2UYJA

Crystal structure of e. coli tdcf with bound ethylene glycol
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
127
Chain Sequence
b'MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TDCF
molecule tags Unknown function
source organism Escherichia coli
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
total genus 36
structure length 127
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uyjA00
1QAHA 3V4DA 1JD1A 2IG8A 3ZO8A 2CVLA 3R0PA 2CWJA 1QU9A 1DBFA 3ZOPA 1UFYA 1UI9A 3I7TA 3K12A 3KJJA 2DYYA 1J7HA 1XRGA 1FNJA 3L7QA 2EWCA 5HP7A 2CHTA 3MQWA 2UYPA 2UYJA 1ONIA 3M4SA 3D01A 1QD9A 3I3FA 3K0TA 2B33A 2UYNA 3ZP4A 1COMA 3ZP7A 3LYBA 3QUWA 1XHOA 3LMEA 2CHSA 1NQ3A 1ODEA 1PF5A 2CW4A 1X25A 2UYNB 2CSLA 3GTZA 3VCZA 2UYKA 4NWOB 4ZK7A 1FNKA 2OTMA 3M1XA 3KJKA 5HP8A
chains in the Genus database with same CATH superfamily
1VQLF 3CC7F 3DDNA 1VQVA 2K1SA 2LCAA 1J7HA 1FNJA 4ZHQA 5C8YA 2BTUA 2UYPA 3M4SA 2HP0A 1CLIA 3C9UA 3CD6F 3SIUA 5GIPC 4YJ2B 3HTNA 3HKBB 1QD9A 4X1IA 1Q86H 2I6DA 4C8IA 1YI2F 3HKEA 2HP0B 4O4IA 3VTIC 2AIFA 4B5CA 1R1MA 1YJWF 1W41A 5EZYA 1GO0A 2ZAUA 3WGMA 4I4TA 1GO1A 2CVLA 1YJNF 4X1YB 1DBFA 3GYQA 3MDOA 4BT3A 3S0YA 4KWEA 3S02A 2P6YA 3I7TA 2VXYA 3RYIB 2EWCA 4BVSA 3JAKB 2N48A 3G6EF 4X1IB 4EB6A 4O4JB 5JCOA 3OBYA 3JVHA 5EYPB 1FFXA 4TV9A 4LNUB 3K0TA 3I55F 4IIJB 5EO3A 1W55A 1K8AH 1IPAA 3V7QA 4B45A 4IIJA 1X7PA 1XBIA 3LFOA 4BT5A 5ITZA 1E7KA 4DRXB 1FFXB 3JAWB 3VYUC 5GONA 3BYQA 4X1KA 4G4YA 2GZLA 5IYZA 4R40B 3LWQC 5GONB 3FBAA 5G4VC 5IJ0B 5LOVA 4C4WC 4M8IA 5LA6B 5JH7B 4I55B 2RHOA 1KNKA 2R6R1 3VYTC 3HAXD 3QTYA 2G9IA 3UT5B 3T80A 1W5FA 3VOAA 1VQMF 3CCRF 4YJ3B 5A2QM 5GINC 5HXUA 5MN4A 3FFMA 3JCMM 4TV9B 1Q81H 2UYKA 3N2GA 2ZVZA 2Z01A 3S06A 3FPIA 5ITZB 3QHDA 3P0ZA 3V4DA 5GANK 1QAHA 1W42A 1RA4A 1SDSA 1JY8A 3K2XA 5HXZA 3CC2F 3VOBA 4O2BA 2BTOA 4WBNB 1W5EA 1UI9A 3N4ZA 2F9ZC 2HQSC 5KX5B 3HKDA 5CA1B 1VQ6F 2UYJA 3IEQA 1YHQF 3JATA 5G4UC 4FFBA 4G88A 2VAMA 4X20B 3WJQA 1W3EX 2UYNB 4RHAA 2Z1EA 3MCQA 4ZK7A 3J80M 3CCMF 3HKDB 2VGNA 4ERHA 5CA0B 3CCEF 2FGYA 2CWJA 5J2UB 3WGNA 2Z1TA 5J2UA 4G4XA 4BY9D 4B46A 4I4TB 3CPQA 4RQOA 2BTQB 1VQ9F 2ZOVA 3F6MA 