2UYNA

Crystal structure of e. coli tdcf with bound 2-ketobutyrate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
125
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords PROTEIN TDCF
total genus 34
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uynA00
1QAHA 3V4DA 3K0TA 1JD1A 1QU9A 2UYKA 1COMA 2CWJA 1PF5A 1ODEA 2UYJA 3LYBA 1UFYA 3M1XA 3ZP7A 1FNKA 3D01A 2CSLA 2UYNB 5HP8A 3GTZA 2EWCA 3I3FA 1XRGA 1DBFA 2B33A 2DYYA 2IG8A 3KJJA 3LMEA 1QD9A 1X25A 1ONIA 2CHSA 1XHOA 3M4SA 2CVLA 3ZOPA 1UI9A 2UYPA 2CW4A 1FNJA 2CHTA 2UYNA 3QUWA 4NWOB 3ZO8A 3L7QA 3KJKA 5HP7A 2OTMA 4ZK7A 1J7HA 3R0PA 3ZP4A 3K12A 1NQ3A 3VCZA 3I7TA 3MQWA
chains in the Genus database with same CATH superfamily
3J7AR 3K0TA 4X1YA 3VOBA 2QI2A 1GO1A 4O2AA 5EYPB 2GLZA 3LYBA 1RQ2A 3CCEF 3PLAC 1YQNA 5EO3A 4ZHWA 2ALEA 3CC2F 4IHJB 3ERNA 2B33A 3HJWC 3WGLA 3C9RA 4FFBA 1SA0B 2PMPA 4DXDA 5LXTB 4O4IA 3HKEB 1FFXA 3JARA 2VAPA 3KJKA 4HNAB 3SIVA 1RLUA 1CLIA 5JQGB 2PHNA 5LOVA 5J2UB 4BT4A 3LWVC 1TUBA 4G4XA 3S02A 4YJ2B 2ZODA 1JD1A 3N4ZA 4U3JB 1TUBB 1DT9A 3JAKB 2GVIA 2VAMA 3JASA 1VQ9F 2CWJA 3VMFB 5J2UA 2Z1FA 4ZHQA 3VTIC 4ZI7B 4I4TB 5GINC 2N48A 3O85A 2VGNA 3I55F 3M4SA 3LFOA 2CVLA 2RHOA 3FD6A 2Q1XA 1Z5WA 3OONA 3CPWF 3AGKA 5FLXM 5EB0A 5CB4B 1R1MA 3V3TA 4BVQA 4ZHQB 4X1YB 1M1KH 3JAKA 3E22B 2H6LA 3IMPA 5CA1A 1NMUB 3JARB 4PWTA 2LCAA 1FFXB 1W57A 1Q82H 1YITF 5G4UC 3LWRC 3BYQA 2CZWA 4C8IA 3OW2F 3P4EA 3QUWA 3ZO8A 2R751 2VAWA 1W41A 3JCMM 4BT6A 3LWPC 2YXZA 5FNVB 3CCMF 4ZOLA 3RYCB 3CCSF 3GYQA 3CC4F 5GIPC 4RHAA 1YJWF 1H47A 1W59A 2I6DA 1W5FA 3FFMA 3RYHA 1U3LA 2ZF8A 3FD5A 4BW0B 1FSZA 2MQEA 1W5AA 1IV4A 1PXWA 3N2KA 3GHZA 4X20B 1X25A 3VYUC 3JAWB 5CA0B 1W3EX 1VQVA 4WBNA 4B45A 4LNUB 3HTNA 4I55B 1IV3A 2IAFA 3N2GA 3I56F 3CMEF 2OTLF 2HRUA 3RYFA 5JH7A 1COMA 3N2GB 5GAPK 1U3PA 3J80M 1RLGA 3ZP7A 3D01A 4LNUA 1Z5VA 2BO1A 1KQSF 4DRXA 1K9MH 3OBWA 2Z1EA 1VQ7F 2H8EA 4X20A 3U0OA 5MN6A 3CMAF 4TV8A 4X1IA 2IQQA 1GX1A 3WJRA 5LP6B 2CHTA 1Q7YH 3JALB 3S0HA 2K1SA 1YI2F 3G71F 3MCAB 2Z1UA 1QAHA 3C9SA 4G4VA 2BTOA 4ZOLB 3IKEA 3RYCA 1JJ2F 1KNJA 3HWUA 4O2BA 2RB9A 2W8BC 1CK2A 2QEXF 1FNKA 4C8GA 