2UYQA

Crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
297
structure length
274
Chain Sequence
VGTTAVMVAAARAAETDRPDALIRDPYAKLLVTNTGAGALWEAMDAEAAAMVEHMRSYQAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTGTTVYEIDQPKVLAYKSTTLAEHGVTPTADRREVPIDLRQDWPPALRSAGFDPSARTAWLAEGLLMYLPATAQDGLFTEIGGLSAVGSRIAVETSPLHGDEWREQMQLRFRRVSDALIYHDENRAVVADWLNRHGWRATAQSAPDEMRRVGRWGDGVPMADDKDAFAEFVTAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of M. Leprae Ml2640C Defines a Large Family of Putative S-Adenosylmethionine- Dependent Methyltransferases in Mycobacteria.
pubmed doi rcsb
source organism Mycobacterium leprae
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN ML2640
total genus 95
structure length 274
sequence length 297
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04072 LCM Leucine carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2uyqA00
1RI2A 3O7WA 3G2PA 3X0DA 1G38A 2AVNA 3GGDA 3MTEA 2YX1A 5BW5A 3LBYA 3DLIA 5EZSA 2AS0A 3PTAA 4Y30A 3BGDA 3G8AA 4GQBA 2QRVB 1RI1A 4LWOA 3SM3A 2AN3A 1I4WA 2ZIFA 3HM2A 5MHTA 3PX2A 5DM1A 3UJDA 5GWXA 4CXMA 4CWAA 5K0JA 3C3YA 4BLWA 3R6TA 2NXEA 4LWPA 3FYDA 1G60A 2B3TA 3R24A 3FRIA 2I9KA 1M0EA 2KW5A 2ZLBA 5DM0A 3M6VA 5FADA 4C08A 10MHA 2YUIA 4Z2YA 3V97A 1D2GA 3EVAA 3UA4A 3LDUA 2PVCA 4WXHA 1YZ3A 2P8JA 3G88A 3BXOA 3JWJA 3B3FA 2VZ9A 1XXLA 3OZRA 1AQJA 4QPNA 4RV9A 2NNWB 3NDIA 4CKCA 4GOND 1XCJA 3S68A 4DM3A 2YTZA 3C6KA 1X1DA 3EEYA 1RJEA 3G7UA 5EGSA 1RI5A 4HGZA 3MCZA 2PSSA 5LQRA 2NXCA 2IH5A 2G70A 3MHTA 2BR3A 1Z3CA 2H00A 2PXCA 5GOZA 2GB4A 3LKZA 1X1BA 5JR3A 5E9WA 3BWBA 3PS9A 4HSGA 4B17A 3R9XB 4KRGA 3LCVB 4OA5A 5LQAA 4CTJA 4IV8A 2G72A 3E23A 3A7DA 1VQ1A 4E33A 2AOWA 2NXJA 3A27A 4MHTA 2I7CA 3G2MA 3LDGA 2LD4A 3ORHA 3VYWA 1VP9A 3LKDA 1P91A 5D1HA 3OE4A 3LDFA 4LECA 2XBMA 3GRYA 4EMSA 5E1DA 2CL5A 5K0LA 4PNEA 3B5IA 3TKAA 1XTPA 1L1EA 2JHCA 3A4TA 1WY7A 1MHTA 3FUXA 3C0KA 3FUVA 4RVFA 4YMGA 4RTNA 4CTKA 2UYCA 3EPPA 4PYIA 2Z6QA 4CKBA 4FS8A 3KHKA 2PT6A 2UYQA 3GRUA 3AY0A 2I6GA 4JXJA 5DLYA 3DMGA 2E5WA 4GOMD 1XDUA 3OU7A 4OBXA 3P8ZA 3UBTA 2BM8A 3IYLW 2PXXA 2ESRA 4ISCA 3LX6A 3SSNA 4P7FA 2JH8A 2IBTA 1R18A 3ELWA 4MIKA 3E05A 4EKGA 1L3IA 3NVMB 2BR4A 1M6YA 2JJQA 3FPHA 1XVAA 4IV0A 5CUQA 4K6MA 2ZBRA 3HA3A 4PYQA 5DSXA 3DP7A 2EJUA 3DULA 4RSRA 3KKZA 4M7RA 1I9GA 1JG4A 1VP3A 2YQZA 4XCXA 5DT2A 1SUIA 2G71A 1YZHA 3AXSA 4R6WA 4M36A 5E2AA 4E70A 2Z6AA 4FSDA 3DMFA 4QQKA 3FPJA 3PFGA 4CKEA 5P8WA 1WS6A 4QDKA 2IH4A 3NJRA 4X63A 1KIAA 3FUTA 4E32A 1R00A 3KQPA 3NVKI 5EEHA 3C6MA 3DR5A 3NW9A 2BH2A 2QY6A 2FCAA 4BLVA 3B3GA 1O9GA 3I53A 4KDRA 2A14A 5HIMA 2ZVJA 3T0IA 5CIYA 2P7IA 1QAOA 5FWDA 5IKMA 3AJDA 7MHTA 1O9HA 4RYLA 3P9CA 3UJ9A 3HCFA 1QYRA 4RX1A 3MCTA 3FPGA 1ZQ9A 2BM9A 1PRYA 3GO4A 3OU2A 3B89A 3LSTA 2AOUA 1O54A 4QDJA 2FHPA 3GU3A 5DX0A 1ORHA 3DMHA 1AV6A 4RTJA 3RODA 1KYWA 2PX5A 4C4AA 4WVLA 5K01A 3NMUF 1KPGA 2ZBPA 1R8XA 3CJRA 3QOWA 2PT9A 4BP3A 4YUYA 5DXJA 5EMMA 3HVJA 3BWMA 1QAMA 3TOSA 2EJTA 5GP1A 3IV6A 4P7JA 1VL5A 4KIGA 1TW2A 2GS9A 4QTTB 2CKDA 2NXNA 1NV9A 5EMJA 5GINE 3CVOA 3JWIA 4HGYA 2ZCJA 4KIFA 3KR2A 4RVGA 3P2EA 4M38A 1SQGA 2YXLA 3KR1A 4HC4A 3TR6A 1NW5A 3IEIA 5LSAA 5FTWA 5F2NA 3FYCA 3HCDA 3P2KA 4FP9A 4HG2A 1JG1A 3HCCA 2HWKA 3RIEA 4DA4A 1RI4A 1XDZA 4RTRA 3ERCA 4RTPA 3SR4A 3P2IA 5HEKA 1SUSA 2G8NA 3U81A 3OU6A 2AVDA 5DWQA 2HNKA 1VIDA 4A6EA 5HIIA 1KYZA 4PIMA 3QOXA 4FSXA 5DRYA 2WA1A 2ZZKA 5CVVA 3R0QA 5E8RA 4DMGA 5FQOA 5ICFA 4BY9E 3UJ8A 5E1BA 3OFKA 3G2OA 3FRHA 4YV2A 4DZRA 3M6WA 3EVGA 2ADMA 3Q87B 5FA5A 3V8VA 3OZSA 2YXDA 2BR5A 4PIPA 1D2HA 2CMGA 5E9JA 4HTFB 5H02A 4OBWA 3P9KA 4YV0A 2ZZNA 2HV9A 2VDUE 3E8SA 4YUZA 3GIWA 1ORIA 4E31A 5GIOE 5DTMA 1QANA 1N7JA 1P1CA 2ONZA 3M6XA 2IDJA 2WA2A 3C3PA 5DSTA 3LPMA 5KS2A 2C7RA 1R6AA 3P9IA 5HIKA 5CVUA 1I1NA 2P7HA 2ZTHA 3TMAA 1Q0TA 1VE3A 3TQSA 2O06A 1QAQA 4PYNA 5DM2A 5DTRA 2AOXA 3ME5A 3P71T 4GBED 3EGVA 8MHTA 3KPYA 5CM2Z 5EKUA 3KQQA 1R8YA 4KDCA 3M4XA 3OCJA 3KPWA 3EVBA 3I58A 3GWZA 3O4FA 5EZQA 2DULA 5HILA 3GCZA 5U4XA 4EVIA 2HMYB 4P7GA 3GDHA 3K0BA 3BT7A 3PVCA 2VP3A 5KQRA 4C04A 3AXTA 1VPTA 3DXYA 1SVUA 3HA5A 1ZGJA 2QRVA 2PX2A 