2UYNB

Crystal structure of e. coli tdcf with bound 2-ketobutyrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords PROTEIN TDCF
total genus 36
structure length 126
sequence length 127
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uynB00
1QU9A 3GTZA 2UYPA 2CW4A 1PF5A 1QAHA 3R0PA 1QD9A 3M1XA 2UYKA 1COMA 4NWOB 3ZP4A 4ZK7A 5HP7A 2IG8A 3I3FA 1JD1A 3KJKA 3ZO8A 3QUWA 3MQWA 2UYJA 3ZP7A 5HP8A 3V4DA 2EWCA 3L7QA 3KJJA 2DYYA 3K0TA 1ODEA 3LYBA 1X25A 2B33A 2OTMA 2CWJA 1ONIA 1XHOA 1DBFA 1FNKA 1UI9A 2CHTA 2UYNB 2UYNA 3D01A 1J7HA 2CSLA 3K12A 1FNJA 3I7TA 1UFYA 2CHSA 1XRGA 3M4SA 2CVLA 3VCZA 1NQ3A 3LMEA 3ZOPA
chains in the Genus database with same CATH superfamily
1YJ9F 4X1KB 5CA0A 5JVDB 4B45A 1QAHA 3IEQA 3CB2A 3R0PA 3RE3A 4B5CA 3CXCF 3D00A 5EB1B 3CCVF 1YIJF 4ZK7A 3V7EA 2Z1EA 3SIVA 1H7MA 4EI9A 4X3MA 3WJPA 5IYZB 3OBWA 3L7QA 1XBIA 1VQ4F 1YHQF 3TD3A 1VQLF 1TVKA 2VAPA 1VQ9F 5MN4A 4YJ3B 3B6NA 3MCQA 5JH7A 5JQGB 1YJNF 3RYHA 4FFBA 1KNJA 3Q8HA 3N2KA 4YJ2A 4IHJB 3ERNA 4KWEA 5FNVB 3VYSC 5G4VC 2YXZA 3GTZA 1PXWA 5IT9M 2JNBA 3ESJA 4ZHWA 3HKEA 1KNKA 3CC7F 2PMPA 4G4ZA 5LOVB 5GINC 2IAFA 4C4WC 2GLZA 2KG4A 1JFFB 3U0OA 3HAXD 1W2BF 5LA6B 1TUBA 3HJWC 3DC2A 3JARB 4X1IA 4WBNB 3T80A 2OZBA 3E22B 1Z5VA 3RYFB 5GANK 2YYEA 4O2BA 3S0YA 1QU9A 5IJ0A 2OTLF 2N48A 2UYPA 2H8CA 5CB4A 3J7AR 3M1XA 3JASA 2IG8A 3ZO8A 3CCSF 3NMUC 5HP8A 3V7QA 3JALA 3C9SA 4BT7A 1NJIH 4G4WA 3K0TA 3CMEF 5LP6A 1ODEA 4I55B 4BVQA 2B33A 1ONIA 4EB6B 1H48A 1FNKA 3N4YA 2UYNB 2ALEA 3V3TA 3JVHA 4B46A 2G9IA 4BT4A 3HKCB 1GO0A 4BVTA 2BTOA 4BT5A 4X1YA 3ZP4A 5HP7A 5J2TB 3I3FA 2I6DA 3RYHB 1KC8H 2IQQA 4C8GA 1CLIA 1XHOA 1DBFA 3IMPA 1JY8A 2UZHA 1K73H 2KGWA 3SIUA 3CCQF 2CSLA 1W42A 3RYIA 1VQVA 3CPQA 1IV1A 3HTNA 3S03A 2CVLA 3VCZA 3VYUC 2RHJA 3HKDB 5HWEA 5IJ9A 5LA6A 3JAMM 3CCEF 3JCMM 5CA1B 5LYJB 3OW2F 3JATB 3RA6A 3V4DA 5IYZA 4RQOA 4EI8A 2DYYA 4O4LB 5KX5B 4LNUB 4O2AA 2HS4A 3UT5A 3K12A 1M1KH 2CHSA 3IEWA 2HP0A 3HKBA 1FFXB 3O85A 4O4IB 4U3JA 1Q7YH 5GONA 3NK7A 2P6YA 3QUWA 1RQ7A 5HY1A 3KHNA 5EB0A 3RYCA 2MQEA 2L26A 3DDNA 2HQSC 4BVRA 1X7OA 3PAFA 5C8YA 2F9ZC 1J7HA 4C8EA 5LP6C 4O4HA 2Q1XA 