  1J6Q A;  4CDE C;  1H95 A;  1BVS A;  1KC8 C;  1QUQ B;  4X62 Q;  3U4V A;  4C56 C;  3SVM A;  3CCE A;  4X6A H;  1MIU A;  3KF8 B;  1I6H B;  4AQY L;  1RD9 D;  4J15 A;  1VQO A;  4B3R L;  4LFA L;  3NTI A;  3M85 A;  4XXE A;  3K0X A;  4DKA C;  4DR1 L;  1PYB A;  3J80 E; 
#chains in the Genus database with same CATH homology
 4HJ7 A;  3ZJY C;  4X62 L;  2E5L L;  4DV5 L;  2RHQ B;  4OON A;  3I4O A;  2OQ0 A;  3CQZ H;  1VQ9 A;  4HID A;  4B3T Q;  2EIF A;  2Q2H A;  2ZJP A;  4JI6 Q;  4MNO A;  2FXQ A;  3M4Q A;  2YTX A;  1QVF A;  1XMO L;  2ASB A;  3GTM H;  3STB D;  4DR4 Q;  2YTV A;  4BBS G;  1HNX Q;  3RN2 A;  5IYC G;  4P75 A;  2R6G A;  3Q8D A;  5GAH C;  2HT1 A;  4XTC S;  4POG A;  3HKZ G;  2Q2U A;  3HOX G;  2R7D A;  1RIP A;  2YU9 H;  4B3M L;  4MTN A;  5ELO A;  1XMQ L;  1X9N A;  4JI7 Q;  1KD1 C;  4YCV A;  1Q82 C;  4OO1 G;  1A0I A;  3GTL H;  1LM0 A;  5LMU Q;  1XJV A;  3CPF A;  2RHS B;  1Q81 C;  2I0Q A;  4GKK Q;  3B6Y A;  4DV4 L;  1PFS A;  4BA1 I;  3GD7 A;  3DM3 A;  1VQ8 A;  3KF6 A;  2K75 A;  2L15 A;  4LW1 A;  2B3G A;  2KBN A;  2ZM6 L;  4DUY Q;  1Y1W H;  3A0J A;  3CW2 C;  4C3H H;  3CCJ A;  1SFO H;  3I4M H;  3OTO L;  1PH5 A;  5IP9 H;  3S1M H;  1YBY A;  4X65 L;  3RNU A;  1VQB A;  4LF4 L;  3HOZ H;  1PH8 A;  5M3F H;  3GTO H;  3H3V I;  4A93 G;  1RL2 A;  1KRT A;  1FVI A;  1XMQ Q;  4BBR G;  2JA6 G;  4YCW A;  1A63 A;  4KHP Q;  4JI0 L;  1HNW Q;  1KIX A;  1VQM A;  4NXN Q;  1I6H H;  3S24 A;  4JI2 Q;  1B70 B;  1UE6 A;  2WFW A;  2PI2 A;  1Y14 B;  3TEH B;  5C0X I;  5LMN Q;  2K5H A;  4JI1 Q;  3UDG A;  4A3J H;  2NVX H;  2D0O A;  1Q7Y C;  1KQS A;  4DR7 L;  4FDB A;  1MJE A;  2ZM6 Q;  3JC6 6;  4YWK A;  4DUY L;  1OXU A;  1I5F A;  1VQ5 A;  2N78 A;  2F4V Q;  2JJQ A;  4JYA Q;  2PNH A;  3CCR A;  1K9M C;  4DK6 C;  1YI2 A;  4JI3 L;  4EX5 A;  2CWA A;  3CC4 A;  2ZTC A;  4IPC A;  4BY1 G;  5JEA J;  2E2J H;  4JI8 L;  4GOP B;  1VQ7 A;  3EBE A;  1E1T A;  1SE8 A;  3W5O A;  3BZC A;  2MQH A;  2Z6K A;  4HJA A;  1K8G A;  2QGQ A;  2UXC Q;  2RCN A;  4A3F H;  3U58 A;  3ERS X;  2AMC B;  2JA7 H;  1I3Q H;  3OYY A;  4GKK L;  2LSS A;  4R1J A;  3ULP