3D01A 3E20B 5HY0A 3GHZA 2B33A 5EZYB 3HKCA 4EI9A 4F6RB 3C8LA 3CCQF 3TD5A 3JAWA 3MBMA 5EIBD 3WPXA 1PF5A 1U3PA 2CW4A 4U3JB 5LP6A 3HKEB 2AMTA 4C8GA 1Z5WA 3N2KA 4LCKA 3EORA 3S0HA 3V7EA 3JALA 3RYCA 1W57A 3C9TA 3IR9A 3KJJA 3LWPC 1T0KB 3CC4F 3B6NA 3IMPA 1IV2A 1TVKA 1IV4A 1VHAA 3RYIA 3N2KB 3N2GB 2MQEA 3FD6A 3ZP7A 1COMA 3OONA 4XCQA 1YITF 5LP6B 1ODEA 4BT7A 4HNAB 3GTZA 1IV3A 2QEXF 2HVYD 5LA6A 5JH7A 4DXDA 3JASA 3RA6A 5EB1B 5HWEA 1YIJF 3CB2A 3VO8A 1YJ9F 4X3MA 3WXMB 1JFFB 3AGKA 2RHLA 1JN1A 3O85A 1X52A 1JFFA 3WGLA 4LNUA 5AVMA 1SA0A 2HS0A 3KIZA 1RQ2A 4WBNA 3ZP4A 2CHSA 3CYQA 5HY2A 1NMUB 1GZ0A 3CCLF 4I50B 1Z5VA 3VCZA 2LBTA 1Q82H 3WJRA 1FNKA 2OTMA 4BVRA 2CZWA 4C8EA 4ZHQB 5FNVA 3ZO8A 3NVKE 5HY1A 3Q8HA 5GAPK 3ERNA 3P4EA 3UT5A 1VH8A 3M84A 3VMFB 5JQGA 2DYYA 1XRGA 1ZWZA 1JJ2F 4BT4A 1VQ4F 4B62A 3JAMM 5KMGA 1VK3A 4G4ZA 1SA0B 2FC3A 4YJ2A 2QA4F 3CCUF 4ZI7A 3RYFA 4YJ3A 3J7AR 2RB9A 4I55A 2Q1XA 3S03A 2YYEA 1W40A 3M1XA 3KJKA 5HP8A 4C81A 5KMGB 3IKFA 1TVKB 3G4SF 3ZOPA 2JNBA 4U3JA 2IQQA 4O4LB 3RE3A 4E6EA 2UZHA 1U40A 2H8EA 4G4WA 3CMEF 5HY4A 3IEWA 4HNAA 2KTUA 4F6RA 5EYPA 3RYFB 1SZQA 1OFUA 3KE1A 5LP6C 5EWRA 3TD3A 2KTVA 3JAKA 3HWUA 2DT4A 4BT2A 2ALEA 2HX0A 1KNJA 3V3TA 3NK6A 2RHJA 3MCAB 1TUBB 3QUWA 4TZZA 4IHJB 1NQ3A 3E22A 4TUYA 3KHNA 5B8FA 2CSLA 2HRYA 3WGJA 3JASB 1S72F 2PMPA 3D00A 2RHHA 1VQOF 1M90H 3RYCB 3K12A 4ZI7B 3RA5A 2ZVYA 4X20A 3D54A 3VYSC 3MQWA 4BVQA 2HRUA 2IAFA 1NJIH 5FJ4C 1RQ7A 4IHJA 2Z1FA 4X1KB 4BVTA 4X3LA 1W59A 2I6RA 4O2AA 4ZHWA 4O2BB 5LOVB 2OZBA 4NQ3A 5CB4B 3LWVC 1YQNA 3WPWA 4ZHYB 2QI2A 4NUTA 4ZOLA 2Z1UA 1QVGF 5IJ9A 3JARB 4DRXA 5J2TB 3PAFA 3CYPB 4G4VA 5EB0A 3VI6A 3JARA 2ZF8A 3DC2A 3P10A 2UYNA 3ON1A 4O4HB 2WALA 1IV1A 3SIVA 2VAWA 3N4YA 5CA0A 2QTPA 2OHWA 3RYHA 3PLAC 5FNVB 1GX1A 1PXWA 3U0OA 3WJPA 3TD4A 4O4JA 3CPWF 3C9RA 4X1YA 3CMAF 3F0FA 1W581 3E1YA 2KGWA 1TUBA 2CHTA 2V9YA 3JATB 3I56F 5IJ9B 3LWOC 2W8BC 5KX5A 1U3LA 2R751 2VAPA 1X25A 3NVIB 2BO1A 2KG4A 3OBWA 2OTLF 3WGKA 2IG8A 5BMVA 3OW2F 1VQPF 1KQSF 1QU9A 5JCOC 1VQ5F 2PHNA 1Q8RA 4EB6B 5IYZB 5LXTB 3JALB 5JVDA 1K9MH 5MN6A 2LBXA 1ONIA 3J81M 4I50A 2VGMA 4O2AB 4EI7A 3F0GA 2AIZP 5FLXM 4EI8A 3F0EA 1YGYA 