2UXDQ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxdQ00
4QL5A 5IP9G 1HR0W 1FL0A 4DV1Q 1NTGA 2R92H 5IYCG 2KCMA 4A93H 4LFBQ 2UXBQ 4DR7Q 3Q8DA 1WYDA 3PSIA 1LYLA 4KHZA 2RHSB 1VQCA 3CQZH 4PZ6A 2ALYB 2ZM6L 2JK8A 2NZHA 4QY7A 4DV6Q 1K3RA 4JI5Q 4LF5L 2JA6G 2WB1E 1T9HA 3K7UC 1GD7A 2R93G 1E7ZA 3W1GA 1J6QA 2I5MX 1U0LA 3GDEA 3KJOA 1FVIA 1PYSB 4C2MH 4A3FH 4A3IG 3PUZA 4DV4L 2JA5H 1XNRQ 4DUYL 3ICEA 4A3FG 5IT9c 4LF9L 5J3BA 4R4CA 4R4TA 2VW9A 4GOPA 3S17H 4A3LH 4EQ5A 2UUAQ 1B70B 1KAWA 2R7FA 4IPHA 4LF7L 1N36Q 2VUMG 5IY0A 1AE2A 5GAHC 3M4OH 2IX0A 1N34Q 2OCEA 4OWWB 3KF6A 3PO3H 3F2CA 1Q81C 1Q46A 4B3SL 3I4NH 2VQFQ 4IOCA 4IPCA 1NMFA 3I2ZA 4L5RC 1VQ6A 2R6GA 4LNQA 4BA2I 4JYAL 4A3GH 3K7AH 3U4ZA 2JA7H 2RHQB 3FKIG 1S40A 1YHQA 3A74A 4DV3L 4HJ7A 2MO0A 3HOXG 1TWCH 1GKHA 1YI2A 2B3GA 3F2BA 1ASYA 1BKBA 1NE3A 2Z0SA 3BJUA 5C44H 3PCOB 4DV4Q 1HR0L 3BU2A 1SE8A 4JI3L 4HJ5A 4UP7A 2K5VA 1WOCA 3DLLA 3WWVA 1NJIC 4LW1A 5IP7H 3M85A 4LF9Q 3CC2A 3S1RH 1SR3A 3CCJA 4MZ9A 4LF7Q 1G6PA 1RL2A 1CUKA 1CKMA 2AKWB 4GLAC 1IZ6A 2KENA 3RR5A 5BR8L 1PH3A 1VQ5A 1YJWA 5K36G 3GD7A 4B3TL 4B3SQ 1WFQA 1XJVA 4P73A 4BY1H 3S2HH 1L1OC 2AMCB 3KYHC 5M5XH 1PV4A 1IBMQ 4JBKA 4POGA 3KFUA 3S2DH 4JYAQ 3KDFA 1I3QH 2AWNA 3CPFA 2LSSA 1KHIA 4X62L 1XPRA 1Q7YC 4C3HH 1B8AA 4DV2L 1UWVA 4A3DH 3RLOA 4DK6C 1XMOQ 4DR3L 4DR5L 1VQLA 1OXUA 1G51A 1XNQL 1W2BA 1XTDA 2ZJQA 2YTVA 4DKAC 3L0OA 5JEAG 4GKJL 1VQEA 1YIJA 2B63H 1CKNB 1YHAA 4MNOA 5LMNQ 1VQFA 4GNXC 3HOYG 4LF4Q 1EWIA 3S24A 2VQEL 3CMEA 3GTGH 3A5ZB 2AHOB 4JI3Q 3GTMH 3J80i 4PZ8A 2LXJA 1VQGA 1HNXQ 3J81j 4JI1Q 4L5TA 1S3OA 2K14A 3RNUA 3B6YA 2JA8G 1L2FA 3K81C 1VQBA 1PH2A 2NN6I 1B7YB 4DR1Q 4JBJA 1NBWA 1I94L 4DR2Q 2E5LL 4B3TQ 4P71A 2LXKA 2XTIA 2ID0A 2V1CC 3G71A 3HOZH 1I5FA 1QUQA 1TWHH 5LMUQ 1YEZA 4JCVE 3UDXA 1KIXA 4X62Q 3T1YQ 4A3JG 3BZCA 4LWCA 2MNAA 2ATWA 3PO2G 1W3SA 4JI2Q 4DV2Q 1VQ4A 4JI6Q 4OO1I 1OXXK 1X65A 3UDGA 2WAQG 4IFDG 1VQJA 4DR5Q 4DR3Q 3TS0A 1VQ7A 3S1MH 1VQ9A 1C9OA 1PH7A 2R7ZG 5M3MH 2WP8J 1HZ9A 1EYGA 1VQNA 1XMQL 4GKJQ 4GLVB 2VY3A 3KF8B 5ELNA 3ZJYC 2ZJPA 5IP9H 3OW2A 1GM5A 4WJ4A 5IYBG 2OWOA 4LF6Q 1EQQA 3D0FA 4OXPA 1SROA 1L0WA 1X3FA 4DAYB 1FJGL 1PH1A 5IYCH 1VS0A 1CSQA 3I7FA 4DR4Q 3AQQA 2YTYA 3NEMA 1X6OA 1K8GA 2E2HH 1YNXA 1H95A 2Z6KA 5IYDG 4A3BG 3JC66 1P16A 3CAMA 3ULLA 4BBRG 2ZJRA 2YYZA 1LM0A 2VS1A 4JBMA 2HT1A 2JA6H 3S14H 4JV5Q 2HIXA 3S1NH 1WJJA 1I94Q 2R93H 1E3PA 4IFDJ 5GROA 1V43A 3CCSA 2JEAI 4X64L 4GS3A 4DV7Q 4A3IH 3U58A 1TXYA 2Q2HA 1Q8KA 1YVCA 3I4OA 3TQYA 3PF5A 1K0RA 1X56A 4JOIC 4DV0L 3OYYA 5DLQE 3GTOH 1L1OB 2ZTEA 1YHBA 2RF4A 3AFQA 4A3EG 2JA9A 4K0KL 3NENA 2VUMH 1BVSA 1Y1WG 2L15A 2BA0A 3CW2C 4B3RL 1Y14B 4J15A 1VQDA 2CFMA 4ME3A 3ULPA 5H1SE 3MXNB 3LGJA 4APVA 3PF4A 3M4PA 4YCVA 4YHHL 3FKIH 4GNXB 2UXDL 1N33L 2UU9L 1VQMA 4GN3B 2EIFA 1E22A 2F3IA 4LUVA 2GVAA 4C3IH 3HOXH 4P72A 3E0EA 2K75A 1CSPA 1NY4A 2ZM6Q 3ERSX 1PH4A 4BY7G 4QJFA 4GKKL 4HIKA 4LF5Q 4R4OA 3L2PA 3BZKA 3TRZA 1PHJA 2JQOA 1IBKL 3STBC 2KHIA 2PQAB 5FLXc 1JE5A 4HJAA 5C4JH 2Q2UA 2KHJA 4K0KQ 1V9PA 3NBHB 3PUWA 3AYHB 4DUYQ 4NXML 2BH8A 2KCTA 2GVBA 3KF6B 4UP8A 5GADC 1KQSA 4KLKA 3CCQA 1VQAA 1UE5A 5FLMG 1X3GA 2JEBI 1JMCA 3PGZA 4JI8L 2AWOA 2ZTDA 4JI4L 1X54A 2N8NA 3GO5A 2UUBL 1EFWA 2CCZA 4NB3A 3L7ZC 5IWAL 4YHHQ 3IRBA 1X3EA 1VQPA 5M3FG 1N32L 4XTCS 1EIFA 4NXNL 4O2DA 3SGIA 2XGTA 3CCMA 3CMAA 4AQYL 4YCWA 3HOVH 1M90C 3ER0A 3PV0A 1PVOA 1TWGH 4IOAA 1FGUA 4DV3Q 3UE1A 2N78A 1TWAH 3HOVG 2N3SA 3HOYH 3G6EA 4DK3C 5AJ3L 2IHEA 3STBD 3TREA 1IBKQ 3W1BA 2K52A 2OTJA 1A8VA 3T1HL 1HNWL 4BXXG 1HZCA 1JT8A 1U5KA 1SN8A 1ASZA 3CCVA 2A1AA 1OXTA 1EOVA 1VQKA 1HR0Q 2IX1A 4NXMQ 1C7YA 4JI0L 2JA8H 3PIOA 3CCEA 2N49A 1K9MC 1E1OA 4KHPL 4YY3L 1Y1VH 4DV5L 2E2JH 1MKHA 2IHFA 4TVAB 4JI8Q 2A8VA 3J7ZC 2UUBQ 1AE3A 3M4QA 5BR8Q 3AEVA 1Y1VG 5C3EG 4OONA 2PNHA 3HKSA 2NVQH 1N32Q 1GVPA 4A3JH 4AH6A 4GOPC 3PO2H 1SMXA 1IL2A 3HKZG 1Z47A 4A3MG 3RN2A 4HIOA 2CQOA 3H0GG 2D0OA 2R7ZH 1K8AC 4BBSG 2I0QA 1YITA 4A3KG 2KBNA 1KRSA 1K83H 1TWFH 4IFDI 3EBEA 2DGYA 1N8RC 4QQBX 1XNQQ 1Q1BA 4MTNA 2Y0SG 5AJ3Q 5IYBH 1IYJB 3HOUH 2A19A 5FJ8G 2PI2E 2UXBL 1HNWQ 3GTJH 4DR7L 1Q82C 1GO3E 4DUZL 3HOWG 1YZ6A 3HOUG 2VQEQ 3GTQH 3GTKH 4JI5L 4A3CG 5IYDH 4A3BH 4KHPQ 3CCLA 1WCMG 4BBRH 3RZDH 1M1KC 4DAMA 5GAEC 4DV5Q 2C35B 4X66L 1IXRA 4HIMA 4Y52H 5C0XG 1N9WA 3KJPA 2NVYH 1QUQB 4RG1A 4IJLA 3I4MG 3TEHB 4X65L 1KD1C 4L5SA 2VL6A 3F1ZA 3H3VH 2HIVA 2E5LQ 2VZAA 3RLNA 3W5OA 5GAGC 4HJ9A 1L1OA 4H02A 5M5YH 4A3EH 2OQ0A 3H3VI 4AYBG 3PUVA 1OXVA 2HHHL 3S1QH 1JB7A 1PA6A 2JJQA 4DR6L 4FDBA 5LMNW 1VQ8A 3UDFA 1SFOH 2WAQE 2WFWA 1Y1WH 4IPDA 2VQFL 1Z9FA 3A5UA 1P8LA 4UP9A 2Y0SE 2OTLA 3S16H 3J81c 1XPUA 5C4XG 2K5NA 1A0IA 2OQKA 5GQOA 1NMGA 4OX9L 3EN2A 2MO1A 1XMQQ 3E9HA 1MJCA 5C0XJ 2D0PA 1HH2P 3F2DA 4DUZQ 4GNXA 3RN5A 2R92G 1KC8C 4P74A 4LFCL 1OTCA 4JI7L 3I55A 4C3JH 2Q2TA 4KI0A 1FJGQ 4A93G 2YTXA 5JJLA 4LF8L 3VDYA 1E1TA 1X55A 1JJGA 1C0AA 2F52A 4X66Q 1MJEA 1X9NA 4DPGA 2Q2IA 3JAMc 1EUJA 2MQHA 3FP9A 4BY7H 2RCNA 4X65Q 1E24A 2CWPA 1QZHA 4TQUS 4PG3A 3EIVA 1HJPA 1BBUA 2PQAA 2DUDA 4GLXA 2ASBA 3UDIA 4X64Q 2JA5G 1VQHA 4AYBE 1I50H 1EQRA 2HHHQ 3CP0A 3CPWA 3KLWA 1DGSA 3M7NA 1WI5A 4DV0Q 4A3LG 1MIUA 4GOPB 4DR6Q 4L5QA 1LTLA 1SLJA 5FLMH 1V1QA 4AIMA 2I5HA 3D31A 1O7IA 4YCUA 4LFAL 1IBML 3PO3G 4HIDA 1D7QA 4GN4B 3H15A 4OX9Q 2GN5A 3I4NG 4JG2A 1J5EL 4B3RQ 1OXSC 3I56A 5M3FH 1QVGA 1CKOA 1PYBA 2EXDA 1VCIA 1XMOL 2UUCL 4A3GG 4LFCQ 2JA7G 4JI7Q 4PMWA 4NPSA 3KOJA 4A75A 1PH9A 2UXDQ 4LF8Q 1Q1EA 2CKZB 1AH9A 1N33Q 2UU9Q 1I6HH 3OTOL 5LMNL 4X6AH 3K80C 3CC4A 2FXQA 4LF4L 2K4KA 4BA1I 2D62A 3G4SA 2H5XA 1HNZL 5JJIA 2E8GA 5C44G 1G291 1Q12A 1SRUA 1D8LA 5ELOA 1HNXL 3HFZB 1YBYA 4LUOA 1CKNA 4OWXB 4JI1L 3J7A5 4BXXH 4GKKQ 2UXCL 2Z6KC 1EIYB 1LUZA 1YJ9A 1PH8A 4IJHA 1PH6A 3CXCA 4Y7NH 3FHWA 4JOIA 5IP7G 4DR1L 1QVFA 4R1JA 3GTLH 3DM3A 1VQOA 4DNIA 4DR2L 3E9IA 1UE1A 4GN5A 2QEXA 5E7NA 2EQSA 2K5HA 3A0JA 3MEFA 1UE6A 2BA1A 4XIGS 4LFAQ 5LMUL 3CD6A 5HY6A 4IPGA 4EX5A 1IBLL 1K73C 5C3EH 4BY1G 3T1YL 1J5EQ 2F4VL 3TS2A 1KL9A 5HGQA 4JI2L 4JI4Q 4JI6L 4QIWE 2UUCQ 4B3ML 3KDFB 1KRTA 1PFSA 5IWAQ 4A3MH 4JC0A 5EAYA 4YWMA 3H0GH 4JBWA 1QVCA 4A3DG 4BBSH 1XPOA 5M5WH 1A62A 4NXNQ 4A3KH 1JJ2A 2YV5A 2NVXH 3RZOH 1QZGA 2VNUD 2IY5B 3OTOQ 2R7DA 1JJCB 4UPAA 4OWTB 4AQYQ 1Q86C 4LF6L 1RIPA 1HNZQ 2E2IH 4YWLA 2HQLA 2B63G 4ALPA 5FJ8H 3PUYA 4DR4L 2UXCQ 5JJKA 4DV1L 3U50C 2NVTH 2IT1A 3HOWH 3M3YH 1BBWA 4R4QA 4LFBL 4A3CH 2NN6G 3T1HQ 4P75A 3K8AA 2ZTCA 2YU9H 1WCMH 2PMZE 2QGQA 4JV5L 3J81i 4O0AA 1YJNA 1PH5A 2BH2A 5IE8A 4DV6L 2ES2A 2I5LX 4HJ8A 4JI0Q 3I4MH 2WB1G 4DV7L 1UE7A 3F8TA 2NZOA 3CCUA 2QA4A 4YY3Q 1HZAA 1IBLQ 1UEBA 3CCRA 1HZBA 5JEAJ 4A76A 3PUXA 4UY8C 3RLFA 2F4VQ 3HOZG 4LUZA 5C0XI 4OO1G 4PZ7A 4RMFA 3K0XA 3S15H 4A4IA 4WJ3M 2MFIA 4B3MQ 1A63A 3NELA 4QGUA 1XNRL 2B29A 2JE6I 2CWAA 3M9BA 3PIPA 1R9TH 3JAMi 1VQIA 3GTPH 3UE0A 2K50A 3HKZE 2UUAL 3CC7A 3J80c 1N36L 3CF5A 5M3MG 3AFPA 4YWKA 3U4VA 1N34L 1S72A 2PI2A 3G48A 4R4IA 5C4XH 4IO9A 1KXLA 4POFA 3ULJA
chains in the Genus database with same CATH superfamily
5IP9G 2K03A 4DV1Q 3QB3A 4DAPA 3PSIA 1WYDA 2RHSB 1VQCA 1A3UA 4YIJA 2JK8A 2NZHA 4QY7A 4JI5Q 1H9RA 2JXMB 1GD7A 3OSOA 1J6QA 1H9SB 3I3CA 4C2MH 2NYZD 2QKIC 1GUWA 1ESRA 4A3FG 1U4RA 1NAPA 5DNFA 4LF9L 5J3BA 4R4TA 3S17H 4A3LH 2UUAQ 1KAWA 4IPHA 4K5VA 2VUMG 3K57A 2F0QA 1AE2A 1ICWA 5D14A 3KF6A 4HCEA 1DOLA 1U4MA 2PNRC 5CBAE 1SNOA 4IPCA 1NMFA 4UHVA 1R4PB 3BG3A 2JA7H 2RHQB 3FKIG 2ZT9C 1YHQA 5I6WA 4ZLTF 2MO0A 3MA2B 1X3PA 5FLXL 4S3SA 1QJOA 3F2BA 4ULLA 1NE3A 2Z0SA 1CI3M 1HUMA 1HXYD 2L55A 5FO9B 4EQOA 1IYUA 3BU2A 1TWFB 3P75A 4UP7A 5ISRA 5IP7H 4LF9Q 5M3MB 3CC2A 3S1RH 1JCKB 1CZWA 3SR1A 1CUKA 1CKMA 2AKWB 3T4AC 2KENA 5BR8L 5CGKA 3W2DA 3KBXA 4CDCC 5M5XH 3S2DH 3A54A 4X3UA 1CZGA 3I8ZA 4X62L 1Q7YC 1B8AA 3RLOA 4DR3L 1CA5A 1XTDA 1GUGA 4KD3A 4DKAC 2PQEA 1KTKA 3L0OA 2B63H 4MNOA 1ET6A 5C3WA 5HURA 1R4QB 3CMEA 4HEDA 1IYVA 4K6DA 1EZ8A 5I9PA 4HTHA 3TP8A 3B6YA 1NNXA 2F0PA 1IKLA 2JA8G 1VQBA 1PH2A 1LO5D 3MXUA 2A6HC 3G71A 3BVZA 1DZ1A 1WTHA 2B2UA 5KIXA 4JCVE 3KUPA 4WJWA 4EGVA 4X62Q 2HCIA 3H94A 4LWCA 2MNAA 2XRQD 4JI6Q 4DU9A 1VQJA 4DR3Q 2MPMA 1EIGA 3S1MH 1VQ9A 1C9OA 1ZEQX 2RBMA 1HZ9A 1EYGA 5FOBB 4GLVB 1JWSD 1HCZA 2ZJPA 1MGSA 4ABNA 2VXWA 3CKIB 1EQQA 3FPPA 1SROA 1L0WA 1FJGL 5IYCH 4CJ1B 4L8JA 3NEMA 2RSNA 1EY9A 1B9MA 1SNPA 2B8GA 2A6HD 2VS1A 4RFBA 5M3FB 4JV5Q 3S1NH 2MHVA 2R93H 1NR4A 3NWSA 1V43A 5E3FA 4X64L 4A3IH 5JPMC 1Q8KA 1YVCA 1RHPA 1K0RA 2RVLA 5FO8B 4JOIC 1U9RA 2WV6D 4K0KL 3I90A 4DGZA 1KDCA 1Y8NB 4DF7A 5CV4A 2J0TD 4PNYA 3IKJA 2L15A 2BA0A 1Y14B 3EA6A 2B2VA 1EOTA 3ULPA 3NSWA 3MXNB 1LABA 2EYPA 1N33L 2UU9L 1VQMA 3CHBD 2EIFA 4G4KA 1E22A 2F0VA 4C3IH 3OMCA 2E2JB 2K05A 3E0JA 1HFNA 2KJXA 1X3QA 3ERSX 1GUOA 2NVQB 4XQJA 3BZKA 1PHJA 1IBKL 4KN7C 2WAQB 2CH4W 5C4JH 2B2YC 2L9HA 4IZ8A 4K0KQ 2NWGA 2E2IB 3NBHB 1TS4A 4NXML 2BH8A 3M7GA 5ELCA 4FF2A 3CCQA 1JMCA 1EL0A 5C5LA 1TIID 2ZTDA 1X54A 3T13A 2XWJB 2O5IC 5IWAL 5J1ZA 1X3EA 5M3FG 1N32L 1EIFA 1QE6A 1STAA 4O2DA 2XGTA 2A69C 2ZXOA 1PTOF 3H91A 2AUKA 1PVOA 2LY7A 4CKBA 4IOAA 2JP1A 2N78A 4IUQA 1ICFB 2N3SA 3G6EA 4DK3C 5AJ3L 1IBKQ 4A3EB 1A8VA 3T1HL 1HNWL 4BXXG 5EPKA 2A1AA 1VQKA 2RQXA 4NXMQ 4JI0L 2N49A 2F0UA 1E1OA 1AN8A 5CR3A 1ILQA 1HRJA 5KNDA 2A8VA 1SNCA 2R3ZA 1HA6A 3HKSA 1N32Q 2A69D 4GOPC 2K28A 2RDFA 4ILWA 4HIOA 2M2LA 4RHRA 2D0OA 4RCOA 2R7ZH 2PZTA 4C2MB 2KECA 1RJTA 1WTWA 1KRSA 