4ZHQB 4BVSA 1NMUB 3I56F 1IV4A 3CC2F 3P0ZA 4E6EA 3E20B 1SZQA 3JAWB 3I55F 1TVKB 1JN1A 2BTUA 5GIOC 2OTJF 1OAPA 4O4JA 3LFOA 4X20B 3N2GB 1IV3A 3RA5A 3N2KB 3ZP7A 2WALA 2VGMA 5ITZA 1SDSA 2Z01A 2GVIA 2LCAA 5FLXM 5CA0B 3LYBA 5JVDA 4X1KA 2Z1FA 1T0AA 4I55A 3K14A 1W41A 4WBNA 2QEXF 1OFUA 3KIZA 1VHAA 3VTIC 1XRGA 5LXTB 4EI7A 1IPAA 4TV8B 3FD5A 1TUBB 2HS3A 4ERHA 4ZOLB 2QI2A 4I4TA 3MDOA 5JH7B 4IIJA 4YJ3A 1SA0B 3CG6A 4BT3A 1H47A 2BO1A 4TUYA 4PWTA 1K9MH 1VQKF 1VK3A 3P10A 3VOAA 1QVGF 3WGJA 2H6LA 3OBYA 3CC4F 4ZI7A 1R1MA 4G4VA 1S72F 3QHDA 1IV2A 4U3JB 4HNAA 5HXUA 5JQGA 1VQ7F 2Z1TA 3RYIB 1YQNA 1VQ5F 4F6RA 1RLUA 5LOVA 1VQ6F 4TV9B 1Q8RA 3S02A 3S0HA 2W8BC 3JARA 5J2UA 4EB6A 3LDTA 5JCOA 5AVMA 2KTUA 3F0EA 3WGLA 4ZHQA 3CCMF 1W59A 5EYPB 4NQ3A 3CCRF 1JJ2F 3J80M 1KQSF 3CD6F 5CB4B 4X1IB 1DT9A 3G71F 1W40A 4I50A 4ZHVA 4YJ2B 1NQ3A 1Z5WA 3WXMB 1QVFF 2AIZP 3F0FA 3VIUA 1YI2F 5EWRA 3VOBA 5GAPK 3N4ZA 3HWUA 2HS0A 3HKEB 1Q86H 2HP3A 3AGKA 3WPWA 3F6MA 3KJJA 1VQPF 3FD6A 5IJ9B 5LP6B 2PHNA 1W581 4X1YB 3F0GA 1Q82H 3F0DA 3WGKA 3LWRC 3I7TA 3E22A 3M84A 2VAWA 4O2BB 2HRYA 5FNVA 4M8IA 1FSZA 2QTPA 3MCAB 5EZYB 5KX5A 1W57A 2Z1UA 3QTYA 4R40B 4O4JB 2ZOVA 3KJKA 3WPXA 5J2TA 3JAKB 3G4SF 4BT2A 1M90H 3S06A 3JALB 4DXDA 3ELCA 1K8AH 5HY4A 4B62A 2UYNA 3D54A 2NMUA 4O4HB 3IKFA 1CK2A 3VYTC 5BMVA 5LXTA 3MBMA 5MN5A 5EAZA 3C9RA 3VI6A 5A2QM 3IR9A 1N8RH 3RYCB 1RA4A 2H8EA 3PLAC 5B8FA 2FC3A 2AIFA 1X52A 3HKCA 4G88A 5KMGA 5DCVA 4LNUA 3EORA 4ZOLA 4BW0B 3WJQA 5GIPC 3NVIB 1SA0A 1VH8A 1W5AA 1GX1A 1W3EX 3FBAA 3C9UA 3MQWA 2UYJA 5LYJA 2Q1YA 3HKBB 3KE1A 5IJ0B 1KD1H 1W5EA 1X25A 2ZVYA 1U43A 1UI9A 4C82A 1CN7A 3VMFB 3M4SA 3E1YA 2LBWA 4DRXA 3LWPC 2HVYD 4IHJA 1GO1A 3G6EF 2K1SA 4TV8A 3CCJF 2CW4A 1W5BA 1YITF 1Q81H 1JD1A 3RYFA 5CA1A 3GYQA 1VQNF 4BY9D 1W55A 1T0KB 3WJRA 3CPWF 5EZYA 3LWVC 1VQOF 2BTQB 3WGMA 2CHTA 4FFBB 1FNJA 2HX0A 2FGYA 2CZWA 4TV9A 4TUYB 3ON1A 3WGNA 5MN6A 4NUTA 3K2XA 2VXYA 1PF5A 4O4IA 1E7KA 1RQ2A 1U40A 3CYQA 4G4YA 5HY2A 3VO8A 2HRUA 3NVKE 5FJ4C 1W5FA 1JFFA 2AMTA 4BT6A 3C8LA 3NK6A 5KMGB 5HXZA 2V9YA 4I4TB 4X3LA 3UT5B 1U3PA 5JCOC 1U3LA 2GZLA 3CCUF 3TD5A 2R6R1 2ZAUA 2KTVA 2DT4A 