2UYNB

Crystal structure of e. coli tdcf with bound 2-ketobutyrate
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TDCF
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 36
structure length 126
sequence length 127
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uynB00
2EWCA 2CSLA 1FNJA 1UI9A 3ZP4A 1NQ3A 3K0TA 3KJJA 3I7TA 3QUWA 1QD9A 1PF5A 1ODEA 2CWJA 1QU9A 3VCZA 2DYYA 1XRGA 1COMA 2CHSA 1JD1A 3L7QA 3ZP7A 5HP7A 1XHOA 1QAHA 1UFYA 2UYNA 3I3FA 3GTZA 3ZO8A 1ONIA 1X25A 2UYKA 2OTMA 3ZOPA 4NWOB 3LYBA 2CHTA 3D01A 3MQWA 4ZK7A 3K12A 2B33A 2CVLA 2UYNB 3M4SA 2UYPA 1DBFA 3R0PA 3LMEA 3KJKA 3V4DA 2IG8A 5HP8A 3M1XA 2CW4A 1J7HA 2UYJA 1FNKA
chains in the Genus database with same CATH superfamily
3CD6F 1T0AA 4F6RB 5FNVA 1FNJA 3HAXD 5LP6B 3G4SF 1SA0A 3JVHA 1VK3A 1QD9A 3N4YA 4X1KB 5MN5A 1QU9A 4O4LB 2KTVA 3L7QA 1SA0B 5LYJB 3C9UA 1NMUB 3S02A 4NWOB 1JN1A 3KIZA 2HRYA 1KD1H 2UZHA 1IPAA 4EB6A 3CYQA 3S0HA 5G4VC 3VI6A 1IV3A 3LMEA 2VAWA 1VQ6F 4IIJA 4EB6B 1RQ7A 4YJ2A 2I6DA 2VAPA 4I4TA 1CN7A 3CC7F 3U0OA 3CC4F 3F6MA 2HS0A 2Z1UA 3RYIA 4I50B 3P10A 4IIJB 4BT6A 4YJ2B 4I4TB 5EAZA 4ZHYB 3CCVF 2UYNA 3RYIB 1OFUA 5IJ0A 2QI2A 3RYHA 3CG6A 2UYNB 3M4SA 2W8BC 5IJ0B 1U3LA 3RYHB 3F0DA 5HY4A 5HP8A 5B8FA 2RHJA 1RA4A 4LCKA 2EWCA 4FFBA 3SIVA 1NQ3A 1U40A 1RLGA 2YXZA 1ODEA 2JNBA 3CYPB 4BVTA 1H47A 5EYPA 4FFBB 2CHSA 3VOBA 5A2QM 4O4IA 3LFOA 5JH7A 3S0YA 4G4XA 1GO1A 3IR9A 5HY1A 1JFFA 2RHLA 1Q86H 1M1KH 3OW2F 1TUBA 4G88A 3LWPC 4O4JB 2KTUA 1JFFB 2GZLA 3CCUF 3F0FA 1UI9A 2LBWA 2Z01A 3LWOC 4ERHA 1ZWZA 5GANK 1K8AH 3C9RA 2CWJA 4KWEA 1VQ4F 2HRUA 4EI8A 3HJWC 1W5FA 2Z1EA 3S0WA 1N8RH 1Z5VA 3FBAA 3O85A 3HKCA 5J2UA 1FSZA 5LA6A 2KGWA 1YQNA 3ZOPA 2ZOVA 5FJ4C 1W3EX 5C8YA 1FFXA 3HKCB 5GONA 5J2UB 5LA6B 4TV8A 1DBFA 3R0PA 4DXDA 3NMUC 3DDNA 2VXYA 2LBTA 1FFXB 2ZODA 5GONB 4TV8B 1VQ8F 1X7PA 2H8EA 1XV2A 2R751 4R40B 1IV1A 2WALA 2GLZA 5KMGB 5LP6C 5HY2A 4X20A 3JALA 3G6EF 1VHAA 1COMA 2AMTA 2RB9A 1QAHA 5ITZA 3S03A 1X25A 4BT4A 4U3JB 4X20B 3JALB 3VMFB 3DC2A 2KG4A 4X1IA 5CA1A 5HXUA 5JCOC 2P6YA 5ITZB 2Z1FA 1VQMF 1H48A 4ZOLA 4BVSA 4BVQA 4X1YA 4X1IB 2LBXA 5CA1B 4LNUA 3RA6A 