A;  1L1O C;  5C3E G;  2OQK A;  4K0K Q;  4GOP A;  5GAE C;  1GD7 A;  2UUA L;  5C44 G;  2OTL A;  4IOA A;  1K83 H;  4R4I A;  3RLO A;  4APV A;  4R4O A;  3CC2 A;  4DR5 L;  1IBL L;  1NY4 A;  1XTD A;  2ZTE A;  3T1Y L;  4LF4 Q;  3HOW H;  5K36 G;  1Z47 A;  4A3I G;  4LFC Q;  1E3P A;  1U5K A;  1IXR A;  2JE6 I;  4IJH A;  3PUW A;  3UDI A;  5IYD G;  1XNQ L;  4A3G G;  3ER0 A;  1SLJ A;  3HKS A;  2AKW B;  3G71 A;  1KL9 A;  3T1H Q;  2VQE Q;  4LUZ A;  3M7N A;  2N3S A;  3I4N G;  1JJ2 A;  4LFC L;  5C4J H;  4NXM L;  5C4X G;  3CXC A;  3M4P A;  4DR1 Q;  1K3R A;  4LF8 Q;  1VQA A;  4LUO A;  1AH9 A;  1PH7 A;  2R92 G;  3PF5 A;  2MO1 A;  4X64 Q;  3HOU H;  1VQF A;  3A5Z B;  1S40 A;  1YVC A;  4JBW A;  2JA8 G;  4GNX B;  2ATW A;  1L2F A;  2PQA A;  2CFM A;  3JAM c;  1UEB A;  1CKO A;  4PZ7 A;  4RMF A;  4JBJ A;  3SGI A;  3F2D A;  1PA6 A;  5EAY A;  2E5L Q;  3PUX A;  3PF4 A;  4LFB Q;  3G48 A;  1Q1E A;  5AJ3 Q;  1EIY B;  4L5S A;  2VNU D;  1HZA A;  1PHJ A;  3PGZ A;  1DGS A;  1G29 1;  3UE0 A;  5C0X J;  4LUV A;  5M5X H;  2BH8 A;  4KLK A;  1V9P A;  4UPA A;  3M3Y H;  3D0F A;  2NVT H;  4AYB G;  4A3B H;  1Y1W G;  2VUM G;  3I4M G;  3HOV G;  4DV3 L;  1UE1 A;  1VQC A;  3K7A H;  3KJP A;  3PUV A;  4A3D G;  2GVB A;  4OWT B;  3CCQ A;  3M9B A;  1U0L A;  1VQP A;  3LGJ A;  1ASZ A;  3CF5 A;  4GN4 B;  1B8A A;  2K4K A;  1S3O A;  2OCE A;  2AWO A;  2UUC Q;  4GKJ L;  2UXB Q;  3K80 C;  3ULJ A;  4A93 H;  5GAD C;  4B3M Q;  1EOV A;  1TWG H;  2UU9 L;  4OX9 Q;  3CD6 A;  4DV4 Q;  1W2B A;  3J81 i;  4JCV E;  2MNA A;  2NVY H;  3J81 c;  5LMU L;  3H3V H;  1OXS C;  3IRB A;  4PG3 A;  1L1O B;  1X54 A;  4WJ4 A;  3TQY A;  4HIO A;  1VQI A;  3A5U A;  2VQE L;  1C9O A;  1AE2 A;  1B7Y B;  1A62 A;  1VQG A;  1YHQ A;  2NN6 I;  1E7Z A;  1HR0 W;  2UU9 Q;  3PIO A;  1WYD A;  4UP7 A;  2JEA I;  3U4Z A;  3GTP H;  3HOY G;  3FHW A;  3S16 H;  4X64 L;  1YIJ A;  1I50 H;  4ALP A;  4X66 Q;  2I5H A;  5M3M H;  3KJO A;  1VQD A;  4DR6 Q;  4X65 Q;  4MZ9 A;  2Z6K C;  4UP8 A;  2IHF A;  4IPD A;  2GN5 A;  1KAW A;  2R93 G;  4ME3 A;  2NZO A;  3E9H A;  1CSP A;  1X3G A;  4C3J H;  1K73 C;  