1K83H 1GJXA 2DGYA 3IL8A 5AJ3Q 5IYBH 2A19A 5EQ0A 1HNWQ 2EY2A 1Q82C 4KD4A 2PW7A 2VQEQ 3NQIA 4A3BH 4RKBA 4N8FA 4DAMA 2NB0A 2C35B 4HIMA 1NR2A 5KGUA 2CVRA 2EPBA 3HP3A 4RG1A 1QUQB 3TEHB 2VZAA 4R8NA 1LT5D 3RLNA 1H9SA 3CU7A 4H02A 3PUVA 2HHHL 1I6HB 1JB7A 1PA6A 4DR6L 1BXTA 2L12A 1SFOH 1JORA 1LACA 3S16H 3D8GA 1A0IA 2D2CC 3S1RB 3EN2A 2MO1A 3R8BA 2D0PA 3RN5A 5FO7B 3SVMA 3GTLB 4C3JH 2Q8RE 1C48A 1X55A 1JJGA 3S2DB 1MJEA 2RCNA 1F2ZA 1E24A 2XVSA 1H9MA 1QZHA 5JVG3 3HKZB 1K8MA 2ASBA 1EEID 2KHSA 1F9QA 4AYBE 1EQRA 2HHHQ 3CP0A 3CPWA 2B63B 1WI5A 1GOZA 4A3LG 1MIUA 4DR6Q 4X3KA 1V1QA 2FJ2A 4AIMA 1D7QA 4HIDA 4I7ZC 3EQLC 2QILA 4B9XA 4IQZA 3H6MA 1CKOA 3BVMA 1XMOL 2EXDA 2UUCL 1WTXA 2JA7G 5BN4A 2FMMA 3I4MB 4N9PA 1EFID 5DM63 5LMNL 4X6AH 2FXQA 1LLRD 4LF4L 4DK0A 2H5XA 3OPOA 1G291 1Q12A 3S1MB 1I4HA 5ELOA 1HNXL 2K04A 1PTOB 2DNCA 4GKKQ 5EJWA 4JI1L 3J7A5 5D65A 2Z6KC 3OIQA 5JAVA 3SK6A 4TKOB 4JOIA 5IP7G 1B2TA 3A8JE 3E9IA 2QEXA 4HJAA 3J80E 3CD6A 5EPJA 5HY6A 2BE5C 4HN7A 3T1YL 2F4VL 1V1OA 4JI2L 2PO4A 2UUCQ 1PFSA 4A3MH 3S1NB 4YWMA 2R93B 3TP7A 2HQEA 4BBSH 3SHLA 2ZXRA 1JJ2A 4A3IB 4H7BA 1QZGA 1JJCB 4UPAA 1Q86C 3OIPA 1EZ6A 2A73B 4Q5VA 2B63G 5FJ8H 5JJZA 4DR4L 1T5EA 4KKSA 2NVTH 1BCPC 1LTSD 4KKUA 4LFBL 1EY6A 3K8AA 2YU9H 3J7AF 1WCMH 3SEBA 3J81i 1QCBD 2B2YA 1PH5A 3PO3B 4DV6L 2BE5D 2CW0C 5C0XH 2ES2A 2QA4A 4MTKA 1HZBA 2F4VQ 5C0XI 4RMFA 2A74C 3D6WA 2B39A 3BS1A 4QGUA 3GTPH 1TWCB 2FFKB 1CTMA 3CC7A 4ZK9B 3T51B 2F0IA 2PI2A 2AQ3B 4NP5A 2SOBA 4QL5A 1HR0W 1BCPD 1FL0A 1SNMA 3R2TA 1LTGD 1S5ED 5KNCA 2KCMA 5IYCG 4A93H 4LFBQ 2UXBQ 2EJFC 4DR7Q 1STBA 4KHZA 2CW0D 4PZ6A 5EKKA 4DV6Q 4LF5L 2WB1E 3S2HB 1T9HA 3C2PA 2R93G 3NP8A 1U0LA 1V8QA 5IT9L 4A3IG 4FXGC 1JICA 4DUYL 5DAUA 1CFMA 1K8OA 1XTCD 5IT9c 4H0LC 2VW9A 4GOPA 5IOCA 2D5DA 4EQ5A 1B70B 5DM73 2R7FA 3C46A 3M4OH 5E4WC 2IX0A 1WVLA 2DJFC 1NSNS 3A55A 1Q46A 4B3SL 3I2ZA 4CJ0B 4BA2I 4ZKCB 4A3GH 3DEOA 5I2YA 3A74A 4DV3L 3QO2A 4C3IG 3VYTA 2GA4B 3K59A 1RF2D 2LFNA 3HOZB 5C44H 1EYCA 4LJZC 2R7ZB 1GXDC 1K83B 2K5VA 2L1BA 3M85A 1SR3A 3CCJA 1AFPA 3RR5A 5C4HA 4RKLA 1YJWA 4B3TL 3O13A 1ENFA 4B3SQ 1WFQA 2MP1A 4P73A 1CQFA 4BY1H 4A3BB 3KYHC 5CV6A 1IBMQ 2A6EC 1I3QH 1RD9D 1JOKA 4C3HH 1BO0A 4PMBA 4DR5L 2BOSA 4I7AA 1OXUA 3CRLC 1XNQL 4WORA 1CM9A 3K5LA 1VQEA 1LTBD 1CKNB 4GNXC 1EWIA 4LK1C 2QW7A 3GTOB 1SFOB 2AHOB 2X6LA 1IHZA 1VQGA 1GUNA 2K14A 3TBIB 4HMIA 1RODA 3K81C 3VYSA 1NBWA 2DNEA 3NQTA 4B3TQ 1STEA 2ID0A 4C3JB 4ZCKA 4K5WA 2A6ED 2F1MA 1I5FA 4OO1H 1QUQA 5LMUQ 5A2QE 4FF4A 3OMGA 4OIKA 3D6CA 1W3SA 2MJ8A 4OO1I 3I4LA 3EFXD 5EBDA 4DR5Q 5ELEA 2R7ZG 2WP8J 1JB3A 1A2UA 1EU3A 2VY3A 5IYBG 3D0FA 4ZRZA 4DAYB 1PH1A 1Z7TA 3I7FA 3AQQA 2JN4A 1PRTF 2E2HH 2Z6KA 2EYOA 2RKSA 4A3BG 3JC66 5COYA 2ZJRA 4CJ2C 1LM0A 4JBMA 2JA6H 3EJIA 2QCPX 3K5MA 2JEAI 4GS3A 4DV7Q 1TXYA 2Q2HA 1SYBA 3PF5A 4C56C 1X56A 5ELBA 3HOVB 5DLQE 4OHJA 1TWGB 2XRSD 5FKAC 1U4PA 2EY1A 2KCCA 1Y8OB 5K5PA 4N9TA 1B44D 3VR6A 1VQDA 4ODGA 4ME3A 4KN4C 1LTID 3M4PA 4YCVA 2UXDL 2JA8B 1EY0A 4C3JG 4LUVA 2GVAA 3HOXH 2F0FA 3NHHA 4F88A 1NY4A 1F9RA 1I4PA 2QEJC 3TRZA 3QIAA 4KHVA 3ONAB 3STBC 2F0OA 5FLXc 1JE5A 2I46A 5IODA 2KHJA 1V9PA 1YNNC 3AYHB 2KCTA 4UP8A 1KQSA 1RDPD 1SNQA 5K36H 4G7OC 4FP5D 3PGZA 2AWOA 2FMCA 4JI8L 4JI4L 2UUBL 3GTJB 1EFWA 2YU9B 3L7ZC 4DXFA 3MFGA 3K5NA 3GTKB 3SGIA 5CMDA 3WOEA 3TZUA 3CCMA 1HUNA 4FVMA 2ICIA 3VR5A 3HOVG 3TP5A 3HOYH 3GTPB 2MGSA 2IHEA 3STBD 4O42A 2OTJA 3SK4A 1JT8A 2KOLA 1U5KA 1O7ZA 1SN8A 1YNND 3CCVA 1OXTA 2BDNA 4QMGA 2CH4A 4YY3L 1Y1VH 4DV5L 1SYDA 2JYOA 4TVAB 1F77A 4JI8Q 4L63B 2UUBQ 4A93B 1AE3A 5BR8Q 2MUYA 3I73A 4OONA 1GVPA 3MXGA 1JWMD 4AH6A 4A3JH 1SMXA 4ZAIA 1Z47A 4A3MG 4DXGA 5T1GA 4IFDH 1WTOA 4QUFA 4BBSG 5EKIA 2I0QA 1YITA 2KBNA 2PZWA 3FPUB 4IFDI 3EBEA 1N8RC 1Q1BA 2PYKA 3BDOA 2E74C 1IYJB 3HOUH 5FJ8G 1GO3E 3M4OB 1YZ6A 4NMZA 3KLRA 3GTQH 4ME5A 5IYDH 4LAAA 1WCMG 4BBRH 5CV5A 4DV5Q 5JVH3 2E75C 4QIWB 2A5HA 1WD1A 5C0XG 1N9WA 3KJPA 4IJLA 2B8FA 4FNFA 2LMCB 1KD1C 1PRTB 3M4YA 1II3A 1KABA 2SDFA 4IUUA 1OXVA 5C44B 3S1QH 1F9PA 4EVOA 2JJQA 1B4OA 1VQ8A 3UDFA 3IFTA 2XSCA 1Y1WH 1QG7A 2VQFL 1QNUA 1P8LA 2Y0SE 2C5CA 4CBVA 3L9AX 2F0WA 2XNAC 1FNWA 1MJCA 5C0XJ 4GNXA 4P74A 1OTCA 4JI7L 3JAML 2Q2TA 4A93G 4KI0A 1FJGQ 3MAQA 2YTXA 3LNNA 3FDTA 4LF8L 3VDYA 1O7YA 1BDOA 2Q2IA 3JAMc 2KA7A 2MQHA 3FP9A 4BY7H 1CHPD 1A15A 4C3HB 3MVVA 1PYWD 2O2LD 4NW2A 4TQUS 4PG3A 1BBUA 2Z4IA 2DUDA 5CYUA 5BN3A 1SEBD 3UDIA 4X64Q 5LL6X 1UEAB 3HGBA 5CORA 4GOPB 2I5HA 1O7IA 3DEPA 4LFAL 4C1NK 2NBFA 1BCPF 3PQIA 5CBEE 3I91A 1DOKA 1PRTC 3M3YB 1OXSC 4TSSA 3I56A 1TVXA 4R8IA 4A3GG 4JI7Q 2Z1CA 1KNAA 4LF8Q 1Q1EA 1N33Q 2UU9Q 1LTRD 1QILA 2LKVA 2R61A 1B3AA 1TS3A 3L3OC 2K4KA 4EQNA 1IKMA 5C44G 5HGTA 4ZQ3A 2K1BA 1BBXC 4LUOA 1ESFA 1CKNA 4OWXB 1DYQA 3AB9A 1R9TB 1HPCA 3SK5A 4IJHA 1PH6A 4DR1L 2EOTA 4DR2L 1EIHA 5E7NA 2EQSA 2K5HA 1Q8IA 4LFAQ 1UE6A 1MHWC 2BA1A 4XIGS 1PRTD 2KVMA 2NTSA 4IPGA 5KYIA 2E2HB 3T56B 5C3EH 4BY1G 3Q24A 2B2WC 3TS2A 1KL9A 4H44C 5D3DA 2JA6B 5KRUA 5IWAQ 5EAYA 3BYTB 4C3HG 1SXTA 1QVCA 5M5WH 1A62A 4JVZA 2PW5A 3OHXC 4A3KH 2YV5A 2NVXH 3RZOH 2VNUD 2XIWA 4OWTB 4LF6L 5CV9A 4YWLA 2HQLA 1FYCA 1I4RA 5JJKA 1W6JA 4M1UB 3HOWH 3S17B 3Q23A 1BBWA 3OWFA 1SE4A 4A3CH 3T1HQ 4DAYA 1GHKA 3PIO3 3KK7A 2PMZE 4HR7B 1YJNA 1OO9B 2BH2A 4HAEA 2L11A 5IE8A 2I5LX 2N55A 4JI0Q 1U4LA 4KK7A 3DHQA 5JEAJ 3BDCA 3Q6SA 4LUZA 4OO1G 2JA7B 4PZ7A 4RGOS 3K0XA 3S15H 4A4IA 1HFGA 4OGQC 1A63A 3NELA 3J80L 1JWUD 3V05A 3M9BA 4RGTA 2K50A 1EQTA 1EY5A 3J80c 4KY6A 3AFPA 2M9VA 4R4IA 5C4XH 1XWEA 4POFA 3QR8A 5IGGA 3T53B 1D1KA 4C1NI 1A6XA 1NTGA 2R92H 1D5ZC 1KLGD 5D3IB 3Q8DA 1LYLA 1ZYRC 3CQZH 2ZM6L 2JA6G 2K5DA 5M5XB 1MD2D 1Y8PB 2G5DA 3KJOA 1FVIA 4A3FH 4DV4L 2JA5H 3ICEA 3U9SA 1E2VA 1O78A 4R4CA 3HOYB 1MSGA 2F0NA 3RUZA 5IY0A 5GAHC 3FRPB 3F2CA 1CQVA 4L5RC 1VQ6A 4LNQA 4G57A 3K7AH 3U4ZA 2PCFB 1S40A 2OEOA 1ZYRD 1BCPB 1VF7A 3HOXG 1GKHA 2L5TA 2B3GA 3TN2A 1YI2A 1FGBD 1BKBA 2EYLA 3BJUA 4R9WA 1PXUA 1BNZA 1A3VA 4HMJA 2IX3A 4DV4Q 1HR0L 3TSSA 4HJ5A 3DLLA 3WWVA 1NJIC 4LW1A 1RL2A 4GLAC 1VQ5A 3DWAA 2B2TC 1KAAA 5K36G 3GD7A 3V2TA 1XJVA 1L1OC 1PV4A 4JBKA 4BBRB 3KDFA 3CPFA 2LSSA 1KHIA 1VMCA 1XPRA 4IUVA 4U68A 5C6AA 3FMCA 4JK1C 4DV2L 1UWVA 4DK6C 1XMOQ 4EQPA 3WOFA 3AMUA 1G51A 3GP7A 3ZYYX 3HRZC 2ZJQA 3DMUA 1STHA 3MZ5A 4GKJL 1YIJA 5LMNQ 3HOYG 2QF7A 4LF4Q 3S24A 3GTGH 3A5ZB 3GTMH 1HNXQ 2LXJA 5EPLA 2NN6H 3J81j 4JI1Q 1G6ZA 4L5TA 3RNUA 2AUJD 1AEXA 2K32A 1LTAD 2NN6I 1B7YB 3Q22A 4JBJA 2O5JC 2ZXPA 4IUNA 5F2DA 2E5LL 4KJNA 1YEZA 3T1YQ 4A3JG 3BZCA 2F0DA 4C3IB 2ATWA 4JI2Q 2J7ZA 4DV2Q 4BY7B 3MFYA 1X65A 4IFDG 1EY8A 1VQ7A 2X6GA 2OT2A 3TP6A 5M3MH 2HUGA 4RH6A 3H09A 1VQNA 1XMQL 4GKJQ 3ZJYC 3KF8B 3OW2A 4WJ4A 3A56A 2OWOA 1TS5A 2ENBA 5C4JB 3C3LA 1X3FA 1S5DD 1VS0A 4DR4Q 5IIFA 4ZUJA 3D4RA 5G3LD 5IYDG 3V96A 1VF5C 3CAMA 1SE3A 3ULLA 4QCLA 4BBRG 2HT1A 3X3NA 1DCZA 2F0HA 2HIXA 3U9OA 1WJJA 1W6KA 1E3PA 2Z9HA 4IFDJ 3QG1A 4X3SA 3CCSA 3HS0C 4IN3A 1I4GA 5KNBA 3VA5A 3TQYA 5TSSA 4DV0L 2B2WA 3PIP3 1XXGA 1YHBA 2RF4A 2JA9A 2HDLA 4IURA 3ERQA 4K6LA 2P5ZX 2TMPA 5A2QL 1Y1WG 3CW2C 5JPNC 4B3RL 3GV6A 3LWEA 3BDLA 4J15A 3J7YW 5NUCA 3LGJA 5FK9C 4YHHL 2L4NA 4GNXB 1SJED 4NDXA 1EWHA 2F3IA 4WFN3 4P72A 4B9WA 1CSPA 1XYIA 4BY7G 4QJFA 4LF5Q 2Z6BA 4PMCA 4A3KB 2NVXB 2VB3X 2Q2UA 3MEHA 1PFBA 4DUYQ 2GVBA 3TMEA 2G9DA 2TSSA 4KLKA 5GADC 1VQAA 1UE5A 1X3GA 3HOWB 3LX0A 1STGA 3NWTA 4F87A 3KBGA 4K5XA 4YHHQ 3IRBA 1VQPA 4CDEC 4NXNL 3RD4A 5ELFA 4AQYL 4YCWA 1M90C 3ER0A 1FGUA 1UNSA 4DV3Q 3S15B 1LV9A 3UE1A 1TWAH 3TZDA 5JEAH 4FXKC 4AYBB 2EYJA 2WKCA 3NTHA 3IAYA 2HCCA 3TREA 1BOSA 2F0LA 2K52A 4K2LA 1ASZA 4N8X1 1EOVA 2IX1A 4F7XA 4KHPL 1K9MC 3S16B 4G7ZC 2E2JH 2R92B 1J8IA 4V0BA 3J7ZC 3M4QA 3AEVA 3ND9A 5C3EG 2PNHA 2NVQH 3J81E 3DM1A 5CV8A 3PO2H 2F3VA 2BDOA 1IL2A 4XT1B 2CQOA 2V4DA 4OIJA 1I4QA 1E2WA 4A3KG 2JA5B 4QQBX 1SSOA 1WTQA 1XNQQ 2F0SA 2PI2E 4Z9CB 2RDHA 4DUZL 2RDGA 3HOWG 2QDLA 4JI5L 4A3CG 4KHPQ 3RZDH 4Y52H 3K7AB 2NVYH 4CGYB 1EQVA 4FYDA 1STNA 2B2TA 3H3VH 2VL6A 3F1ZA 2HIVA 2KCNA 1L1OA 4A3EH 5M5YH 1G91A 3H3VI 4AYBG 1EYDA 2WAQE 4BWGB 4IPDA 5IGEA 3E5SA 4Q0FA 4DAVA 1WTVA 3D3RA 1CHQD 2Z4HA 4UP9A 3WDNA 1XPUA 5C4XG 2OQKA 4HSVA 4ZYSA 4OX9L 2OXPA 4KKTA 3E9HA 4PV1C 4DUZQ 4MIUA 3F2DA 2R92G 1B53A 3I55A 2I07B 2VB2X 3QOJA 1I4XA 2CWPA 2JSOA 2EYHA 5A35A 1HJPA 5EKLA 4A3MB 2PQAA 3W3AA 1LTTD 1V1PA 4GLXA 2JA5G 4BBSB 4BS9A 1I50H 3M7NA 3UI2A 4FF1A 3GTGB 5FLMH 1EY4A 1EEFD 3GTMB 1F9SA 1JR0D 2X69A 3H15A 3HZXA 2GN5A 4OX9Q 2NVTB 1J5EL 1L0YB 1QVGA 1PYBA 3KLSX 1VCIA 5IGDA 2WB1B 1WCMB 4IUPA 4PMWA 4NPSA 3KOJA 2UXDQ 2CKZB 1AH9A 1S5FD 1I6HH 3CC4A 2Q8IB 1WD0A 4BA1I 4DNTB 2Z8LA 2D62A 2KQ3A 3K0YA 5M9OA 3QJYA 1SRUA 1D8LA 2FHTA 1IL8A 1EIYB 3CXCA 2N88A 4Y7NH 3FHWA 1QVFA 2HD3A 1JOQA 3GTLH 4R1JA 1VQOA 3EROA 1S4ZA 1UE1A 3A0JA 4FO2A 4RWSC 4EX5A 1IBLL 2L0CA 1K73C 1J5EQ 1FNVA 2F0GA 4JI4Q 4JI6L 1SYCA 3SDZA 4B3ML 3KDFB 4MN3A 1KRTA 5IGBA 1BUVT 4JC0A 3DWQA 3H0GH 3BYYB 1XPOA 1EU4A 4XDXA 1F2LA 1RIPA 3TDQA 1G2SA 4ALPA 4K8JA 1STYA 3PUYA 3KF8A 3NXWA 2K6AA 4J6HA 2H4OA 1IW7C 2NN6G 4K8IA 4P75A 1TY2A 4JV5L 5IGFA 1JE4A 1E2ZA 1TQOA 1PZID 4HJ8A 4UDUC 3I4MH 2WB1G 1UE7A 1IBLQ 4YY3Q 2EJGC 3CCRA 4TRDA 3VA7A 3D4WA 4A76A 4UY8C 3RLFA 4A3GB 1G2TA 3NK9A 4WJ3M 2F3WA 1AZQA 1B9NA 4B3MQ 1UUPA 1Y69U 4KY7A 1XNRL 2B29A 1PTOH 1X32A 1SYGA 1FNUA 2H1EA 1SDFA 2ICEC 2SNSA 3JAMi 3UE0A 3HKZE 1AW7A 2D9UA 1N36L 5M3MG 3U4VA 1N34L 1S72A 1E0BA 1S5CD 