4MQ4A 2C7QA 4YUXA 4XUDA 1NW3A 4MTLA 9MHTA 1RJFA 1ZG3A 2XYVA 3ER9A 3EVCA 4MWZA 3HCEA 2YR0A 4C05A 4ER7A 1FP2A 3DXXA 2IBSA 2OO3A 3UJ7A 3NTVA 1INLA 4YMHA 2OXTA 3F4KA 4PYOA 2EG5A 3M33A 4U7PB 2PV0A 5K0CA 5FULA 4L7VA 3NDJA 3CBGA 4PINA 1UFKA 5CVEA 3ELDA 4PGHA 3HVIA 5HIJA 5EHIA 2P35A 5K03A 3FTFA 1Q0SA 1U2ZA 4XUEA 3BKXA 4PYKA 4FT2A 5K0FA 4X41A 1WXXA 2R3SA 4Y2HA 2CWWA 1YUBA 2ZW9A 3PFHA 3FTCA 4OA8A 3HNRA 4QPPA 1TPYA 2I62A 2JH9A 3GNLA 5BXYA 1ZHFA 1RJGA 5G02A 1KP9A 3DUWA 1NE2A 3GRZA 1AF7A 2ZIEA 3L8DA 3SSMA 1KR5A 2JHAA 3HVKA 3KU1A 3SXJA 5EEGA 3HP7A 3PT9A 2OBFA 3TKYA 3TM4A 2N47A 3FPFA 4HTFA 2ZZMA 2P3QA 2Y1WA 4POOA 1TW3A 4AZVA 5K05A 3I5UA 5CVJA 3PB3A 4C06A 3G2QA 1SQFA 3OFJA 3H2BA 1BHJA 3BKWA 3D2LA 3HCAA 3A7EA 3CJTA 3M6UA 3WSTA 2PX4A 5FQNA 2IIPA 5DXAA 3SX0A 2PKWA 1WXWA 5GIPE 1FBNA 3GRRA 4H0NA 4PCLA 2AOTB 4BP1A 4E2XA 5GM2A 4O29A 3UJCA 2ZBQA 1NW8A 3MQ2A 2ZULA 3KQVA 2IH2A 2NYUA 2P1DA 5EC8A 1KPIA 3REOA 3EVEA 3BUSA 4QVKA 2IGTA 2EFJA 2QYOA 1NV8A 3CGGA 3KPJA 5EHGA 2VS1A 3CC8A 1M6EX 3KQMA 4V0QA 3A25A 4ZTBA 2WK1A 3BWCA 3KR0A 2O07A 1R74A 4P58A 4C07A 3THRA 2C7PA 3OPNA 5LQCA 2K4MA 1VLMA 5E2BA 5DM4A 2FK7A 3GRVA 1EJ0A 4ER5A 5BW4A 4PYLA 5ICCA 1T43A 2FYTA 2ORED 1NW7A 4GF5A 4GOLD 2QM3A 3KQWA 4OQDA 3TFWA 3JWHA 5F2OA 4IKPA 4RTLA 2AOTA 1JQEA 2XYRA 3FUWA 5E1MA 5JUWA 2GA9A 2UYHA 3VSEA 1DL5A 2O0LA 1FP1D 1UIRA 4XUCA 1X1CA 5FHRA 1SKMA 1EJ6A 2O57A 3UJBA 2PJDA 2F8LA 4R8SA 3DTNA 5ICEA 5LQKA 2FK8A 3FUUA 3SGLA 3TRKA 4EK9A 1QZZA 5BP7A 3ID6C 1IXKA 1RJDA 1HNNA 2OKCA 2YVLA 3FTDA 5E8JA 4ER0A 2H1RA 3HVHA 2IDKA 1MJFA 4U7TB 4E2WA 1EIZA 3FZGA 5K0NA 2G1PA 2B78A 5EQJB 4V0RA 3UA3A 3GJYA 5CCBA 1KXZA 4GC5A 1OR8A 3UWPA 1UWVA 5CVDA 4ATNA 5FHQA 4C03A 3HTXA 4GC9A 4HH4A 4X60A 5C9ZA 3ELUA 5K8VA 4E30A 2OYRA 1JQ3A 2XYQA 5EMLA 2DPMA 3EGEA 5LQNA 1RI3A 2JG3A 1SG9A 3FPEA 5C0OE 4YUVA 4EKIA 4ER6A 3VC2A 5EOVA 1XCLA 3EVZA 4X1OA 4RTSA 3FTEA 1NKVA 2NP7A 1NBHA 4LG1A 1JR4A 5B1SA 4QQNA 2OY0A 1XJ5A 4KW7A 2HR1A 2PWYA 1FJXA 1XDSA 4FGZA 3O31A 3THSA 4PCAA 3RW9A 4F84A 3EEOA 5T67A 3PX3A 4F85A 3MB5A 1H1DA 1F38A 1JQDA 2PWPA 5EMKA 5KQSA 4OQEA 1AQIA 1NT2A 3QV2A 4DCMA 1BC5A 1JTEA 2B25A 2VDVE 2EX4A 2PX8A 3ELYA 3EVDA 3LL7A 4AZSA 2P3LA 2P3OA 2PLWA 2P41A 1YB2A 1G8SA 3BGVA 5HFJA 1X1AA 3KQSA 1L9KA 2HTEA 2Z6UA 5EVJA 2JHPA 3SSOA 4DCGA 5HZMA 2FPOA 4M37A 1P39A 5FCDA 3MTIA 1JSZA 1L3BA 4AX8A 3HCBA 5F2KA 3UFBA 3B7PA 1FPQA 3IHTA 3GXOA 3SMQA 1YFJA 5DRTA 1IY9A 1JG2A 1JG3A 4QTUB 2GLUA 1L3CA 3TM5A 4YUWA 3AWIA 5FWAA 5EPEA 5ERGB 1HMYA 3UJ6A 5LR6A 4RTMA 1NW6A 3G5LA 2AOVA 5T64A 4RTKA 4PONA 3HEMA 5KYGA 1DUSA 1X19A 3K6RA 3UZUA 1D2CA 2XVMA 2ONYA 2ZWAA 4RTOA 2B9EA 5DTQA 3KPVA 5EKXA 4IWNA 3T7TA 1P1BA 3ER8A 1YFLA 2NP6A 3KPUA 4GEKA 3TPZA 5K0GA 1DCTA 1EQAA 1KPHA 3R3HA 4DQ0A 5KVAA 1EAMA 3TLJA 2PBFA 1G6Q1 1KHHA 3MGGA 3EGIA 4RVDA 4RWZA 3P9NA 2ZIGA 2H11A 2UYOA 4G56A 4R05A 5FUBA 5IH3A 1BOOA 1NBIA 2XVAA 2OB1A 1PJZA 2O05A 4DKJA 3JWGA 3P97A 4OX9Y 2BZGA 2OPBA 5LQUA 4KWCA 3G5TA 1WZNA 2P40A 2YXEA 4R6XA 4RVHA 5LQJA 1VBFA 2IP2A 3E7PA 3NWEA 5D1NA 3HA7A 3G89A 5M5BA 1WG8A 3CCFA 4FR0A 4GUAA 5EIFA 5T6BA 4FZVA 3KR9A 4P7KA 5EIWA 4PYJA 2ERCA 5CD1A 4NECA 5DX8A 2QE6A 3EMDA 2R6ZA 2GH1A 4DF3A 3M70A 3UJAA 2IFTA 3BWYA 5DPMA 5EG5A 2CMHA 2ZFUA 3DOUA 3G8BA 1ZKDA 2AN4A 4QVGA 5K0EA 1B42A 4HRAA 5CCXA 1BKYA 2AR0A 3Q7EA 3OE5A 2AN5A 1Y8CA 1ZGAA 1V39A 2IPXA 3LGAA 3LHDA 5DX1A 3DH0A 2OB2A 4AZTA 4EQZA 3BGIA 1IM8A 3EMBA 1F3LA 2GAFA 4AUKA 3A26A 3LECA 3ANXA 4UOEA 1N2XA 2C7OA 4ER3A 3KQTA 1N7IA 4E2YA 4BLUA 3EVFA 4PGGA 2V7EA 2Q41A 3KQYA 2Y1XA 3CKKA 4PYMA 5K09A 1JTFA 3PLAE 3B3JA 3T7RA 5K0BA 4AZWA 4FT4A 3T7SA 3LBFA 3SVZA 3I9FA 2AOUB 5C1IA 5GM1A 3MERA 2GPYA 5E9QA 2FRXA 3NWBA 5ICGA 3KQOA 3CJQA 5E1OA 3VC1A 5FA8A 2ZSUA 4X61A 4RTQA 2PGXA 3I64A 2ZWVA 2V74B 2UZ4A 3LCCA 1G8AA 3LCUA 4E2ZA 2PXAA 1EG2A 1G55A 1JSXA 4GOOD 4PWYA 1YF3A 3OZTA 4F86A 4R8RA 2PY6A 3BZBA 2VDWA 2B2CA 2OZVA 3DLCA 3MAGA 4YV1A 3DXZA 2AZTA 5HOQA 4KVZA 4A6DA
chains in the Genus database with same CATH superfamily
