2UYNB

Crystal structure of e. coli tdcf with bound 2-ketobutyrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TDCF
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 36
structure length 126
sequence length 127
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uynB00
1QU9A 1QAHA 3M1XA 3L7QA 3MQWA 1PF5A 3I3FA 3ZP7A 3VCZA 1NQ3A 2UYKA 3QUWA 1X25A 2B33A 3D01A 3GTZA 1DBFA 3K12A 4ZK7A 2CWJA 3R0PA 1XRGA 1UFYA 2CSLA 2DYYA 2UYNA 3K0TA 2OTMA 2CHSA 2CHTA 2UYJA 3LYBA 1FNJA 5HP8A 4NWOB 1QD9A 1ODEA 1JD1A 2IG8A 1COMA 3V4DA 1UI9A 3ZP4A 2UYNB 1ONIA 3ZOPA 5HP7A 2CVLA 3ZO8A 2UYPA 3LMEA 1J7HA 1FNKA 3KJKA 3M4SA 3I7TA 3KJJA 2CW4A 2EWCA 1XHOA
chains in the Genus database with same CATH superfamily
3JAWA 4RQOA 4BVRA 3D00A 2PHNA 1W5EA 3J81M 5KX5A 2QEXF 3OBWA 3F0GA 3QUWA 4BT2A 4BVTA 2G9IA 3K12A 1TUBB 3DDNA 3CCMF 3ON1A 4O2AB 1UFYA 2CHTA 3S0WA 3S03A 1SA0A 5HY2A 2PMPA 3AGKA 1VQ6F 3RYFA 3RE3A 3RA6A 3VOAA 2UYNB 2UZHA 2CZWA 3RYIB 1VQOF 4ZHVA 3WXMB 2BTQB 3IR9A 3KJJA 5EIBD 4O4IA 1KD1H 3M1XA 4PWTA 2AMTA 1IV1A 2HP0A 2RHOA 3WPXA 1W581 4B5CA 2FC3A 3CB2A 3E22B 3KHNA 4LNUB 5JCOC 2CSLA 2P6YA 4C8IA 4NWOB 1W3EX 1KQSF 4YJ3A 3N4YA 5J2TB 3UT5A 1IV3A 1VQVA 3I55F 1QU9A 4BY9D 3LWRC 5GONA 5CA0B 3BYQA 2AIZP 3M84A 1CK2A 3Q8HA 3RYCB 1K73H 3D01A 1IV4A 2KGWA 3MBMA 2VAMA 1IPAA 3RA5A 5EWRA 5CA1B 2BO1A 3P0ZA 3FD6A 5A2QM 1E7KA 3WGJA 2HS4A 4X1KB 4E6EA 4O4JA 1CN7A 3N2GA 2UYPA 5JVDA 3N4ZA 1N8RH 4X1IA 1Z5VA 3HKCA 4C4WC 2Q1YA 2R751 3L7QA 1ZWZA 2KTUA 3MDOA 3FD5A 3JARA 3I3FA 1W40A 1NQ3A 3V3TA 4RHAA 2Q1XA 4G88A 3TD3A 4DXDA 1JY8A 4ZOLB 3CD6F 5JQGA 3SIVA 4C81A 4EI8A 1W5AA 5EB1B 1VQMF 1CLIA 4B45A 1RQ7A 1TUBA 4O2AA 3VI6A 1GO0A 3LDTA 5EYPA 3RYHB 3JATA 3IMPA 3LMEA 3NK7A 3CCEF 3P10A 4KWEA 2UYNA 3RYIA 1QAHA 4TV8B 4BW0B 3CC4F 1VQKF 3PAFA 2JNBA 2Z1FA 3CYQA 1YITF 5HXUA 2RHJA 3IKEA 4O4HB 2HX0A 2GZLA 2HP3A 1OAPA 2GLZA 3CMAF 3SIUA 3O85A 4M8IA 2DYYA 3LWQC 3MCQA 3IKFA 3WGLA 3E22A 1QVGF 3FBAA 4LNUA 4G4ZA 1ODEA 3C9RA 3WGKA 3E20B 1YGYA 1RQ2A 1YJNF 1VQ9F 3CCRF 1RLGA 1YJWF 2CW4A 5HXZA 5J2TA 3MQWA 3DC2A 3FFMA 3N2KB 3HAXD 5B8FA 3F0FA 3IEQA 1VQ8F 4HNAB 4LCKA 5CA0A 3J7AR 