1KXLA 1ILPA 2DY8A 1IW7D 2K7VA 4J8QA 5FLXE 2EZVA 2KUMA 2RA4A 4M8AA 3VYUA 2AQ2B 2ALYB 1K3RA 1MI2A 1SMYC 1BQQT 5KEEA 4BY1B 4MHEA 3K7UC 1E7ZA 3W1GA 2I5MX 1I3QB 3GDEA 1CK1A 1PYSB 1LT6D 4CDDC 1FD7D 4CKCA 3VR3A 3PUZA 1QB5D 3X3MA 1S5BD 1XNRQ 1DONA 2XN9C 1TWAB 3OWEB 3VR4A 4P2CB 4LF7L 2K5WA 3A7LA 1N36Q 3G7LA 4DK1A 1N34Q 2OCEA 5CV7A 4OWWB 2A68C 3PO3H 3URYA 1Q81C 3I4NH 2VQFQ 4IOCA 2R6GA 4JYAL 3D4DA 1MSHA 5G3LF 1GUSA 4HJ7A 1SMYD 1TWCH 2WKDA 2WIIB 3PO2B 1ASYA 3NPPA 4OELB 3PCOB 3R3OA 2M00A 1ENCA 2K33A 1M4VA 3ND8A 1SE8A 4JI3L 4XXEA 4KJOA 1D2BA 1WOCA 2EE1A 4MZ9A 1QOHA 4LF7Q 1G6PA 2A68D 3P20A 4KMUC 1IZ6A 1PH3A 4QUCA 1ZXTA 4NKLA 1SYFA 3S2HH 2AMCB 3KFUA 4POGA 3RZDB 4JYAQ 2AWNA 4ID6A 3OOCA 2NVYB 4IALA 2EYMA 4A3DH 1I6VC 3SK8A 1TU2B 3P7JA 1BR9A 3R2IA 3BZDB 1VQLA 5C3XA 5T1IA 1W2BA 2IL8A 2YTVA 2O4XA 1K28A 5C4ZA 2NTTA 5JEAG 5M5YB 2WINB 1YHAA 1T5XD 1VQFA 3C1FA 2FINB 2VQEL 2F0EA 3C1EA 3E3XA 4JI3Q 3J80i 4PZ8A 2KEDA 1KDBA 1S3OA 3PMFA 1YNJC 3AU7A 1RTNA 4CHTB 2J4XA 1L2FA 1O7LA 4XYOA 4DR1Q 5IGCA 1TY0A 4XQQA 4I65A 1J9OA 4DR2Q 1I94L 4P71A 2LXKA 2XTIA 2EJMA 2V1CC 4GZYC 2EDGA 1A3TA 3HOZH 2C9OA 1HA5A 1NUCA 1TWHH 1ZKOA 4KV6A 1ML0D 3UDXA 1KIXA 3PO2G 1PFMA 2F0TA 1BF4A 1VQ4A 3HOXB 1OXXK 3UDGA 2WAQG 3K58A 3TS0A 1L0XB 1PH7A 3JAME 4LMQD 1KNEA 1Z6HA 1I50B 5ELNA 3BVGA 5IP9H 1GM5A 2EXZA 4UAIA 1FR3A 4LF6Q 1C4QA 1PFNA 2NUCA 4OXPA 4QB4A 3DXJC 1CSQA 1YNJD 2YTYA 1H95A 1X6OA 1K8GA 1YNXA 4B08A 3H3VC 1P16A 4RHSA 1JC7A 2G9HD 3S14H 2YYZA 3QOLA 4X3TA 3K6OA 1I94Q 5GROA 5ELDA 1GHJA 3CRKC 1VMPA 3U58A 3I4OA 3I70A 2LS01 2K5QA 5I6YA 3OYYA 3GTOH 1L1OB 2ZTEA 3AFQA 4A3EG 3G6JB 3MHBA 3NENA 2IJ0A 1HQMC 1XX8A 1BVSA 2VUMH 1DOMA 1ET9A 2DJGC 2AQ1B 3NUCA 1DM0B 4XQNA 1HTPA 3SXHA 4Y7NB 3DWPA 2CFMA 5H1SE 3T16A 4APVA 2NZ1D 3PF4A 2HDMA 3FKIH 4G7HC 1RTOA 4GN3B 1Y1VB 3N6RA 2PPBC 1DXMA 3E0EA 2BCOA 2K75A 4F8MA 2K01A 4KTAA 2ZM6Q 1PH4A 4GKKL 4HIKA 1NCVA 3H0GB 1SNDA 4R4OA 3L2PA 4A3JB 2JQOA 2CQAA 5E1FA 2KHIA 2PQAB 1V1PB 1F2MA 4XYQA 1SJHD 2Y0SB 3PUWA 2E2DC 4ZKBB 4ZUIA 3KF6B 3S9WA 5FLMG 3HG9A 3HOUB 2JEBI 1EWCA 3LWUA 3I72A 3MWYW 2N8NA 3GO5A 3ITPA 4RGMA 4NB3A 2CCZA 3GTQB 1JQYD 4XTCS 3CMAA 3HOVH 4RGNA 3PV0A 4JW0A 1TWGH 5BN5A 1PZJD 1WTRA 1C8CA 5LL6S 3W1BA 1B3QA 1K3BC 3HEJA 1HZCA 3S1QB 1RKNA 5E4XA 1PZKD 2EVBA 1HR0Q 5KYLA 1Y1WB 1C7YA 2JA8H 3PIOA 3CCEA 1KDAA 1PMRA 1MKHA 2IHFA 3F2UA 1D5MC 4FF3A 1H9JA 2IW3A 1ONLA 1Y1VG 4WRDA 3NBIA 3J7AV 1SAPA 1UAPA 3HKZG 4HCSA 3RN2A 4DFAA 1D5XC 4IUTA 3H0GG 4CKEA 1K8AC 2SEBD 5JOBA 5L37A 1TWFH 1TR5A 3GV3A 4MTNA 5AFWA 2Y0SG 3VR2A 4L6TB 3MXPA 2UXBL 3GTJH 4DR7L 3HOUG 1KLUD 3GTKH 1SE2A 2PZUA 4E6IA 3I4NB 3CCLA 2XWBB 1M1KC 5GAEC 4X66L 1IXRA 1LT4D 1PTOC 3MC0B 3I4MG 1DJRD 4X65L 1AZPA 1JOOA 3A7AB 3EVQA 4L5SA 2E5LQ 1TT2A 3NTKA 2F0JA 3W5OA 5GAGC 4HJ9A 2OQ0A 1Q90A 1GUTA 4XT3B 2F4IA 4FDBA 3J81L 5LMNW 3NTIA 2WFWA 4RCNA 2Q8TA 1Z9FA 1B1ZA 3A5UA 3DUZA 2OTLA 2RCFA 3J81c 2K5NA 5GQOA 1NMGA 3E6ZX 3MXNA 2PMZB 2RSOA 1XMQQ 2EY6A 3KLSA 1HH2P 4U673 1EY7A 4DA2A 3Q0AA 1KC8C 4LFCL 4J1MA 1O80A 5JJLA 2EY5A 1B50A 2IWHA 1QWYA 1E1TA 1SYEA 3RMHA 1PTOD 2F52A 1PDQA 4X66Q 1X9NA 4DPGA 1C0AA 1EYAA 1EUJA 3IFDA 5C3EB 1LT3D 4X65Q 5LHY1 2F03A 4FXDA 4A3DB 3A8KE 3GQBA 3NE5B 1PLFA 1RCVD 3EIVA 2F0MA 4K2KA 2OF1A 5I4DA 4CDFC 1VQHA 5M5WB 3NBHA 3RZOB 3KLWA 1DGSA 1ENAA 3VYRA 5EGTA 4DV0Q 4L5QA 1LTLA 1SLJA 3A8IE 4DN4M 5J22A 3D31A 1D1IA 3FEWX 2B2UC 4YCUA 1IBML 1HTLD 3PO3G 4GN4B 3SE0A 3I4NG 4JG2A 4B3RQ 5M3FH 3QWNA 4LFCQ 3N52A 4A75A 1PH9A 4DNRB 1TWHB 1M8AA 3OTOL 1WTPA 3K80C 3G4SA 2DY7A 1HNZL 1D6EC 5JJIA 2E8GA 4HSPA 1QNKA 3HFZB 1YBYA 4BXXH 2UXCL 4PQXA 5J39A 1LUZA 3K5OA 1YJ9A 1PH8A 4V190 2F0KA 4OEMB 2WACA 4RA8A 2QDBA 3DM3A 4DNIA 5C5MA 2EYFA 5C4XB 4GN5A 3MEFA 4H13C 5LMUL 1CT1D 5I9OA 4QF4A 1H9KA 1MBYA 1TS2A 4KY5A 4OL7A 5HGQA 1TKWB 3S14B 4QIWE 1VDZA 3CQZB 1Q3LA 4JBWA 4O1NA 4JPBW 4A3DG 4NXNQ 2SNMA 3R93A 3FVQA 3MTSA 2IY5B 2B2VC 3OTOQ 2R7DA 4AQYQ 4A3FB 1HNZQ 2E2IH 2E76C 1HQRD 2VUMB 2UXCQ 5DEHA 2IPKD 3U50C 4DV1L 2IT1A 3M3YH 2DN8A 4R4QA 3P1HA 2ZTCA 2QGQA 1F2YA 4O0AA 5I2XA 1DD2A 5IT9E 3FKIB 4DV7L 1AP0A 2KEEA 2NZOA 3F8TA 3CCUA 1HZAA 5EBCA 1UEBA 1G8ZD 3OW7A 3PUXA 3HOZG 2MFIA 1HHVA 2JE6I 1SBBB 2CWAA 1CA6A 3PIPA 5CC4A 1R9TH 1VQIA 4RAUC 1K0SA 2UUAL 3CF5A 4K14A 4YWKA 1A2TA 3G48A 4IO9A 2CHBD 3ULJA
chains in the Genus database with same CATH topology
4QL5A 5IP9G 1HR0W 1FL0A 4DV1Q 1NTGA 2R92H 5IYCG 2KCMA 4A93H 4LFBQ 2UXBQ 4DR7Q 3Q8DA 1WYDA 3PSIA 1LYLA 4KHZA 2RHSB 1VQCA 3CQZH 4PZ6A 2ALYB 2ZM6L 2JK8A 2NZHA 4QY7A 4DV6Q 1K3RA 4JI5Q 4LF5L 2JA6G 2WB1E 1T9HA 3K7UC 1GD7A 2R93G 1E7ZA 3W1GA 1J6QA 2I5MX 1U0LA 3GDEA 3KJOA 1FVIA 1PYSB 4C2MH 4A3FH 4A3IG 3PUZA 4DV4L 2JA5H 1XNRQ 4DUYL 3ICEA 4A3FG 5IT9c 4LF9L 5J3BA 4R4CA 4R4TA 2VW9A 4GOPA 3S17H 4A3LH 4EQ5A 2UUAQ 1B70B 1KAWA 2R7FA 4IPHA 4LF7L 1N36Q 2VUMG 5IY0A 1AE2A 5GAHC 3M4OH 2IX0A 1N34Q 2OCEA 4OWWB 3KF6A 3PO3H 3F2CA 1Q81C 1Q46A 4B3SL 3I4NH 2VQFQ 4IOCA 4IPCA 1NMFA 3I2ZA 4L5RC 1VQ6A 2R6GA 4LNQA 4BA2I 4JYAL 4A3GH 3K7AH 3U4ZA 2JA7H 2RHQB 3FKIG 1S40A 1YHQA 3A74A 4DV3L 4HJ7A 2MO0A 3HOXG 1TWCH 1GKHA 1YI2A 2B3GA 3F2BA 1ASYA 1BKBA 1NE3A 2Z0SA 3BJUA 5C44H 3PCOB 4DV4Q 1HR0L 3BU2A 1SE8A 4JI3L 4HJ5A 4UP7A 2K5VA 1WOCA 3DLLA 3WWVA 1NJIC 4LW1A 5IP7H 3M85A 4LF9Q 3CC2A 3S1RH 1SR3A 3CCJA 4MZ9A 4LF7Q 1G6PA 1RL2A 1CUKA 1CKMA 2AKWB 4GLAC 1IZ6A 2KENA 3RR5A 5BR8L 1PH3A 1VQ5A 1YJWA 5K36G 3GD7A 4B3TL 4B3SQ 1WFQA 1XJVA 4P73A 4BY1H 3S2HH 1L1OC 2AMCB 3KYHC 5M5XH 1PV4A 1IBMQ 4JBKA 4POGA 3KFUA 3S2DH 4JYAQ 3KDFA 1I3QH 2AWNA 3CPFA 2LSSA 1KHIA 4X62L 1XPRA 1Q7YC 4C3HH 1B8AA 4DV2L 1UWVA 4A3DH 3RLOA 4DK6C 1XMOQ 4DR3L 4DR5L 1VQLA 1OXUA 1G51A 1XNQL 1W2BA 1XTDA 2ZJQA 2YTVA 4DKAC 3L0OA 5JEAG 4GKJL 1VQEA 1YIJA 2B63H 1CKNB 1YHAA 4MNOA 5LMNQ 1VQFA 4GNXC 3HOYG 4LF4Q 1EWIA 3S24A 2VQEL 3CMEA 3GTGH 3A5ZB 2AHOB 4JI3Q 3GTMH 3J80i 4PZ8A 2LXJA 1VQGA 1HNXQ 3J81j 4JI1Q 4L5TA 1S3OA 2K14A 3RNUA 3B6YA 2JA8G 1L2FA 3K81C 1VQBA 1PH2A 2NN6I 1B7YB 4DR1Q 4JBJA 1NBWA 1I94L 4DR2Q 2E5LL 4B3TQ 4P71A 2LXKA 2XTIA 2ID0A 2V1CC 3G71A 3HOZH 1I5FA 1QUQA 1TWHH 5LMUQ 1YEZA 4JCVE 3UDXA 1KIXA 4X62Q 3T1YQ 4A3JG 3BZCA 4LWCA 2MNAA 2ATWA 3PO2G 1W3SA 4JI2Q 4DV2Q 1VQ4A 4JI6Q 4OO1I 1OXXK 1X65A 3UDGA 2WAQG 4IFDG 1VQJA 4DR5Q 4DR3Q 3TS0A 1VQ7A 3S1MH 1VQ9A 1C9OA 1PH7A 2R7ZG 5M3MH 2WP8J 1HZ9A 1EYGA 1VQNA 1XMQL 4GKJQ 4GLVB 2VY3A 3KF8B 5ELNA 3ZJYC 2ZJPA 5IP9H 3OW2A 1GM5A 4WJ4A 5IYBG 2OWOA 4LF6Q 1EQQA 3D0FA 4OXPA 1SROA 1L0WA 1X3FA 4DAYB 1FJGL 1PH1A 5IYCH 1VS0A 1CSQA 3I7FA 4DR4Q 3AQQA 2YTYA 3NEMA 1X6OA 1K8GA 2E2HH 1YNXA 1H95A 2Z6KA 5IYDG 4A3BG 3JC66 1P16A 3CAMA 3ULLA 4BBRG 2ZJRA 2YYZA 1LM0A 2VS1A 4JBMA 2HT1A 2JA6H 3S14H 4JV5Q 2HIXA 3S1NH 1WJJA 1I94Q 2R93H 1E3PA 4IFDJ 5GROA 1V43A 3CCSA 2JEAI 4X64L 4GS3A 4DV7Q 4A3IH 3U58A 1TXYA 2Q2HA 1Q8KA 1YVCA 3I4OA 3TQYA 3PF5A 1K0RA 1X56A 4JOIC 4DV0L 3OYYA 5DLQE 3GTOH 1L1OB 2ZTEA 1YHBA 2RF4A 3AFQA 4A3EG 2JA9A 4K0KL 3NENA 2VUMH 1BVSA 1Y1WG 2L15A 2BA0A 3CW2C 4B3RL 1Y14B 4J15A 1VQDA 2CFMA 4ME3A 3ULPA 5H1SE 3MXNB 3LGJA 4APVA 3PF4A 3M4PA 4YCVA 4YHHL 3FKIH 4GNXB 2UXDL 1N33L 2UU9L 1VQMA 4GN3B 2EIFA 1E22A 2F3IA 4LUVA 2GVAA 4C3IH 3HOXH 4P72A 3E0EA 2K75A 1CSPA 1NY4A 2ZM6Q 3ERSX 1PH4A 4BY7G 4QJFA 4GKKL 4HIKA 4LF5Q 4R4OA 3L2PA 3BZKA 3TRZA 1PHJA 2JQOA 1IBKL 3STBC 2KHIA 2PQAB 5FLXc 1JE5A 4HJAA 5C4JH 2Q2UA 2KHJA 4K0KQ 1V9PA 3NBHB 3PUWA 3AYHB 4DUYQ 4NXML 2BH8A 2KCTA 2GVBA 3KF6B 4UP8A 5GADC 1KQSA 4KLKA 3CCQA 1VQAA 1UE5A 5FLMG 1X3GA 2JEBI 1JMCA 3PGZA 4JI8L 2AWOA 2ZTDA 4JI4L 1X54A 2N8NA 3GO5A 2UUBL 1EFWA 2CCZA 4NB3A 3L7ZC 5IWAL 4YHHQ 3IRBA 1X3EA 1VQPA 5M3FG 1N32L 4XTCS 1EIFA 4NXNL 4O2DA 3SGIA 2XGTA 3CCMA 3CMAA 4AQYL 4YCWA 3HOVH 1M90C 3ER0A 3PV0A 1PVOA 1TWGH 4IOAA 1FGUA 4DV3Q 3UE1A 2N78A 1TWAH 3HOVG 2N3SA 3HOYH 3G6EA 4DK3C 5AJ3L 2IHEA 3STBD 3TREA 1IBKQ 3W1BA 2K52A 2OTJA 1A8VA 3T1HL 1HNWL 4BXXG 1HZCA 1JT8A 1U5KA 1SN8A 1ASZA 3CCVA 2A1AA 1OXTA 1EOVA 1VQKA 1HR0Q 2IX1A 4NXMQ 1C7YA 4JI0L 2JA8H 3PIOA 3CCEA 2N49A 1K9MC 1E1OA 4KHPL 4YY3L 1Y1VH 4DV5L 2E2JH 1MKHA 2IHFA 4TVAB 4JI8Q 2A8VA 3J7ZC 2UUBQ 1AE3A 3M4QA 5BR8Q 3AEVA 1Y1VG 5C3EG 4OONA 2PNHA 3HKSA 2NVQH 1N32Q 1GVPA 4A3JH 4AH6A 4GOPC 3PO2H 1SMXA 1IL2A 3HKZG 1Z47A 4A3MG 3RN2A 4HIOA 2CQOA 3H0GG 2D0OA 2R7ZH 1K8AC 4BBSG 2I0QA 1YITA 4A3KG 2KBNA 1KRSA 1K83H 1TWFH 4IFDI 3EBEA 2DGYA 1N8RC 4QQBX 1XNQQ 1Q1BA 4MTNA 2Y0SG 5AJ3Q 5IYBH 1IYJB 3HOUH 2A19A 5FJ8G 2PI2E 2UXBL 1HNWQ 3GTJH 4DR7L 1Q82C 1GO3E 4DUZL 3HOWG 1YZ6A 3HOUG 2VQEQ 3GTQH 3GTKH 4JI5L 4A3CG 5IYDH 4A3BH 4KHPQ 3CCLA 1WCMG 4BBRH 3RZDH 1M1KC 4DAMA 5GAEC 4DV5Q 2C35B 4X66L 1IXRA 4HIMA 4Y52H 5C0XG 1N9WA 3KJPA 2NVYH 1QUQB 4RG1A 4IJLA 3I4MG 3TEHB 4X65L 1KD1C 4L5SA 2VL6A 3F1ZA 3H3VH 2HIVA 2E5LQ 2VZAA 3RLNA 3W5OA 5GAGC 4HJ9A 1L1OA 4H02A 5M5YH 4A3EH 2OQ0A 3H3VI 4AYBG 3PUVA 1OXVA 2HHHL 3S1QH 1JB7A 1PA6A 2JJQA 4DR6L 4FDBA 5LMNW 1VQ8A 3UDFA 1SFOH 2WAQE 2WFWA 1Y1WH 4IPDA 2VQFL 1Z9FA 3A5UA 1P8LA 4UP9A 2Y0SE 2OTLA 3S16H 3J81c 1XPUA 5C4XG 2K5NA 1A0IA 2OQKA 5GQOA 1NMGA 4OX9L 3EN2A 2MO1A 1XMQQ 3E9HA 1MJCA 5C0XJ 2D0PA 1HH2P 3F2DA 4DUZQ 4GNXA 3RN5A 2R92G 1KC8C 4P74A 4LFCL 1OTCA 4JI7L 3I55A 4C3JH 2Q2TA 4KI0A 1FJGQ 4A93G 2YTXA 5JJLA 4LF8L 3VDYA 1E1TA 1X55A 1JJGA 1C0AA 2F52A 4X66Q 1MJEA 1X9NA 4DPGA 2Q2IA 3JAMc 1EUJA 2MQHA 3FP9A 4BY7H 2RCNA 4X65Q 1E24A 2CWPA 1QZHA 4TQUS 4PG3A 3EIVA 1HJPA 1BBUA 2PQAA 2DUDA 4GLXA 2ASBA 3UDIA 4X64Q 