4TUYA 3M84A 4YJ3A 5EO3A 3IKFA 1T0KB 1CK2A 1PF5A 2PMPA 3ELCA 4TV9A 3CPQA 2Z1TA 4LNUB 4TUYB 5EB1B 4YJ3B 5FNVB 2LCAA 2HP3A 3F0GA 2UYKA 1S72F 3RE3A 4TV9B 1KNJA 1VQPF 3K12A 3FFMA 3LDTA 4X3MA 2OTLF 3E1YA 1VQNF 2AIFA 3N2GA 4ZHWA 3UT5A 3RYFA 3LWVC 4B62A 5GINC 1J7HA 2HS3A 2UYJA 3NK7A 3JCMM 3VYTC 3NVKE 1DT9A 4B5CA 3N2GB 5IT9M 3UT5B 3K0TA 3RYFB 4O2BA 2QA4F 3MCQA 1SDSA 4BVRA 3LWRC 3GHZA 3ESJA 4EI9A 1ONIA 4O2BB 3WPXA 4HNAA 2CHTA 4PWTA 5LXTA 3MBMA 2FGYA 2B33A 1IV2A 3JARA 1W42A 3CCJF 5LXTB 3SIUA 2IAFA 4ZHQA 3I55F 5EB0A 3JARB 3JASA 3TD3A 4DRXA 1YI2F 1XBIA 4ZHQB 3FD6A 3JASB 4B45A 1X7OA 4DRXB 4EI7A 4NUTA 2OTMA 1GZ0A 1U43A 3V7EA 4O2AA 3WGMA 5CB4A 5EYPB 1Z5WA 3C8LA 1GX1A 3GYQA 2QEXF 4BT7A 2BTUA 2CVLA 5GIOC 4O4IB 5JH7B 3ERNA 1Q8RA 4O4HA 3C9SA 2IG8A 5CB4B 3VYUC 1YJNF 5JQGA 4O4HB 2Q1YA 5HY0A 1TUBB 2PHNA 2YYEA 1VQ5F 1U3PA 5BMVA 1X52A 1XHOA 3J81M 4BT5A 5FLXM 1NJIH 3RYCA 1W5EA 3E20B 2Q1XA 2ALEA 5BMVB 3MQWA 4C4WC 2HVYD 1W40A 2MQEA 3RYCB 3T80A 1E7KA 3V4DA 3I56F 3WJPA 3CCSF 3M1XA 2CW4A 5C8YB 3C9TA 1KQSF 3ZP4A 1VQLF 4G4VA 2N48A 4BT2A 3K2XA 5JVDA 3Q8HA 1SZQA 2F9ZC 1VQVA 2IQQA 5HP7A 1YJWF 3CPWF 3WJQA 2GVIA 4I55A 5JVDB 1W55A 2V9YA 2ZAUA 2BO1A 5CA0A 4I55B 1K9MH 2UYPA 3B6NA 3MCAB 2ZF8A 3CCLF 5CA0B 1R1MA 1OAPA 5HXZA 1W41A 2CSLA 5IYZA 3J80M 2DT4A 3N4ZA 4ZOLB 2K1SA 4G4WA 2VGMA 3D00A 4X1YB 4ZHVA 5IYZB 1W5BA 2RHHA 3VO8A 3CXCF 2QTPA 3JAMM 3JATA 3GTZA 3WPWA 1W581 3LYBA 4BW0B 4X3LA 3VIUA 3P0ZA 1YGYA 1W57A 3JATB 5LP6A 4WBNA 4X1KA 3J7AR 1VQOF 3CMAF 3F0EA 1RQ2A 2RHOA 4RQOA 1JY8A 5LYJA 5KX5A 3FPIA 3IMPA 4WBNB 3KJJA 3AGKA 3WJRA 3BYQA 5JCOA 4C81A 2AIZP 3TD5A 5KX5B 4BY9D 3CMEF 3V3TA 3NVIB 5MN6A 2VAMA 3IEQA 3IEWA 2H6LA 3PAFA 2HP0A 2L26A 1YJ9F 3QTYA 3FD5A 1YIJF 3OBWA 4BT3A 3HKBA 4I50A 3HWUA 1YITF 2HP0B 4HNAB 4M8IA 3TD4A 1IV4A 2HX0A 3RA5A 3HKBB 4G4ZA 3G71F 2VGNA 3IKEA 3P4EA 1VH8A 3VYSC 3VCZA 2ZVZA 4TZZA 1JD1A 3ZP7A 2FC3A 5EIBD 2CZWA 3S06A 3K14A 1Q81H 4G4YA 3CCRF 3WXMB 5J2TA 2HQSC 5MN4A 5AVMA 1RLUA 4O2AB 5J2TB 1Q82H 3KHNA 3CCMF 1QVFF 5EZYA 1K73H 5IJ9A 3CCQF 3CCEF 4C8IA 5DCVA 1JJ2F 3JAWA 3VOAA 5EZYB 3HKEA 3VTIC 4E6EA 5IJ9B 5JQGB 1UFYA 3CC2F 4O4JA 