4ZHYB 4C8IA 1GZ0A 2RHLA 5EO3A 2ZODA 2LBXA 3CCLF 1YGYA 4O2AB 1ZWZA 4HNAB 2UYKA 3JASB 1COMA 3IKEA 1VQMF 3OONA 3N2GA 4RHAA 3JAKA 3J81M 1VQ8F 3FPIA 3P4EA 2ZVZA 3TD4A 4DRXB 5ITZB 2RHOA 2I6RA 1FFXA 5EIBC 4C81A 2OTMA 3D01A 5J2UB 4U39A 1UFYA 5GONB 2R751 4F6RB 3C9TA 5BMVB 2ZF8A 4LCKA 2LBTA 5EYPA 1X7PA 3LMEA 3ZOPA 3HKDA 3LWOC 4G4XA 5C8YB 5G4UC 1QD9A 4IIJB 1XV2A 4NWOB 3CMAF 4X20A 5EIBD 3JATA 3GHZA 3BYQA 3CYPB 2EWCA 2OHWA 2VAMA 3JAWA 4O4LA 2RHHA 4ZI7B 2RB9A 4XCQA 4TZZA 1YJWF 2CWJA 3FFMA 2VGNA 1RLGA 2QA4F 3LWQC 4I50B 5HY0A 3S0WA 2HP0B
chains in the Genus database with same CATH topology
1QU9A 3GTZA 2UYPA 2CW4A 1PF5A 1QAHA 3R0PA 1QD9A 3M1XA 2UYKA 1COMA 4NWOB 3ZP4A 4ZK7A 5HP7A 2IG8A 3I3FA 1JD1A 3KJKA 3ZO8A 3QUWA 3MQWA 2UYJA 3ZP7A 5HP8A 3V4DA 2EWCA 3L7QA 3KJJA 2DYYA 3K0TA 1ODEA 3LYBA 1X25A 2B33A 2OTMA 2CWJA 1ONIA 1XHOA 1DBFA 1FNKA 1UI9A 2CHTA 2UYNB 2UYNA 3D01A 1J7HA 2CSLA 3K12A 1FNJA 3I7TA 1UFYA 2CHSA 1XRGA 3M4SA 2CVLA 3VCZA 1NQ3A 3LMEA 3ZOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  3GTZ A;  2UYP A;  2CW4 A;  1PF5 A;  1QAH A;  3R0P A;  1QD9 A;  3M1X A;  2UYK A;  1COM A;  4NWO B;  3ZP4 A;  4ZK7 A;  5HP7 A;  2IG8 A;  3I3F A;  1JD1 A;  3KJK A;  3ZO8 A;  3QUW A;  3MQW A;  2UYJ A;  3ZP7 A;  5HP8 A;  3V4D A;  2EWC A;  3L7Q A;  3KJJ A;  2DYY A;  3K0T A;  1ODE A;  3LYB A;  1X25 A;  2B33 A;  2OTM A;  2CWJ A;  1ONI A;  1XHO A;  1DBF A;  1FNK A;  1UI9 A;  2CHT A;  2UYN B;  2UYN A;  3D01 A;  1J7H A;  2CSL A;  3K12 A;  1FNJ A;  3I7T A;  1UFY A;  2CHS A;  1XRG A;  3M4S A;  2CVL A;  3VCZ A;  1NQ3 A;  3LME A;  3ZOP A; 
#chains in the Genus database with same CATH topology
 1YJ9 F;  4X1K B;  5CA0 A;  5JVD B;  4B45 A;  1QAH A;  3IEQ A;  3CB2 A;  3R0P A;  3RE3 A;  4B5C A;  3CXC F;  3D00 A;  5EB1 B;  3CCV F;  1YIJ F;  4ZK7 A;  3V7E A;  2Z1E A;  3SIV A;  1H7M A;  4EI9 A;  4X3M A;  3WJP A;  5IYZ B;  3OBW A;  3L7Q A;  1XBI A;  1VQ4 F;  1YHQ F;  3TD3 A;  1VQL F;  1TVK A;  2VAP A;  1VQ9 F;  5MN4 A;  4YJ3 B;  3B6N A;  3MCQ A;  5JH7 A;  5JQG B;  1YJN F;  3RYH A;  4FFB A;  1KNJ A;  3Q8H A;  3N2K A;  4YJ2 A;  4IHJ B;  