2JA5G 1VQHA 4AYBE 1I50H 1EQRA 2HHHQ 3CP0A 3CPWA 3KLWA 1DGSA 3M7NA 1WI5A 4DV0Q 4A3LG 1MIUA 4GOPB 4DR6Q 4L5QA 1LTLA 1SLJA 5FLMH 1V1QA 4AIMA 2I5HA 3D31A 1O7IA 4YCUA 4LFAL 1IBML 3PO3G 4HIDA 1D7QA 4GN4B 3H15A 4OX9Q 2GN5A 3I4NG 4JG2A 1J5EL 4B3RQ 1OXSC 3I56A 5M3FH 1QVGA 1CKOA 1PYBA 2EXDA 1VCIA 1XMOL 2UUCL 4A3GG 4LFCQ 2JA7G 4JI7Q 4PMWA 4NPSA 3KOJA 4A75A 1PH9A 2UXDQ 4LF8Q 1Q1EA 2CKZB 1AH9A 1N33Q 2UU9Q 1I6HH 3OTOL 5LMNL 4X6AH 3K80C 3CC4A 2FXQA 4LF4L 2K4KA 4BA1I 2D62A 3G4SA 2H5XA 1HNZL 5JJIA 2E8GA 5C44G 1G291 1Q12A 1SRUA 1D8LA 5ELOA 1HNXL 3HFZB 1YBYA 4LUOA 1CKNA 4OWXB 4JI1L 3J7A5 4BXXH 4GKKQ 2UXCL 2Z6KC 1EIYB 1LUZA 1YJ9A 1PH8A 4IJHA 1PH6A 3CXCA 4Y7NH 3FHWA 4JOIA 5IP7G 4DR1L 1QVFA 4R1JA 3GTLH 3DM3A 1VQOA 4DNIA 4DR2L 3E9IA 1UE1A 4GN5A 2QEXA 5E7NA 2EQSA 2K5HA 3A0JA 3MEFA 1UE6A 2BA1A 4XIGS 4LFAQ 5LMUL 3CD6A 5HY6A 4IPGA 4EX5A 1IBLL 1K73C 5C3EH 4BY1G 3T1YL 1J5EQ 2F4VL 3TS2A 1KL9A 5HGQA 4JI2L 4JI4Q 4JI6L 4QIWE 2UUCQ 4B3ML 3KDFB 1KRTA 1PFSA 5IWAQ 4A3MH 4JC0A 5EAYA 4YWMA 3H0GH 4JBWA 1QVCA 4A3DG 4BBSH 1XPOA 5M5WH 1A62A 4NXNQ 4A3KH 1JJ2A 2YV5A 2NVXH 3RZOH 1QZGA 2VNUD 2IY5B 3OTOQ 2R7DA 1JJCB 4UPAA 4OWTB 4AQYQ 1Q86C 4LF6L 1RIPA 1HNZQ 2E2IH 4YWLA 2HQLA 2B63G 4ALPA 5FJ8H 3PUYA 4DR4L 2UXCQ 5JJKA 4DV1L 3U50C 2NVTH 2IT1A 3HOWH 3M3YH 1BBWA 4R4QA 4LFBL 4A3CH 2NN6G 3T1HQ 4P75A 3K8AA 2ZTCA 2YU9H 1WCMH 2PMZE 2QGQA 4JV5L 3J81i 4O0AA 1YJNA 1PH5A 2BH2A 5IE8A 4DV6L 2ES2A 2I5LX 4HJ8A 4JI0Q 3I4MH 2WB1G 4DV7L 1UE7A 3F8TA 2NZOA 3CCUA 2QA4A 4YY3Q 1HZAA 1IBLQ 1UEBA 3CCRA 1HZBA 5JEAJ 4A76A 3PUXA 4UY8C 3RLFA 2F4VQ 3HOZG 4LUZA 5C0XI 4OO1G 4PZ7A 4RMFA 3K0XA 3S15H 4A4IA 4WJ3M 2MFIA 4B3MQ 1A63A 3NELA 4QGUA 1XNRL 2B29A 2JE6I 2CWAA 3M9BA 3PIPA 1R9TH 3JAMi 1VQIA 3GTPH 3UE0A 2K50A 3HKZE 2UUAL 3CC7A 3J80c 1N36L 3CF5A 5M3MG 3AFPA 4YWKA 3U4VA 1N34L 1S72A 2PI2A 3G48A 4R4IA 5C4XH 4IO9A 1KXLA 4POFA 3ULJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL5 A;  5IP9 G;  1HR0 W;  1FL0 A;  4DV1 Q;  1NTG A;  2R92 H;  5IYC G;  2KCM A;  4A93 H;  4LFB Q;  2UXB Q;  4DR7 Q;  3Q8D A;  1WYD A;  3PSI A;  1LYL A;  4KHZ A;  2RHS B;  1VQC A;  3CQZ H;  4PZ6 A;  2ALY B;  2ZM6 L;  2JK8 A;  2NZH A;  4QY7 A;  4DV6 Q;  1K3R A;  4JI5 Q;  4LF5 L;  2JA6 G;  2WB1 E;  1T9H A;  3K7U C;  1GD7 A;  2R93 G;  1E7Z A;  3W1G A;  1J6Q A;  2I5M X;  1U0L A;  3GDE A;  3KJO A;  1FVI A;  1PYS B;  4C2M H;  4A3F H;  4A3I G;  3PUZ A;  4DV4 L;  2JA5 H;  1XNR Q;  4DUY L;  3ICE A;  4A3F G;  5IT9 c;  4LF9 L;  5J3B A;  4R4C A;  4R4T A;  2VW9 A;  4GOP A;  3S17 H;  4A3L H;  4EQ5 A;  2UUA Q;  1B70 B;  1KAW A;  2R7F A;  4IPH A;  4LF7 L;  1N36 Q;  2VUM G;  5IY0 A;  1AE2 A;  5GAH C;  3M4O H;  2IX0 A;  1N34 Q;  2OCE A;  4OWW B;  3KF6 A;  3PO3 H;  3F2C A;  1Q81 C;  1Q46 A;  4B3S L;  3I4N H;  2VQF Q;  4IOC A;  4IPC A;  1NMF A;  3I2Z A;  4L5R C;  1VQ6 A;  2R6G A;  4LNQ A;  4BA2 I;  4JYA L;  4A3G H;  3K7A H;  3U4Z A;  2JA7 H;  2RHQ B;  3FKI G;  1S40 A;  1YHQ A;  3A74 A;  4DV3 L;  4HJ7 A;  2MO0 A;  3HOX G;  1TWC H;  1GKH A;  1YI2 A;  2B3G A;  3F2B A;  1ASY A;  1BKB A;  1NE3 A;  2Z0S A;  3BJU A;  5C44 H;  3PCO B;  4DV4 Q;  1HR0 L;  3BU2 A;  1SE8 A;  4JI3 L;  4HJ5 A;  4UP7 A;  2K5V A;  1WOC A;  3DLL A;  3WWV A;  1NJI C;  4LW1 A;  5IP7 H;  3M85 A;  4LF9 Q;  3CC2 A;  3S1R H;  1SR3 A;  3CCJ A;  4MZ9 A;  4LF7 Q;  1G6P A;  1RL2 A;  1CUK A;  1CKM A;  2AKW B;  4GLA C;  1IZ6 A;  2KEN A;  3RR5 A;  5BR8 L;  1PH3 A;  1VQ5 A;  1YJW A;  5K36 G;  3GD7 A;  4B3T L;  4B3S Q;  1WFQ A;  1XJV A;  4P73 A;  4BY1 H;  3S2H H;  1L1O C;  2AMC B;  3KYH C;  5M5X H;  1PV4 A;  1IBM Q;  4JBK A;  4POG A;  3KFU A;  3S2D H;  4JYA Q;  3KDF A;  1I3Q H;  2AWN A;  3CPF A;  2LSS A;  1KHI A;  4X62 L;  1XPR A;  1Q7Y C;  4C3H H;  1B8A A;  4DV2 L;  1UWV A;  4A3D H;  3RLO A;  4DK6 C;  1XMO Q;  4DR3 L;  4DR5 L;  1VQL A;  1OXU A;  1G51 A;  1XNQ L;  1W2B A;  1XTD A;  2ZJQ A;  2YTV A;  4DKA C;  3L0O A;  5JEA G;  4GKJ L;  1VQE A;  1YIJ A;  2B63 H;  1CKN B;  1YHA A;  4MNO A;  5LMN Q;  1VQF A;  4GNX C;  3HOY G;  4LF4 Q;  1EWI A;  3S24 A;  2VQE L;  3CME A;  3GTG H;  3A5Z B;  2AHO B;  4JI3 Q;  3GTM H;  3J80 i;  4PZ8 A;  2LXJ A;  1VQG A;  1HNX Q;  3J81 j;  4JI1 Q;  4L5T A;  1S3O A;  2K14 A;  3RNU A;  3B6Y A;  2JA8 G;  1L2F A;  3K81 C;  1VQB A;  1PH2 A;  2NN6 I;  1B7Y B;  4DR1 Q;  4JBJ A;  1NBW A;  1I94 L;  4DR2 Q;  2E5L L;  4B3T Q;  4P71 A;  2LXK A;  2XTI A;  2ID0 A;  2V1C C;  3G71 A;  3HOZ H;  1I5F A;  1QUQ A;  1TWH H;  5LMU Q;  1YEZ A;  4JCV E;  3UDX A;  1KIX A;  4X62 Q;  3T1Y Q;  4A3J G;  3BZC A;  4LWC A;  2MNA A;  2ATW A;  3PO2 G;  1W3S A;  4JI2 Q;  4DV2 Q;  1VQ4 A;  4JI6 Q;  4OO1 I;  1OXX K;  1X65 A;  3UDG A;  2WAQ G;  4IFD G;  1VQJ A;  4DR5 Q;  4DR3 Q;  3TS0 A;  1VQ7 A;  3S1M H;  1VQ9 A;  1C9O A;  1PH7 A;  2R7Z G;  5M3M H;  2WP8 J;  1HZ9 A;  1EYG A;  1VQN A;  1XMQ L;  4GKJ Q;  4GLV B;  2VY3 A;  3KF8 B;  5ELN A;  3ZJY C;  2ZJP A;  5IP9 H;  3OW2 A;  1GM5 A;  4WJ4 A;  5IYB G;  2OWO A;  4LF6 Q;  1EQQ A;  3D0F A;  4OXP A;  1SRO A;  1L0W A;  1X3F A;  4DAY B;  1FJG L;  1PH1 A;  5IYC H;  1VS0 A;  1CSQ A;  3I7F A;  4DR4 Q;  3AQQ A;  2YTY A;  3NEM A;  1X6O A;  1K8G A;  2E2H H;  1YNX A;  1H95 A;  2Z6K A;  5IYD G;  4A3B G;  3JC6 6;  1P16 A;  3CAM A;  3ULL A;  4BBR G;  2ZJR A;  2YYZ A;  1LM0 A;  2VS1 A;  4JBM A;  2HT1 A;  2JA6 H;  3S14 H;  4JV5 Q;  2HIX A;  3S1N H;  1WJJ A;  1I94 Q;  2R93 H;  1E3P A;  4IFD J;  5GRO A;  1V43 A;  3CCS A;  2JEA I;  4X64 L;  4GS3 A;  4DV7 Q;  4A3I H;  3U58 A;  1TXY A;  2Q2H A;  1Q8K A;  1YVC A;  3I4O A;  3TQY A;  3PF5 A;  1K0R A;  1X56 A;  4JOI C;  4DV0 L;  3OYY A;  5DLQ E;  3GTO H;  1L1O B;  2ZTE A;  1YHB A;  2RF4 A;  3AFQ A;  4A3E G;  2JA9 A;  4K0K L;  3NEN A;  2VUM H;  1BVS A;  1Y1W G;  2L15 A;  2BA0 A;  3CW2 C;  4B3R L;  1Y14 B;  4J15 A;  1VQD A;  2CFM A;  4ME3 A;  3ULP A;  5H1S E;  3MXN B;  3LGJ A;  4APV A;  3PF4 A;  3M4P A;  4YCV A;  4YHH L;  3FKI H;  4GNX B;  2UXD L;  1N33 L;  2UU9 L;  1VQM A;  4GN3 B;  2EIF A;  1E22 A;  2F3I A;  4LUV A;  2GVA A;  4C3I H;  3HOX H;  4P72 A;  3E0E A;  2K75 A;  1CSP A;  1NY4 A;  2ZM6 Q;  3ERS X;  1PH4 A;  4BY7 G;  4QJF A;  4GKK L;  4HIK A;  4LF5 Q;  4R4O A;  3L2P A;  3BZK A;  3TRZ A;  1PHJ A;  2JQO A;  1IBK L;  3STB C;  2KHI A;  2PQA B;  5FLX c;  1JE5 A;  4HJA A;  5C4J H;  2Q2U A;  2KHJ A;  4K0K Q;  1V9P A;  3NBH B;  3PUW A;  3AYH B;  4DUY Q;  4NXM L;  2BH8 A;  2KCT A;  2GVB A;  3KF6 B;  4UP8 A;  5GAD C;  1KQS A;  4KLK A;  3CCQ A;  1VQA A;  1UE5 A;  5FLM G;  1X3G A;  2JEB I;  1JMC A;  3PGZ A;  4JI8 L;  2AWO A;  2ZTD A;  4JI4 L;  1X54 A;  2N8N A;  3GO5 A;  2UUB L;  1EFW A;  2CCZ A;  4NB3 A;  3L7Z C;  5IWA L;  4YHH Q;  3IRB A;  1X3E A;  1VQP A;  5M3F G;  1N32 L;  4XTC S;  1EIF A;  4NXN L;  4O2D A;  3SGI A;  2XGT A;  3CCM A;  3CMA A;  4AQY L;  4YCW A;  3HOV H;  1M90 C;  3ER0 A;  3PV0 A;  1PVO A;  1TWG H;  4IOA A;  1FGU A;  4DV3 Q;  3UE1 A;  2N78 A;  1TWA H;  3HOV G;  2N3S A;  3HOY H;  3G6E A;  4DK3 C;  5AJ3 L;  2IHE A;  3STB D;  3TRE A;  1IBK Q;  3W1B A;  2K52 A;  2OTJ A;  1A8V A;  3T1H L;  1HNW L;  4BXX G;  1HZC A;  1JT8 A;  1U5K A;  1SN8 A;  1ASZ A;  3CCV A;  2A1A A;  1OXT A;  1EOV A;  1VQK A;  1HR0 Q;  2IX1 A;  4NXM Q;  1C7Y A;  4JI0 L;  2JA8 H;  3PIO A;  3CCE A;  2N49 A;  1K9M C;  1E1O A;  4KHP L;  4YY3 L;  1Y1V H;  4DV5 L;  2E2J H;  1MKH A;  2IHF A;  4TVA B;  4JI8 Q;  2A8V A;  3J7Z C;  2UUB Q;  1AE3 A;  3M4Q A;  5BR8 Q;  3AEV A;  1Y1V G;  5C3E G;  4OON A;  2PNH A;  3HKS A;  2NVQ H;  1N32 Q;  1GVP A;  4A3J H;  4AH6 A;  4GOP C;  3PO2 H;  1SMX A;  1IL2 A;  3HKZ G;  1Z47 A;  4A3M G;  3RN2 A;  4HIO A;  2CQO A;  3H0G G;  2D0O A;  2R7Z H;  1K8A C;  4BBS G;  2I0Q A;  1YIT A;  4A3K G;  2KBN A;  1KRS A;  1K83 H;  1TWF H;  4IFD I;  3EBE A;  2DGY A;  1N8R C;  4QQB X;  1XNQ Q;  1Q1B A;  4MTN A;  2Y0S G;  5AJ3 Q;  5IYB H;  1IYJ B;  3HOU H;  2A19 A;  5FJ8 G;  2PI2 E;  2UXB L;  1HNW Q;  3GTJ H;  4DR7 L;  1Q82 C;  1GO3 E;  4DUZ L;  3HOW G;  1YZ6 A;  3HOU G;  2VQE Q;  3GTQ H;  3GTK H;  4JI5 L;  4A3C G;  5IYD H;  4A3B H;  4KHP Q;  3CCL A;  1WCM G;  4BBR H;  3RZD H;  1M1K C;  4DAM A;  5GAE C;  4DV5 Q;  2C35 B;  4X66 L;  1IXR A;  4HIM A;  4Y52 H;  5C0X G;  1N9W A;  3KJP A;  2NVY H;  1QUQ B;  4RG1 A;  4IJL A;  3I4M G;  3TEH B;  4X65 L;  1KD1 C;  4L5S A;  2VL6 A;  3F1Z A;  3H3V H;  2HIV A;  2E5L Q;  2VZA A;  3RLN A;  3W5O A;  5GAG C;  4HJ9 A;  1L1O A;  4H02 A;  5M5Y H;  4A3E H;  2OQ0 A;  3H3V I;  4AYB G;  3PUV A;  1OXV A;  2HHH L;  3S1Q H;  1JB7 A;  1PA6 A;  2JJQ A;  4DR6 L;  4FDB A;  5LMN W;  1VQ8 A;  3UDF A;  1SFO H;  2WAQ E;  2WFW A;  1Y1W H;  4IPD A;  2VQF L;  1Z9F A;  3A5U A;  1P8L A;  4UP9 A;  2Y0S E;  2OTL A;  3S16 H;  3J81 c;  1XPU A;  5C4X G;  2K5N A;  1A0I A;  2OQK A;  5GQO A;  1NMG A;  4OX9 L;  3EN2 A;  2MO1 A;  1XMQ Q;  3E9H A;  1MJC A;  5C0X J;  2D0P A;  1HH2 P;  3F2D A;  4DUZ Q;  4GNX A;  3RN5 A;  2R92 G;  1KC8 C;  4P74 A;  4LFC L;  1OTC A;  4JI7 L;  3I55 A;  4C3J H;  2Q2T A;  4KI0 A;  1FJG Q;  4A93 G;  2YTX A;  5JJL A;  4LF8 L;  3VDY A;  1E1T A;  1X55 A;  1JJG A;  1C0A A;  2F52 A;  4X66 Q;  1MJE A;  1X9N A;  4DPG A;  2Q2I A;  3JAM c;  1EUJ A;  2MQH A;  3FP9 A;  4BY7 H;  2RCN A;  4X65 Q;  1E24 A;  2CWP A;  1QZH A;  4TQU S;  4PG3 