3BMOA 1JEJA 2OHVA 5ULLA 4WXYB 5JO9A 4Y2SA 2NUTB 1VYVA 2R66A 1D0SA 4L15A 2Z2KA 4QSHA 3EWNA 3WL3A 1FSSA 4NZOA 5SV2A 1BKDR 1AHIA 4IUYA 1ZGZA 2JIZD 4LTNA 2C5EA 4LYEA 5HVNA 1FSZA 5HCNA 1JWLA 3DUFA 3DCYA 4JBXA 1JDSA 4C0BA 1DKOA 1C4KA 2NXEA 4R1PA 4DHWA 2N75A 1G60A 2OD7A 3MTAA 4KO2S 3STYA 3V55A 4DCSA 4R2HA 1SVNA 2OHIA 2R5WA 2D0DA 3R9XA 3DG9A 1DFIA 1EZ1A 5IAAA 2G36A 1GKKA 2AFHB 3W2GA 5DM0A 5KTMA 3MYYA 3FHCB 4EG4A 5DN6D 3TTVA 4FNAA 4KE6A 4IDFA 4WLVA 1UJ6A 1Z0JA 1V2HE 5IDQA 3B53X 5KB3A 3H7AA 1F2UB 1U6JA 1YI0A 4B43A 3JVVA 4BYMA 4CCAA 3QV1A 4BTLA 1U7DA 4D4IA 4F3TA 2J08A 3OY2A 4Q3OA 1LDBA 4EEXA 2HQBA 3BICA 4DM3A 1Z4MA 4L0QA 4REOA 4L1KA 1G2PA 3H8WA 4MV1A 1EM8B 4DJDC 4JQYA 7ABPA 2PXCA 5KTPA 3KSZO 2R751 3IA7A 1JALA 4G85A 4DT1A 1QDLB 5FEMA 4F5EA 1E1LA 1U2PA 2VHCA 3KHUA 4B7ZA 4ZCQA 2XEXA 3GT3A 1A04A 4MUKA 4MW7A 1K97A 4R0VA 3FUCA 4MYTA 3U3ZA 3OE4A 2JB9A 2VSNA 1PL0A 3BDAA 3MGKA 2I4NA 3ZGXA 1VCIA 2A1UA 4PNEA 1O0BA 1DTWB 2JAOA 5ICMA 1PSDA 2W6JA 2FOXA 4JP5A 4M88A 1JDPA 3WYEA 2A59A 3EPPA 4IF4A 2DETA 3DB1A 1DAKA 1I1HA 2CNBA 3H9BA 1D0IA 2QENA 2X2PA 2JFGA 1MB0A 3G85A 3K2QA 3GRUA 3PUIA 3SAJA 1Q5PA 5B1YA 4XCQA 1OY1A 1TM2A 3AR4A 3CKYA 5THXA 1PGNA 3IYLW 1UJMA 5GMOA 2R6HA 2H29A 3AEUB 3LLMA 3FOZA 5C5CA 3TX6A 5KMGA 1AS3A 3EVNA 1UWKA 2CMFA 2JJQA 4Q7MB 1BS1A 2F1RA 4GRAA 2Q6IA 4P6VF 3WLPA 4YCNA 3C7KA 3K9CA 2R6R1 3D7KA 4Y1FA 3F5MA 2XMBA 4KQ2A 3LX5A 2A4MA 2GPNA 3WI7A 3T3PB 2NTYC 3EFBA 3EGOA 1WXFA 2QNRA 3DR3A 1G21E 3I39X 4X8MA 1QH1B 1QE5A 1MW8X 2YMMA 4IFBA 1C7JA 2G9VA 2QZ4A 3H99A 1R00A 1TEXA 4MS3A 5TQ0A 3BIFA 1P7YA 1XXHB 4PBTA 2B4TO 2QRJA 2FCAA 1TCBA 1T2DA 3IPRA 2P27A 2UUOA 2WIAA 3BFKA 2CYBA 1E2EA 3U4MA 1QIGA 5KU1A 1XJQA 2XXAB 2V7XA 4ZCMA 3OI7A 1EGHA 1NURA 1LD3A 2WNHA 2X0DA 1F4PA 5FFNA 1YU6A 4X1YA 3GFOA 5CLFA 4B3HA 4KUEA 2GCEA 1YJCA 1FFEA 4ND5A 4DR3B 4ES6A 4JASB 1OLOA 1KEUA 3UXEA 3CKLA 2PX5A 4F6RB 2Y67A 4WVLA 1BWQA 3U16A 2PM8A 3QX8A 3OBBA 5LKAA 4S05A 1MH1A 1B4DA 4M98A 3DL7A 3ZYZA 2HHCA 4Q21A 3EWSA 1UKEA 1F5NA 2WHEA 3MNFA 3K4HA 1IEVA 1AMUA 4OFXA 1WL8A 1GADO 1AGXA 1Y7LA 3DNPA 4HAVA 4HNGA 4IXNA 4KKXB 4KPEC 1RU3A 3DAGA 3OZUA 4FFMA 1JIVA 2Y92A 1NU6A 4JUBA 5J4LA 4UTRA 5GINE 1OH5A 3CVOA 2FSUA 4AY4A 5KQGA 5LSAA 2AW5A 2IX9A 2B1IA 4U2FA 5KKAA 3EZ2A 4JLDA 2B8NA 1ZCZA 3GEHA 1W75A 4MR7A 3GLFB 4NU5A 3ORSA 1AS0A 3FZEA 4TTAA 2RAUA 5KTKA 4NJMB 3LCRA 2J3MA 3HB5X 3WLSA 1JLLB 1KYZA 2VHWA 3OESA 1XNGA 2ZR0A 5DRYA 3EJ6A 3K3PA 3PNYA 1ILEA 5TC4A 1CE8B 3VR5H 2IZ7A 1U11A 2X86A 3VOAA 1UEIA 4CL0A 2WM3A 3ZW8A 2O2EA 4QEDA 1EFRD 1U80A 1OFUA 1Y4ZA 3COVA 4QUJA 5DE3A 1EFDN 1RM5A 3D3NA 5J2UA 2PCJA 3Q87B 3QUTA 4N5IX 1CBUA 1CTQA 4MEJA 4ARIA 1XXHE 4Z4QA 3ZZUA 2ZE6A 1A4RA 3AJ8A 1T8UA 2JGJA 4HX9A 3SC2B 2VDUE 4JDPA 3DQZA 1QX3A 1W87A 4LZAA 4O5AA 4YUZA 1PT6A 1J90A 4JVLA 4KLRA 5KC8A 5LUAA 3L4KA 1A8QA 3HUDA 3V1YA 3IQHX 1I1NA 1U5AA 4HYEA 3A9SA 3GT7A 1L5VA 4MP3A 3SBEA 1ABEA 3RRXA 4D9NA 4UUBA 1TUIA 2Q5QA 5EIBD 2I87A 3Q12A 4HDNA 3T94A 3H8SA 4KK4A 4BKQA 8MHTA 4W4TA 4W9NC 3RYFB 5BV1A 3OT1A 4MCIA 5B2ZA 1YBHA 2QT9A 2XQKA 2FX2A 4J0JA 2UYGA 2Z8ZA 3FA2A 3O4FA 4RV4A 2DULA 4XCVA 4E46A 2IYFA 5HXAA 3F2IA 1U8XX 2W22A 3K16A 4RZXA 3ECAA 2WF9A 1CULC 2RHBA 5BR4A 3TTSA 3LXXA 5A62A 3KLOA 1R6BX 1VPTA 4Q6WA 4LV6A 1MAHA 4YGYA 4IRMA 3W3AD 1P5FA 4Q02A 3WK4A 2D2EA 2DQSA 3ICVA 2CXHA 2XRYA 1VLQA 4F9TA 4I9UA 3I45A 1FP2A 2YVKA 2BKUA 1O95C 3L7KA 3ONEA 1E1RD 2Q6KA 2V54A 4Z1MA 4YRJA 4PYOA 1XCGB 2ZRHA 4GKAA 4GPAA 3UAYA 2QLJA 4DCTA 1TKBA 4EJSA 5G4KB 3DM5A 4C2UA 2IY8A 2O1EA 1N8SA 1QHFA 2WICA 2HF8A 2QTZA 3UQYS 4COKA 2HT6A 5AXAA 3EEQA 4XM2A 5THQA 3GEIA 2YZMA 2ZRJA 2J5XA 4OHPA 1RHUA 1V8OA 3AKCA 4PTLA 4ITUA 1CEEA 2RHCA 2ATCA 4P4LA 3N6VA 3L07A 4A1OA 2G1UA 1F8GA 2OCKA 3K71B 3ETLA 4P3YA 4WK6A 4OQFA 1MB9A 1Y4UA 4CM9D 2NVUB 3VU9B 3GN2A 1ULBA 3VZCA 2HNAA 1Y4SA 2JDID 3GRZA 1RBYA 3LFHA 3LF2A 1SCJA 1XEWX 2JHAA 2CJXA 2FPIA 3I6ZA 4WJZA 4F38A 1WB5A 4O0MA 2E55A 3GL9A 4NV1A 1P0FA 2ZZMA 1YVPA 3I9NA 1DRUA 1H0HA 4OHFA 2Y05A 4PLYA 2FG6C 3AG6A 2GCNA 3RRFA 3VUEA 2VQFB 5CX1B 2O23A 5DIZA 3A14A 1AKQA 1L8QA 4JL5A 3ZDCA 3VV2A 1G291 2HMUA 1ACMA 4OUDB 3CF2A 2MSCB 4OQNA 1SXJE 2VHQA 3ZNPA 4PO8A 2O48X 3NGMA 3GNQA 4J3JA 4KPFC 1SWVA 1ZVVA 4TLCA 1NMXA 3IUYA 3L8GA 4O6VA 1P1JA 2PZBA 1XVUA 1E1KA 2VK2A 