4YJ3B 5LYJB 3IEWA 5HXZA 4LCKA 4BT3A 4KWEA 4TV9A 4X1KB 4F6RA 3V7EA 1QVGF 2Z1TA 1DBFA 5KMGB 1RA4A 1UI9A 1W581 2UYPA 3D54A 1U40A 1W5BA 3KHNA 1YHQF 5C8YB 3VCZA 5KX5A 3E22A 3KE1A 4O4JB 4RQOA 3IEQA 3F0EA 5HWEA 3HKBB 5HY1A 4EI8A 5IYZA 2YYEA 4G4YA 3G4SF 1U43A 3F6MA 4TUYA 2IG8A 2L26A 4TUYB 2F9ZC 1H7MA 1E7KA 5HY4A 3F0FA 3PAFA 5HP7A 2I6RA 4ZI7A 3LWOC 1SZQA 2LBWA 1VQLF 2KG4A 3MQWA 3S0WA 3JASB 2FC3A 5EZYB 2OTJF 4YJ2A 1KC8H 2WALA 4O4LB 5LOVB 1Q86H 3RYIB 4O4JA 5JQGA 3VO8A 4BVSA 5GIOC 3LDTA 4HNAA 5C8YA 5LXTA 5HY2A 1W40A 3NMUC 1W5EA 3HKCB 5LA6B 4E6EA 2RHJA 4X1KA 3OBYA 1VQNF 2QA4F 5JCOC 2OZBA 5EYPA 3NK6A 1VQMF 4O2BB 1JY8A 4O2AB 1QU9A 4NUTA 3S0YA 2OHWA 3UT5B 5EIBC 5IJ9B 1QVFF 3ELCA 3N4YA 4B5CA 1GO0A 3CYQA 1M90H 5J2TB 3JALA 3I3FA 5LP6A 4M8IA 5IJ0A 4X1IB 1YIJF 5GONB 4IIJA 3WXMB 5BMVA 2HX0A 3WJQA 5JVDA 3NVIB 3E1YA 1X7OA 2ZVZA 3RE3A 3FPIA 3NVKE 1T0KB 1GZ0A 3V7QA 2ZVYA 2UYKA 4X3LA 3CB2A 3LWQC 4TZZA 1VHAA 4G4WA 1VH8A 3F0DA 1VQ4F 3T80A 2GZLA 2QTPA 5JVDB 3S03A 2UYNB 4O4HA 2EWCA 4WBNB 1XRGA 3NK7A 4IIJB 3S06A 5CA0A 3ZOPA 1W2BF 3M84A 1IPAA 5J2TA 5G4VC 3VIUA 5GANK 2Z01A 4BT5A 3F0GA 1K73H 5B8FA 1J7HA 3K12A 3ON1A 1W42A 5IJ9A 3JATA 3I7TA 2UZHA 3CCRF 1X7PA 3WPXA 2KTVA 3C9TA 2DT4A 4NQ3A 2V9YA 5IT9M 3IR9A 3EORA 3TD4A 1VQ8F 5EIBD 3VI6A 3DDNA 4U39A 4I50A 5BMVB 1QD9A 5GONA 4ERHA 2HS0A 3IKFA 2BTUA 4B46A 4C81A 2OTMA 3P10A 1YGYA 1YJ9F 1NJIH 3RYIA 2NMUA 2VXYA 3QHDA 4O4LA 2HS3A 3HAXD 2AIFA 3Q8HA 2G9IA 5EZYA 2ZAUA 1X52A 3G6EF 3C8LA 1UFYA 2HRYA 3ESJA 3HKDB 1VQPF 3CD6F 5CB4A 1T0AA 3J81M 2FGYA 1W55A 2CSLA 4BVRA 2HS4A 3CCVF 5A2QM 1XV2A 3CPQA 3HKCA 5LA6A 4C8EA 1S72F 2CHSA 1ONIA 2RHLA 3C9UA 4BT2A 3VOAA 1VQ6F 5ITZA 3D00A 3K2XA 2P6YA 3FBAA 1VQOF 3WGKA 3ZP4A 1VK3A 4I4TA 3HKBA 3TD3A 4XCQA 4U3JA 2UYJA 4ZHYB 5HY0A 1K8AH 3CC7F 1OAPA 3K14A 5ITZB 1ZWZA 3HKEA 4O4IB 3CCLF 2ZOVA 5FJ4C 4B62A 3MCQA 1SA0A 2AMTA 1RQ7A 4FFBB 5DCVA 1FNJA 2LBXA 4IHJA 4TV9B 4F6RB 5AVMA 5LYJA 4ZK7A 5IYZB 3HKDA 1NQ3A 5EWRA 1OFUA 4R40B 4C4WC 3V4DA 4G88A 3KIZA 3MDOA 1KNKA 3MBMA 1ODEA 3WGNA 3DC2A 3SIUA 5KX5B 5EB1B 3WGJA 3P0ZA 3E20B 3JAMM 3CCJF 2JNBA 4X3MA 3VYTC 4EI9A 4TV8B 3KJJA 3LMEA 