2H6LA 2LBWA 5LXTA 4TV8B 5EIBC 1H47A 1N8RH 1X7OA 2HP3A 1FSZA 3NK7A 5BMVB 1W5AA 3FD5A 1W2BF 5LYJA 2Q1YA 5IJ0A 1OAPA 2L26A 1M1KH 1RLUA 5JVDB 2GVIA 3VIUA 3E22B 4TUYB 1DT9A 5EAZA 3LWRC 2NMUA 2OTJF 5IT9M 2GLZA 2YXZA 4U39A 5GIOC 1XV2A 3HJWC 5LYJB 1VQNF 1H48A 4ZHVA 5JQGB 3IKEA 3S0WA 4C82A 1VQ7F 3LDTA 4BT6A 1CN7A 1KC8H 2HS3A 1U43A 4BW0B 4NWOB 5MN5A 3CCVF 4PWTA 1RLGA 3RYHB 1T0AA 3ELCA 3K14A 1JD1A 1CK2A 1Q7YH 5DCVA 3R0PA 4TV8A 1W5BA 1H7MA 1UFYA 3CCSF 3F0DA 3L7QA 4O4IB 1KD1H 3C9SA 3CG6A 5HP7A 4FFBB 5C8YB 4O4HA 1K73H 5J2TA 5CB4A 3I3FA 1VQ8F 2HS4A 3NMUC 5CA1A 1QVFF 3LYBA 1XHOA 1VQKF 3HKCB 3LMEA 4ZOLB 2ZODA 3ESJA 4O4LA 2H8CA 3CXCF 3G71F 3CCJF 3HKBA
chains in the Genus database with same CATH topology
1QAHA 3V4DA 1JD1A 2IG8A 3ZO8A 2CVLA 3R0PA 2CWJA 1QU9A 1DBFA 3ZOPA 1UFYA 1UI9A 3I7TA 3K12A 3KJJA 2DYYA 1J7HA 1XRGA 1FNJA 3L7QA 2EWCA 5HP7A 2CHTA 3MQWA 2UYPA 2UYJA 1ONIA 3M4SA 3D01A 1QD9A 3I3FA 3K0TA 2B33A 2UYNA 3ZP4A 1COMA 3ZP7A 3LYBA 3QUWA 1XHOA 3LMEA 2CHSA 1NQ3A 1ODEA 1PF5A 2CW4A 1X25A 2UYNB 2CSLA 3GTZA 3VCZA 2UYKA 4NWOB 4ZK7A 1FNKA 2OTMA 3M1XA 3KJKA 5HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAH A;  3V4D A;  1JD1 A;  2IG8 A;  3ZO8 A;  2CVL A;  3R0P A;  2CWJ A;  1QU9 A;  1DBF A;  3ZOP A;  1UFY A;  1UI9 A;  3I7T A;  3K12 A;  3KJJ A;  2DYY A;  1J7H A;  1XRG A;  1FNJ A;  3L7Q A;  2EWC A;  5HP7 A;  2CHT A;  3MQW A;  2UYP A;  2UYJ A;  1ONI A;  3M4S A;  3D01 A;  1QD9 A;  3I3F A;  3K0T A;  2B33 A;  2UYN A;  3ZP4 A;  1COM A;  3ZP7 A;  3LYB A;  3QUW A;  1XHO A;  3LME A;  2CHS A;  1NQ3 A;  1ODE A;  1PF5 A;  2CW4 A;  1X25 A;  2UYN B;  2CSL A;  3GTZ A;  3VCZ A;  2UYK A;  4NWO B;  4ZK7 A;  1FNK A;  2OTM A;  3M1X A;  3KJK A;  5HP8 A; 
#chains in the Genus database with same CATH topology
 1VQL F;  3CC7 F;  3DDN A;  1VQV A;  2K1S A;  2LCA A;  1J7H A;  1FNJ A;  4ZHQ A;  5C8Y A;  2BTU A;  2UYP A;  3M4S A;  2HP0 A;  1CLI A;  3C9U A;  3CD6 F;  3SIU A;  5GIP C;  4YJ2 B;  3HTN A;  3HKB B;  1QD9 A;  4X1I A;  1Q86 H;  2I6D A;  4C8I A;  1YI2 F;  3HKE A;  2HP0 B;  4O4I A;  3VTI C;  2AIF A;  4B5C A;  1R1M A;  1YJW F;  1W41 A;  5EZY A;  1GO0 A;  2ZAU