2H8CA 3JAWB 2G9IA 1M90H 3D01A 3HKEB 3D54A 3NK6A 1PXWA 1TVKA 3OONA 1KNKA 2HS4A 1FNKA 1QVGF 3PLAC 3JAKA 3OBYA 1TVKB 3QUWA 3N2KA 5EWRA 1W5AA 2NMUA 2DYYA 1XRGA 4C8GA 3E22A 5HWEA 3JAKB 3WGLA 3I3FA 3N2KB 3WGKA 1W2BF 4B46A 5G4UC 3HTNA 4ZK7A 3E22B 5LOVA 1VQ7F 2I6RA 2OHWA 4NQ3A 1YHQF 2OZBA 3MDOA 5KMGA 2ZVYA 5LOVB 1CLIA 3I7TA 1VQ9F 4U3JA 4IHJA 1GO0A 1Q7YH 1H7MA 3V7QA 3CB2A 3KE1A 4ZI7A 3ON1A 3HKDA 4RHAA 5GIPC 3ZO8A 4C8EA 3QHDA 1VQKF 1KC8H 4IHJB 3WGNA 1W59A 2BTQB 4XCQA 3EORA 4U39A 5EIBC 5GAPK 4C82A 4ZI7B 3HKDB 4F6RA 2BTOA 3KJKA 2OTJF 3LWQC 4O4LA 3WGJA 2R6R1
chains in the Genus database with same CATH topology
2EWCA 2CSLA 1FNJA 1UI9A 3ZP4A 1NQ3A 3K0TA 3KJJA 3I7TA 3QUWA 1QD9A 1PF5A 1ODEA 2CWJA 1QU9A 3VCZA 2DYYA 1XRGA 1COMA 2CHSA 1JD1A 3L7QA 3ZP7A 5HP7A 1XHOA 1QAHA 1UFYA 2UYNA 3I3FA 3GTZA 3ZO8A 1ONIA 1X25A 2UYKA 2OTMA 3ZOPA 4NWOB 3LYBA 2CHTA 3D01A 3MQWA 4ZK7A 3K12A 2B33A 2CVLA 2UYNB 3M4SA 2UYPA 1DBFA 3R0PA 3LMEA 3KJKA 3V4DA 2IG8A 5HP8A 3M1XA 2CW4A 1J7HA 2UYJA 1FNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  2CSL A;  1FNJ A;  1UI9 A;  3ZP4 A;  1NQ3 A;  3K0T A;  3KJJ A;  3I7T A;  3QUW A;  1QD9 A;  1PF5 A;  1ODE A;  2CWJ A;  1QU9 A;  3VCZ A;  2DYY A;  1XRG A;  1COM A;  2CHS A;  1JD1 A;  3L7Q A;  3ZP7 A;  5HP7 A;  1XHO A;  1QAH A;  1UFY A;  2UYN A;  3I3F A;  3GTZ A;  3ZO8 A;  1ONI A;  1X25 A;  2UYK A;  2OTM A;  3ZOP A;  4NWO B;  3LYB A;  2CHT A;  3D01 A;  3MQW A;  4ZK7 A;  3K12 A;  2B33 A;  2CVL A;  2UYN B;  3M4S A;  2UYP A;  1DBF A;  3R0P A;  3LME A;  3KJK A;  3V4D A;  2IG8 A;  5HP8 A;  3M1X A;  2CW4 A;  1J7H A;  2UYJ A;  1FNK A; 
#chains in the Genus database with same CATH topology
 3CD6 F;  1T0A A;  4F6R B;  5FNV A;  1FNJ A;  3HAX D;  5LP6 B;  3G4S F;  1SA0 A;  3JVH A;  1VK3 A;  1QD9 A;  3N4Y A;  4X1K B;  5MN5 A;  1QU9 A;  4O4L B;  2KTV A;  3L7Q A;  1SA0 B;  5LYJ B;  3C9U A;  1NMU B;  3S02 A;  4NWO B;  1JN1 A;  3KIZ A;  2HRY A;  1KD1 H;  2UZH A;  1IPA A;  4EB6 A;  3CYQ A;  3S0H A;  5G4V C;  3VI6 A;  1IV3 A;  3LME A;  2VAW A;  1VQ6 F;  4IIJ A;  4EB6 B;  1RQ7 A;  4YJ2 A;  2I6D A;  2VAP A;  4I4T A;  