A;  3EIV A;  1HJP A;  1BBU A;  2PQA A;  2DUD A;  4GLX A;  2ASB A;  3UDI A;  4X64 Q;  2JA5 G;  1VQH A;  4AYB E;  1I50 H;  1EQR A;  2HHH Q;  3CP0 A;  3CPW A;  3KLW A;  1DGS A;  3M7N A;  1WI5 A;  4DV0 Q;  4A3L G;  1MIU A;  4GOP B;  4DR6 Q;  4L5Q A;  1LTL A;  1SLJ A;  5FLM H;  1V1Q A;  4AIM A;  2I5H A;  3D31 A;  1O7I A;  4YCU A;  4LFA L;  1IBM L;  3PO3 G;  4HID A;  1D7Q A;  4GN4 B;  3H15 A;  4OX9 Q;  2GN5 A;  3I4N G;  4JG2 A;  1J5E L;  4B3R Q;  1OXS C;  3I56 A;  5M3F H;  1QVG A;  1CKO A;  1PYB A;  2EXD A;  1VCI A;  1XMO L;  2UUC L;  4A3G G;  4LFC Q;  2JA7 G;  4JI7 Q;  4PMW A;  4NPS A;  3KOJ A;  4A75 A;  1PH9 A;  2UXD Q;  4LF8 Q;  1Q1E A;  2CKZ B;  1AH9 A;  1N33 Q;  2UU9 Q;  1I6H H;  3OTO L;  5LMN L;  4X6A H;  3K80 C;  3CC4 A;  2FXQ A;  4LF4 L;  2K4K A;  4BA1 I;  2D62 A;  3G4S A;  2H5X A;  1HNZ L;  5JJI A;  2E8G A;  5C44 G;  1G29 1;  1Q12 A;  1SRU A;  1D8L A;  5ELO A;  1HNX L;  3HFZ B;  1YBY A;  4LUO A;  1CKN A;  4OWX B;  4JI1 L;  3J7A 5;  4BXX H;  4GKK Q;  2UXC L;  2Z6K C;  1EIY B;  1LUZ A;  1YJ9 A;  1PH8 A;  4IJH A;  1PH6 A;  3CXC A;  4Y7N H;  3FHW A;  4JOI A;  5IP7 G;  4DR1 L;  1QVF A;  4R1J A;  3GTL H;  3DM3 A;  1VQO A;  4DNI A;  4DR2 L;  3E9I A;  1UE1 A;  4GN5 A;  2QEX A;  5E7N A;  2EQS A;  2K5H A;  3A0J A;  3MEF A;  1UE6 A;  2BA1 A;  4XIG S;  4LFA Q;  5LMU L;  3CD6 A;  5HY6 A;  4IPG A;  4EX5 A;  1IBL L;  1K73 C;  5C3E H;  4BY1 G;  3T1Y L;  1J5E Q;  2F4V L;  3TS2 A;  1KL9 A;  5HGQ A;  4JI2 L;  4JI4 Q;  4JI6 L;  4QIW E;  2UUC Q;  4B3M L;  3KDF B;  1KRT A;  1PFS A;  5IWA Q;  4A3M H;  4JC0 A;  5EAY A;  4YWM A;  3H0G H;  4JBW A;  1QVC A;  4A3D G;  4BBS H;  1XPO A;  5M5W H;  1A62 A;  4NXN Q;  4A3K H;  1JJ2 A;  2YV5 A;  2NVX H;  3RZO H;  1QZG A;  2VNU D;  2IY5 B;  3OTO Q;  2R7D A;  1JJC B;  4UPA A;  4OWT B;  4AQY Q;  1Q86 C;  4LF6 L;  1RIP A;  1HNZ Q;  2E2I H;  4YWL A;  2HQL A;  2B63 G;  4ALP A;  5FJ8 H;  3PUY A;  4DR4 L;  2UXC Q;  5JJK A;  4DV1 L;  3U50 C;  2NVT H;  2IT1 A;  3HOW H;  3M3Y H;  1BBW A;  4R4Q A;  4LFB L;  4A3C H;  2NN6 G;  3T1H Q;  4P75 A;  3K8A A;  2ZTC A;  2YU9 H;  1WCM H;  2PMZ E;  2QGQ A;  4JV5 L;  3J81 i;  4O0A A;  1YJN A;  1PH5 A;  2BH2 A;  5IE8 A;  4DV6 L;  2ES2 A;  2I5L X;  4HJ8 A;  4JI0 Q;  3I4M H;  2WB1 G;  4DV7 L;  1UE7 A;  3F8T A;  2NZO A;  3CCU A;  2QA4 A;  4YY3 Q;  1HZA A;  1IBL Q;  1UEB A;  3CCR A;  1HZB A;  5JEA J;  4A76 A;  3PUX A;  4UY8 C;  3RLF A;  2F4V Q;  3HOZ G;  4LUZ A;  5C0X I;  4OO1 G;  4PZ7 A;  4RMF A;  3K0X A;  3S15 H;  4A4I A;  4WJ3 M;  2MFI A;  4B3M Q;  1A63 A;  3NEL A;  4QGU A;  1XNR L;  2B29 A;  2JE6 I;  2CWA A;  3M9B A;  3PIP A;  1R9T H;  3JAM i;  1VQI A;  3GTP H;  3UE0 A;  2K50 A;  3HKZ E;  2UUA L;  3CC7 A;  3J80 c;  1N36 L;  3CF5 A;  5M3M G;  3AFP A;  4YWK A;  3U4V A;  1N34 L;  1S72 A;  2PI2 A;  3G48 A;  4R4I A;  5C4X H;  4IO9 A;  1KXL A;  4POF A;  3ULJ A; 
#chains in the Genus database with same CATH topology
 5IP9 G;  2K03 A;  4DV1 Q;  3QB3 A;  4DAP A;  3PSI A;  1WYD A;  2RHS B;  1VQC A;  1A3U A;  4YIJ A;  2JK8 A;  2NZH A;  4QY7 A;  4JI5 Q;  1H9R A;  2JXM B;  1GD7 A;  3OSO A;  1J6Q A;  1H9S B;  3I3C A;  4C2M H;  2NYZ D;  2QKI C;  1GUW A;  1ESR A;  4A3F G;  1U4R A;  1NAP A;  5DNF A;  4LF9 L;  5J3B A;  4R4T A;  3S17 H;  4A3L H;  2UUA Q;  1KAW A;  4IPH A;  4K5V A;  2VUM G;  3K57 A;  2F0Q A;  1AE2 A;  1ICW A;  5D14 A;  3KF6 A;  4HCE A;  1DOL A;  1U4M A;  2PNR C;  5CBA E;  1SNO A;  4IPC A;  1NMF A;  4UHV A;  1R4P B;  3BG3 A;  2JA7 H;  2RHQ B;  3FKI G;  2ZT9 C;  1YHQ A;  5I6W A;  4ZLT F;  2MO0 A;  3MA2 B;  1X3P A;  5FLX L;  4S3S A;  1QJO A;  3F2B A;  4ULL A;  1NE3 A;  2Z0S A;  1CI3 M;  1HUM A;  1HXY D;  2L55 A;  5FO9 B;  4EQO A;  1IYU A;  3BU2 A;  1TWF B;  3P75 A;  4UP7 A;  5ISR A;  5IP7 H;  4LF9 Q;  5M3M B;  3CC2 A;  3S1R H;  1JCK B;  1CZW A;  3SR1 A;  1CUK A;  1CKM A;  2AKW B;  3T4A C;  2KEN A;  5BR8 L;  5CGK A;  3W2D A;  3KBX A;  4CDC C;  5M5X H;  3S2D H;  3A54 A;  4X3U A;  1CZG A;  3I8Z A;  4X62 L;  1Q7Y C;  1B8A A;  3RLO A;  4DR3 L;  1CA5 A;  1XTD A;  1GUG A;  4KD3 A;  4DKA C;  2PQE A;  1KTK A;  3L0O A;  2B63 H;  4MNO A;  1ET6 A;  5C3W A;  5HUR A;  1R4Q B;  3CME A;  4HED A;  1IYV A;  4K6D A;  1EZ8 A;  5I9P A;  4HTH A;  3TP8 A;  3B6Y A;  1NNX A;  2F0P A;  1IKL A;  2JA8 G;  1VQB A;  1PH2 A;  1LO5 D;  3MXU A;  2A6H C;  3G71 A;  3BVZ A;  1DZ1 A;  1WTH A;  2B2U A;  5KIX A;  4JCV E;  3KUP A;  4WJW A;  4EGV A;  4X62 Q;  2HCI A;  3H94 A;  4LWC A;  2MNA A;  2XRQ D;  4JI6 Q;  4DU9 A;  1VQJ A;  4DR3 Q;  2MPM A;  1EIG A;  3S1M H;  1VQ9 A;  1C9O A;  1ZEQ X;  2RBM A;  1HZ9 A;  1EYG A;  5FOB B;  4GLV B;  1JWS D;  1HCZ A;  2ZJP A;  1MGS A;  4ABN A;  2VXW A;  3CKI B;  1EQQ A;  3FPP A;  1SRO A;  1L0W A;  1FJG L;  5IYC H;  4CJ1 B;  4L8J A;  3NEM A;  2RSN A;  1EY9 A;  1B9M A;  1SNP A;  2B8G A;  2A6H D;  2VS1 A;  4RFB A;  5M3F B;  4JV5 Q;  3S1N H;  2MHV A;  2R93 H;  1NR4 A;  3NWS A;  1V43 A;  5E3F A;  4X64 L;  4A3I H;  5JPM C;  1Q8K A;  1YVC A;  1RHP A;  1K0R A;  2RVL A;  5FO8 B;  4JOI C;  1U9R A;  2WV6 D;  4K0K L;  3I90 A;  4DGZ A;  1KDC A;  1Y8N B;  4DF7 A;  5CV4 A;  2J0T D;  4PNY A;  3IKJ A;  2L15 A;  2BA0 A;  1Y14 B;  3EA6 A;  2B2V A;  1EOT A;  3ULP A;  3NSW A;  3MXN B;  1LAB A;  2EYP A;  1N33 L;  2UU9 L;  1VQM A;  3CHB D;  2EIF A;  4G4K A;  1E22 A;  2F0V A;  4C3I H;  3OMC A;  2E2J B;  2K05 A;  3E0J A;  1HFN A;  2KJX A;  1X3Q A;  3ERS X;  1GUO A;  2NVQ B;  4XQJ A;  3BZK A;  1PHJ A;  1IBK L;  4KN7 C;  2WAQ B;  2CH4 W;  5C4J H;  2B2Y C;  2L9H A;  4IZ8 A;  4K0K Q;  2NWG A;  2E2I B;  3NBH B;  1TS4 A;  4NXM L;  2BH8 A;  3M7G A;  5ELC A;  4FF2 A;  3CCQ A;  1JMC A;  1EL0 A;  5C5L A;  1TII D;  2ZTD A;  1X54 A;  3T13 A;  2XWJ B;  2O5I C;  5IWA L;  5J1Z A;  1X3E A;  5M3F G;  1N32 L;  1EIF A;  1QE6 A;  1STA A;  4O2D A;  2XGT A;  2A69 C;  2ZXO A;  1PTO F;  3H91 A;  2AUK A;  1PVO A;  2LY7 A;  4CKB A;  4IOA A;  2JP1 A;  2N78 A;  4IUQ A;  1ICF B;  2N3S A;  3G6E A;  4DK3 C;  5AJ3 L;  1IBK Q;  4A3E B;  1A8V A;  3T1H L;  1HNW L;  4BXX G;  5EPK A;  2A1A A;  1VQK A;  2RQX A;  4NXM Q;  4JI0 L;  2N49 A;  2F0U A;  1E1O A;  1AN8 A;  5CR3 A;  1ILQ A;  1HRJ A;  5KND A;  2A8V A;  1SNC A;  2R3Z A;  1HA6 A;  3HKS A;  1N32 Q;  2A69 D;  4GOP C;  2K28 A;  2RDF A;  4ILW A;  4HIO A;  2M2L A;  4RHR A;  2D0O A;  4RCO A;  2R7Z H;  2PZT A;  4C2M B;  2KEC A;  1RJT A;  1WTW A;  1KRS A;  1K83 H;  1GJX A;  2DGY A;  3IL8 A;  5AJ3 Q;  5IYB H;  2A19 A;  5EQ0 A;  1HNW Q;  2EY2 A;  1Q82 C;  4KD4 A;  2PW7 A;  2VQE Q;  3NQI A;  4A3B H;  4RKB A;  4N8F A;  4DAM A;  2NB0 A;  2C35 B;  4HIM A;  1NR2 A;  5KGU A;  2CVR A;  2EPB A;  3HP3 A;  4RG1 A;  1QUQ B;  3TEH B;  2VZA A;  4R8N A;  1LT5 D;  3RLN A;  1H9S A;  3CU7 A;  4H02 A;  3PUV A;  2HHH L;  1I6H B;  1JB7 A;  1PA6 A;  4DR6 L;  1BXT A;  2L12 A;  1SFO H;  1JOR A;  1LAC A;  3S16 H;  3D8G A;  1A0I A;  2D2C C;  3S1R B;  3EN2 A;  2MO1 A;  3R8B A;  2D0P A;  3RN5 A;  5FO7 B;  3SVM A;  3GTL B;  4C3J H;  2Q8R E;  1C48 A;  1X55 A;  1JJG A;  3S2D B;  1MJE A;  2RCN A;  1F2Z A;  1E24 A;  2XVS A;  1H9M A;  1QZH A;  5JVG 3;  3HKZ B;  1K8M A;  2ASB A;  1EEI D;  2KHS A;  1F9Q A;  4AYB E;  1EQR A;  2HHH Q;  3CP0 A;  3CPW A;  2B63 B;  1WI5 A;  1GOZ A;  4A3L G;  1MIU A;  4DR6 Q;  4X3K A;  1V1Q A;  2FJ2 A;  4AIM A;  1D7Q A;  4HID A;  4I7Z C;  3EQL C;  2QIL A;  4B9X A;  4IQZ A;  3H6M A;  1CKO A;  3BVM A;  1XMO L;  2EXD A;  2UUC L;  1WTX A;  2JA7 G;  5BN4 A;  2FMM A;  3I4M B;  4N9P A;  1EFI D;  5DM6 3;  5LMN L;  4X6A H;  2FXQ A;  1LLR D;  4LF4 L;  4DK0 A;  2H5X A;  3OPO A;  1G29 1;  1Q12 A;  3S1M B;  1I4H A;  5ELO A;  1HNX L;  2K04 A;  1PTO B;  2DNC A;  4GKK Q;  5EJW A;  4JI1 L;  3J7A 5;  5D65 A;  2Z6K C;  3OIQ A;  5JAV A;  3SK6 A;  4TKO B;  4JOI A;  5IP7 G;  1B2T A;  3A8J E;  3E9I A;  2QEX A;  4HJA A;  3J80 E;  3CD6 A;  5EPJ A;  5HY6 A;  2BE5 C;  4HN7 A;  3T1Y L;  2F4V L;  1V1O A;  4JI2 L;  2PO4 A;  2UUC Q;  1PFS A;  4A3M H;  3S1N B;  4YWM A;  2R93 B;  3TP7 A;  2HQE A;  4BBS H;  3SHL A;  2ZXR A;  1JJ2 A;  4A3I B;  4H7B A;  1QZG A;  1JJC B;  4UPA A;  1Q86 C;  3OIP A;  1EZ6 A;  2A73 B;  4Q5V A;  2B63 G;  5FJ8 H;  5JJZ A;  4DR4 L;  1T5E A;  4KKS A;  2NVT H;  1BCP C;  1LTS D;  4KKU A;  4LFB L;  1EY6 A;  3K8A A;  2YU9 H;  3J7A F;  1WCM H;  3SEB A;  3J81 i;  1QCB D;  2B2Y A;  1PH5 A;  3PO3 B;  4DV6 L;  2BE5 D;  2CW0 C;  5C0X H;  2ES2 A;  2QA4 A;  4MTK A;  1HZB A;  2F4V Q;  5C0X I;  4RMF A;  2A74 C;  3D6W A;  2B39 A;  3BS1 A;  4QGU A;  3GTP H;  1TWC B;  2FFK B;  1CTM A;  3CC7 A;  4ZK9 B;  3T51 B;  2F0I A;  2PI2 A;  2AQ3 B;  4NP5 A;  2SOB A;  4QL5 A;  1HR0 W;  1BCP D;  1FL0 A;  1SNM A;  3R2T A;  1LTG D;  1S5E D;  5KNC A;  2KCM A;  5IYC G;  4A93 H;  4LFB Q;  2UXB Q;  2EJF C;  4DR7 Q;  1STB A;  4KHZ A;  2CW0 D;  4PZ6 A;  5EKK A;  4DV6 Q;  4LF5 L;  2WB1 E;  3S2H B;  1T9H A;  3C2P A;  2R93 G;  3NP8 A;  1U0L A;  1V8Q A;  5IT9 L;  4A3I G;  4FXG C;  1JIC A;  4DUY L;  5DAU A;  1CFM A;  1K8O A;  1XTC D;  5IT9 c;  4H0L C;  2VW9 A;  4GOP A;  5IOC A;  2D5D A;  4EQ5 A;  1B70 B;  5DM7 3;  2R7F A;  3C46 A;  3M4O H;  5E4W C;  2IX0 A;  1WVL A;  2DJF C;  1NSN S;  3A55 A;  1Q46 A;  4B3S L;  3I2Z A;  4CJ0 B;  4BA2 I;  4ZKC B;  4A3G H;  