4I50B 5JCOA 4EB6B 3CYPB 5KMGA 1JN1A 3TD5A 4NWOB 4BVTA 4DRXB 1IV1A 1VQ5F 3CXCF 2VGMA 4YJ3A 5JH7B 3RYFB 2HQSC 1PF5A 3RA5A 1VQKF 3RA6A 3JATB 3M1XA 4ZHVA 1JFFA 1TVKA 2KTUA 1Q81H 1IV2A 2Q1YA 3JAWA 2AIZP 2H8CA 2HP0A 3N2KB 4C82A 5EAZA 2R6R1 2HP3A 2CW4A 4O4HB 2HP0B 2UYNA 3B6NA 3RYHB 2HVYD 1KD1H 3R0PA 3CCUF 3VYSC 1TVKB 1JFFB 1Q8RA 2LBTA 5MN5A 3WGMA 2KGWA 4EI7A 5FNVA 3JVHA 1CN7A 1H48A 4I55A 5MN4A 1N8RH 4BT7A 5HP8A 3GTZA 2DYYA 3CCQF 3WJPA 2BTQB 5IJ0B 1XHOA 4EB6A 3QTYA 2RHHA 5LP6C 4BY9D 1SDSA 4G4ZA 5CA1B 5HXUA 3WPWA 1XBIA 1YJNF 3L7QA 3CG6A 3UT5A
chains in the Genus database with same CATH topology
1QAHA 3V4DA 3K0TA 1JD1A 1QU9A 2UYKA 1COMA 2CWJA 1PF5A 1ODEA 2UYJA 3LYBA 1UFYA 3M1XA 3ZP7A 1FNKA 3D01A 2CSLA 2UYNB 5HP8A 3GTZA 2EWCA 3I3FA 1XRGA 1DBFA 2B33A 2DYYA 2IG8A 3KJJA 3LMEA 1QD9A 1X25A 1ONIA 2CHSA 1XHOA 3M4SA 2CVLA 3ZOPA 1UI9A 2UYPA 2CW4A 1FNJA 2CHTA 2UYNA 3QUWA 4NWOB 3ZO8A 3L7QA 3KJKA 5HP7A 2OTMA 4ZK7A 1J7HA 3R0PA 3ZP4A 3K12A 1NQ3A 3VCZA 3I7TA 3MQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAH A;  3V4D A;  3K0T A;  1JD1 A;  1QU9 A;  2UYK A;  1COM A;  2CWJ A;  1PF5 A;  1ODE A;  2UYJ A;  3LYB A;  1UFY A;  3M1X A;  3ZP7 A;  1FNK A;  3D01 A;  2CSL A;  2UYN B;  5HP8 A;  3GTZ A;  2EWC A;  3I3F A;  1XRG A;  1DBF A;  2B33 A;  2DYY A;  2IG8 A;  3KJJ A;  3LME A;  1QD9 A;  1X25 A;  1ONI A;  2CHS A;  1XHO A;  3M4S A;  2CVL A;  3ZOP A;  1UI9 A;  2UYP A;  2CW4 A;  1FNJ A;  2CHT A;  2UYN A;  3QUW A;  4NWO B;  3ZO8 A;  3L7Q A;  3KJK A;  5HP7 A;  2OTM A;  4ZK7 A;  1J7H A;  3R0P A;  3ZP4 A;  3K12 A;  1NQ3 A;  3VCZ A;  3I7T A;  3MQW A; 
#chains in the Genus database with same CATH topology
 3J7A R;  3K0T A;  4X1Y A;  3VOB A;  2QI2 A;  1GO1 A;  4O2A A;  5EYP B;  2GLZ A;  3LYB A;  1RQ2 A;  3CCE F;  3PLA C;  1YQN A;  5EO3 A;  4ZHW A;  2ALE A;  3CC2 F;  4IHJ B;  3ERN A;  2B33 A;  3HJW C;  3WGL A;  3C9R A;  4FFB A;  1SA0 B;  2PMP A;  4DXD A;  5LXT B;  4O4I A;  3HKE B;  1FFX A;  3JAR A;  2VAP A;  3KJK A;  4HNA B;  3SIV A;  1RLU A;  1CLI A;  5JQG B;  2PHN A;  5LOV A;  5J2U B;  4BT4 A;  3LWV C;  1TUB A;  4G4X A;  3S02 