3ERN A;  4KWE A;  5FNV B;  3VYS C;  5G4V C;  2YXZ A;  3GTZ A;  1PXW A;  5IT9 M;  2JNB A;  3ESJ A;  4ZHW A;  3HKE A;  1KNK A;  3CC7 F;  2PMP A;  4G4Z A;  5LOV B;  5GIN C;  2IAF A;  4C4W C;  2GLZ A;  2KG4 A;  1JFF B;  3U0O A;  3HAX D;  1W2B F;  5LA6 B;  1TUB A;  3HJW C;  3DC2 A;  3JAR B;  4X1I A;  4WBN B;  3T80 A;  2OZB A;  3E22 B;  1Z5V A;  3RYF B;  5GAN K;  2YYE A;  4O2B A;  3S0Y A;  1QU9 A;  5IJ0 A;  2OTL F;  2N48 A;  2UYP A;  2H8C A;  5CB4 A;  3J7A R;  3M1X A;  3JAS A;  2IG8 A;  3ZO8 A;  3CCS F;  3NMU C;  5HP8 A;  3V7Q A;  3JAL A;  3C9S A;  4BT7 A;  1NJI H;  4G4W A;  3K0T A;  3CME F;  5LP6 A;  1ODE A;  4I55 B;  4BVQ A;  2B33 A;  1ONI A;  4EB6 B;  1H48 A;  1FNK A;  3N4Y A;  2UYN B;  2ALE A;  3V3T A;  3JVH A;  4B46 A;  2G9I A;  4BT4 A;  3HKC B;  1GO0 A;  4BVT A;  2BTO A;  4BT5 A;  4X1Y A;  3ZP4 A;  5HP7 A;  5J2T B;  3I3F A;  2I6D A;  3RYH B;  1KC8 H;  2IQQ A;  4C8G A;  1CLI A;  1XHO A;  1DBF A;  3IMP A;  1JY8 A;  2UZH A;  1K73 H;  2KGW A;  3SIU A;  3CCQ F;  2CSL A;  1W42 A;  3RYI A;  1VQV A;  3CPQ A;  1IV1 A;  3HTN A;  3S03 A;  2CVL A;  3VCZ A;  3VYU C;  2RHJ A;  3HKD B;  5HWE A;  5IJ9 A;  5LA6 A;  3JAM M;  3CCE F;  3JCM M;  5CA1 B;  5LYJ B;  3OW2 F;  3JAT B;  3RA6 A;  3V4D A;  5IYZ A;  4RQO A;  4EI8 A;  2DYY A;  4O4L B;  5KX5 B;  4LNU B;  4O2A A;  2HS4 A;  3UT5 A;  3K12 A;  1M1K H;  2CHS A;  3IEW A;  2HP0 A;  3HKB A;  1FFX B;  3O85 A;  4O4I B;  4U3J A;  1Q7Y H;  5GON A;  3NK7 A;  2P6Y A;  3QUW A;  1RQ7 A;  5HY1 A;  3KHN A;  5EB0 A;  3RYC A;  2MQE A;  2L26 A;  3DDN A;  2HQS C;  4BVR A;  1X7O A;  3PAF A;  5C8Y A;  2F9Z C;  1J7H A;  4C8E A;  5LP6 C;  4O4H A;  2Q1X A;  4ZHQ B;  4BVS A;  1NMU B;  3I56 F;  1IV4 A;  3CC2 F;  3P0Z A;  4E6E A;  3E20 B;  1SZQ A;  3JAW B;  3I55 F;  1TVK B;  1JN1 A;  2BTU A;  5GIO C;  2OTJ F;  1OAP A;  4O4J A;  3LFO A;  4X20 B;  3N2G B;  1IV3 A;  3RA5 A;  3N2K B;  3ZP7 A;  2WAL A;  2VGM A;  5ITZ A;  1SDS A;  2Z01 A;  2GVI A;  2LCA A;  5FLX M;  5CA0 B;  3LYB A;  5JVD A;  4X1K A;  2Z1F A;  1T0A A;  4I55 A;  3K14 A;  1W41 A;  4WBN A;  2QEX F;  1OFU A;  3KIZ A;  1VHA