1NUHA 5EIBC 5CW1A 4JX9A 4MVJG 5DGXA 3HACA 4O29A 1UT5A 2B94A 2FWIA 1A1SA 1NW8A 3SMVA 5I4CA 2NYUA 3NETA 3GDFA 5EE3A 1IFXA 1T9AA 2EFJA 3B51X 3TRIA 4RS4A 4X66B 4L4SA 3KQMA 2YFHA 3PJFA 1DQZA 1PO7A 2H06A 3K0AA 3L7NA 1SURA 1CD5A 4QOEA 4FYWA 3WLAA 4P4TA 2JFWA 2N42A 3OJOA 5JYDA 1UOQA 3TD6A 1DJOA 2GBPA 1SBTA 1A9OA 1YC2A 3AGPA 3C5CA 3FF4A 3JASA 4OQDA 4RADA 5KVCA 1ACLA 1XWIA 3BOSA 4L8VA 2BDUA 1T9DA 4D3YA 2VA9A 4C6TA 4PN7A 1AD2A 4IFEA 4KPGA 3TLAA 1YDGA 1T36B 4ZK2A 3CNLA 1IN8A 4RD3A 3WGVA 4PFSA 5FTLA 3N59A 3B2EA 1GD1O 2ANBA 2JGEA 4MWSA 4QFBA 2X13A 4QYWA 4TXLA 2VHXA 2WKWA 1J70A 4CI9A 1UM9A 3QOFA 4I46A 3OZWA 1ZOOA 1KKUA 1RJDA 1U3VA 2WE8A 3HVHA 3LM8A 5ECDA 1G0OA 4C1NA 4UD6A 3K1TA 2NN3C 5JH7F 2LXNA 2COKA 2HIGA 3BB1A 4K3VA 3KKQA 3SF8B 5JD5A 1WB4A 2FV8A 1SKYE 4RA9A 3QVVA 2ZYGA 3NGLA 1J0AA 2INGX 1IMJA 1JIQA 2R60A 3MAJA 3OZIA 4GVPA 4IKOA 4G0WA 4MV6A 2QQFA 1F6BA 3E1KA 3V1LA 3CVWA 3SZUA 1NI5A 4MA4A 4YUVA 2W8BB 2HA4A 3H11A 3NYQA 2NP7A 5BSHA 1XTSA 1WPGA 4NYJR 3V7YA 4DLAA 5HP4A 1F2DA 3HN2A 1ZXXA 1UIMA 4HUQA 4LGVA 3T3GA 4BTEA 4M8LA 3ZS8A 1H0SA 3GJRA 2NO1A 4CDMA 3CT6A 3HO8A 1GVNB 4XLZA 1GUAA 3R09A 4QHSA 4F21A 5KQSA 2C07A 3V1KA 1J8DA 2JW5A 4JZYA 4K87A 2BD0A 2FZKA 2VDVE 4L9AA 3T3IA 5LBIA 4ZO8A 2MT9A 1SQ5A 4B7UA 2V6IA 4P92A 1JMYA 1L7QA 2GZAA 4M9RA 5I7EA 2F3RA 3WLIA 3R7LA 4GL4A 1J09A 1TMYA 3GUYA 5G40A 5LYJF 1BQEA 5FBRB 2EEZA 2HLDD 5F2KA 3RVQA 5AJXA 1PFKA 1YQEA 3L5OA 3COPA 5LLTA 2QM8A 4LJ9A 5JNUA 4TL9A 1NF3A 1F3OA 1P2FA 3NRJA 1Y7TA 4MVJM 4RD6A 4TYMA 5JVDA 5K99A 2DTDA 4O08A 1OBCA 1Y9AA 3PUVA 2VOJA 4CR6A 3LVBA 2FWBA 3GJ0A 1QX4A 2P91A 1O6BA 2FUEA 4FDLA 2CV2A 4CJXA 2ZJFA 4NAVA 4BMYA 1J0XO 4H1VA 1TUBB 5HUHA 3PFBA 5BV2P 4BNHA 1GA1A 2ZETA 3PA6A 3AIKA 3DE6X 1YAJA 1OUMA 4G63A 3A6JA 1Q11A 1T1RA 1XD8A 4ZAZA 4F0JA 1AKTA 1YZLA 2M6RA 3EOBI 1RKBA 3JWPA 1JA1A 4DILA 2WYIA 1YL7A 4O4IA 4BNNA 4TT3D 3R7NA 3OQIA 3TVDA 1P2DA 3BK1A 1GNQA 1XZIA 4B84A 4FGJA 3WX0A 1L5WA 3DZKA 2OKGA 1X77A 4QDUA 4ZC8A 2VDNB 1PD1A 4DR7B 4AMZA 1FXWF 1WDWB 2PGJA 5L45A 1JHVA 3FNRA 3N2LA 2JVIA 4PG8A 2OWEA 5JDCA 3SJAA 3PD7A 1ZMRA 4BX9A 3G5TA 4GX5A 1WZNA 5BNIA 2P40A 1JILA 4FYYA 4MH0R 1JEEA 2IP2A 1H5QA 1HM5A 1QF9A 3ZY4A 3GLRA 2NPFA 5KOJB 4XVCA 3ADBA 1ZXLA 3C3CA 1XZAA 5I9SA 3RS7A 2IVZA 1O0SA 4BNMA 5CD1A 5BMOA 2HMSA 3ZLJA 2XDQB 1U8AA 4FSHA 5DOZA 5JFTA 4YJ2A 3T1YB 4FILA 4JGIA 1D07A 4LF8B 2BBOA 1KQPA 2AN4A 2YKGA 4MWCA 3IAS1 1F8FA 1MHPA 1NRJB 2FPRA 3NH9A 1P1FA 4XQCA 3TBFA 2E4UA 4EB0A 1QOQB 4E09A 1E4EA 3DW3X 1GRQA 1GRNA 4UNSA 1Y1SA 2OBMA 2QM0A 3KZNA 2XY4A 2IS2A 2AQIA 4TV8A 4F6CA 1E5DA 1NVWQ 2GLXA 4P0TA 2HRZA 2XB2A 1FVFA 5JNWA 5JJKA 1V16B 1RM0A 4LNHA 3VTAA 3DZBA 1B0ZA 3RUDA 1ZQ1A 1XWWA 1B41A 1ZZGA 2VTKA 1TXGA 2J0UB 4OHYA 4D99A 1AKRA 1G5RA 2QGNA 4FB5A 1PDOA 5DVZA 5CT8A 5K2OA 4YAUA 4ZMRA 1I7NA 1QHNA 2IHUA 1LV7A 2AHRA 4HNAB 5GM1A 4Z7JA 4AMUA 4UQOA 3MK31 3O5AA 2CXTA 4HP8A 2MSNA 3D8UA 2BZ1A 2H9IA 3UC5A 4YJKA 2ZSUA 4JL8A 4NBUA 3UWDA 2FMKA 2WTBA 4QUEA 1E0DA 2X40A 1Q83A 4OUKX 4UHBA 2UZ4A 5G0WA 3LCUA 3RYCB 2ZG6A 3LBAA 3AVTA 5AJUA 4GOOD 3GZNA 3H8VA 5DCUA 1M2KA 1LFAA 3H9CA 1IXRC 1V26A 3GA0A 2B2CA 3GG2A 4W5WA 1A0OA 3TAXA 3SKXA 3ZNNA 1X8LA 1I3NA 1II0A 3HXPA 1K6MA 4NNOA 3TDKA 2CB0A 1A8UA 4A2WA 3OTWA 2QY9A 1SCKA 1WZIA 5DYIA 2SCUA 3GROA 5CA1A 1AU9A 5LQSA 5SICE 4C4XA 5ADVA 1C41A 1HPLA 1RI1A 2XH8A 1DLJA 1PKEA 1S2LA 3LBHA 1F5SA 1TIBA 1AQUA 3QVKA 2Y1DA 4UVIA 5J2TA 3F6SA 3QEAZ 1ZMBA 3OPYA 1KEWA 4RHCA 4EJSC 4GAEA 5ARDA 4UE6A 5F3RA 3CPSA 3EJWA 3MJ4A 2H4JA 4ENTA 3ASUA 1PNVA 4Q48A 3TGWA 2LTAA 1UJBA 3ANLA 1EI9A 4YWJA 1C80A 1URPA 2J6HA 2R6DA 1XX6A 3JZMA 1IN6A 1KO7A 1XV5A 5JOQA 3HCWA 4J2HA 3R8XA 4TX1A 3S2GA 2G83A 4UEWA 1TQ6A 3IQXA 3ZV4A 1L7OA 1TZKA 1U9JA 4M6WA 3ESAA 3NDIA 1G3RA 3S68A 1PK7A 2BLLA 1KYTA 3B52X 3I23A 1N2JA 1TT7A 5JS2A 1X1DA 2Q3CA 4OQLA 4J3NA 1GGNA 3W4KA 1X70A 5ER9A 5TIIA 2XJ9A 2RHOA 2HZ7A 1PVVA 1QYWA 2GB4A 1XG5A 4GBJA 4LX8A 4NONA 4R3WA 4RLQA 3FMVA 3ZH2A 2MINB 3DMDA 1L5MA 1C8LA 2W2TA 3D6FA 3GJ5A 3MS7A 3CN9A 3WK6A 3PKJA 2OK7A 4YT2A 4TMVA 5ARBA 5AOAA 4CTJA 1ITZA 4RZUA 1NNEA 4CCSA 2I1WA 3GAAA 1G5QA 3JYQA 4HNRA 1Z4QA 5FL7D 3A27A 