3KIZA 4G4WA 3RYCA 5KMGB 5EB0A 3S02A 3C9SA 2RB9A 1X52A 2FGYA 2AIFA 4TUYB 2IG8A 4ZHQB 5CA1A 2QI2A 2YXZA 3VTIC 3WJRA 4WBNB 1W42A 4X1KA 5MN6A 2EWCA 1JJ2F 1W57A 3C8LA 3HTNA 3CC7F 3CCLF 2OHWA 5GINC 4BT4A 5EIBC 1Q86H 2Z1UA 3HJWC 3GTZA 1DBFA 1H48A 1VH8A 1H47A 1X7PA 2I6RA 5C8YB 5G4VC 5HY4A 1W41A 3RYHA 5LOVB 4BT6A 4TZZA 4X3LA 3JAKB 1PF5A 3V7QA 5IJ9B 1KNJA 5FNVB 3D54A 1U3PA 2BTOA 3CMEF 2I6DA 4TV8A 3FPIA 1K9MH 5LP6C 1YHQF 1YQNA 3VIUA 2GVIA 4O4HA 3LFOA 4B46A 4ERHA 2CHSA 2H6LA 3HKDA 3VMFB 2YYEA 2HRUA 1VK3A 3LWPC 2ZVZA 2RHLA 4NUTA 1Q8RA 4I50A 1Z5WA 3B6NA 1NJIH 5KX5B 3QHDA 3F0DA 5GAPK 5ITZB 2Z1TA 2KTVA 2HRYA 3LWVC 1VQ4F 1SA0B 2B33A 2DT4A 5EZYB 5J2UB 4ZK7A 1PXWA 1TVKB 3CG6A 3RYFB 3HKBB 1KC8H 2V9YA 2ZF8A 2HS0A 1FNJA 2N48A 4R40B 1GZ0A 5KMGA 4O2BB 3V4DA 3S0YA 1UI9A 3ZP4A 3KE1A 4O4LB 4BT5A 5MN5A 1SDSA 4TUYA 3WJQA 4ZHQA 3M4SA 1YI2F 2VAPA 5HP8A 1XHOA 3PLAC 4IHJB 4WBNA 1K8AH 4X1YB 3CYPB 2WALA 5FLXM 3OONA 1X25A 3WPWA 4EI9A 5FJ4C 3I56F 4BVSA 4DRXB 4G4VA 1XRGA 3K0TA 4YJ3B 3JAMM 1QVFF 2ALEA 4EB6B 3UT5B 1JFFB 3LWOC 5HY0A 2LBWA 3JALB 1W55A 1M90H 3HWUA 3CCQF 4G4YA 3CCVF 5C8YA 3S06A 3VYTC 4BVQA 4U3JB 2F9ZC 3VOBA 5MN4A 5LOVA 3C9TA 3ZP7A 2LCAA 5IJ9A 2R6R1 5JH7B 3G6EF 3HKEB 5EO3A 5CB4B 1FFXB 5LP6B 2VAWA 1VQ7F 4O4JB 4ZHWA 3TD4A 1KNKA 1QD9A 1GO1A 4EI7A 2ZAUA 1COMA 4X20B 3ESJA 1FSZA 3QTYA 3J80M 5BMVB 3WGMA 5JQGB 2IAFA 2OZBA 4C8GA 1RA4A 2UYKA 5IJ0B 3F0EA 5ITZA 1DT9A 3ERNA 1U43A 2CWJA 4IIJB 5EYPB 4B62A 4ZOLA 5EZYA 2K1SA 5J2UA 2VGMA 3JATB 1TVKA 4FFBB 2LBXA 3HKBA 1Q7YH 1JD1A 3JASB 2L26A 4ZHYB 5LYJB 4I4TB 1R1MA 3CCSF 1ONIA 2CVLA 1J7HA 3NVKE 3E1YA 2ZODA 3P4EA 4O2BA 4I55B 4O4LA 1XBIA 2VXYA 2ZVYA 5LXTB 2H8EA 5GIOC 1H7MA 4IHJA 4X1YA 4F6RB 3NK6A 1XV2A 5LA6B 4TV9B 2MQEA 2UYJA 4ZI7B 5IYZB 3CCUF 1X7OA 4DRXA 1VQNF 4C8EA 4BT3A 4YJ2B 1VHAA 3WGNA 4EB6A 1M1KH 4U39A 2HQSC 1JFFA 1T0AA 1Q82H 1FNKA 2VGNA 3JAWB 3KJKA 5JCOA 1W2BF 2NMUA 2LBTA 3JALA 3MCAB 2HVYD 3K2XA 3GYQA 3ELCA 3JCMM 3CXCF 3VYUC 3G4SF 3CCJF 1W5FA 5HY1A 3JVHA 4U3JA 3N2KA 3F6MA 5DCVA 5G4UC 1U3LA 4X3MA 4HNAA 5JH7A 2HS3A 3HKEA 5CB4A 3OBYA 1FFXA 1YIJF 3V7EA 2OTJF 5LP6A 1OFUA 5HWEA 4C82A 