3DEO A;  5I2Y A;  3A74 A;  4DV3 L;  3QO2 A;  4C3I G;  3VYT A;  2GA4 B;  3K59 A;  1RF2 D;  2LFN A;  3HOZ B;  5C44 H;  1EYC A;  4LJZ C;  2R7Z B;  1GXD C;  1K83 B;  2K5V A;  2L1B A;  3M85 A;  1SR3 A;  3CCJ A;  1AFP A;  3RR5 A;  5C4H A;  4RKL A;  1YJW A;  4B3T L;  3O13 A;  1ENF A;  4B3S Q;  1WFQ A;  2MP1 A;  4P73 A;  1CQF A;  4BY1 H;  4A3B B;  3KYH C;  5CV6 A;  1IBM Q;  2A6E C;  1I3Q H;  1RD9 D;  1JOK A;  4C3H H;  1BO0 A;  4PMB A;  4DR5 L;  2BOS A;  4I7A A;  1OXU A;  3CRL C;  1XNQ L;  4WOR A;  1CM9 A;  3K5L A;  1VQE A;  1LTB D;  1CKN B;  4GNX C;  1EWI A;  4LK1 C;  2QW7 A;  3GTO B;  1SFO B;  2AHO B;  2X6L A;  1IHZ A;  1VQG A;  1GUN A;  2K14 A;  3TBI B;  4HMI A;  1ROD A;  3K81 C;  3VYS A;  1NBW A;  2DNE A;  3NQT A;  4B3T Q;  1STE A;  2ID0 A;  4C3J B;  4ZCK A;  4K5W A;  2A6E D;  2F1M A;  1I5F A;  4OO1 H;  1QUQ A;  5LMU Q;  5A2Q E;  4FF4 A;  3OMG A;  4OIK A;  3D6C A;  1W3S A;  2MJ8 A;  4OO1 I;  3I4L A;  3EFX D;  5EBD A;  4DR5 Q;  5ELE A;  2R7Z G;  2WP8 J;  1JB3 A;  1A2U A;  1EU3 A;  2VY3 A;  5IYB G;  3D0F A;  4ZRZ A;  4DAY B;  1PH1 A;  1Z7T A;  3I7F A;  3AQQ A;  2JN4 A;  1PRT F;  2E2H H;  2Z6K A;  2EYO A;  2RKS A;  4A3B G;  3JC6 6;  5COY A;  2ZJR A;  4CJ2 C;  1LM0 A;  4JBM A;  2JA6 H;  3EJI A;  2QCP X;  3K5M A;  2JEA I;  4GS3 A;  4DV7 Q;  1TXY A;  2Q2H A;  1SYB A;  3PF5 A;  4C56 C;  1X56 A;  5ELB A;  3HOV B;  5DLQ E;  4OHJ A;  1TWG B;  2XRS D;  5FKA C;  1U4P A;  2EY1 A;  2KCC A;  1Y8O B;  5K5P A;  4N9T A;  1B44 D;  3VR6 A;  1VQD A;  4ODG A;  4ME3 A;  4KN4 C;  1LTI D;  3M4P A;  4YCV A;  2UXD L;  2JA8 B;  1EY0 A;  4C3J G;  4LUV A;  2GVA A;  3HOX H;  2F0F A;  3NHH A;  4F88 A;  1NY4 A;  1F9R A;  1I4P A;  2QEJ C;  3TRZ A;  3QIA A;  4KHV A;  3ONA B;  3STB C;  2F0O A;  5FLX c;  1JE5 A;  2I46 A;  5IOD A;  2KHJ A;  1V9P A;  1YNN C;  3AYH B;  2KCT A;  4UP8 A;  1KQS A;  1RDP D;  1SNQ A;  5K36 H;  4G7O C;  4FP5 D;  3PGZ A;  2AWO A;  2FMC A;  4JI8 L;  4JI4 L;  2UUB L;  3GTJ B;  1EFW A;  2YU9 B;  3L7Z C;  4DXF A;  3MFG A;  3K5N A;  3GTK B;  3SGI A;  5CMD A;  3WOE A;  3TZU A;  3CCM A;  1HUN A;  4FVM A;  2ICI A;  3VR5 A;  3HOV G;  3TP5 A;  3HOY H;  3GTP B;  2MGS A;  2IHE A;  3STB D;  4O42 A;  2OTJ A;  3SK4 A;  1JT8 A;  2KOL A;  1U5K A;  1O7Z A;  1SN8 A;  1YNN D;  3CCV A;  1OXT A;  2BDN A;  4QMG A;  2CH4 A;  4YY3 L;  1Y1V H;  4DV5 L;  1SYD A;  2JYO A;  4TVA B;  1F77 A;  4JI8 Q;  4L63 B;  2UUB Q;  4A93 B;  1AE3 A;  5BR8 Q;  2MUY A;  3I73 A;  4OON A;  1GVP A;  3MXG A;  1JWM D;  4AH6 A;  4A3J H;  1SMX A;  4ZAI A;  1Z47 A;  4A3M G;  4DXG A;  5T1G A;  4IFD H;  1WTO A;  4QUF A;  4BBS G;  5EKI A;  2I0Q A;  1YIT A;  2KBN A;  2PZW A;  3FPU B;  4IFD I;  3EBE A;  1N8R C;  1Q1B A;  2PYK A;  3BDO A;  2E74 C;  1IYJ B;  3HOU H;  5FJ8 G;  1GO3 E;  3M4O B;  1YZ6 A;  4NMZ A;  3KLR A;  3GTQ H;  4ME5 A;  5IYD H;  4LAA A;  1WCM G;  4BBR H;  5CV5 A;  4DV5 Q;  5JVH 3;  2E75 C;  4QIW B;  2A5H A;  1WD1 A;  5C0X G;  1N9W A;  3KJP A;  4IJL A;  2B8F A;  4FNF A;  2LMC B;  1KD1 C;  1PRT B;  3M4Y A;  1II3 A;  1KAB A;  2SDF A;  4IUU A;  1OXV A;  5C44 B;  3S1Q H;  1F9P A;  4EVO A;  2JJQ A;  1B4O A;  1VQ8 A;  3UDF A;  3IFT A;  2XSC A;  1Y1W H;  1QG7 A;  2VQF L;  1QNU A;  1P8L A;  2Y0S E;  2C5C A;  4CBV A;  3L9A X;  2F0W A;  2XNA C;  1FNW A;  1MJC A;  5C0X J;  4GNX A;  4P74 A;  1OTC A;  4JI7 L;  3JAM L;  2Q2T A;  4A93 G;  4KI0 A;  1FJG Q;  3MAQ A;  2YTX A;  3LNN A;  3FDT A;  4LF8 L;  3VDY A;  1O7Y A;  1BDO A;  2Q2I A;  3JAM c;  2KA7 A;  2MQH A;  3FP9 A;  4BY7 H;  1CHP D;  1A15 A;  4C3H B;  3MVV A;  1PYW D;  2O2L D;  4NW2 A;  4TQU S;  4PG3 A;  1BBU A;  2Z4I A;  2DUD A;  5CYU A;  5BN3 A;  1SEB D;  3UDI A;  4X64 Q;  5LL6 X;  1UEA B;  3HGB A;  5COR A;  4GOP B;  2I5H A;  1O7I A;  3DEP A;  4LFA L;  4C1N K;  2NBF A;  1BCP F;  3PQI A;  5CBE E;  3I91 A;  1DOK A;  1PRT C;  3M3Y B;  1OXS C;  4TSS A;  3I56 A;  1TVX A;  4R8I A;  4A3G G;  4JI7 Q;  2Z1C A;  1KNA A;  4LF8 Q;  1Q1E A;  1N33 Q;  2UU9 Q;  1LTR D;  1QIL A;  2LKV A;  2R61 A;  1B3A A;  1TS3 A;  3L3O C;  2K4K A;  4EQN A;  1IKM A;  5C44 G;  5HGT A;  4ZQ3 A;  2K1B A;  1BBX C;  4LUO A;  1ESF A;  1CKN A;  4OWX B;  1DYQ A;  3AB9 A;  1R9T B;  1HPC A;  3SK5 A;  4IJH A;  1PH6 A;  4DR1 L;  2EOT A;  4DR2 L;  1EIH A;  5E7N A;  2EQS A;  2K5H A;  1Q8I A;  4LFA Q;  1UE6 A;  1MHW C;  2BA1 A;  4XIG S;  1PRT D;  2KVM A;  2NTS A;  4IPG A;  5KYI A;  2E2H B;  3T56 B;  5C3E H;  4BY1 G;  3Q24 A;  2B2W C;  3TS2 A;  1KL9 A;  4H44 C;  5D3D A;  2JA6 B;  5KRU A;  5IWA Q;  5EAY A;  3BYT B;  4C3H G;  1SXT A;  1QVC A;  5M5W H;  1A62 A;  4JVZ A;  2PW5 A;  3OHX C;  4A3K H;  2YV5 A;  2NVX H;  3RZO H;  2VNU D;  2XIW A;  4OWT B;  4LF6 L;  5CV9 A;  4YWL A;  2HQL A;  1FYC A;  1I4R A;  5JJK A;  1W6J A;  4M1U B;  3HOW H;  3S17 B;  3Q23 A;  1BBW A;  3OWF A;  1SE4 A;  4A3C H;  3T1H Q;  4DAY A;  1GHK A;  3PIO 3;  3KK7 A;  2PMZ E;  4HR7 B;  1YJN A;  1OO9 B;  2BH2 A;  4HAE A;  2L11 A;  5IE8 A;  2I5L X;  2N55 A;  4JI0 Q;  1U4L A;  4KK7 A;  3DHQ A;  5JEA J;  3BDC A;  3Q6S A;  4LUZ A;  4OO1 G;  2JA7 B;  4PZ7 A;  4RGO S;  3K0X A;  3S15 H;  4A4I A;  1HFG A;  4OGQ C;  1A63 A;  3NEL A;  3J80 L;  1JWU D;  3V05 A;  3M9B A;  4RGT A;  2K50 A;  1EQT A;  1EY5 A;  3J80 c;  4KY6 A;  3AFP A;  2M9V A;  4R4I A;  5C4X H;  1XWE A;  4POF A;  3QR8 A;  5IGG A;  3T53 B;  1D1K A;  4C1N I;  1A6X A;  1NTG A;  2R92 H;  1D5Z C;  1KLG D;  5D3I B;  3Q8D A;  1LYL A;  1ZYR C;  3CQZ H;  2ZM6 L;  2JA6 G;  2K5D A;  5M5X B;  1MD2 D;  1Y8P B;  2G5D A;  3KJO A;  1FVI A;  4A3F H;  4DV4 L;  2JA5 H;  3ICE A;  3U9S A;  1E2V A;  1O78 A;  4R4C A;  3HOY B;  1MSG A;  2F0N A;  3RUZ A;  5IY0 A;  5GAH C;  3FRP B;  3F2C A;  1CQV A;  4L5R C;  1VQ6 A;  4LNQ A;  4G57 A;  3K7A H;  3U4Z A;  2PCF B;  1S40 A;  2OEO A;  1ZYR D;  1BCP B;  1VF7 A;  3HOX G;  1GKH A;  2L5T A;  2B3G A;  3TN2 A;  1YI2 A;  1FGB D;  1BKB A;  2EYL A;  3BJU A;  4R9W A;  1PXU A;  1BNZ A;  1A3V A;  4HMJ A;  2IX3 A;  4DV4 Q;  1HR0 L;  3TSS A;  4HJ5 A;  3DLL A;  3WWV A;  1NJI C;  4LW1 A;  1RL2 A;  4GLA C;  1VQ5 A;  3DWA A;  2B2T C;  1KAA A;  5K36 G;  3GD7 A;  3V2T A;  1XJV A;  1L1O C;  1PV4 A;  4JBK A;  4BBR B;  3KDF A;  3CPF A;  2LSS A;  1KHI A;  1VMC A;  1XPR A;  4IUV A;  4U68 A;  5C6A A;  3FMC A;  4JK1 C;  4DV2 L;  1UWV A;  4DK6 C;  1XMO Q;  4EQP A;  3WOF A;  3AMU A;  1G51 A;  3GP7 A;  3ZYY X;  3HRZ C;  2ZJQ A;  3DMU A;  1STH A;  3MZ5 A;  4GKJ L;  1YIJ A;  5LMN Q;  3HOY G;  2QF7 A;  4LF4 Q;  3S24 A;  3GTG H;  3A5Z B;  3GTM H;  1HNX Q;  2LXJ A;  5EPL A;  2NN6 H;  3J81 j;  4JI1 Q;  1G6Z A;  4L5T A;  3RNU A;  2AUJ D;  1AEX A;  2K32 A;  1LTA D;  2NN6 I;  1B7Y B;  3Q22 A;  4JBJ A;  2O5J C;  2ZXP A;  4IUN A;  5F2D A;  2E5L L;  4KJN A;  1YEZ A;  3T1Y Q;  4A3J G;  3BZC A;  2F0D A;  4C3I B;  2ATW A;  4JI2 Q;  2J7Z A;  4DV2 Q;  4BY7 B;  3MFY A;  1X65 A;  4IFD G;  1EY8 A;  1VQ7 A;  2X6G A;  2OT2 A;  3TP6 A;  5M3M H;  2HUG A;  4RH6 A;  3H09 A;  1VQN A;  1XMQ L;  4GKJ Q;  3ZJY C;  3KF8 B;  3OW2 A;  4WJ4 A;  3A56 A;  2OWO A;  1TS5 A;  2ENB A;  5C4J B;  3C3L A;  1X3F A;  1S5D D;  1VS0 A;  4DR4 Q;  5IIF A;  4ZUJ A;  3D4R A;  5G3L D;  5IYD G;  3V96 A;  1VF5 C;  3CAM A;  1SE3 A;  3ULL A;  4QCL A;  4BBR G;  2HT1 A;  3X3N A;  1DCZ A;  2F0H A;  2HIX A;  3U9O A;  1WJJ A;  1W6K A;  1E3P A;  2Z9H A;  4IFD J;  3QG1 A;  4X3S A;  3CCS A;  3HS0 C;  4IN3 A;  1I4G A;  5KNB A;  3VA5 A;  3TQY A;  5TSS A;  4DV0 L;  2B2W A;  3PIP 3;  1XXG A;  1YHB A;  2RF4 A;  2JA9 A;  2HDL A;  4IUR A;  3ERQ A;  4K6L A;  2P5Z X;  2TMP A;  5A2Q L;  1Y1W G;  3CW2 C;  5JPN C;  4B3R L;  3GV6 A;  3LWE A;  3BDL A;  4J15 A;  3J7Y W;  5NUC A;  3LGJ A;  5FK9 C;  4YHH L;  2L4N A;  4GNX B;  1SJE D;  4NDX A;  1EWH A;  2F3I A;  4WFN 3;  4P72 A;  4B9W A;  1CSP A;  1XYI A;  4BY7 G;  4QJF A;  4LF5 Q;  2Z6B A;  4PMC A;  4A3K B;  2NVX B;  2VB3 X;  2Q2U A;  3MEH A;  1PFB A;  4DUY Q;  2GVB A;  3TME A;  2G9D A;  2TSS A;  4KLK A;  5GAD C;  1VQA A;  1UE5 A;  1X3G A;  3HOW B;  3LX0 A;  1STG A;  3NWT A;  4F87 A;  3KBG A;  4K5X A;  4YHH Q;  3IRB A;  1VQP A;  4CDE C;  4NXN L;  3RD4 A;  5ELF A;  4AQY L;  4YCW A;  1M90 C;  3ER0 A;  1FGU A;  1UNS A;  4DV3 Q;  3S15 B;  1LV9 A;  3UE1 A;  1TWA H;  3TZD A;  5JEA H;  4FXK C;  4AYB B;  2EYJ A;  2WKC A;  3NTH A;  3IAY A;  2HCC A;  3TRE A;  1BOS A;  2F0L A;  2K52 A;  4K2L A;  1ASZ A;  4N8X 1;  1EOV A;  2IX1 A;  4F7X A;  4KHP L;  1K9M C;  3S16 B;  4G7Z C;  2E2J H;  2R92 B;  1J8I A;  4V0B A;  3J7Z C;  3M4Q A;  3AEV A;  3ND9 A;  5C3E G;  2PNH A;  2NVQ H;  3J81 E;  3DM1 A;  5CV8 A;  3PO2 H;  2F3V A;  2BDO A;  1IL2 A;  4XT1 B;  2CQO A;  2V4D A;  4OIJ A;  1I4Q A;  1E2W A;  4A3K G;  2JA5 B;  4QQB X;  1SSO A;  1WTQ A;  1XNQ Q;  2F0S A;  2PI2 E;  4Z9C B;  2RDH A;  4DUZ L;  2RDG A;  3HOW G;  2QDL A;  4JI5 L;  4A3C G;  4KHP Q;  3RZD H;  4Y52 H;  3K7A B;  2NVY H;  4CGY B;  1EQV A;  4FYD A;  1STN A;  2B2T A;  3H3V H;  2VL6 A;  3F1Z A;  2HIV A;  2KCN A;  1L1O A;  4A3E H;  5M5Y H;  1G91 A;  3H3V I;  4AYB G;  1EYD A;  2WAQ E;  4BWG B;  4IPD A;  5IGE A;  3E5S A;  4Q0F A;  4DAV A;  1WTV A;  3D3R A;  1CHQ D;  2Z4H A;  4UP9 A;  3WDN A;  1XPU A;  5C4X G;  2OQK A;  4HSV A;  4ZYS A;  4OX9 L;  2OXP A;  4KKT A;  3E9H