2JA5 H;  3CCU A;  2Y0S G;  4AQY Q;  2LXJ A;  2JEB I;  4DR7 Q;  5FJ8 G;  3PCO B;  4A3F G;  2IY5 B;  2RF4 A;  3G4S A;  3CCL A;  4LF7 Q;  2CWP A;  4QIW E;  2BA1 A;  2YTY A;  3H0G G;  4YCU A;  3J80 i;  1VS0 A;  4BXX G;  4IFD I;  2MO0 A;  3AYH B;  1TWC H;  2IT1 A;  4RG1 A;  1P8L A;  4AYB E;  1FGU A;  4HJ5 A;  1IBM L;  5C44 H;  1NJI C;  1HNZ Q;  2K52 A;  3PUY A;  2PI2 E;  4DUZ Q;  3KFU A;  1Z9F A;  1T9H A;  2EQS A;  3E9I A;  3PO3 H;  4WJ3 M;  4BA2 I;  4A3I H;  5JJL A;  5FLM G;  4A3L G;  3KDF B;  4JI6 L;  1EIF A;  2YV5 A;  5J3B A;  3TS0 A;  1YJN A;  1M1K C;  1TWF H;  2KCT A;  3G6E A;  4A3G H;  1FJG L;  1HJP A;  1TWA H;  1Y1V G;  4DPG A;  4IO9 A;  5IY0 A;  4JI1 L;  4NPS A;  2D62 A;  3TRE A;  3T1Y Q;  2JK8 A;  3STB C;  4QL5 A;  4A3E H;  5M5W H;  4DR5 Q;  1LYL A;  2R92 H;  1CUK A;  2UUA Q;  1VQE A;  4GS3 A;  5JEA G;  4L5R C;  4LWC A;  4P73 A;  1P16 A;  4JBM A;  1N34 L;  4HIK A;  1XPO A;  1N36 Q;  3RZO H;  1YJ9 A;  3GTJ H;  4IFD J;  5JJK A;  2A1A A;  1BBU A;  2B63 H;  5ELN A;  4YHH L;  4DV3 Q;  4JI3 Q;  3UDF A;  1I94 Q;  3DLL A;  2CCZ A;  5IYC H;  1IBK L;  2N8N A;  4GNX C;  1UE7 A;  4DV7 L;  1VQL A;  1TXY A;  2HQL A;  3E0E A;  4JI5 L;  4A3K H;  3HOX H;  2AHO B;  1VCI A;  1Q8K A;  5GRO A;  4L5T A;  3I56 A;  3K81 C;  4DV2 Q;  2R7Z H;  2UXD L;  2Z0S A;  2K14 A;  4DNI A;  1HNX L;  2R7F A;  4OWW B;  2Q2I A;  5C4X H;  4QGU A;  4QY7 A;  1EUJ A;  1VQK A;  5IP7 G;  1HNZ L;  2K5V A;  1GM5 A;  2K50 A;  3F2B A;  4DV0 L;  3S1N H;  3KOJ A;  4IJL A;  1HNW L;  5IWA L;  1XNR L;  2JA9 A;  3PO2 H;  1LUZ A;  2F4V L;  1IBK Q;  4Y52 H;  1XPU A;  4IFD G;  5IYB G;  1SR3 A;  4DAM A;  1LTL A;  2KHJ A;  4A3C G;  5GAG C;  4POF A;  2AWN A;  4GLA C;  3RR5 A;  2ID0 A;  4HIM A;  3J7A 5;  4BBS H;  2WAQ G;  3S1R H;  1BKB A;  3OW2 A;  4JV5 Q;  5M3F G;  3T1H L;  3FKI G;  1FJG Q;  2VQF Q;  3EIV A;  1E24 A;  3S15 H;  3CMA A;  3CCM A;  3GTG H;  1HZB A;  4AH6 A;  4PMW A;  2UXB L;  1E22 A;  3CP0 A;  4DK3 C;  3U50 C;  1YEZ A;  5M3M G;  1A8V A;  3AEV A;  3A74 A;  2BH2 A;  3PSI A;  2R93 H;  4OXP A;  2QA4 A;  4JG2 A;  4TVA B;  5M5Y H;  