3OPYB 4L5YA 2I7CA 3Q9LA 4EYKA 1XPUA 1BDMA 1M2NA 3CUKA 1S2DA 5FNVA 3UK1A 5A4IS 1GSHA 4CR8A 1PDVA 4NYIQ 2EX1A 1B8UA 5DTJA 4TKUB 3TTTA 3FCAA 1L1EA 2RARA 3D4NA 3IO3A 4BNVA 4EY4A 2VYQA 4V1CA 3WLMA 1ZK3A 1ZINA 3U26A 1Q22A 2NAPA 4HMQA 1X1SA 3TTYA 2O1WA 3I42A 4GOMD 1XDUA 1Y3CE 2DJ5A 1T9CA 4MUXA 1TE2A 1E4OA 2B8WA 5IWAB 2E4YA 1XYVA 4OJYA 4AJ2A 4EKEA 3E2PA 3UFXA 1DEAA 2IDZA 3WLLA 3ZWPA 4YVFA 2IBTA 1C4XA 1BA2A 1W93A 1E6MA 1RPTA 1VSBA 2ZBVA 3K0FB 1L3IA 1CUYA 3ZHBA 3VKUA 2ZBRA 3AG5A 4ZVNA 3LUFA 4HWGA 1M0SA 5K3FB 2YHBA 5TQVA 1BMFA 3IXQA 4DA8A 1Z8HA 1W96A 3P5SA 4P4SB 2QJFA 3C3WA 1V47A 1SUIA 3QTTA 3Q1LA 3U19A 2JIOA 1KDOA 4HVTA 1UBEA 4WK2B 4BKPA 4QQKA 2HW8A 1X2EA 3IILA 4UCQA 4CKEA 2G07A 5P8WA 1JHYA 3OFVA 4ZV4A 5TB5A 2IVFA 4GI5A 4BMVA 3FUTA 1KY3A 1WV1A 4NV3A 4PANA 4E5KA 1QDUA 3O82A 1GZSA 1Q6YA 3VOTA 1DQNA 2Q50A 2O9JA 3B3GA 4H59A 3QFHA 2ZVJA 1YB6A 4GW3A 5KTTA 4S24A 3CLTD 3PDIB 3BJMA 1U1FA 1X8XA 3MD9A 2DFTA 4DC9A 4EJMA 5IRCD 2OV8A 3QG5A 3BGWA 4Z99A 1E8MA 2Z1NA 2W42A 2TECE 2GHTA 3K7EA 3MA0A 1E5VA 3NHYA 4AF7A 1OI4A 2EF0A 4PLTA 4QDJA 3VHRA 3GU3A 2VTVA 1MC4A 3AETB 1G8PA 5DYTA 2CT8A 4LPSA 5FAXA 3HV0A 3TOXA 3TDMA 1UBOS 4Y2QA 5AT1A 2Z2XA 3SYTA 4R40A 5P21A 1KZGB 5A9SA 5KOIA 5K8UA 3FWPA 1JE1A 1LBEA 1LTQA 1PJTA 4N5DA 1NE7A 1QAMA 3ZHXA 4N8EA 4CUZA 4Z1MD 4UE3S 1OXUA 1Z39A 2ZB3A 2P6RA 3OKCA 5B5SA 2EDCA 1SOMA 4WZAB 1NN0A 4KQFA 2Q4EA 4JXXA 3HXKA 1XL1A 4HGYA 2ZRNA 3P2EA 1QUEA 3Q0TA 3TR6A 1Q12A 2QJOA 2PRYA 4D8TA 1P61B 4BKMA 2J33A 3EIQA 3HFGA 3D6JA 3NBUA 2QN3A 4XIGS 1JX6A 1FDUA 4PAOA 4K9KA 1RI4A 1S7CA 3H18A 4WA8A 4L28A 4TKVA 4M7WA 3T3MB 3DAOA 1LLCA 4KQGA 1VJRA 3J81k 1R6TA 3CF0A 3KOZA 1FFWA 5JY6A 4KKVA 1RQXA 5BMVA 1RS0A 1I51A 1FUYB 2YNMD 3Q8XB 2IIVA 1IDN1 1PTKA 1NQXA 5HPYB 4HZUA 4F7DA 3R0QA 2VCEA 5JNTA 1RC0A 1U8EA 3UAVA 4RQTA 3WY9A 1FSGA 2L2QA 3WRXC 4LOIA 5JQWA 2A35A 3F4BA 5ENDA 3STUA 1P9OA 4TVKA 1THTA 3PHLA 3IMFA 4MUYA 4DZRA 2X9VA 1ZITA 1GQQA 3V8VA 1Y3IA 2FN8A 4NBLA 3UMFA 5EIEA 1MB2A 2GZ3A 4MI9A 3ZV5A 4JJGA 3PQ2A 3D43A 4YASA 4FN5A 1M34E 1U28C 4MK4A 4W6ZA 5FV4A 4TWAA 1CVRA 5IZCC 3DFUA 5DTMA 1OJLA 4CVNA 1U02A 1N3BA 3LPMA 5T8KA 4Q7LA 4XRGA 5HIKA 3RTCA 4Z4FA 4UPVA 1JXQA 4MKIA 4Z0PA 1UDRA 1T2FA 3MYRA 1L5SA 1X9HA 2AE1A 3N2IA 2IOQA 2RSLA 3NV9A 5LWQA 2GPWA 5B57C 1Q44A 4G89A 4NICA 1FRVA 3KSBC 4I1SA 1NNUA 3D6TB 3KPWA 3ISJA 2DLDA 2NQ8A 2XMRA 5TARA 2QVZX 1P7WA 2YWFA 4CIBA 4HLCA 5KYUB 5MN5A 2X5NA 2G0TA 1A4UA 2JAQA 4QICA 5TPWA 3E5MA 2OXFA 3N8DA 5DV9A 3PD1A 3VPAA 3OCCA 1ULAA 1ZESA 3KVOA 2BF7A 2WTXA 3JD1A 3FKQA 4GG1A 4TYQA 5SY6A 4AKSA 4EFNA 4JITA 2HKIA 3QLTA 5HZGA 1NULA 2SECE 1DAIA 2VATA 3FSGD 3K5PA 4B6JA 1K7EB 4BJHB 4BIIA 1L4UA 4DBVO 4J76A 1CUVA 4KG7A 3DT6A 2FMTA 1INLA 4EUNA 3TQRA 3G59A 5FT9A 1O8CA 2J3LA 4BO6A 2BUCA 3D2AA 2NQTA 5JDIA 2AFIB 2FEAA 1XZCA 1DJNA 2IEAA 2AMVA 4I55F 4MUJA 1J1UA 1AKEA 1OYWA 3JD4A 5A3JA 3CLRD 1PL8A 2GCGA 1AK9A 1C29B 2ZI9A 4Q3AA 3CINA 4MYHA 4R8LA 2HMVA 2AJDA 1P8JA 3GDWA 3OECA 2NU7B 1UQUA 3W8NA 1DP4A 1UJCA 1IEWA 4QU9A 1UM9B 3O8BA 3WFJA 2AD5A 1H2FA 3EW9A 5HYVA 5LXTB 1PR4A 4ZT5A 1MD9A 4X41A 3Q5DA 1IB0A 4KYVA 1WUHS 4QPPA 3CLRC 1E0SA 3H2SA 2XCIA 3QEBZ 3R5SA 1DWPA 2GK6A 1JWAB 2J6CA 3CUVA 5CJJA 4AKIA 1KP9A 5IF3A 4ZGBA 2G82A 1FNSA 2XKKA 2PT7A 3QKIA 4MKHA 4GP9A 3IIMA 1PYOA 2Z83A 1EP3B 2ZUFA 1ZO8A 4L76A 1FZQA 1O08A 3U4IA 2HJWA 2WJIA 3CZCA 3D3JA 4JKIA 4MLCA 4MV5A 4OBBA 1AXEA 1SIBE 1QK4A 3F3KA 3HDHA 2CW5A 4MDYA 4TMYA 4XRRA 5AM0A 4ZANA 5CFMA 1ECGA 1QS0A 1EDDA 1RYFA 3TAUA 4ZRNA 3N6RA 3O94A 4IKEA 3PNPA 1KE2A 2HA7A 3L05A 4JZKA 5C7IO 3QXGA 4CM6A 4OY3A 1EFKA 3BKWA 3HM9A 4WASA 2P9FA 1YS4A 1Y3FE 1FS4A 3BFXA 3V1MA 2WRZA 1EDEA 1KC1A 5AVSA 4BVFA 2BEJA 2WSBA 4M76B 4OIFA 2PPLA 3V3KA 1IM5A 2PMEA 3VYTB 4HQFA 1XT6A 1E3WA 4QEZA 1L7MA 2DHDA 1BD4A 2J5BA 3E18A 2M32A 3R6GA 3RKUA 1L4YA 1MA0A 1RD4A 1V7PC 3IP7A 3L1HA 4HN4B 4J29A 4UXIA 1P2VA 4O2AF 3PGMA 4JMPA 1E1YA 2QM7A 3CWQA 3IODA 3QF4B 3DLBA 3BWCA 2OD2A 3O8LA 4WBXC 3H5IA 4MQ5A 4PHGA 1MO2A 1VGRA 1U94A 2ZUDA 4A2PA 2J07A 1WP4A 1ADBA 2GZSA 1QOZA 5E2BA 3GT4A 5JDCC 4JOBA 4KGZA 5BW4A 2WTUA 3DDWA 3HV2A 3LBIA 4GF5A 4RE6A 3SLGA 5CYGA 4E2YA 