A;  3VTI C;  1XRG A;  5LXT B;  4EI7 A;  1IPA A;  4TV8 B;  3FD5 A;  1TUB B;  2HS3 A;  4ERH A;  4ZOL B;  2QI2 A;  4I4T A;  3MDO A;  5JH7 B;  4IIJ A;  4YJ3 A;  1SA0 B;  3CG6 A;  4BT3 A;  1H47 A;  2BO1 A;  4TUY A;  4PWT A;  1K9M H;  1VQK F;  1VK3 A;  3P10 A;  3VOA A;  1QVG F;  3WGJ A;  2H6L A;  3OBY A;  3CC4 F;  4ZI7 A;  1R1M A;  4G4V A;  1S72 F;  3QHD A;  1IV2 A;  4U3J B;  4HNA A;  5HXU A;  5JQG A;  1VQ7 F;  2Z1T A;  3RYI B;  1YQN A;  1VQ5 F;  4F6R A;  1RLU A;  5LOV A;  1VQ6 F;  4TV9 B;  1Q8R A;  3S02 A;  3S0H A;  2W8B C;  3JAR A;  5J2U A;  4EB6 A;  3LDT A;  5JCO A;  5AVM A;  2KTU A;  3F0E A;  3WGL A;  4ZHQ A;  3CCM F;  1W59 A;  5EYP B;  4NQ3 A;  3CCR F;  1JJ2 F;  3J80 M;  1KQS F;  3CD6 F;  5CB4 B;  4X1I B;  1DT9 A;  3G71 F;  1W40 A;  4I50 A;  4ZHV A;  4YJ2 B;  1NQ3 A;  1Z5W A;  3WXM B;  1QVF F;  2AIZ P;  3F0F A;  3VIU A;  1YI2 F;  5EWR A;  3VOB A;  5GAP K;  3N4Z A;  3HWU A;  2HS0 A;  3HKE B;  1Q86 H;  2HP3 A;  3AGK A;  3WPW A;  3F6M A;  3KJJ A;  1VQP F;  3FD6 A;  5IJ9 B;  5LP6 B;  2PHN A;  1W58 1;  4X1Y B;  3F0G A;  1Q82 H;  3F0D A;  3WGK A;  3LWR C;  3I7T A;  3E22 A;  3M84 A;  2VAW A;  4O2B B;  2HRY A;  5FNV A;  4M8I A;  1FSZ A;  2QTP A;  3MCA B;  5EZY B;  5KX5 A;  1W57 A;  2Z1U A;  3QTY A;  4R40 B;  4O4J B;  2ZOV A;  3KJK A;  3WPX A;  5J2T A;  3JAK B;  3G4S F;  4BT2 A;  1M90 H;  3S06 A;  3JAL B;  4DXD A;  3ELC A;  1K8A H;  5HY4 A;  4B62 A;  2UYN A;  3D54 A;  2NMU A;  4O4H B;  3IKF A;  1CK2 A;  3VYT C;  5BMV A;  5LXT A;  3MBM A;  5MN5 A;  5EAZ A;  3C9R A;  3VI6 A;  5A2Q M;  3IR9 A;  1N8R H;  3RYC B;  1RA4 A;  2H8E A;  3PLA C;  5B8F A;  2FC3 A;  2AIF A;  1X52 A;  3HKC A;  4G88 A;  5KMG A;  5DCV A;  4LNU A;  3EOR A;  4ZOL A;  4BW0 B;  3WJQ A;  5GIP C;  3NVI B;  1SA0 A;  1VH8 A;  1W5A A;  1GX1 A;  1W3E X;  3FBA A;  3C9U A;  3MQW A;  2UYJ A;  5LYJ A;  2Q1Y A;  3HKB B;  3KE1 A;  5IJ0 B;  1KD1 H;  1W5E A;  1X25 A;  2ZVY A;  1U43 A;  1UI9 A;  4C82 A;  1CN7 A;  3VMF B;  3M4S A;  3E1Y A;  2LBW A;  4DRX A;  3LWP C;  2HVY D;  4IHJ A;  1GO1 A;  3G6E F;  2K1S A;  4TV8 A;  3CCJ F;  2CW4 A;  1W5B A;  