A;  3WGM A;  4I4T A;  1GO1 A;  2CVL A;  1YJN F;  4X1Y B;  1DBF A;  3GYQ A;  3MDO A;  4BT3 A;  3S0Y A;  4KWE A;  3S02 A;  2P6Y A;  3I7T A;  2VXY A;  3RYI B;  2EWC A;  4BVS A;  3JAK B;  2N48 A;  3G6E F;  4X1I B;  4EB6 A;  4O4J B;  5JCO A;  3OBY A;  3JVH A;  5EYP B;  1FFX A;  4TV9 A;  4LNU B;  3K0T A;  3I55 F;  4IIJ B;  5EO3 A;  1W55 A;  1K8A H;  1IPA A;  3V7Q A;  4B45 A;  4IIJ A;  1X7P A;  1XBI A;  3LFO A;  4BT5 A;  5ITZ A;  1E7K A;  4DRX B;  1FFX B;  3JAW B;  3VYU C;  5GON A;  3BYQ A;  4X1K A;  4G4Y A;  2GZL A;  5IYZ A;  4R40 B;  3LWQ C;  5GON B;  3FBA A;  5G4V C;  5IJ0 B;  5LOV A;  4C4W C;  4M8I A;  5LA6 B;  5JH7 B;  4I55 B;  2RHO A;  1KNK A;  2R6R 1;  3VYT C;  3HAX D;  3QTY A;  2G9I A;  3UT5 B;  3T80 A;  1W5F A;  3VOA A;  1VQM F;  3CCR F;  4YJ3 B;  5A2Q M;  5GIN C;  5HXU A;  5MN4 A;  3FFM A;  3JCM M;  4TV9 B;  1Q81 H;  2UYK A;  3N2G A;  2ZVZ A;  2Z01 A;  3S06 A;  3FPI A;  5ITZ B;  3QHD A;  3P0Z A;  3V4D A;  5GAN K;  1QAH A;  1W42 A;  1RA4 A;  1SDS A;  1JY8 A;  3K2X A;  5HXZ A;  3CC2 F;  3VOB A;  4O2B A;  2BTO A;  4WBN B;  1W5E A;  1UI9 A;  3N4Z A;  2F9Z C;  2HQS C;  5KX5 B;  3HKD A;  5CA1 B;  1VQ6 F;  2UYJ A;  3IEQ A;  1YHQ F;  3JAT A;  5G4U C;  4FFB A;  4G88 A;  2VAM A;  4X20 B;  3WJQ A;  1W3E X;  2UYN B;  4RHA A;  2Z1E A;  3MCQ A;  4ZK7 A;  3J80 M;  3CCM F;  3HKD B;  2VGN A;  4ERH A;  5CA0 B;  3CCE F;  2FGY A;  2CWJ A;  5J2U B;  3WGN A;  2Z1T A;  5J2U A;  4G4X A;  4BY9 D;  4B46 A;  4I4T B;  3CPQ A;  4RQO A;  2BTQ B;  1VQ9 F;  2ZOV A;  3F6M A;  3D01 A;  3E20 B;  5HY0 A;  3GHZ A;  2B33 A;  5EZY B;  3HKC A;  4EI9 A;  4F6R B;  3C8L A;  3CCQ F;  3TD5 A;  3JAW A;  3MBM A;  5EIB D;  3WPX A;  1PF5 A;  1U3P A;  2CW4 A;  4U3J B;  5LP6 A;  3HKE B;  2AMT A;  4C8G A;  1Z5W A;  3N2K A;  4LCK A;  3EOR A;  3S0H A;  3V7E A;  3JAL A;  3RYC A;  1W57 A;  3C9T A;  3IR9 A;  3KJJ A;  3LWP C;  1T0K B;  3CC4 F;  3B6N A;  3IMP A;  1IV2 A;  1TVK A;  1IV4 A;  1VHA A;  3RYI A;  3N2K B;  3N2G B;  2MQE A;  3FD6 A;  3ZP7 A;  1COM A;  3OON A;  4XCQ A;  1YIT F;  5LP6 B;  1ODE A;  4BT7 A;  4HNA B;  3GTZ A;  1IV3 A;  2QEX F;  2HVY D;  5LA6 A;  