4TGLA 5BN3B 4GMDA 1O0CA 5D6OA 3BQNB 3HPRA 3FETA 4HQNA 4XGNA 1PZGA 5ETJA 5T57A 4W5RA 3P19A 4Y2YA 2GEDA 4L9RA 5FPQA 5A0VA 3KYJB 1Z6YA 3TMKA 1IIRA 1YQTA 4QA9A 1D0VA 4EB3A 2ZCVA 2WDZA 1P77A 3TIGA 3Q98A 1T3LA 2DF8A 2MU1A 2PJRA 1JSRA 4A73A 1SKMA 1EA5A 1QK3A 2YHIB 4UU8A 4DV5B 2BEUA 3GG9A 3BMNA 4Y6QA 2XBLA 3ZLBA 4KWEA 1CJVC 2A67A 2EARA 4D0NA 2C92A 4BNYA 3PWSA 2MR6A 4N54A 2P9CA 4B09A 3EH1A 3WP1B 3VJRA 4OLAA 2C2KA 2OE2A 4GVLA 4QSMA 4F2WA 4BGDA 2I2DA 4O4IF 4XAQA 4EMBA 2XRZA 3IKLA 1OAOA 3EFHA 4RPGA 4N47A 5CCBA 3DVLA 1LQUA 4GC5A 1S2IA 5FOWA 2XKJE 1W1IA 3LT0A 3S4YA 2HK6A 2ZJBA 3LUAA 1OYYA 4KYTA 4WZBA 4CCYA 3W6OA 5EMLA 1ZUD1 1M6NA 1NUQA 4Q7JB 3KWMA 1DAHA 4NU8X 4N7MA 3NM6B 5LA6A 4PAGA 3FMGA 5TV2A 1JR4A 3EAFA 4L3OA 1M76A 4HF7A 1GFZA 2Q62A 1P60A 1SO8A 2PANA 1LLDA 1SB9A 1G2IA 1V2GA 2XNKA 1GN8A 2PWPA 4WXMA 1A9RA 2BMDA 2AW3A 1OFUX 3PC6A 2UVDA 1WQ4A 1YUMA 2CCKA 1RKXA 1T1EA 4P82A 4C0AC 3HFRA 3PJDA 2FRDA 1TYBE 1B14A 5TT1A 4DCGA 1D4OA 3W2EA 1GAXA 4BQNA 4D9BA 1ZVQA 4B5LA 4R2JA 2CLEB 3L92A 1E8NA 1HUQA 3T15A 1A97A 2REXB 2KB0A 2Y4OA 3NTLA 2GZ1A 3AOGA 3A31A 1WSDA 1RRGA 3I4FA 4MVJF 4OH1A 2VK4A 4FTWA 1SULA 1QO0A 2D59A 4NDAA 4IG4A 5DRTA 2H7YA 2KBEA 3H97A 2CNWA 2ZIXB 3UKOA 3LT2A 2GLUA 4Y7DA 2A9QA 2CLOB 1YA8A 1B6RA 1NN1A 3AJAA 4I0WB 4L75A 1LDYA 3ZXYA 5CDHA 2HMAA 3RC7A 3T9FA 2P69A 1FTGA 3UH0A 1DDGA 1VYHA 1JQLB 1RIIA 1TF5A 2R8RA 3IPYA 3M3DA 3GJZA 3MUNA 1VXOA 1FFCA 2SKCA 2ZIZA 3OF5A 1P0CA 3VISA 1YSCA 1M2FA 2VTEA 1L8OA 3CB2A 4GD3Q 2ONYA 1WXDA 2Q28A 3A6EA 1PSWA 3DPSA 5F76A 2JC3A 1IY8A 4CMAA 4JI8B 3KYCB 4H1TA 1DWOA 4BNZA 5EKXA 3PNKA 3IEXA 1I3CA 4J03A 1KPHA 5LQDA 3NX4A 5CMLA 1KHHA 4Q39A 3H19A 2D4HA 3UHOA 4RD1A 1W73A 2VXOA 4TV9F 1QHSA 2IEYA 1PBNA 5GGYA 1ETUA 4HDCA 4RK4A 2V9ZA 2YQ4A 2JLYA 3HN7A 1BXGA 3D8SA 3KOUA 5MF6A 3LJKA 5AKYA 3SZLA 4EFLA 3O9VA 5GQSA 1B8VA 1P4AA 2AX4A 4BB9A 2QUJA 4TT3A 2PD4A 4YA6A 4FR0A 3BHMA 1SC9A 4GUAA 4A10A 4H31A 4FZVA 5G2OA 4XYLA 3PEUA 3A1SA 4JMLA 4B2YA 3MJHA 1CY8A 1NFFA 1Q0UA 2PCLA 1LNSA 3KIPA 4KR0A 4RHTA 3RYTC 5FWXB 1RACA 1QWSA 5CH8A 4ZIRB 4K03A 4K9NA 1U90A 1XZNA 2Y0DA 2W70A 4DIBA 1HA3A 3ZHYA 3ZNOA 1XRMA 4XQ9A 3JRXA 2AC7A 3WDLA 5EP1A 4PXSA 3LMKA 1P2TA 1NJ2A 1ZGAA 1RXIA 2AQKA 2HA2A 2WFLA 3DTVB 5DULA 5C8XA 1UFRA 3O8QB 5DX1A 1Q15A 3FIJA 4EEKA 1QYIA 5DEOA 2GAFA 2PLNA 4CIDA 4BHTA 4HJXA 3DJYA 3ORRA 4U5XA 1WTAA 1HV8A 3ANXA 4ZRDA 3RSSA 3R7BA 4KH1A 4K9LA 4CKYA 1YFKA 1XLUA 3CNQS 3FGOA 2A7XA 1ZJ5A 2FPIB 3E5HA 2JIRA 3L0PA 3LC1O 1PJQA 4EPXA 1Y0BA 2HLDA 2QG9A 1LPMA 5IZCA 4OQYA 2DFNA 3B6KA 3QKRB 4GR4A 5EZYA 5KWIA 4LF9B 4PVDA 3G1WA 3BG5A 3JAWB 1V8FA 4J4BA 4WOBA 5JZSA 4HO1X 2H17A 2JFZA 3ROQA 3LBFA 3NS7A 3WADA 4PCUA 3X1DA 4FC7A 3S5UA 4B5KA 1FEZA 1KAQA 3CNHA 4D0SA 3O2JA 3WLKX 1UFVA 1PEKE 4WACA 4IDPA 1N8NA 4KVFA 3D64A 3LCCA 3M6LA 2R5FA 5JSHA 3EXFA 2HSZA 3I8OA 1EG2A 3O4GA 3ZY6A 2HQRA 5AVZA 1TCCA 2ISCA 2LW7A 5MN6A 2QU8A 4EUSA 3ZKWB 3ADKA 1VMKA 4V02A 4BQSA 1P8AA 2AZTA 2VP6A 4LDZA 3T95A 1UMDA 1WXIA 1D7AA 4LDRA 5F5NA 5T5QA 3VC3A 2WSYB 3LK6A 1Y82A 4PSAA 4DG8A 2NSLA 1YXMA 3OZEA 3CUUA 5FPSA 1MHTA 2H3EA 4CT4B 3WL5A 4PPNA 4AS2A 4IEEA 4G5XA 4DY4A 3S7TA 3ZGVA 3J7AC 5CB0A 3RJMA 1X7GA 4H7JA 3PQ7A 2R0QC 2H9YA 1GPH1 2J3HA 3DMNA 2X8WA 4EY5A 1OXKB 1QFJA 3RYIA 3OMWA 2I9KA 4C0SA 4DM7A 5E38A 1EQUA 1KTVA 2H0AA 1NXTA 1BYIA 1G4UR 1PD0A 3AZPA 2JS7A 3F9CA 3GFTA 2RKBA 1IZZA 3QUCA 1D2GA 1RPNA 4JJ8A 4NDNE 3HK2A 4M1SA 2C98A 1MQAA 3BZWA 4RGYA 1U3GA 4CF6A 3OZRA 2F3QA 3S44A 2GEUA 1G20A 4K28A 5LN1A 4ARUA 1HDIA 5FNVB 4DR4B 1TUBA 1NKSA 3PPYA 1C7IA 1N1GA 2NZXA 3DHEA 1IZ8A 4NYMR 3EVTA 5LQRA 1R6DA 2H00A 4MUIA 2X8AA 5BSKA 2RONA 4G01B 4Y6GB 1NWCA 4N39A 3MC1A 4MOWA 4BQPA 5L3SB 5AXCA 3I5XA 1LI4A 3LA8A 2FMXA 5IVIA 2Q5IA 2QTCA 2BVNA 3NPAA 4XSVA 5FLYA 3I0ZA 1GZ6A 2XJ4A 3PZRA 4FHCA 4IH9A 4KQ9A 4PRZA 3TIIA 4QT4A 1OWMA 2QA5A 3VDRA 4QASA 3MWJA 2GKSA 3L6DA 2AFRA 1TI7A 3UW1A 4TOIA 2GJ9A 2IV3A 2CL5A 3GUVA 3KTAB 3TKAA 2BUBA 5KAMA 5GZ6A 1F14A 2NZJA 2XMQA 5EJ9A 3S2EA 1KYQA 4NZMA 1BTOA 4CT0A 4NK4A 5FRDA 3O47A 2Q21A 2CYAA 3OM8A 1PFVA 4LY0A 1DBVO 1Y3BE 3FOBA 5LP6B 3T5PA 3R40A 1SEVA 1S4QA 3GLHE 1P6QA 3BB3A 3T9BA 2FR0A 