4JI0 Q;  3PIP A;  1JJG A;  3L7Z C;  1N8R C;  5GQO A;  2LXK A;  3CME A;  1I94 L;  4P71 A;  5FJ8 H;  1EWI A;  1OXV A;  1SN8 A;  1QZG A;  3CAM A;  4YHH Q;  3J7Z C;  4BY1 H;  4DR4 L;  2A8V A;  4QQB X;  1D7Q A;  4A76 A;  4BBR H;  1X56 A;  5DLQ E;  2ZJR A;  1N33 Q;  2JA6 H;  3S1Q H;  4DAY B;  4JI5 Q;  4YY3 Q;  1PH3 A;  4A75 A;  4DR2 L;  2ALY B;  1MKH A;  4DV5 Q;  3NEM A;  3CC7 A;  4DV0 Q;  3CCV A;  1VQ4 A;  1ASY A;  4LF5 L;  1C0A A;  1XNQ Q;  1PH2 A;  4KHZ A;  4A3J G;  2WAQ E;  3FP9 A;  1YJW A;  4YWM A;  2KCM A;  5E7N A;  1IYJ B;  2WB1 G;  4H02 A;  3NBH B;  4A3L H;  5C3E H;  1E1O A;  3RLN A;  1VQJ A;  3K7U C;  4DV1 L;  5FLX c;  4BY7 G;  3HKZ E;  3EN2 A;  1Y1V H;  2XGT A;  1EFW A;  1WCM G;  4GOP C;  4IOC A;  3GTQ H;  1HH2 P;  2A19 A;  3HOW G;  4LFB L;  4UY8 C;  4JI2 L;  1N36 L;  4LNQ A;  4OX9 L;  4DR2 Q;  3M4O H;  1UE5 A;  3W1G A;  4DV1 Q;  3K8A A;  3PV0 A;  1SMX A;  2UUB L;  3J80 c;  2JA7 G;  1WJJ A;  1W3S A;  1CKN A;  2F3I A;  4LF6 L;  1HZC A;  2EXD A;  2KEN A;  3H15 A;  3S2H H;  4YWL A;  2OTJ A;  4BY7 H;  1EQR A;  4R4C A;  1GKH A;  4GLV B;  4A3M G;  1QUQ A;  2Y0S E;  2MFI A;  2YYZ A;  3OTO Q;  1R9T H;  3KLW A;  1EYG A;  3NEN A;  2HIX A;  4NB3 A;  5IWA Q;  2F52 A;  1XNR Q;  4B3T L;  2VW9 A;  1GO3 E;  1HZ9 A;  5BR8 L;  2JA8 H;  4OWX B;  3KYH C;  4GN5 A;  2I5L X;  1N33 L;  3UDX A;  2E2I H;  2WP8 J;  2PQA B;  1WI5 A;  2UUC L;  1WFQ A;  1D8L A;  4C2M H;  5IT9 c;  3HFZ B;  4LF7 L;  1JE5 A;  3BU2 A;  3W1B A;  1V43 A;  4B3S Q;  4LF6 Q;  4NXM Q;  5IYD H;  3F2C A;  1VQH A;  2VS1 A;  1KXL A;  5IP7 H;  4PZ8 A;  4NXN L;  3F1Z A;  2UUB Q;  5JJI A;  2GVA A;  3L0O A;  5BR8 Q;  4JBK A;  1Q86 C;  4KHP L;  3PO2 G;  1X3E A;  2B29 A;  2NZH A;  2JQO A;  2NVQ H;  2IX1 A;  3I4N H;  2HHH L;  4A3B G;  5IYB H;  1S72 A;  4PZ6 A;  5LMN L;  2BA0 A;  1O7I A;  4A3D H;  4A3C H;  1KRS A;  3GO5 A;  4DUZ L;  2IX0 A;  5AJ3 L;  1PH1 A;  1QZH A;  1PYS B;  1X3F A;  2DUD A;  2I5M X;  1PH6 A;  1YNX A;  2HIV A;  1IBL Q;  3I2Z A;  3CCS A;  3HOU G;  4B3R Q;  3FKI H;  4TQU S;  4DR3 L;  3AQQ A;  2ZJQ A;  1YHA A;  2V1C C;  4GLX