5JH7 A;  4DXD A;  3JAS A;  3RA6 A;  5EB1 B;  5HWE A;  1YIJ F;  3CB2 A;  3VO8 A;  1YJ9 F;  4X3M A;  3WXM B;  1JFF B;  3AGK A;  2RHL A;  1JN1 A;  3O85 A;  1X52 A;  1JFF A;  3WGL A;  4LNU A;  5AVM A;  1SA0 A;  2HS0 A;  3KIZ A;  1RQ2 A;  4WBN A;  3ZP4 A;  2CHS A;  3CYQ A;  5HY2 A;  1NMU B;  1GZ0 A;  3CCL F;  4I50 B;  1Z5V A;  3VCZ A;  2LBT A;  1Q82 H;  3WJR A;  1FNK A;  2OTM A;  4BVR A;  2CZW A;  4C8E A;  4ZHQ B;  5FNV A;  3ZO8 A;  3NVK E;  5HY1 A;  3Q8H A;  5GAP K;  3ERN A;  3P4E A;  3UT5 A;  1VH8 A;  3M84 A;  3VMF B;  5JQG A;  2DYY A;  1XRG A;  1ZWZ A;  1JJ2 F;  4BT4 A;  1VQ4 F;  4B62 A;  3JAM M;  5KMG A;  1VK3 A;  4G4Z A;  1SA0 B;  2FC3 A;  4YJ2 A;  2QA4 F;  3CCU F;  4ZI7 A;  3RYF A;  4YJ3 A;  3J7A R;  2RB9 A;  4I55 A;  2Q1X A;  3S03 A;  2YYE A;  1W40 A;  3M1X A;  3KJK A;  5HP8 A;  4C81 A;  5KMG B;  3IKF A;  1TVK B;  3G4S F;  3ZOP A;  2JNB A;  4U3J A;  2IQQ A;  4O4L B;  3RE3 A;  4E6E A;  2UZH A;  1U40 A;  2H8E A;  4G4W A;  3CME F;  5HY4 A;  3IEW A;  4HNA A;  2KTU A;  4F6R A;  5EYP A;  3RYF B;  1SZQ A;  1OFU A;  3KE1 A;  5LP6 C;  5EWR A;  3TD3 A;  2KTV A;  3JAK A;  3HWU A;  2DT4 A;  4BT2 A;  2ALE A;  2HX0 A;  1KNJ A;  3V3T A;  3NK6 A;  2RHJ A;  3MCA B;  1TUB B;  3QUW A;  4TZZ A;  4IHJ B;  1NQ3 A;  3E22 A;  4TUY A;  3KHN A;  5B8F A;  2CSL A;  2HRY A;  3WGJ A;  3JAS B;  1S72 F;  2PMP A;  3D00 A;  2RHH A;  1VQO F;  1M90 H;  3RYC B;  3K12 A;  4ZI7 B;  3RA5 A;  2ZVY A;  4X20 A;  3D54 A;  3VYS C;  3MQW A;  4BVQ A;  2HRU A;  2IAF A;  1NJI H;  5FJ4 C;  1RQ7 A;  4IHJ A;  2Z1F A;  4X1K B;  4BVT A;  4X3L A;  1W59 A;  2I6R A;  4O2A A;  4ZHW A;  4O2B B;  5LOV B;  2OZB A;  4NQ3 A;  5CB4 B;  3LWV C;  1YQN A;  3WPW A;  4ZHY B;  2QI2 A;  4NUT A;  4ZOL A;  2Z1U A;  1QVG F;  5IJ9 A;  3JAR B;  4DRX A;  5J2T B;  3PAF A;  3CYP B;  4G4V A;  5EB0 A;  3VI6 A;  3JAR A;  2ZF8 A;  3DC2 A;  3P10 A;  2UYN A;  3ON1 A;  4O4H B;  2WAL A;  1IV1 A;  3SIV A;  2VAW A;  3N4Y A;  5CA0 A;  2QTP A;  2OHW A;  3RYH A;  3PLA C;  5FNV B;  1GX1 A;  1PXW A;  3U0O A;  3WJP A;  3TD4 A;  4O4J A;  3CPW F;  3C9R A;  4X1Y A;  3CMA F;  3F0F A;  1W58 1;  3E1Y A;  2KGW A;  