1KH2A 2PXXA 3ZBTA 1I6WA 2E6UX 4C7XA 1XB2A 4KJXA 3IGFA 4MVYA 3G2HA 1ZSVA 4WLOA 1U9CA 3KOYA 5CK5A 3TOZA 4ZEWA 3SD7A 1IQPA 2C9ZA 1N2EA 1QZTA 3O0DA 4IQ8A 4MJ7A 1B43A 2JZOA 3OEWA 5DGIA 2J48A 2O2DA 5A4KA 3DBHB 1KI7A 1VZ2A 1Z4PX 3FYUC 1IBMB 4LFAB 1ZGBA 5CPFA 3GN1A 4H08A 3RVLA 1GY8A 2WJPA 3U3DA 2QR5A 4JLVA 2C2ZA 4GUDA 3CLUD 3N2EA 4C89A 3NXSA 2WJVA 2FW6A 2QX7A 2DHCA 1PS9A 3GYGA 1E7QA 3O92A 2AMJA 3INRA 2OUKA 4OKSA 4RWEA 3WL8A 4PZUA 1GPYA 2FN7A 1LNQA 3EUWA 2VNAA 3LQ2A 4PZ0A 1YMUA 4F56A 3NEJA 3PDUA 4JR0A 1F48A 4NF2A 2B92A 1PW7A 3ZTWA 4WJLA 3BDIA 1CUCA 3WB1A 1OLSB 5LD2C 4UVDA 3T7EA 3HH8A 1VE7A 3FMOB 7MHTA 4K1LA 3UGQA 1NJ8A 2IP1A 3ABIA 4WBNB 4QM6A 1ADJA 1XAGA 4LK2A 3B89A 2B3DA 3BCUA 3JQ8A 3KZCA 4YH1A 1FFHA 1ORHA 3PNBA 4DLSA 4IH1A 2YY5A 4RKEA 3WV5A 3VZSA 1MA3A 1PFUA 4Q4LA 1RM3A 1CKEA 1Z2OX 4DCJA 1F0PA 2YHUA 5U1PA 4CDNA 5DI9A 4FDTA 5B1DA 1MC1A 1EFHA 1U9ZA 1VHJA 2GN4A 4N65A 2E4VA 5BSVA 4YUYA 3CJRA 2IEGA 1PTJA 2V3WA 5EMMA 3QVWA 1Q7EA 3SR3A 1MV5A 1ND5A 4JP2A 3QXSA 5ELLA 2QG6A 4EO7A 4Q7EA 2PKQP 2OZEA 2C42A 1NTOA 3QJYA 5T3UA 4ZZIA 3OZXA 2XA1A 1BNCA 2I54A 4LXHA 4HBGA 4FM9A 5JIBA 1USGA 4JB3A 2F4VB 1GNVA 4Q4AB 4EHDA 2OEPA 3GT0A 1ANKA 1C1DB 4L9SA 4BX0A 1ZLXA 2D3WA 1CV2A 1SK9A 3ERCA 4JJEA 4DJ5X 1VB5A 2J9RA 4RTRA 3AZOA 3KC2A 1TM7E 4OBEA 4AM8A 1E3DA 4QJBA 2WWIA 1VJGA 4TLMB 3EZYA 2OV4A 1FU8A 1SD5A 1MVNA 5G0TA 4EJ6A 3AM1A 3B85A 3W8FA 2ECQA 2W2VA 1B6TA 1AK2A 2RHGB 4JP8A 2IQIA 5CVVA 5A5EA 3O0TA 3DFKA 1FSPA 2J9YB 1NLMA 4EABA 1I6LA 1SELA 4EJFA 3KS9A 1LPSA 3LL4A 5FQOA 4YT5A 3ZWDA 1PQYA 5KHOC 1NF2A 3ZQJA 4WADA 4QPZA 1CFJA 1NC3A 3REQB 3TSAA 3U3RA 1NUTA 5MFZA 4XVUA 1BVHA 2BFFA 3G2OA 1Y9ZA 3HHPA 3M6WA 1FXWA 1TA9A 1ZJYA 1LVGA 3AI7A 3NZEA 4BC1A 3Q3JB 4O4IB 2WVAA 3UH1A 3KZ1E 3ZC3A 2WFZA 4YRZA 1AO0A 2IS1A 2CNLA 4O4JF 4OBWA 3P9KA 5AP9A 4EHLA 4QQNA 1Z0UA 2JI6A 2ONKA 3E8SA 1Y6QA 4UXJA 3LQFA 2FWNA 3A1UA 4U7HA 3QP9A 2UZ3A 2E48A 3LLCA 3AYZB 3PCRB 1CHDA 1TU0A 5CT4A 4ZDJA 2P7HA 5J4HA 1QP4A 4NCNA 3S55A 3UPDA 2O06A 3BIOA 4GYYA 1W5FA 1N3YA 2VYND 3ME5A 4DANA 2XB9A 3O4HA 2WEKA 3U3KA 5EHXA 3U7HB 2W0MA 1Q84A 1Z12A 3KQQA 5EKUA 4JUFA 1B0UA 1LPPA 1OIWA 2QX8A 1E6LA 3N8HA 5H3CA 2AR7A 5IJ9A 3A1EA 4HMPA 3ZBUA 3NPMA 1Y8QB 4ARSA 3CM0A 3K0BA 1LW7A 5KQRA 4D9JA 4ZN6A 4URXR 1I2CA 1QF6A 3ISTA 3IOMA 2I2BA 4BBZA 1SBIA 3HZZA 1EFTA 3IXLA 3KDSE 1L7NA 2IOFK 4GQIA 4PGAA 4YFYA 4Q9JA 5TX7A 4J1QA 2PRZA 1ZG3A 4AF8A 3P20A 1KOLA 4BVKA 3M81A 1FJHA 4A6XA 3IL2A 1KSHA 4F5WA 3LZ6A 2QLMA 4I4TB 4L8LA 3F4KA 1WOMA 1UMBB 3M33A 1H42A 2DR2A 3JQCA 1R3DA 5EEHA 1IK4A 2GPAA 3EC2A 4LYDA 4CEJB 4L7VA 2HRQA 3V1TC 5E0KB 1VCOA 4PINA 5IK2A 2GBIA 5CX4A 1Z6QA 2QMOA 2YWBA 3C1TA 4DRXB 3A3PA 4FNGA 1EAYA 4ZOQI 5IDYA 3E53A 1EFAA 1WVGA 4IZIA 4Y2UA 2C2MA 1NP7A 3IPAA 3VNQA 5E95A 2P9GA 3OQ6A 4F3NA 4L9WA 3RASA 1YCHA 3L0IB 4Y2HA 1G7RA 3ETHA 2VPQA 3BD8A 2ZRAA 2VWGA 4JIMA 5F7XA 5A5GA 1RJGA 3IAXA 1QQ5A 5FL7A 2C58A 2HA6A 2V6FA 1HDOA 3KYDA 2G28A 3L49A 2J3DA 3ONDA 4KQMA 1ZZEA 3TOVA 2HK9A 3SXJA 2CDBA 2QG4A 1AF4A 2FW1A 2YIDA 5CVCA 2OT3B 2BSQA 2P3QA 1S3GA 2D7JA 2VJNA 2Y1WA 4FK8A 2MYNA 4YP9A 3TN7A 1G2QA 1EFPB 1Q2UA 3O8QA 4NXMB 1RRMA 4M53A 4TV9B 3TZBA 1FX1A 1SQFA 2XOXA 5F5XA 4RJJA 2OCAA 2PS1A 5ADWA 2P2ZA 4LJ8A 5LXTF 4Z4HA 2IWHA 5FLXA 3WSWA 2HDHA 4P98A 4B80A 3CJTA 1E9VA 5FYDA 3VTZA 1U0NA 1PQ4A 4NOJA 3GVCA 1IZ9A 3UTCA 1G7TA 3QU7A 1FBNA 1QYCA 3MUEA 3TTUA 2B21A 2WQ7A 3K20A 3UJCA 4KRYA 4L8YA 2W6JD 4O8ZA 2O8EB 3V8RA 3G9QA 1SG6A 1W85A 5EC8A 4U7JA 4I3HA 1W44A 2PA3A 2XKBA 3JAKB 3W7BA 2VS1A 3I09A 3WB2A 2OV3A 3OKAA 4MW5A 1HDYA 6NULA 1EXMA 2I78A 2IU3A 4PQEA 3OPNA 4EG7A 2K4MA 1VLMA 3CBQA 2O5VA 4XJVA 1QGED 3KFVA 3SEFA 2UZ1A 4ER5A 1R12A 3NVAA 2VYVD 1NW7A 4GOLD 3RFXA 1V9SA 1Z2CA 1B1CA 2GGSA 2ENWA 4D4LA 4GM4A 1A76A 4TYNA 1T2UA 5JPIA 4RXUA 4YRCA 1EZ4A 4G23A 4ZEXA 4EP1A 5JSUA 2ZWPA 4FFRA 4HNHA 1CUHA 3AP2A 2POCA 3HEAA 5NLLA 1QRSA 2E1PA 3TZHA 3ZWNA 2UYHA 3G0DA 2XE4A 1FP1D 1A69A 1TZ2A 1UIRA 1UKZA 3GAZA 1G6OA 3HBJA 3ZWBA 2CLHB 2DERA 3NIFB 3A1TA 4RL6A 2N1MA 1NJ6A 4JJZA 1P7CA 4OFZA 3USCS 5F7JA 1DBSA 5BP7A 3SGLA 1N2ZA 1QZZA 1NQWA 1WXEA 1V8PA 4CMKA 1AT1A 2V7WA 2PZLA 2H1RA 