3GHZA 5HP7A 1JN1A 4O4IB 3WJPA 3ZO8A 1NMUB 3I7TA 5GANK 4NQ3A 1Q81H 4X20A 1SZQA 2HP0B 2IQQA 3CC2F 1T0KB 1W5BA 4XCQA 1VQPF 1IV2A 1S72F 3CPWF 2KG4A 3NMUC 5BMVA 3VCZA 3TD5A 1VQ5F 5IJ0A 3G71F 3R0PA 3U0OA 2Z01A 2QTPA 1GX1A 3IEWA 3LYBA 2OTMA 1RLUA 4IIJA 4G4XA 5AVMA 3VYSC 3CPQA 3OW2F 4FFBA 3C9UA 3T80A 2ZOVA 3JASA 5LYJA 4I4TA 5GONB 2QA4F 5IT9M 4I55A 2Z1EA 2RHHA 1YJ9F 3S0HA 3NVIB 5LXTA 3JAKA 3HKDB 5GIPC 5FNVA 5EAZA 2H8CA 2BTUA 4BT7A 3VO8A 3EORA 4F6RA 4I50B 1W59A 2W8BC 3N2GB 5LA6A 5JVDB 2OTLF 4TV9A 4ZI7A 5IYZA 3ZOPA 1U40A 4X1IB 1VQLF 3HKCB 4YJ2A 3K14A 3JARB
chains in the Genus database with same CATH topology
1QU9A 1QAHA 3M1XA 3L7QA 3MQWA 1PF5A 3I3FA 3ZP7A 3VCZA 1NQ3A 2UYKA 3QUWA 1X25A 2B33A 3D01A 3GTZA 1DBFA 3K12A 4ZK7A 2CWJA 3R0PA 1XRGA 1UFYA 2CSLA 2DYYA 2UYNA 3K0TA 2OTMA 2CHSA 2CHTA 2UYJA 3LYBA 1FNJA 5HP8A 4NWOB 1QD9A 1ODEA 1JD1A 2IG8A 1COMA 3V4DA 1UI9A 3ZP4A 2UYNB 1ONIA 3ZOPA 5HP7A 2CVLA 3ZO8A 2UYPA 3LMEA 1J7HA 1FNKA 3KJKA 3M4SA 3I7TA 3KJJA 2CW4A 2EWCA 1XHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  1QAH A;  3M1X A;  3L7Q A;  3MQW A;  1PF5 A;  3I3F A;  3ZP7 A;  3VCZ A;  1NQ3 A;  2UYK A;  3QUW A;  1X25 A;  2B33 A;  3D01 A;  3GTZ A;  1DBF A;  3K12 A;  4ZK7 A;  2CWJ A;  3R0P A;  1XRG A;  1UFY A;  2CSL A;  2DYY A;  2UYN A;  3K0T A;  2OTM A;  2CHS A;  2CHT A;  2UYJ A;  3LYB A;  1FNJ A;  5HP8 A;  4NWO B;  1QD9 A;  1ODE A;  1JD1 A;  2IG8 A;  1COM A;  3V4D A;  1UI9 A;  3ZP4 A;  2UYN B;  1ONI A;  3ZOP A;  5HP7 A;  2CVL A;  3ZO8 A;  2UYP A;  3LME A;  1J7H A;  1FNK A;  3KJK A;  3M4S A;  3I7T A;  3KJJ A;  2CW4 A;  2EWC A;  1XHO A; 
#chains in the Genus database with same CATH topology
 3JAW A;  4RQO A;  4BVR A;  3D00 A;  2PHN A;  1W5E A;  3J81 M;  5KX5 A;  2QEX F;  3OBW A;  3F0G A;  3QUW A;  4BT2 A;  4BVT A;  2G9I A;  3K12 A;  1TUB B;  3DDN A;  3CCM F;  3ON1 A;  4O2A B;  1UFY A;  2CHT A;  3S0W A;  3S03 A;  1SA0 A;  5HY2 A;  2PMP A;  3AGK A;  1VQ6 F;  3RYF A;  3RE3 A;  3RA6 A;  3VOA A;  2UYN B;  2UZH A;  2CZW A;  3RYI B;  1VQO F;  4ZHV A;  3WXM B;  2BTQ B;  3IR9 A;  3KJJ A;  5EIB D;  4O4I A;  1KD1 H;  3M1X