A;  4GKJ Q;  1YHB A;  4XIG S;  4AIM A;  1YIT A;  1JJC B;  1FL0 A;  1Q12 A;  2E8G A;  2Q2T A;  1G51 A;  1HR0 L;  4R4T A;  5HGQ A;  1XPR A;  4R4Q A;  3CPW A;  1J5E Q;  2VUM H;  2WB1 E;  1IZ6 A;  3HOV H;  3HOY H;  1X6O A;  4GNX A;  2XTI A;  4GN3 B;  3KF6 B;  4LF8 L;  3PUZ A;  1V1Q A;  5C0X G;  1XMO Q;  1CKN B;  4LF5 Q;  4JI7 L;  4LF9 Q;  1GVP A;  2N49 A;  2UXD Q;  5H1S E;  4JI4 Q;  1TWH H;  1VQN A;  4C3I H;  4DV7 Q;  2VL6 A;  2NN6 G;  1HR0 Q;  2JA5 G;  4K0K L;  1QVG A;  2PMZ E;  5IP9 G;  4Y7N H;  1M90 C;  4O0A A;  1PV4 A;  3RN5 A;  1NTG A;  5IE8 A;  4LF9 L;  4JI8 Q;  3HOZ G;  4DV6 Q;  4IPG A;  1L0W A;  3BJU A;  3H0G H;  4DR6 L;  1CSQ A;  1MJC A;  1JB7 A;  4DV2 L;  3ICE A;  4JOI C;  4LFA Q;  1J5E L;  3TRZ A;  4UP9 A;  3AFP A;  3S14 H;  4BXX H;  4JYA L;  3I7F A;  1SRU A;  1NE3 A;  1OXX K;  1K0R A;  2CKZ B;  3MXN B;  2UXC L;  5HY6 A;  4JI4 L;  1C7Y A;  3MEF A;  4P72 A;  1X65 A;  4HJ8 A;  3S2D H;  1OTC A;  4DV6 L;  1WCM H;  4EQ5 A;  4O2D A;  2QEX A;  1CKM A;  4OO1 I;  1PH4 A;  2IHE A;  5FLM H;  1N34 Q;  1IBM Q;  2D0P A;  4DR3 Q;  3WWV A;  3ULL A;  3D31 A;  4JC0 A;  4YY3 L;  3KDF A;  1KHI A;  2ES2 A;  1VQ6 A;  1AE3 A;  3TS2 A;  4KI0 A;  1BBW A;  4IPH A;  5LMN W;  2H5X A;  3J81 j;  1OXT A;  2VY3 A;  1QVC A;  1K8A C;  1Q46 A;  3NEL A;  1N32 Q;  4P74 A;  1N9W A;  2CQO A;  1NMG A;  2DGY A;  3UE1 A;  4A4I A;  2KHI A;  4B3S L;  1IL2 A;  3S17 H;  3GDE A;  1WOC A;  4L5Q A;  4X66 L;  4QJF A;  3VDY A;  1JMC A;  1Q1B A;  4A3M H;  2E2H H;  2OWO A;  4A3E G;  3F8T A;  1UWV A;  1NBW A;  1J6Q A;  1H95 A;  1BVS A;  1SRO A;  1X55 A;  1EQQ A;  1KC8 C;  1QUQ B;  3RLF A;  3U4V A;  4X62 Q;  3L2P A;  4JV5 L;  3PO3 G;  3CCE A;  3BZK A;  4X6A H;  1YZ6 A;  2B63 G;  1N32 L;  3JAM i;  1JT8 A;  3RZD H;  2HHH Q;  1NMF A;  1MIU A;  2VZA A;  3KF8 B;  3AFQ A;  2C35 B;  4JOI A;  4AQY L;  1L1O A;  4J15 A;  4HJ9 A;  1G6P A;  3I55 A;  2VQF L;  4A3K G;  1VQO A;  4B3R L;  3GTK H;  4LFA L;  3M85 A;  1PH9 A;  2ZTD A;  2R7Z G;  2K5N A;  3K0X A;  4DKA C;  4DR1 L;  1PYB A;  1PVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...