1CN7 A;  3CC7 F;  3U0O A;  3CC4 F;  3F6M A;  2HS0 A;  2Z1U A;  3RYI A;  4I50 B;  3P10 A;  4IIJ B;  4BT6 A;  4YJ2 B;  4I4T B;  5EAZ A;  4ZHY B;  3CCV F;  2UYN A;  3RYI B;  1OFU A;  5IJ0 A;  2QI2 A;  3RYH A;  3CG6 A;  2UYN B;  3M4S A;  2W8B C;  5IJ0 B;  1U3L A;  3RYH B;  3F0D A;  5HY4 A;  5HP8 A;  5B8F A;  2RHJ A;  1RA4 A;  4LCK A;  2EWC A;  4FFB A;  3SIV A;  1NQ3 A;  1U40 A;  1RLG A;  2YXZ A;  1ODE A;  2JNB A;  3CYP B;  4BVT A;  1H47 A;  5EYP A;  4FFB B;  2CHS A;  3VOB A;  5A2Q M;  4O4I A;  3LFO A;  5JH7 A;  3S0Y A;  4G4X A;  1GO1 A;  3IR9 A;  5HY1 A;  1JFF A;  2RHL A;  1Q86 H;  1M1K H;  3OW2 F;  1TUB A;  4G88 A;  3LWP C;  4O4J B;  2KTU A;  1JFF B;  2GZL A;  3CCU F;  3F0F A;  1UI9 A;  2LBW A;  2Z01 A;  3LWO C;  4ERH A;  1ZWZ A;  5GAN K;  1K8A H;  3C9R A;  2CWJ A;  4KWE A;  1VQ4 F;  2HRU A;  4EI8 A;  3HJW C;  1W5F A;  2Z1E A;  3S0W A;  1N8R H;  1Z5V A;  3FBA A;  3O85 A;  3HKC A;  5J2U A;  1FSZ A;  5LA6 A;  2KGW A;  1YQN A;  3ZOP A;  2ZOV A;  5FJ4 C;  1W3E X;  5C8Y A;  1FFX A;  3HKC B;  5GON A;  5J2U B;  5LA6 B;  4TV8 A;  1DBF A;  3R0P A;  4DXD A;  3NMU C;  3DDN A;  2VXY A;  2LBT A;  1FFX B;  2ZOD A;  5GON B;  4TV8 B;  1VQ8 F;  1X7P A;  2H8E A;  1XV2 A;  2R75 1;  4R40 B;  1IV1 A;  2WAL A;  2GLZ A;  5KMG B;  5LP6 C;  5HY2 A;  4X20 A;  3JAL A;  3G6E F;  1VHA A;  1COM A;  2AMT A;  2RB9 A;  1QAH A;  5ITZ A;  3S03 A;  1X25 A;  4BT4 A;  4U3J B;  4X20 B;  3JAL B;  3VMF B;  3DC2 A;  2KG4 A;  4X1I A;  5CA1 A;  5HXU A;  5JCO C;  2P6Y A;  5ITZ B;  2Z1F A;  1VQM F;  1H48 A;  4ZOL A;  4BVS A;  4BVQ A;  4X1Y A;  4X1I B;  2LBX A;  5CA1 B;  4LNU A;  3RA6 A;  4TUY A;  3M84 A;  4YJ3 A;  5EO3 A;  3IKF A;  1T0K B;  1CK2 A;  1PF5 A;  2PMP A;  3ELC A;  4TV9 A;  3CPQ A;  2Z1T A;  4LNU B;  4TUY B;  5EB1 B;  4YJ3 B;  5FNV B;  2LCA A;  2HP3 A;  3F0G A;  2UYK A;  1S72 F;  3RE3 A;  4TV9 B;  1KNJ A;  1VQP F;  3K12 A;  3FFM A;  3LDT A;  4X3M A;  2OTL F;  3E1Y A;  1VQN F;  2AIF A;  3N2G A;  4ZHW A;  3UT5 A;  3RYF A;  3LWV C;  4B62 A;  5GIN C;  1J7H A;  2HS3 A;  2UYJ A;  3NK7 A;  3JCM M;  3VYT C;  3NVK E;  1DT9 A;  4B5C A;  3N2G