A;  4YJ2 B;  2ZOD A;  1JD1 A;  3N4Z A;  4U3J B;  1TUB B;  1DT9 A;  3JAK B;  2GVI A;  2VAM A;  3JAS A;  1VQ9 F;  2CWJ A;  3VMF B;  5J2U A;  2Z1F A;  4ZHQ A;  3VTI C;  4ZI7 B;  4I4T B;  5GIN C;  2N48 A;  3O85 A;  2VGN A;  3I55 F;  3M4S A;  3LFO A;  2CVL A;  2RHO A;  3FD6 A;  2Q1X A;  1Z5W A;  3OON A;  3CPW F;  3AGK A;  5FLX M;  5EB0 A;  5CB4 B;  1R1M A;  3V3T A;  4BVQ A;  4ZHQ B;  4X1Y B;  1M1K H;  3JAK A;  3E22 B;  2H6L A;  3IMP A;  5CA1 A;  1NMU B;  3JAR B;  4PWT A;  2LCA A;  1FFX B;  1W57 A;  1Q82 H;  1YIT F;  5G4U C;  3LWR C;  3BYQ A;  2CZW A;  4C8I A;  3OW2 F;  3P4E A;  3QUW A;  3ZO8 A;  2R75 1;  2VAW A;  1W41 A;  3JCM M;  4BT6 A;  3LWP C;  2YXZ A;  5FNV B;  3CCM F;  4ZOL A;  3RYC B;  3CCS F;  3GYQ A;  3CC4 F;  5GIP C;  4RHA A;  1YJW F;  1H47 A;  1W59 A;  2I6D A;  1W5F A;  3FFM A;  3RYH A;  1U3L A;  2ZF8 A;  3FD5 A;  4BW0 B;  1FSZ A;  2MQE A;  1W5A A;  1IV4 A;  1PXW A;  3N2K A;  3GHZ A;  4X20 B;  1X25 A;  3VYU C;  3JAW B;  5CA0 B;  1W3E X;  1VQV A;  4WBN A;  4B45 A;  4LNU B;  3HTN A;  4I55 B;  1IV3 A;  2IAF A;  3N2G A;  3I56 F;  3CME F;  2OTL F;  2HRU A;  3RYF A;  5JH7 A;  1COM A;  3N2G B;  5GAP K;  1U3P A;  3J80 M;  1RLG A;  3ZP7 A;  3D01 A;  4LNU A;  1Z5V A;  2BO1 A;  1KQS F;  4DRX A;  1K9M H;  3OBW A;  2Z1E A;  1VQ7 F;  2H8E A;  4X20 A;  3U0O A;  5MN6 A;  3CMA F;  4TV8 A;  4X1I A;  2IQQ A;  1GX1 A;  3WJR A;  5LP6 B;  2CHT A;  1Q7Y H;  3JAL B;  3S0H A;  2K1S A;  1YI2 F;  3G71 F;  3MCA B;  2Z1U A;  1QAH A;  3C9S A;  4G4V A;  2BTO A;  4ZOL B;  3IKE A;  3RYC A;  1JJ2 F;  1KNJ A;  3HWU A;  4O2B A;  2RB9 A;  2W8B C;  1CK2 A;  2QEX F;  1FNK A;  4C8G A;  4YJ3 B;  5LYJ B;  3IEW A;  5HXZ A;  4LCK A;  4BT3 A;  4KWE A;  4TV9 A;  4X1K B;  4F6R A;  3V7E A;  1QVG F;  2Z1T A;  1DBF A;  5KMG B;  1RA4 A;  1UI9 A;  1W58 1;  2UYP A;  3D54 A;  1U40 A;  1W5B A;  3KHN A;  1YHQ F;  5C8Y B;  3VCZ A;  5KX5 A;  3E22 A;  3KE1 A;  4O4J B;  4RQO A;  3IEQ A;  3F0E A;  5HWE A;  3HKB B;  5HY1 A;  4EI8 A;  5IYZ A;  2YYE A;  4G4Y A;  3G4S F;  1U43 A;  3F6M A;  4TUY A;  2IG8 A;  2L26 A;  4TUY B;  2F9Z C;  1H7M A;  1E7K A;  5HY4 A;  3F0F A;  3PAF A;  5HP7 A;  2I6R A;  4ZI7 A;  3LWO C;  1SZQ A;  2LBW A;  1VQL F;  2KG4 A;  3MQW A;  3S0W A;  3JAS B;  2FC3 A;  5EZY B;  2OTJ F;  4YJ2 A;  1KC8 H;  2WAL A;  4O4L B;  5LOV B;  1Q86 H;  3RYI B;  4O4J A;  5JQG A;  3VO8 A;  4BVS A;  5GIO C;  3LDT A;  4HNA A;  5C8Y A;  5LXT A;  5HY2 A;  1W40 A;  3NMU C;  1W5E A;  3HKC B;  5LA6 B;  4E6E A;  2RHJ A;  4X1K A;  3OBY A;  1VQN F;  2QA4 F;  5JCO C;  2OZB A;  5EYP A;  3NK6 A;  1VQM F;  4O2B B;  1JY8 A;  4O2A B;  1QU9 A;  4NUT A;  3S0Y A;  2OHW A;  3UT5 B;  5EIB C;  5IJ9 B;  1QVF F;  3ELC A;  3N4Y A;  4B5C A;  1GO0 A;  3CYQ A;  1M90 H;  5J2T B;  3JAL A;  3I3F A;  5LP6 A;  4M8I A;  5IJ0 A;  4X1I B;  1YIJ F;  5GON B;  4IIJ A;  3WXM B;  5BMV A;  2HX0 A;  3WJQ A;  5JVD A;  3NVI B;  3E1Y A;  1X7O A;  2ZVZ A;  3RE3 A;  3FPI A;  3NVK E;  1T0K B;  1GZ0 A;  3V7Q A;  2ZVY A;  2UYK A;  4X3L A;  3CB2 A;  3LWQ C;  4TZZ A;  1VHA A;  4G4W A;  1VH8 A;  3F0D A;  1VQ4 F;  3T80 A;  2GZL A;  2QTP A;  5JVD B;  3S03 A;  2UYN B;  4O4H A;  2EWC A;  4WBN B;  1XRG A;  3NK7 A;  4IIJ B;  3S06 A;  5CA0 A;  3ZOP A;  1W2B F;  3M84 A;  1IPA A;  5J2T A;  5G4V C;  3VIU A;  5GAN K;  2Z01 A;  4BT5 A;  3F0G A;  1K73 H;  5B8F A;  1J7H A;  3K12 A;  3ON1 A;  1W42 A;  5IJ9 A;  3JAT A;  3I7T A;  2UZH A;  3CCR F;  1X7P A;  3WPX A;  2KTV A;  3C9T A;  2DT4 A;  4NQ3 A;  2V9Y A;  5IT9 M;  3IR9 A;  3EOR A;  3TD4 A;  1VQ8 F;  5EIB D;  3VI6 A;  3DDN A;  4U39 A;  4I50 A;  5BMV B;  1QD9 A;  5GON A;  4ERH A;  2HS0 A;  3IKF A;  2BTU A;  4B46 A;  4C81 A;  2OTM A;  3P10 A;  1YGY A;  1YJ9 F;  1NJI H;  3RYI A;  2NMU A;  2VXY A;  3QHD A;  4O4L A;  2HS3 A;  3HAX D;  2AIF A;  3Q8H A;  2G9I A;  5EZY A;  2ZAU A;  1X52 A;  3G6E F;  3C8L A;  1UFY A;  2HRY A;  3ESJ A;  3HKD B;  1VQP F;  3CD6 F;  5CB4 A;  1T0A A;  3J81 M;  2FGY A;  1W55 A;  2CSL A;  4BVR A;  2HS4 A;  3CCV F;  5A2Q M;  1XV2 A;  3CPQ A;  3HKC A;  5LA6 A;  4C8E A;  1S72 F;  2CHS A;  1ONI A;  2RHL A;  3C9U A;  4BT2 A;  3VOA A;  1VQ6 F;  5ITZ A;  3D00 A;  3K2X A;  2P6Y A;  3FBA A;  1VQO F;  3WGK A;  3ZP4 A;  1VK3 A;  4I4T A;  3HKB