1TUB A;  2CHT A;  2V9Y A;  3JAT B;  3I56 F;  5IJ9 B;  3LWO C;  2W8B C;  5KX5 A;  1U3L A;  2R75 1;  2VAP A;  1X25 A;  3NVI B;  2BO1 A;  2KG4 A;  3OBW A;  2OTL F;  3WGK A;  2IG8 A;  5BMV A;  3OW2 F;  1VQP F;  1KQS F;  1QU9 A;  5JCO C;  1VQ5 F;  2PHN A;  1Q8R A;  4EB6 B;  5IYZ B;  5LXT B;  3JAL B;  5JVD A;  1K9M H;  5MN6 A;  2LBX A;  1ONI A;  3J81 M;  4I50 A;  2VGM A;  4O2A B;  4EI7 A;  3F0G A;  2AIZ P;  5FLX M;  4EI8 A;  3F0E A;  1YGY A;  2H6L A;  2LBW A;  5LXT A;  4TV8 B;  5EIB C;  1H47 A;  1N8R H;  1X7O A;  2HP3 A;  1FSZ A;  3NK7 A;  5BMV B;  1W5A A;  3FD5 A;  1W2B F;  5LYJ A;  2Q1Y A;  5IJ0 A;  1OAP A;  2L26 A;  1M1K H;  1RLU A;  5JVD B;  2GVI A;  3VIU A;  3E22 B;  4TUY B;  1DT9 A;  5EAZ A;  3LWR C;  2NMU A;  2OTJ F;  5IT9 M;  2GLZ A;  2YXZ A;  4U39 A;  5GIO C;  1XV2 A;  3HJW C;  5LYJ B;  1VQN F;  1H48 A;  4ZHV A;  5JQG B;  3IKE A;  3S0W A;  4C82 A;  1VQ7 F;  3LDT A;  4BT6 A;  1CN7 A;  1KC8 H;  2HS3 A;  1U43 A;  4BW0 B;  4NWO B;  5MN5 A;  3CCV F;  4PWT A;  1RLG A;  3RYH B;  1T0A A;  3ELC A;  3K14 A;  1JD1 A;  1CK2 A;  1Q7Y H;  5DCV A;  3R0P A;  4TV8 A;  1W5B A;  1H7M A;  1UFY A;  3CCS F;  3F0D A;  3L7Q A;  4O4I B;  1KD1 H;  3C9S A;  3CG6 A;  5HP7 A;  4FFB B;  5C8Y B;  4O4H A;  1K73 H;  5J2T A;  5CB4 A;  3I3F A;  1VQ8 F;  2HS4 A;  3NMU C;  5CA1 A;  1QVF F;  3LYB A;  1XHO A;  1VQK F;  3HKC B;  3LME A;  4ZOL B;  2ZOD A;  3ESJ A;  4O4L A;  2H8C A;  3CXC F;  3G71 F;  3CCJ F;  3HKB A; 
#chains in the Genus database with same CATH homology
 1QAH A;  3V4D A;  1JD1 A;  2IG8 A;  3ZO8 A;  2CVL A;  3R0P A;  2CWJ A;  1QU9 A;  1DBF A;  3ZOP A;  1UFY A;  1UI9 A;  3I7T A;  3K12 A;  3KJJ A;  2DYY A;  1J7H A;  1XRG A;  1FNJ A;  3L7Q A;  2EWC A;  5HP7 A;  2CHT A;  3MQW A;  2UYP A;  2UYJ A;  1ONI A;  3M4S A;  3D01 A;  1QD9 A;  3I3F A;  3K0T A;  2B33 A;  2UYN A;  3ZP4 A;  1COM A;  3ZP7 A;  3LYB A;  3QUW A;  1XHO A;  3LME A;  2CHS A;  1NQ3 A;  1ODE A;  1PF5 A;  2CW4 A;  1X25 A;  2UYN B;  2CSL A;  3GTZ A;  3VCZ A;  2UYK A;  4NWO B;  4ZK7 A;  1FNK A;  2OTM A;  3M1X A;  3KJK A;  5HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...