B;  5IT9 M;  3UT5 B;  3K0T A;  3RYF B;  4O2B A;  2QA4 F;  3MCQ A;  1SDS A;  4BVR A;  3LWR C;  3GHZ A;  3ESJ A;  4EI9 A;  1ONI A;  4O2B B;  3WPX A;  4HNA A;  2CHT A;  4PWT A;  5LXT A;  3MBM A;  2FGY A;  2B33 A;  1IV2 A;  3JAR A;  1W42 A;  3CCJ F;  5LXT B;  3SIU A;  2IAF A;  4ZHQ A;  3I55 F;  5EB0 A;  3JAR B;  3JAS A;  3TD3 A;  4DRX A;  1YI2 F;  1XBI A;  4ZHQ B;  3FD6 A;  3JAS B;  4B45 A;  1X7O A;  4DRX B;  4EI7 A;  4NUT A;  2OTM A;  1GZ0 A;  1U43 A;  3V7E A;  4O2A A;  3WGM A;  5CB4 A;  5EYP B;  1Z5W A;  3C8L A;  1GX1 A;  3GYQ A;  2QEX F;  4BT7 A;  2BTU A;  2CVL A;  5GIO C;  4O4I B;  5JH7 B;  3ERN A;  1Q8R A;  4O4H A;  3C9S A;  2IG8 A;  5CB4 B;  3VYU C;  1YJN F;  5JQG A;  4O4H B;  2Q1Y A;  5HY0 A;  1TUB B;  2PHN A;  2YYE A;  1VQ5 F;  1U3P A;  5BMV A;  1X52 A;  1XHO A;  3J81 M;  4BT5 A;  5FLX M;  1NJI H;  3RYC A;  1W5E A;  3E20 B;  2Q1X A;  2ALE A;  5BMV B;  3MQW A;  4C4W C;  2HVY D;  1W40 A;  2MQE A;  3RYC B;  3T80 A;  1E7K A;  3V4D A;  3I56 F;  3WJP A;  3CCS F;  3M1X A;  2CW4 A;  5C8Y B;  3C9T A;  1KQS F;  3ZP4 A;  1VQL F;  4G4V A;  2N48 A;  4BT2 A;  3K2X A;  5JVD A;  3Q8H A;  1SZQ A;  2F9Z C;  1VQV A;  2IQQ A;  5HP7 A;  1YJW F;  3CPW F;  3WJQ A;  2GVI A;  4I55 A;  5JVD B;  1W55 A;  2V9Y A;  2ZAU A;  2BO1 A;  5CA0 A;  4I55 B;  1K9M H;  2UYP A;  3B6N A;  3MCA B;  2ZF8 A;  3CCL F;  5CA0 B;  1R1M A;  1OAP A;  5HXZ A;  1W41 A;  2CSL A;  5IYZ A;  3J80 M;  2DT4 A;  3N4Z A;  4ZOL B;  2K1S A;  4G4W A;  2VGM A;  3D00 A;  4X1Y B;  4ZHV A;  5IYZ B;  1W5B A;  2RHH A;  3VO8 A;  3CXC F;  2QTP A;  3JAM M;  3JAT A;  3GTZ A;  3WPW A;  1W58 1;  3LYB A;  4BW0 B;  4X3L A;  3VIU A;  3P0Z A;  1YGY A;  1W57 A;  3JAT B;  5LP6 A;  4WBN A;  4X1K A;  3J7A R;  1VQO F;  3CMA F;  3F0E A;  1RQ2 A;  2RHO A;  4RQO A;  1JY8 A;  5LYJ A;  5KX5 A;  3FPI A;  3IMP A;  4WBN B;  3KJJ A;  3AGK A;  3WJR A;  3BYQ A;  5JCO A;  4C81 A;  2AIZ P;  3TD5 A;  5KX5 B;  4BY9 D;  3CME F;  3V3T A;  3NVI B;  5MN6 A;  2VAM A;  3IEQ A;  3IEW A;  2H6L A;  3PAF A;  2HP0 A;  2L26 A;  1YJ9 F;  3QTY A;  3FD5 A;  1YIJ F;  3OBW A;  4BT3 A;  3HKB A;  4I50 