A;  4PWT A;  2AMT A;  1IV1 A;  2HP0 A;  2RHO A;  3WPX A;  1W58 1;  4B5C A;  2FC3 A;  3CB2 A;  3E22 B;  3KHN A;  4LNU B;  5JCO C;  2CSL A;  2P6Y A;  4C8I A;  4NWO B;  1W3E X;  1KQS F;  4YJ3 A;  3N4Y A;  5J2T B;  3UT5 A;  1IV3 A;  1VQV A;  3I55 F;  1QU9 A;  4BY9 D;  3LWR C;  5GON A;  5CA0 B;  3BYQ A;  2AIZ P;  3M84 A;  1CK2 A;  3Q8H A;  3RYC B;  1K73 H;  3D01 A;  1IV4 A;  2KGW A;  3MBM A;  2VAM A;  1IPA A;  3RA5 A;  5EWR A;  5CA1 B;  2BO1 A;  3P0Z A;  3FD6 A;  5A2Q M;  1E7K A;  3WGJ A;  2HS4 A;  4X1K B;  4E6E A;  4O4J A;  1CN7 A;  3N2G A;  2UYP A;  5JVD A;  3N4Z A;  1N8R H;  4X1I A;  1Z5V A;  3HKC A;  4C4W C;  2Q1Y A;  2R75 1;  3L7Q A;  1ZWZ A;  2KTU A;  3MDO A;  3FD5 A;  3JAR A;  3I3F A;  1W40 A;  1NQ3 A;  3V3T A;  4RHA A;  2Q1X A;  4G88 A;  3TD3 A;  4DXD A;  1JY8 A;  4ZOL B;  3CD6 F;  5JQG A;  3SIV A;  4C81 A;  4EI8 A;  1W5A A;  5EB1 B;  1VQM F;  1CLI A;  4B45 A;  1RQ7 A;  1TUB A;  4O2A A;  3VI6 A;  1GO0 A;  3LDT A;  5EYP A;  3RYH B;  3JAT A;  3IMP A;  3LME A;  3NK7 A;  3CCE F;  3P10 A;  4KWE A;  2UYN A;  3RYI A;  1QAH A;  4TV8 B;  4BW0 B;  3CC4 F;  1VQK F;  3PAF A;  2JNB A;  2Z1F A;  3CYQ A;  1YIT F;  5HXU A;  2RHJ A;  3IKE A;  4O4H B;  2HX0 A;  2GZL A;  2HP3 A;  1OAP A;  2GLZ A;  3CMA F;  3SIU A;  3O85 A;  4M8I A;  2DYY A;  3LWQ C;  3MCQ A;  3IKF A;  3WGL A;  3E22 A;  1QVG F;  3FBA A;  4LNU A;  4G4Z A;  1ODE A;  3C9R A;  3WGK A;  3E20 B;  1YGY A;  1RQ2 A;  1YJN F;  1VQ9 F;  3CCR F;  1RLG A;  1YJW F;  2CW4 A;  5HXZ A;  5J2T A;  3MQW A;  3DC2 A;  3FFM A;  3N2K B;  3HAX D;  5B8F A;  3F0F A;  3IEQ A;  1VQ8 F;  4HNA B;  4LCK A;  5CA0 A;  3J7A R;  3KIZ A;  4G4W A;  3RYC A;  5KMG B;  5EB0 A;  3S02 A;  3C9S A;  2RB9 A;  1X52 A;  2FGY A;  2AIF A;  4TUY B;  2IG8 A;  4ZHQ B;  5CA1 A;  2QI2 A;  2YXZ A;  3VTI C;  3WJR A;  4WBN B;  1W42 A;  4X1K A;  5MN6 A;  2EWC A;  1JJ2 F;  1W57 A;  3C8L A;  3HTN A;  3CC7 F;  3CCL F;  2OHW A;  5GIN C;  4BT4 A;  5EIB C;  1Q86 H;  2Z1U A;  3HJW C;  3GTZ A;  1DBF A;  1H48 A;  1VH8 A;  1H47 A;  1X7P A;  2I6R A;  5C8Y B;  5G4V C;  5HY4 A;  1W41 A;  3RYH A;  5LOV B;  4BT6 