A;  4PV1 C;  4DUZ Q;  4MIU A;  3F2D A;  2R92 G;  1B53 A;  3I55 A;  2I07 B;  2VB2 X;  3QOJ A;  1I4X A;  2CWP A;  2JSO A;  2EYH A;  5A35 A;  1HJP A;  5EKL A;  4A3M B;  2PQA A;  3W3A A;  1LTT D;  1V1P A;  4GLX A;  2JA5 G;  4BBS B;  4BS9 A;  1I50 H;  3M7N A;  3UI2 A;  4FF1 A;  3GTG B;  5FLM H;  1EY4 A;  1EEF D;  3GTM B;  1F9S A;  1JR0 D;  2X69 A;  3H15 A;  3HZX A;  2GN5 A;  4OX9 Q;  2NVT B;  1J5E L;  1L0Y B;  1QVG A;  1PYB A;  3KLS X;  1VCI A;  5IGD A;  2WB1 B;  1WCM B;  4IUP A;  4PMW A;  4NPS A;  3KOJ A;  2UXD Q;  2CKZ B;  1AH9 A;  1S5F D;  1I6H H;  3CC4 A;  2Q8I B;  1WD0 A;  4BA1 I;  4DNT B;  2Z8L A;  2D62 A;  2KQ3 A;  3K0Y A;  5M9O A;  3QJY A;  1SRU A;  1D8L A;  2FHT A;  1IL8 A;  1EIY B;  3CXC A;  2N88 A;  4Y7N H;  3FHW A;  1QVF A;  2HD3 A;  1JOQ A;  3GTL H;  4R1J A;  1VQO A;  3ERO A;  1S4Z A;  1UE1 A;  3A0J A;  4FO2 A;  4RWS C;  4EX5 A;  1IBL L;  2L0C A;  1K73 C;  1J5E Q;  1FNV A;  2F0G A;  4JI4 Q;  4JI6 L;  1SYC A;  3SDZ A;  4B3M L;  3KDF B;  4MN3 A;  1KRT A;  5IGB A;  1BUV T;  4JC0 A;  3DWQ A;  3H0G H;  3BYY B;  1XPO A;  1EU4 A;  4XDX A;  1F2L A;  1RIP A;  3TDQ A;  1G2S A;  4ALP A;  4K8J A;  1STY A;  3PUY A;  3KF8 A;  3NXW A;  2K6A A;  4J6H A;  2H4O A;  1IW7 C;  2NN6 G;  4K8I A;  4P75 A;  1TY2 A;  4JV5 L;  5IGF A;  1JE4 A;  1E2Z A;  1TQO A;  1PZI D;  4HJ8 A;  4UDU C;  3I4M H;  2WB1 G;  1UE7 A;  1IBL Q;  4YY3 Q;  2EJG C;  3CCR A;  4TRD A;  3VA7 A;  3D4W A;  4A76 A;  4UY8 C;  3RLF A;  4A3G B;  1G2T A;  3NK9 A;  4WJ3 M;  2F3W A;  1AZQ A;  1B9N A;  4B3M Q;  1UUP A;  1Y69 U;  4KY7 A;  1XNR L;  2B29 A;  1PTO H;  1X32 A;  1SYG A;  1FNU A;  2H1E A;  1SDF A;  2ICE C;  2SNS A;  3JAM i;  3UE0 A;  3HKZ E;  1AW7 A;  2D9U A;  1N36 L;  5M3M G;  3U4V A;  1N34 L;  1S72 A;  1E0B A;  1S5C D;  1KXL A;  1ILP A;  2DY8 A;  1IW7 D;  2K7V A;  4J8Q A;  5FLX E;  2EZV A;  2KUM A;  2RA4 A;  4M8A A;  3VYU A;  2AQ2 B;  2ALY B;  1K3R A;  1MI2 A;  1SMY C;  1BQQ T;  5KEE A;  4BY1 B;  4MHE A;  3K7U C;  1E7Z A;  3W1G A;  2I5M X;  1I3Q B;  3GDE A;  1CK1 A;  1PYS B;  1LT6 D;  4CDD C;  1FD7 D;  4CKC A;  3VR3 A;  3PUZ A;  1QB5 D;  3X3M A;  1S5B D;  1XNR Q;  1DON A;  2XN9 C;  1TWA B;  3OWE B;  3VR4 A;  4P2C B;  4LF7 L;  2K5W A;  3A7L A;  1N36 Q;  3G7L A;  4DK1 A;  1N34 Q;  2OCE A;  5CV7 A;  4OWW B;  2A68 C;  3PO3 H;  3URY A;  1Q81 C;  3I4N H;  2VQF Q;  4IOC A;  2R6G A;  4JYA L;  3D4D A;  1MSH A;  5G3L F;  1GUS A;  4HJ7 A;  1SMY D;  1TWC H;  2WKD A;  2WII B;  3PO2 B;  1ASY A;  3NPP A;  4OEL B;  3PCO B;  3R3O A;  2M00 A;  1ENC A;  2K33 A;  1M4V A;  3ND8 A;  1SE8 A;  4JI3 L;  4XXE A;  4KJO A;  1D2B A;  1WOC A;  2EE1 A;  4MZ9 A;  1QOH A;  4LF7 Q;  1G6P A;  2A68 D;  3P20 A;  4KMU C;  1IZ6 A;  1PH3 A;  4QUC A;  1ZXT A;  4NKL A;  1SYF A;  3S2H H;  2AMC B;  3KFU A;  4POG A;  3RZD B;  4JYA Q;  2AWN A;  4ID6 A;  3OOC A;  2NVY B;  4IAL A;  2EYM A;  4A3D H;  1I6V C;  3SK8 A;  1TU2 B;  3P7J A;  1BR9 A;  3R2I A;  3BZD B;  1VQL A;  5C3X A;  5T1I A;  1W2B A;  2IL8 A;  2YTV A;  2O4X A;  1K28 A;  5C4Z A;  2NTT A;  5JEA G;  5M5Y B;  2WIN B;  1YHA A;  1T5X D;  1VQF A;  3C1F A;  2FIN B;  2VQE L;  2F0E A;  3C1E A;  3E3X A;  4JI3 Q;  3J80 i;  4PZ8 A;  2KED A;  1KDB A;  1S3O A;  3PMF A;  1YNJ C;  3AU7 A;  1RTN A;  4CHT B;  2J4X A;  1L2F A;  1O7L A;  4XYO A;  4DR1 Q;  5IGC A;  1TY0 A;  4XQQ A;  4I65 A;  1J9O A;  4DR2 Q;  1I94 L;  4P71 A;  2LXK A;  2XTI A;  2EJM A;  2V1C C;  4GZY C;  2EDG A;  1A3T A;  3HOZ H;  2C9O A;  1HA5 A;  1NUC A;  1TWH H;  1ZKO A;  4KV6 A;  1ML0 D;  3UDX A;  1KIX A;  3PO2 G;  1PFM A;  2F0T A;  1BF4 A;  1VQ4 A;  3HOX B;  1OXX K;  3UDG A;  2WAQ G;  3K58 A;  3TS0 A;  1L0X B;  1PH7 A;  3JAM E;  4LMQ D;  1KNE A;  1Z6H A;  1I50 B;  5ELN A;  3BVG A;  5IP9 H;  1GM5 A;  2EXZ A;  4UAI A;  1FR3 A;  4LF6 Q;  1C4Q A;  1PFN A;  2NUC A;  4OXP A;  4QB4 A;  3DXJ C;  1CSQ A;  1YNJ D;  2YTY A;  1H95 A;  1X6O A;  1K8G A;  1YNX A;  4B08 A;  3H3V C;  1P16 A;  4RHS A;  1JC7 A;  2G9H D;  3S14 H;  2YYZ A;  3QOL A;  4X3T A;  3K6O A;  1I94 Q;  5GRO A;  5ELD A;  1GHJ A;  3CRK C;  1VMP A;  3U58 A;  3I4O A;  3I70 A;  2LS0 1;  2K5Q A;  5I6Y A;  3OYY A;  3GTO H;  1L1O B;  2ZTE A;  3AFQ A;  4A3E G;  3G6J B;  3MHB A;  3NEN A;  2IJ0 A;  1HQM C;  1XX8 A;  1BVS A;  2VUM H;  1DOM A;  1ET9 A;  2DJG C;  2AQ1 B;  3NUC A;  1DM0 B;  4XQN A;  1HTP A;  3SXH A;  4Y7N B;  3DWP A;  2CFM A;  5H1S E;  3T16 A;  4APV A;  2NZ1 D;  3PF4 A;  2HDM A;  3FKI H;  4G7H C;  1RTO A;  4GN3 B;  1Y1V B;  3N6R A;  2PPB C;  1DXM A;  3E0E A;  2BCO A;  2K75 A;  4F8M A;  2K01 A;  4KTA A;  2ZM6 Q;  1PH4 A;  4GKK L;  4HIK A;  1NCV A;  3H0G B;  1SND A;  4R4O A;  3L2P A;  4A3J B;  2JQO A;  2CQA A;  5E1F A;  2KHI A;  2PQA B;  1V1P B;  1F2M A;  4XYQ A;  1SJH D;  2Y0S B;  3PUW A;  2E2D C;  4ZKB B;  4ZUI A;  3KF6 B;  3S9W A;  5FLM G;  3HG9 A;  3HOU B;  2JEB I;  1EWC A;  3LWU A;  3I72 A;  3MWY W;  2N8N A;  3GO5 A;  3ITP A;  4RGM A;  4NB3 A;  2CCZ A;  3GTQ B;  1JQY D;  4XTC S;  3CMA A;  3HOV H;  4RGN A;  3PV0 A;  4JW0 A;  1TWG H;  5BN5 A;  1PZJ D;  1WTR A;  1C8C A;  5LL6 S;  3W1B A;  1B3Q A;  1K3B C;  3HEJ A;  1HZC A;  3S1Q B;  1RKN A;  5E4X A;  1PZK D;  2EVB A;  1HR0 Q;  5KYL A;  1Y1W B;  1C7Y A;  2JA8 H;  3PIO A;  3CCE A;  1KDA A;  1PMR A;  1MKH A;  2IHF A;  3F2U A;  1D5M C;  4FF3 A;  1H9J A;  2IW3 A;  1ONL A;  1Y1V G;  4WRD A;  3NBI A;  3J7A V;  1SAP A;  1UAP A;  3HKZ G;  4HCS A;  3RN2 A;  4DFA A;  1D5X C;  4IUT A;  3H0G G;  4CKE A;  1K8A C;  2SEB D;  5JOB A;  5L37 A;  1TWF H;  1TR5 A;  3GV3 A;  4MTN A;  5AFW A;  2Y0S G;  3VR2 A;  4L6T B;  3MXP A;  2UXB L;  3GTJ H;  4DR7 L;  3HOU G;  1KLU D;  3GTK H;  1SE2 A;  2PZU A;  4E6I A;  3I4N B;  3CCL A;  2XWB B;  1M1K C;  5GAE C;  4X66 L;  1IXR A;  1LT4 D;  1PTO C;  3MC0 B;  3I4M G;  1DJR D;  4X65 L;  1AZP A;  1JOO A;  3A7A B;  3EVQ A;  4L5S A;  2E5L Q;  1TT2 A;  3NTK A;  2F0J A;  3W5O A;  5GAG C;  4HJ9 A;  2OQ0 A;  1Q90 A;  1GUT A;  4XT3 B;  2F4I A;  4FDB A;  3J81 L;  5LMN W;  3NTI A;  2WFW A;  4RCN A;  2Q8T A;  1Z9F A;  1B1Z A;  3A5U A;  3DUZ A;  2OTL A;  2RCF A;  3J81 c;  2K5N A;  5GQO A;  1NMG A;  3E6Z X;  3MXN A;  2PMZ B;  2RSO A;  1XMQ Q;  2EY6 A;  3KLS A;  1HH2 P;  4U67 3;  1EY7 A;  4DA2 A;  3Q0A A;  1KC8 C;  4LFC L;  4J1M A;  1O80 A;  5JJL A;  2EY5 A;  1B50 A;  2IWH A;  1QWY A;  1E1T A;  1SYE A;  3RMH A;  1PTO D;  2F52 A;  1PDQ A;  4X66 Q;  1X9N A;  4DPG A;  1C0A A;  1EYA A;  1EUJ A;  3IFD A;  5C3E B;  1LT3 D;  4X65 Q;  5LHY 1;  2F03 A;  4FXD A;  4A3D B;  3A8K E;  3GQB A;  3NE5 B;  1PLF A;  1RCV D;  3EIV A;  2F0M A;  4K2K A;  2OF1 A;  5I4D A;  4CDF C;  1VQH A;  5M5W B;  3NBH A;  3RZO B;  3KLW A;  1DGS A;  1ENA A;  3VYR A;  5EGT A;  4DV0 Q;  4L5Q A;  1LTL A;  1SLJ A;  3A8I E;  4DN4 M;  5J22 A;  3D31 A;  1D1I A;  3FEW X;  2B2U C;  4YCU A;  1IBM L;  1HTL D;  3PO3 G;  4GN4 B;  3SE0 A;  3I4N G;  4JG2 A;  4B3R Q;  5M3F H;  3QWN A;  4LFC Q;  3N52 A;  4A75 A;  1PH9 A;  4DNR B;  1TWH B;  1M8A A;  3OTO L;  1WTP A;  3K80 C;  3G4S A;  2DY7 A;  1HNZ L;  1D6E C;  5JJI A;  2E8G A;  4HSP A;  1QNK A;  3HFZ B;  1YBY A;  4BXX H;  2UXC L;  4PQX A;  5J39 A;  1LUZ A;  3K5O A;  1YJ9 A;  1PH8 A;  4V19 0;  2F0K A;  4OEM B;  2WAC A;  4RA8 A;  2QDB A;  3DM3 A;  4DNI A;  5C5M A;  2EYF A;  5C4X B;  4GN5 A;  3MEF A;  4H13 C;  5LMU L;  1CT1 D;  5I9O A;  4QF4 A;  1H9K A;  1MBY A;  1TS2 A;  4KY5 A;  4OL7 A;  5HGQ A;  1TKW B;  3S14 B;  4QIW E;  1VDZ A;  3CQZ B;  1Q3L A;  4JBW A;  4O1N A;  4JPB W;  4A3D G;  4NXN Q;  2SNM A;  3R93 A;  3FVQ A;  3MTS A;  2IY5 B;  2B2V C;  3OTO Q;  2R7D A;  4AQY Q;  4A3F B;  1HNZ Q;  2E2I H;  2E76 C;  1HQR D;  2VUM B;  2UXC Q;  5DEH A;  2IPK D;  3U50 C;  4DV1 L;  2IT1 A;  3M3Y H;  2DN8 A;  4R4Q A;  3P1H A;  2ZTC A;  2QGQ A;  1F2Y A;  4O0A A;  5I2X A;  1DD2 A;  5IT9 E;  3FKI B;  4DV7 L;  1AP0 A;  2KEE A;  2NZO A;  3F8T A;  3CCU A;  1HZA A;  5EBC A;  1UEB A;  1G8Z D;  3OW7 A;  3PUX A;  3HOZ G;  2MFI A;  1HHV A;  2JE6 I;  1SBB B;  2CWA A;  1CA6 A;  3PIP A;  5CC4 A;  1R9T H;  1VQI A;  4RAU C;  1K0S A;  2UUA L;  3CF5 A;  4K14 A;  4YWK A;  1A2T A;  3G48 A;  4IO9 A;  2CHB D;  3ULJ A; 
#chains in the Genus database with same CATH homology