1YIT F;  1Q81 H;  1JD1 A;  3RYF A;  5CA1 A;  3GYQ A;  1VQN F;  4BY9 D;  1W55 A;  1T0K B;  3WJR A;  3CPW F;  5EZY A;  3LWV C;  1VQO F;  2BTQ B;  3WGM A;  2CHT A;  4FFB B;  1FNJ A;  2HX0 A;  2FGY A;  2CZW A;  4TV9 A;  4TUY B;  3ON1 A;  3WGN A;  5MN6 A;  4NUT A;  3K2X A;  2VXY A;  1PF5 A;  4O4I A;  1E7K A;  1RQ2 A;  1U40 A;  3CYQ A;  4G4Y A;  5HY2 A;  3VO8 A;  2HRU A;  3NVK E;  5FJ4 C;  1W5F A;  1JFF A;  2AMT A;  4BT6 A;  3C8L A;  3NK6 A;  5KMG B;  5HXZ A;  2V9Y A;  4I4T B;  4X3L A;  3UT5 B;  1U3P A;  5JCO C;  1U3L A;  2GZL A;  3CCU F;  3TD5 A;  2R6R 1;  2ZAU A;  2KTV A;  2DT4 A;  4ZHY B;  4C8I A;  1GZ0 A;  2RHL A;  5EO3 A;  2ZOD A;  2LBX A;  3CCL F;  1YGY A;  4O2A B;  1ZWZ A;  4HNA B;  2UYK A;  3JAS B;  1COM A;  3IKE A;  1VQM F;  3OON A;  3N2G A;  4RHA A;  3JAK A;  3J81 M;  1VQ8 F;  3FPI A;  3P4E A;  2ZVZ A;  3TD4 A;  4DRX B;  5ITZ B;  2RHO A;  2I6R A;  1FFX A;  5EIB C;  4C81 A;  2OTM A;  3D01 A;  5J2U B;  4U39 A;  1UFY A;  5GON B;  2R75 1;  4F6R B;  3C9T A;  5BMV B;  2ZF8 A;  4LCK A;  2LBT A;  5EYP A;  1X7P A;  3LME A;  3ZOP A;  3HKD A;  3LWO C;  4G4X A;  5C8Y B;  5G4U C;  1QD9 A;  4IIJ B;  1XV2 A;  4NWO B;  3CMA F;  4X20 A;  5EIB D;  3JAT A;  3GHZ A;  3BYQ A;  3CYP B;  2EWC A;  2OHW A;  2VAM A;  3JAW A;  4O4L A;  2RHH A;  4ZI7 B;  2RB9 A;  4XCQ A;  4TZZ A;  1YJW F;  2CWJ A;  3FFM A;  2VGN A;  1RLG A;  2QA4 F;  3LWQ C;  4I50 B;  5HY0 A;  3S0W A;  2HP0 B; 
#chains in the Genus database with same CATH homology
 1QU9 A;  3GTZ A;  2UYP A;  2CW4 A;  1PF5 A;  1QAH A;  3R0P A;  1QD9 A;  3M1X A;  2UYK A;  1COM A;  4NWO B;  3ZP4 A;  4ZK7 A;  5HP7 A;  2IG8 A;  3I3F A;  1JD1 A;  3KJK A;  3ZO8 A;  3QUW A;  3MQW A;  2UYJ A;  3ZP7 A;  5HP8 A;  3V4D A;  2EWC A;  3L7Q A;  3KJJ A;  2DYY A;  3K0T A;  1ODE A;  3LYB A;  1X25 A;  2B33 A;  2OTM A;  2CWJ A;  1ONI A;  1XHO A;  1DBF A;  1FNK A;  1UI9 A;  2CHT A;  2UYN B;  2UYN A;  3D01 A;  1J7H A;  2CSL A;  3K12 A;  1FNJ A;  3I7T A;  1UFY A;  2CHS A;  1XRG A;  3M4S A;  2CVL A;  3VCZ A;  1NQ3 A;  3LME A;  3ZOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...