A;  4TZZ A;  4X3L A;  3JAK B;  1PF5 A;  3V7Q A;  5IJ9 B;  1KNJ A;  5FNV B;  3D54 A;  1U3P A;  2BTO A;  3CME F;  2I6D A;  4TV8 A;  3FPI A;  1K9M H;  5LP6 C;  1YHQ F;  1YQN A;  3VIU A;  2GVI A;  4O4H A;  3LFO A;  4B46 A;  4ERH A;  2CHS A;  2H6L A;  3HKD A;  3VMF B;  2YYE A;  2HRU A;  1VK3 A;  3LWP C;  2ZVZ A;  2RHL A;  4NUT A;  1Q8R A;  4I50 A;  1Z5W A;  3B6N A;  1NJI H;  5KX5 B;  3QHD A;  3F0D A;  5GAP K;  5ITZ B;  2Z1T A;  2KTV A;  2HRY A;  3LWV C;  1VQ4 F;  1SA0 B;  2B33 A;  2DT4 A;  5EZY B;  5J2U B;  4ZK7 A;  1PXW A;  1TVK B;  3CG6 A;  3RYF B;  3HKB B;  1KC8 H;  2V9Y A;  2ZF8 A;  2HS0 A;  1FNJ A;  2N48 A;  4R40 B;  1GZ0 A;  5KMG A;  4O2B B;  3V4D A;  3S0Y A;  1UI9 A;  3ZP4 A;  3KE1 A;  4O4L B;  4BT5 A;  5MN5 A;  1SDS A;  4TUY A;  3WJQ A;  4ZHQ A;  3M4S A;  1YI2 F;  2VAP A;  5HP8 A;  1XHO A;  3PLA C;  4IHJ B;  4WBN A;  1K8A H;  4X1Y B;  3CYP B;  2WAL A;  5FLX M;  3OON A;  1X25 A;  3WPW A;  4EI9 A;  5FJ4 C;  3I56 F;  4BVS A;  4DRX B;  4G4V A;  1XRG A;  3K0T A;  4YJ3 B;  3JAM M;  1QVF F;  2ALE A;  4EB6 B;  3UT5 B;  1JFF B;  3LWO C;  5HY0 A;  2LBW A;  3JAL B;  1W55 A;  1M90 H;  3HWU A;  3CCQ F;  4G4Y A;  3CCV F;  5C8Y A;  3S06 A;  3VYT C;  4BVQ A;  4U3J B;  2F9Z C;  3VOB A;  5MN4 A;  5LOV A;  3C9T A;  3ZP7 A;  2LCA A;  5IJ9 A;  2R6R 1;  5JH7 B;  3G6E F;  3HKE B;  5EO3 A;  5CB4 B;  1FFX B;  5LP6 B;  2VAW A;  1VQ7 F;  4O4J B;  4ZHW A;  3TD4 A;  1KNK A;  1QD9 A;  1GO1 A;  4EI7 A;  2ZAU A;  1COM A;  4X20 B;  3ESJ A;  1FSZ A;  3QTY A;  3J80 M;  5BMV B;  3WGM A;  5JQG B;  2IAF A;  2OZB A;  4C8G A;  1RA4 A;  2UYK A;  5IJ0 B;  3F0E A;  5ITZ A;  1DT9 A;  3ERN A;  1U43 A;  2CWJ A;  4IIJ B;  5EYP B;  4B62 A;  4ZOL A;  5EZY A;  2K1S A;  5J2U A;  2VGM A;  3JAT B;  1TVK A;  4FFB B;  2LBX A;  3HKB A;  1Q7Y H;  1JD1 A;  3JAS B;  2L26 A;  4ZHY B;  5LYJ B;  4I4T B;  1R1M A;  3CCS F;  1ONI A;  2CVL A;  1J7H A;  3NVK E;  3E1Y A;  2ZOD A;  3P4E A;  4O2B A;  4I55 B;  4O4L A;  1XBI A;  2VXY A;  2ZVY A;  5LXT B;  2H8E A;  5GIO C;  1H7M A;  4IHJ A;  4X1Y A;  4F6R B;  3NK6 A;  1XV2 A;  5LA6 B;  4TV9 B;  2MQE A;  2UYJ A;  4ZI7 B;  5IYZ B;  3CCU F;  1X7O A;  4DRX A;  1VQN F;  4C8E A;  4BT3 A;  4YJ2 B;  1VHA A;  3WGN A;  4EB6 A;  1M1K H;  4U39 A;  2HQS C;  1JFF A;  1T0A A;  1Q82 H;  1FNK A;  2VGN A;  3JAW B;  3KJK A;  5JCO A;  1W2B F;  2NMU A;  2LBT A;  3JAL A;  3MCA B;  2HVY D;  3K2X A;  3GYQ A;  3ELC A;  3JCM M;  3CXC F;  3VYU C;  3G4S F;  3CCJ F;  1W5F A;  5HY1 A;  3JVH A;  4U3J A;  3N2K A;  3F6M A;  5DCV A;  5G4U C;  1U3L A;  4X3M A;  4HNA A;  5JH7 A;  2HS3 A;  3HKE A;  5CB4 A;  3OBY A;  1FFX A;  1YIJ F;  3V7E A;  2OTJ F;  5LP6 A;  1OFU A;  5HWE A;  4C82 A;  3GHZ A;  5HP7 A;  1JN1 A;  4O4I B;  3WJP A;  3ZO8 A;  1NMU B;  3I7T A;  5GAN K;  4NQ3 A;  1Q81 H;  4X20 A;  1SZQ A;  2HP0 B;  2IQQ A;  3CC2 F;  1T0K B;  1W5B A;  4XCQ A;  1VQP F;  1IV2 A;  1S72 F;  3CPW F;  2KG4 A;  3NMU C;  5BMV A;  3VCZ A;  3TD5 A;  1VQ5 F;  5IJ0 A;  3G71 F;  3R0P A;  3U0O A;  2Z01 A;  2QTP A;  1GX1 A;  3IEW A;  3LYB A;  2OTM A;  1RLU A;  4IIJ A;  4G4X A;  5AVM A;  3VYS C;  3CPQ A;  3OW2 F;  4FFB A;  3C9U A;  3T80 A;  2ZOV A;  3JAS A;  5LYJ A;  4I4T A;  5GON B;  2QA4 F;  5IT9 M;  4I55 A;  2Z1E A;  2RHH A;  1YJ9 F;  3S0H A;  3NVI B;  5LXT A;  3JAK A;  3HKD B;  5GIP C;  5FNV A;  5EAZ A;  2H8C A;  2BTU A;  4BT7 A;  3VO8 A;  3EOR A;  4F6R A;  4I50 B;  1W59 A;  2W8B C;  3N2G B;  5LA6 A;  5JVD B;  2OTL F;  4TV9 A;  4ZI7 A;  5IYZ A;  3ZOP A;  1U40 A;  4X1I B;  1VQL F;  3HKC B;  4YJ2 A;  3K14 A;  3JAR B; 
#chains in the Genus database with same CATH homology
 1QU9 A;  1QAH A;  3M1X A;  3L7Q A;  3MQW A;  1PF5 A;  3I3F A;  3ZP7 A;  3VCZ A;  1NQ3 A;  2UYK A;  3QUW A;  1X25 A;  2B33 A;  3D01 A;  3GTZ A;  1DBF A;  3K12 A;  4ZK7 A;  2CWJ A;  3R0P A;  1XRG A;  1UFY A;  2CSL A;  2DYY A;  2UYN A;  3K0T A;  2OTM A;  2CHS A;  2CHT A;  2UYJ A;  3LYB A;  1FNJ A;  5HP8 A;  4NWO B;  1QD9 A;  1ODE A;  1JD1 A;  2IG8 A;  1COM A;  3V4D A;  1UI9 A;  3ZP4 A;  2UYN B;  1ONI A;  3ZOP A;  5HP7 A;  2CVL A;  3ZO8 A;  2UYP A;  3LME A;  1J7H A;  1FNK A;  3KJK A;  3M4S A;  3I7T A;  3KJJ A;  2CW4 A;  2EWC A;  1XHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...