 4QL5 A;  5IP9 G;  1HR0 W;  1FL0 A;  4DV1 Q;  1NTG A;  2R92 H;  5IYC G;  2KCM A;  4A93 H;  4LFB Q;  2UXB Q;  4DR7 Q;  3Q8D A;  1WYD A;  3PSI A;  1LYL A;  4KHZ A;  2RHS B;  1VQC A;  3CQZ H;  4PZ6 A;  2ALY B;  2ZM6 L;  2JK8 A;  2NZH A;  4QY7 A;  4DV6 Q;  1K3R A;  4JI5 Q;  4LF5 L;  2JA6 G;  2WB1 E;  1T9H A;  3K7U C;  1GD7 A;  2R93 G;  1E7Z A;  3W1G A;  1J6Q A;  2I5M X;  1U0L A;  3GDE A;  3KJO A;  1FVI A;  1PYS B;  4C2M H;  4A3F H;  4A3I G;  3PUZ A;  4DV4 L;  2JA5 H;  1XNR Q;  4DUY L;  3ICE A;  4A3F G;  5IT9 c;  4LF9 L;  5J3B A;  4R4C A;  4R4T A;  2VW9 A;  4GOP A;  3S17 H;  4A3L H;  4EQ5 A;  2UUA Q;  1B70 B;  1KAW A;  2R7F A;  4IPH A;  4LF7 L;  1N36 Q;  2VUM G;  5IY0 A;  1AE2 A;  5GAH C;  3M4O H;  2IX0 A;  1N34 Q;  2OCE A;  4OWW B;  3KF6 A;  3PO3 H;  3F2C A;  1Q81 C;  1Q46 A;  4B3S L;  3I4N H;  2VQF Q;  4IOC A;  4IPC A;  1NMF A;  3I2Z A;  4L5R C;  1VQ6 A;  2R6G A;  4LNQ A;  4BA2 I;  4JYA L;  4A3G H;  3K7A H;  3U4Z A;  2JA7 H;  2RHQ B;  3FKI G;  1S40 A;  1YHQ A;  3A74 A;  4DV3 L;  4HJ7 A;  2MO0 A;  3HOX G;  1TWC H;  1GKH A;  1YI2 A;  2B3G A;  3F2B A;  1ASY A;  1BKB A;  1NE3 A;  2Z0S A;  3BJU A;  5C44 H;  3PCO B;  4DV4 Q;  1HR0 L;  3BU2 A;  1SE8 A;  4JI3 L;  4HJ5 A;  4UP7 A;  2K5V A;  1WOC A;  3DLL A;  3WWV A;  1NJI C;  4LW1 A;  5IP7 H;  3M85 A;  4LF9 Q;  3CC2 A;  3S1R H;  1SR3 A;  3CCJ A;  4MZ9 A;  4LF7 Q;  1G6P A;  1RL2 A;  1CUK A;  1CKM A;  2AKW B;  4GLA C;  1IZ6 A;  2KEN A;  3RR5 A;  5BR8 L;  1PH3 A;  1VQ5 A;  1YJW A;  5K36 G;  3GD7 A;  4B3T L;  4B3S Q;  1WFQ A;  1XJV A;  4P73 A;  4BY1 H;  3S2H H;  1L1O C;  2AMC B;  3KYH C;  5M5X H;  1PV4 A;  1IBM Q;  4JBK A;  4POG A;  3KFU A;  3S2D H;  4JYA Q;  3KDF A;  1I3Q H;  2AWN A;  3CPF A;  2LSS A;  1KHI A;  4X62 L;  1XPR A;  1Q7Y C;  4C3H H;  1B8A A;  4DV2 L;  1UWV A;  4A3D H;  3RLO A;  4DK6 C;  1XMO Q;  4DR3 L;  4DR5 L;  1VQL A;  1OXU A;  1G51 A;  1XNQ L;  1W2B A;  1XTD A;  2ZJQ A;  2YTV A;  4DKA C;  3L0O A;  5JEA G;  4GKJ L;  1VQE A;  1YIJ A;  2B63 H;  1CKN B;  1YHA A;  4MNO A;  5LMN Q;  1VQF A;  4GNX C;  3HOY G;  4LF4 Q;  1EWI A;  3S24 A;  2VQE L;  3CME A;  3GTG H;  3A5Z B;  2AHO B;  4JI3 Q;  3GTM H;  3J80 i;  4PZ8 A;  2LXJ A;  1VQG A;  1HNX Q;  3J81 j;  4JI1 Q;  4L5T A;  1S3O A;  2K14 A;  3RNU A;  3B6Y A;  2JA8 G;  1L2F A;  3K81 C;  1VQB A;  1PH2 A;  2NN6 I;  1B7Y B;  4DR1 Q;  4JBJ A;  1NBW A;  1I94 L;  4DR2 Q;  2E5L L;  4B3T Q;  4P71 A;  2LXK A;  2XTI A;  2ID0 A;  2V1C C;  3G71 A;  3HOZ H;  1I5F A;  1QUQ A;  1TWH H;  5LMU Q;  1YEZ A;  4JCV E;  3UDX A;  1KIX A;  4X62 Q;  3T1Y Q;  4A3J G;  3BZC A;  4LWC A;  2MNA A;  2ATW A;  3PO2 G;  1W3S A;  4JI2 Q;  4DV2 Q;  1VQ4 A;  4JI6 Q;  4OO1 I;  1OXX K;  1X65 A;  3UDG A;  2WAQ G;  4IFD G;  1VQJ A;  4DR5 Q;  4DR3 Q;  3TS0 A;  1VQ7 A;  3S1M H;  1VQ9 A;  1C9O A;  1PH7 A;  2R7Z G;  5M3M H;  2WP8 J;  1HZ9 A;  1EYG A;  1VQN A;  1XMQ L;  4GKJ Q;  4GLV B;  2VY3 A;  3KF8 B;  5ELN A;  3ZJY C;  2ZJP A;  5IP9 H;  3OW2 A;  1GM5 A;  4WJ4 A;  5IYB G;  2OWO A;  4LF6 Q;  1EQQ A;  3D0F A;  4OXP A;  1SRO A;  1L0W A;  1X3F A;  4DAY B;  1FJG L;  1PH1 A;  5IYC H;  1VS0 A;  1CSQ A;  3I7F A;  4DR4 Q;  3AQQ A;  2YTY A;  3NEM A;  1X6O A;  1K8G A;  2E2H H;  1YNX A;  1H95 A;  2Z6K A;  5IYD G;  4A3B G;  3JC6 6;  1P16 A;  3CAM A;  3ULL A;  4BBR G;  2ZJR A;  2YYZ A;  1LM0 A;  2VS1 A;  4JBM A;  2HT1 A;  2JA6 H;  3S14 H;  4JV5 Q;  2HIX A;  3S1N H;  1WJJ A;  1I94 Q;  2R93 H;  1E3P A;  4IFD J;  5GRO A;  1V43 A;  3CCS A;  2JEA I;  4X64 L;  4GS3 A;  4DV7 Q;  4A3I H;  3U58 A;  1TXY A;  2Q2H A;  1Q8K A;  1YVC A;  3I4O A;  3TQY A;  3PF5 A;  1K0R A;  1X56 A;  4JOI C;  4DV0 L;  3OYY A;  5DLQ E;  3GTO H;  1L1O B;  2ZTE A;  1YHB A;  2RF4 A;  3AFQ A;  4A3E G;  2JA9 A;  4K0K L;  3NEN A;  2VUM H;  1BVS A;  1Y1W G;  2L15 A;  2BA0 A;  3CW2 C;  4B3R L;  1Y14 B;  4J15 A;  1VQD A;  2CFM A;  4ME3 A;  3ULP A;  5H1S E;  3MXN B;  3LGJ A;  4APV A;  3PF4 A;  3M4P A;  4YCV A;  4YHH L;  3FKI H;  4GNX B;  2UXD L;  1N33 L;  2UU9 L;  1VQM A;  4GN3 B;  2EIF A;  1E22 A;  2F3I A;  4LUV A;  2GVA A;  4C3I H;  3HOX H;  4P72 A;  3E0E A;  2K75 A;  1CSP A;  1NY4 A;  2ZM6 Q;  3ERS X;  1PH4 A;  4BY7 G;  4QJF A;  4GKK L;  4HIK A;  4LF5 Q;  4R4O A;  3L2P A;  3BZK A;  3TRZ A;  1PHJ A;  2JQO A;  1IBK L;  3STB C;  2KHI A;  2PQA B;  5FLX c;  1JE5 A;  4HJA A;  5C4J H;  2Q2U A;  2KHJ A;  4K0K Q;  1V9P A;  3NBH B;  3PUW A;  3AYH B;  4DUY Q;  4NXM L;  2BH8 A;  2KCT A;  2GVB A;  3KF6 B;  4UP8 A;  5GAD C;  1KQS A;  4KLK A;  3CCQ A;  1VQA A;  1UE5 A;  5FLM G;  1X3G A;  2JEB I;  1JMC A;  3PGZ A;  4JI8 L;  2AWO A;  2ZTD A;  4JI4 L;  1X54 A;  2N8N A;  3GO5 A;  2UUB L;  1EFW A;  2CCZ A;  4NB3 A;  3L7Z C;  5IWA L;  4YHH Q;  3IRB A;  1X3E A;  1VQP A;  5M3F G;  1N32 L;  4XTC S;  1EIF A;  4NXN L;  4O2D A;  3SGI A;  2XGT A;  3CCM A;  3CMA A;  4AQY L;  4YCW A;  3HOV H;  1M90 C;  3ER0 A;  3PV0 A;  1PVO A;  1TWG H;  4IOA A;  1FGU A;  4DV3 Q;  3UE1 A;  2N78 A;  1TWA H;  3HOV G;  2N3S A;  3HOY H;  3G6E A;  4DK3 C;  5AJ3 L;  2IHE A;  3STB D;  3TRE A;  1IBK Q;  3W1B A;  2K52 A;  2OTJ A;  1A8V A;  3T1H L;  1HNW L;  4BXX G;  1HZC A;  1JT8 A;  1U5K A;  1SN8 A;  1ASZ A;  3CCV A;  2A1A A;  1OXT A;  1EOV A;  1VQK A;  1HR0 Q;  2IX1 A;  4NXM Q;  1C7Y A;  4JI0 L;  2JA8 H;  3PIO A;  3CCE A;  2N49 A;  1K9M C;  1E1O A;  4KHP L;  4YY3 L;  1Y1V H;  4DV5 L;  2E2J H;  1MKH A;  2IHF A;  4TVA B;  4JI8 Q;  2A8V A;  3J7Z C;  2UUB Q;  1AE3 A;  3M4Q A;  5BR8 Q;  3AEV A;  1Y1V G;  5C3E G;  4OON A;  2PNH A;  3HKS A;  2NVQ H;  1N32 Q;  1GVP A;  4A3J H;  4AH6 A;  4GOP C;  3PO2 H;  1SMX A;  1IL2 A;  3HKZ G;  1Z47 A;  4A3M G;  3RN2 A;  4HIO A;  2CQO A;  3H0G G;  2D0O A;  2R7Z H;  1K8A C;  4BBS G;  2I0Q A;  1YIT A;  4A3K G;  2KBN A;  1KRS A;  1K83 H;  1TWF H;  4IFD I;  3EBE A;  2DGY A;  1N8R C;  4QQB X;  1XNQ Q;  1Q1B A;  4MTN A;  2Y0S G;  5AJ3 Q;  5IYB H;  1IYJ B;  3HOU H;  2A19 A;  5FJ8 G;  2PI2 E;  2UXB L;  1HNW Q;  3GTJ H;  4DR7 L;  1Q82 C;  1GO3 E;  4DUZ L;  3HOW G;  1YZ6 A;  3HOU G;  2VQE Q;  3GTQ H;  3GTK H;  4JI5 L;  4A3C G;  5IYD H;  4A3B H;  4KHP Q;  3CCL A;  1WCM G;  4BBR H;  3RZD H;  1M1K C;  4DAM A;  5GAE C;  4DV5 Q;  2C35 B;  4X66 L;  1IXR A;  4HIM A;  4Y52 H;  5C0X G;  1N9W A;  3KJP A;  2NVY H;  1QUQ B;  4RG1 A;  4IJL A;  3I4M G;  3TEH B;  4X65 L;  1KD1 C;  4L5S A;  2VL6 A;  3F1Z A;  3H3V H;  2HIV A;  2E5L Q;  2VZA A;  3RLN A;  3W5O A;  5GAG C;  4HJ9 A;  1L1O A;  4H02 A;  5M5Y H;  4A3E H;  2OQ0 A;  3H3V I;  4AYB G;  3PUV A;  1OXV A;  2HHH L;  3S1Q H;  1JB7 A;  1PA6 A;  2JJQ A;  4DR6 L;  4FDB A;  5LMN W;  1VQ8 A;  3UDF A;  1SFO H;  2WAQ E;  2WFW A;  1Y1W H;  4IPD A;  2VQF L;  1Z9F A;  3A5U A;  1P8L A;  4UP9 A;  2Y0S E;  2OTL A;  3S16 H;  3J81 c;  1XPU A;  5C4X G;  2K5N A;  1A0I A;  2OQK A;  5GQO A;  1NMG A;  4OX9 L;  3EN2 A;  2MO1 A;  1XMQ Q;  3E9H A;  1MJC A;  5C0X J;  2D0P A;  1HH2 P;  3F2D A;  4DUZ Q;  4GNX A;  3RN5 A;  2R92 G;  1KC8 C;  4P74 A;  4LFC L;  1OTC A;  4JI7 L;  3I55 A;  4C3J H;  2Q2T A;  4KI0 A;  1FJG Q;  4A93 G;  2YTX A;  5JJL A;  4LF8 L;  3VDY A;  1E1T A;  1X55 A;  1JJG A;  1C0A A;  2F52 A;  4X66 Q;  1MJE A;  1X9N A;  4DPG A;  2Q2I A;  3JAM c;  1EUJ A;  2MQH A;  3FP9 A;  4BY7 H;  2RCN A;  4X65 Q;  1E24 A;  2CWP A;  1QZH A;  4TQU S;  4PG3 A;  3EIV A;  1HJP A;  1BBU A;  2PQA A;  2DUD A;  4GLX A;  2ASB A;  3UDI A;  4X64 Q;  2JA5 G;  1VQH A;  4AYB E;  1I50 H;  1EQR A;  2HHH Q;  3CP0 A;  3CPW A;  3KLW A;  1DGS A;  3M7N A;  1WI5 A;  4DV0 Q;  4A3L G;  1MIU A;  4GOP B;  4DR6 Q;  4L5Q A;  1LTL A;  1SLJ A;  5FLM H;  1V1Q A;  4AIM A;  2I5H A;  3D31 A;  1O7I A;  4YCU A;  4LFA L;  1IBM L;  3PO3 G;  4HID A;  1D7Q A;  4GN4 B;  3H15 A;  4OX9 Q;  2GN5 A;  3I4N G;  4JG2 A;  1J5E L;  4B3R Q;  1OXS C;  3I56 A;  5M3F H;  1QVG A;  1CKO A;  1PYB A;  2EXD A;  1VCI A;  1XMO L;  2UUC L;  4A3G G;  4LFC Q;  2JA7 G;  4JI7 Q;  4PMW A;  4NPS A;  3KOJ A;  4A75 A;  1PH9 A;  2UXD Q;  4LF8 Q;  1Q1E A;  2CKZ B;  1AH9 A;  1N33 Q;  2UU9 Q;  1I6H H;  3OTO L;  5LMN L;  4X6A H;  3K80 C;  3CC4 A;  2FXQ A;  4LF4 L;  2K4K A;  4BA1 I;  2D62 A;  3G4S A;  2H5X A;  1HNZ L;  5JJI A;  2E8G A;  5C44 G;  1G29 1;  1Q12 A;  1SRU A;  1D8L A;  5ELO A;  1HNX L;  3HFZ B;  1YBY A;  4LUO A;  1CKN A;  4OWX B;  4JI1 L;  3J7A 5;  4BXX H;  4GKK Q;  2UXC L;  2Z6K C;  1EIY B;  1LUZ A;  1YJ9 A;  1PH8 A;  4IJH A;  1PH6 A;  3CXC A;  4Y7N H;  3FHW A;  4JOI A;  5IP7 G;  4DR1 L;  1QVF A;  4R1J A;  3GTL H;  3DM3 A;  1VQO A;  4DNI A;  4DR2 L;  3E9I A;  1UE1 A;  4GN5 A;  2QEX A;  5E7N A;  2EQS A;  2K5H A;  3A0J A;  3MEF A;  1UE6 A;  2BA1 A;  4XIG S;  4LFA Q;  5LMU L;  3CD6 A;  5HY6 A;  4IPG A;  4EX5 A;  1IBL L;  1K73 C;  5C3E H;  4BY1 G;  3T1Y L;  1J5E Q;  2F4V L;  3TS2 A;  1KL9 A;  5HGQ A;  4JI2 L;  4JI4 Q;  4JI6 L;  4QIW E;  2UUC Q;  4B3M L;  3KDF B;  1KRT A;  1PFS A;  5IWA Q;  4A3M H;  4JC0 A;  5EAY A;  4YWM A;  3H0G H;  4JBW A;  1QVC A;  4A3D G;  4BBS H;  1XPO A;  5M5W H;  1A62 A;  4NXN Q;  4A3K H;  1JJ2 A;  2YV5 A;  2NVX H;  3RZO H;  1QZG A;  2VNU D;  2IY5 B;  3OTO Q;  2R7D A;  1JJC B;  4UPA A;  4OWT B;  4AQY Q;  1Q86 C;  4LF6 L;  1RIP A;  1HNZ Q;  2E2I H;  4YWL A;  2HQL A;  2B63 G;  4ALP A;  5FJ8 H;  3PUY A;  4DR4 L;  2UXC Q;  5JJK A;  4DV1 L;  3U50 C;  2NVT H;  2IT1 A;  3HOW H;  3M3Y H;  1BBW A;  4R4Q A;  4LFB L;  4A3C H;  2NN6 G;  3T1H Q;  4P75 A;  3K8A A;  2ZTC A;  2YU9 H;  1WCM H;  2PMZ E;  2QGQ A;  4JV5 L;  3J81 i;  4O0A A;  1YJN A;  1PH5 A;  2BH2 A;  5IE8 A;  4DV6 L;  2ES2 A;  2I5L X;  4HJ8 A;  4JI0 Q;  3I4M H;  2WB1 G;  4DV7 L;  1UE7 A;  3F8T A;  2NZO A;  3CCU A;  2QA4 A;  4YY3 Q;  1HZA A;  1IBL Q;  1UEB A;  3CCR A;  1HZB A;  5JEA J;  4A76 A;  3PUX A;  4UY8 C;  3RLF A;  2F4V Q;  3HOZ G;  4LUZ A;  5C0X I;  4OO1 G;  4PZ7 A;  4RMF A;  3K0X A;  3S15 H;  4A4I A;  4WJ3 M;  2MFI A;  4B3M Q;  1A63 A;  3NEL A;  4QGU A;  1XNR L;  2B29 A;  2JE6 I;  2CWA A;  3M9B A;  3PIP A;  1R9T H;  3JAM i;  1VQI A;  3GTP H;  3UE0 A;  2K50 A;  3HKZ E;  2UUA L;  3CC7 A;  3J80 c;  1N36 L;  3CF5 A;  5M3M G;  3AFP A;  4YWK A;  3U4V A;  1N34 L;  1S72 A;  2PI2 A;  3G48 A;  4R4I A;  5C4X H;  4IO9 A;  1KXL A;  4POF A;  3ULJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...