A;  3HWU A;  1YIT F;  2HP0 B;  4HNA B;  4M8I A;  3TD4 A;  1IV4 A;  2HX0 A;  3RA5 A;  3HKB B;  4G4Z A;  3G71 F;  2VGN A;  3IKE A;  3P4E A;  1VH8 A;  3VYS C;  3VCZ A;  2ZVZ A;  4TZZ A;  1JD1 A;  3ZP7 A;  2FC3 A;  5EIB D;  2CZW A;  3S06 A;  3K14 A;  1Q81 H;  4G4Y A;  3CCR F;  3WXM B;  5J2T A;  2HQS C;  5MN4 A;  5AVM A;  1RLU A;  4O2A B;  5J2T B;  1Q82 H;  3KHN A;  3CCM F;  1QVF F;  5EZY A;  1K73 H;  5IJ9 A;  3CCQ F;  3CCE F;  4C8I A;  5DCV A;  1JJ2 F;  3JAW A;  3VOA A;  5EZY B;  3HKE A;  3VTI C;  4E6E A;  5IJ9 B;  5JQG B;  1UFY A;  3CC2 F;  4O4J A;  2H8C A;  3JAW B;  2G9I A;  1M90 H;  3D01 A;  3HKE B;  3D54 A;  3NK6 A;  1PXW A;  1TVK A;  3OON A;  1KNK A;  2HS4 A;  1FNK A;  1QVG F;  3PLA C;  3JAK A;  3OBY A;  1TVK B;  3QUW A;  3N2K A;  5EWR A;  1W5A A;  2NMU A;  2DYY A;  1XRG A;  4C8G A;  3E22 A;  5HWE A;  3JAK B;  3WGL A;  3I3F A;  3N2K B;  3WGK A;  1W2B F;  4B46 A;  5G4U C;  3HTN A;  4ZK7 A;  3E22 B;  5LOV A;  1VQ7 F;  2I6R A;  2OHW A;  4NQ3 A;  1YHQ F;  2OZB A;  3MDO A;  5KMG A;  2ZVY A;  5LOV B;  1CLI A;  3I7T A;  1VQ9 F;  4U3J A;  4IHJ A;  1GO0 A;  1Q7Y H;  1H7M A;  3V7Q A;  3CB2 A;  3KE1 A;  4ZI7 A;  3ON1 A;  3HKD A;  4RHA A;  5GIP C;  3ZO8 A;  4C8E A;  3QHD A;  1VQK F;  1KC8 H;  4IHJ B;  3WGN A;  1W59 A;  2BTQ B;  4XCQ A;  3EOR A;  4U39 A;  5EIB C;  5GAP K;  4C82 A;  4ZI7 B;  3HKD B;  4F6R A;  2BTO A;  3KJK A;  2OTJ F;  3LWQ C;  4O4L A;  3WGJ A;  2R6R 1; 
#chains in the Genus database with same CATH homology
 2EWC A;  2CSL A;  1FNJ A;  1UI9 A;  3ZP4 A;  1NQ3 A;  3K0T A;  3KJJ A;  3I7T A;  3QUW A;  1QD9 A;  1PF5 A;  1ODE A;  2CWJ A;  1QU9 A;  3VCZ A;  2DYY A;  1XRG A;  1COM A;  2CHS A;  1JD1 A;  3L7Q A;  3ZP7 A;  5HP7 A;  1XHO A;  1QAH A;  1UFY A;  2UYN A;  3I3F A;  3GTZ A;  3ZO8 A;  1ONI A;  1X25 A;  2UYK A;  2OTM A;  3ZOP A;  4NWO B;  3LYB A;  2CHT A;  3D01 A;  3MQW A;  4ZK7 A;  3K12 A;  2B33 A;  2CVL A;  2UYN B;  3M4S A;  2UYP A;  1DBF A;  3R0P A;  3LME A;  3KJK A;  3V4D A;  2IG8 A;  5HP8 A;  3M1X A;  2CW4 A;  1J7H A;  2UYJ A;  1FNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...