A;  3TD3 A;  4XCQ A;  4U3J A;  2UYJ A;  4ZHY B;  5HY0 A;  1K8A H;  3CC7 F;  1OAP A;  3K14 A;  5ITZ B;  1ZWZ A;  3HKE A;  4O4I B;  3CCL F;  2ZOV A;  5FJ4 C;  4B62 A;  3MCQ A;  1SA0 A;  2AMT A;  1RQ7 A;  4FFB B;  5DCV A;  1FNJ A;  2LBX A;  4IHJ A;  4TV9 B;  4F6R B;  5AVM A;  5LYJ A;  4ZK7 A;  5IYZ B;  3HKD A;  1NQ3 A;  5EWR A;  1OFU A;  4R40 B;  4C4W C;  3V4D A;  4G88 A;  3KIZ A;  3MDO A;  1KNK A;  3MBM A;  1ODE A;  3WGN A;  3DC2 A;  3SIU A;  5KX5 B;  5EB1 B;  3WGJ A;  3P0Z A;  3E20 B;  3JAM M;  3CCJ F;  2JNB A;  4X3M A;  3VYT C;  4EI9 A;  4TV8 B;  3KJJ A;  3LME A;  4I50 B;  5JCO A;  4EB6 B;  3CYP B;  5KMG A;  1JN1 A;  3TD5 A;  4NWO B;  4BVT A;  4DRX B;  1IV1 A;  1VQ5 F;  3CXC F;  2VGM A;  4YJ3 A;  5JH7 B;  3RYF B;  2HQS C;  1PF5 A;  3RA5 A;  1VQK F;  3RA6 A;  3JAT B;  3M1X A;  4ZHV A;  1JFF A;  1TVK A;  2KTU A;  1Q81 H;  1IV2 A;  2Q1Y A;  3JAW A;  2AIZ P;  2H8C A;  2HP0 A;  3N2K B;  4C82 A;  5EAZ A;  2R6R 1;  2HP3 A;  2CW4 A;  4O4H B;  2HP0 B;  2UYN A;  3B6N A;  3RYH B;  2HVY D;  1KD1 H;  3R0P A;  3CCU F;  3VYS C;  1TVK B;  1JFF B;  1Q8R A;  2LBT A;  5MN5 A;  3WGM A;  2KGW A;  4EI7 A;  5FNV A;  3JVH A;  1CN7 A;  1H48 A;  4I55 A;  5MN4 A;  1N8R H;  4BT7 A;  5HP8 A;  3GTZ A;  2DYY A;  3CCQ F;  3WJP A;  2BTQ B;  5IJ0 B;  1XHO A;  4EB6 A;  3QTY A;  2RHH A;  5LP6 C;  4BY9 D;  1SDS A;  4G4Z A;  5CA1 B;  5HXU A;  3WPW A;  1XBI A;  1YJN F;  3L7Q A;  3CG6 A;  3UT5 A; 
#chains in the Genus database with same CATH homology
 1QAH A;  3V4D A;  3K0T A;  1JD1 A;  1QU9 A;  2UYK A;  1COM A;  2CWJ A;  1PF5 A;  1ODE A;  2UYJ A;  3LYB A;  1UFY A;  3M1X A;  3ZP7 A;  1FNK A;  3D01 A;  2CSL A;  2UYN B;  5HP8 A;  3GTZ A;  2EWC A;  3I3F A;  1XRG A;  1DBF A;  2B33 A;  2DYY A;  2IG8 A;  3KJJ A;  3LME A;  1QD9 A;  1X25 A;  1ONI A;  2CHS A;  1XHO A;  3M4S A;  2CVL A;  3ZOP A;  1UI9 A;  2UYP A;  2CW4 A;  1FNJ A;  2CHT A;  2UYN A;  3QUW A;  4NWO B;  3ZO8 A;  3L7Q A;  3KJK A;  5HP7 A;  2OTM A;  4ZK7 A;  1J7H A;  3R0P A;  3ZP4 A;  3K12 A;  1NQ3 A;  3VCZ A;  3I7T A;  3MQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...