3GJ8A 2HXGA 3QH4A 4MB6A 1JWBB 3IOBA 4L3WA 4GSLA 2YWEA 4NK5A 4PBRA 4PPFA 3AVYA 2CC2A 1BJTA 2B1QA 1F4LA 1AJEA 1P5JA 2O4UX 3QEOA 5BQPA 4JR2A 3H1EA 4QULA 3UA3A 1TFUA 3OAAD 4MIEA 5K5EA 4QECA 3BN3A 2DYKA 3UWPA 1I4LD 2O2SA 2CFRA 2JFQA 2QXUA 1T4DA 3GOHA 4NNPA 2PZEA 5JSQA 4JIGA 4LRYA 4M9SA 2BMVA 1KFKB 2QKYA 1JQ3A 5D3ZA 1SPBS 4URVR 3P9ZA 2QUBA 4H27A 4Q9HA 2P2CA 3E82A 1R4AA 3EXHB 2VNIA 3C5VA 4X7RA 2P5TB 3H4VA 1NKVA 4CRWB 3U17A 3PHJA 4UTPA 2FZWA 4OI2A 3PIRA 1IVSA 2WYVA 2NSYA 5JZ9A 4LYHA 1IAQA 1NMEA 2HLHA 1O57A 1TJYA 2Q1TA 4MR8B 3WIEA 5IT5A 2YY6A 5KNCD 1U6IA 4G25A 1UMBA 4EBFA 4DCMA 3LL7A 1KIFA 1JDNA 1T6BY 2F67A 3BXPA 2X3UA 1X42A 5A0FA 5HW0A 4TLLB 1RRFA 3HWRA 4B6EA 4B2IA 3IP5A 3DDUA 3BRSA 3IP8A 3Q3EA 5EGNA 2JCVA 5M34A 1NI4A 3S1LA 3N5KA 3JCZA 2HSDA 5JAQA 5C37A 2ZYWX 2QI9F 2OFOA 3HO1A 2ZAIA 3BERA 4M0KA 2VF7A 5DBEX 2DZDA 3H1PA 4DC0A 2D1TA 3I6IA 3A1WA 3IBCA 4QBGB 4D8XA 2H16A 3QVMA 2X4DA 1G3MA 4LW8A 4QTUB 3PITA 2Y1GA 3AP1A 3S27A 5EPEA 4G2TA 2X2EA 4CV0A 1JR3E 3FB4A 5IZ4A 3BIWA 3ADPA 4HH3C 1XA0A 5T64A 1MAUA 4JC8A 3AX6A 1J2EA 1G3IA 1NBMA 4O4LF 2PGLA 1V8DA 1PJ8A 1U1IA 3EYAA 3IPLA 4H4DA 3LO8A 3V1NA 2E89A 3VPFA 2EJWA 4K5QA 5F9FA 2O6LA 3AFGA 3KUXA 2B9EA 2O7NA 4LYFA 1QBGA 2AN9A 4Q03A 1KRHA 1T35A 1Z6TA 1K6XA 4MYCA 5DCLA 2X0JA 3WB9A 1X3SA 5BN3A 5I5EA 3ET5A 4M8KA 3RVKA 1FUUA 4YRAA 1ZHOA 4GPIB 2O7QA 4BUZA 5DOVA 1FTSA 2OHJA 1T26A 4OK3A 4HOYA 1NNSA 4EL5A 4RVDA 4RWZA 4K40A 3PRHA 1HQYE 2JKZA 2HQOA 2BBTA 1DHRA 2QL5A 2YIMA 2GILA 3FGZA 3LC2O 4B31A 2O05A 3TNLA 2JD0A 3V2IA 2XF8A 3NAMA 5LQUA 3ILSA 3OCXA 3MM4A 1K06A 3KCQA 3OPMA 4I4IA 3WK5A 3IS3A 2Y9PB 5D1NA 4F6LA 3GRFA 4WKBA 3OETA 1WG8A 4DLNA 3R3ZA 3LHFA 3Q4GA 2QAIA 5GADl 1D6MA 3DFZA 3D0OA 4RVOA 4RY9A 4TL6A 3FR8A 3HQ4O 3UJAA 1EUCA 4MDEA 4URUR 4QBTA 2HEIA 3O90A 1A9ZA 3UXYA 3VZRA 1PNTA 3NBAA 5IFLA 1WBBA 1XNJA 4QXMA 1C8BA 2AR0A 1EK1A 4Z7NB 3BSYA 4U2CA 4PC7A 4B7XA 4EKYA 1D2MA 3WMFA 1TMKA 1GV1A 4KITB 3VR5A 3KXDA 4JB8A 4TWZA 2ZCUA 5EJFA 1N2XA 2C7OA 1LDEA 2ON6A 1YI8A 2CHUA 1CF9A 2HOQA 1VG1A 3MUFA 1EQ2A 5CLQA 1P17A 3EVFA 1L7XA 4RF4A 3GA7A 1TTTA 2O8DA 3OQJA 1FW8A 3EGCA 4MVJI 1JPVA 4OI1A 1XELA 2CXXA 2WM2A 4GI1A 4TZ6A 3T7JA 4P4SA 4C3ZA 2P30A 4CMGA 1TM5E 1Q0HA 3VR6H 3A9UA 4MA0A 4N01A 3HJTA 3VH2A 5JQGA 5LXTA 1NPTO 5DHPA 1KRXA 1C5KA 2BFWA 2YJ5A 3KZVA 3ND8A 3O9ZA 4F1JA 5KNCH 3SQNA 2H8GA 1F9EA 2E82A 3I64A 3W1VA 1EB8A 3PQ6A 2JLBA 4E2ZA 4KACA 2X1VA 4IOJA 5AK4A 5LD2B 4RD0A 2A1TR 2QL9A 3JWEA 3DLAA 4R8RA 1HZJA 2HU8A 4RH3A 3EE6A 3OBIA 4OO3A 2CHFA 2XOKD 3IB6A 4JXKA 1M8FA 1MNAA 3EPLA 1NGSA 4KDFA 2PEYA 2ZJ1A 5BT9A 3BCRA 2HCBA 3EWAA 4CM5A 5BORA 4ARCA 2AVNA 2YJ6A 1ISIA 3B9RA 4Z2AA 2EKZA 2JGNA 1U2GA 4KSBA 1P1KA 2XUGA 3LYLA 3IMGA 4YK7A 3WHIA 3G8AA 1XZEA 1VI5A 2BHNA 2GRJA 3E7DA 3HN6A 2HDNB 3PX2A 3WWDA 5DI3B 3U3JA 1PJRA 2OGZA 4B0OA 1BXGB 5CNJA 5K0JA 3DV2A 1QMGA 1A4XA 2ZDGA 3ZXIA 4ZDIA 1KOFA 1QVAA 1QVRA 1EX1A 1EGMB 2AWNA 3UW3A 2CY0A 4IZ6A 1OV4A 3CF6R 3DLPX 2FXVA 3C3KA 4NBSA 5L3VA 2G3YA 4JOSA 2WAMA 2ODNA 2R7LA 1C3EA 4KR6A 5IH7A 2QQ0A 2I7TA 4E07A 1FCJA 1KEKA 3EVAA 1JKFA 1HL7A 2HSGA 3JQ9C 4HGQA 5EUCA 4EYOA 1WJGA 2OHFA 2P8JA 1QWOA 2PAAA 1IN5A 4RSGA 3FRJA 4AJPA 3PDJA 4B8ZA 4EY8A 1DEXA 4BFCA 3FWYA 3OVMA 1DVRA 2H63A 3LUCA 4G84A 3U13A 1AUXA 4UNQA 3M4NA 2WWXA 3CUSA 1XCJA 2I33A 3FBTA 2GSWA 3EEYA 2IY9A 3AUAA 3G7UA 3MS2A 4OGLA 4RS3A 3VPXA 3JALA 4BX2A 1W88A 4W9MC 4IUBS 5GOZA 1M2WA 4NU0A 2V6JA 1ZJ6A 3ZDYB 5TSDA 2DPLA 1GSIA 3MJCA 4JQSA 1H05A 2FOLA 4L8GA 4LV8B 3N86A 3OQNA 3L93A 2G72A 1LU9A 3E23A 1D3AA 4R1QA 2NXWA 3LC7O 6YASA 1WULS 1JVSA 3V2GA 4MP6A 4OM7A 1VP9A 1TVEA 3VVLA 4XPIB 5A6SA 1HNWB 3CU5A 3UIEA 1K3FA 4PG5A 2PMFA 4UUQA 2FE4A 4X7BA 2ATIA 4BP9A 1XTZA 1FFSA 5DM60 3T3OA 1YJAA 1E7SA 4BNGA 4R8KA 4BUJA 4CKBA 4EUEA 1H85A 3RIYA 3HBFA 4Y6PA 2VUIB 3F5DA 1WDTA 4YYEA 1I0ZA 3SOPA 1RAIA 1UPFA 1XLWA 2PKEA 4JT2A 4LGYA 3LX6A 2NT4A 2W98A 2AYYA 5EWJB 3VPDA 4E14A 2UAGA 5CA0B 2HN9A 3RYCA 3S2UA 3PR3A 3E4CA 4O4HB 1H4QA 3DUFB 3PWTA 2JKVA 1A9XB 3FPHA 4H3VA 4EGFA 3UC9A 3MT7A 1RHQA 2EJUA 4RSRA 3CLSD 2IXTA 1XQXA 3C6QA 1VP3A 2ZREA 3JPWA 4GHWA 4IS2A 2EFDB 3E9NA 4F4UA 4RORA 4UTNA 3AXSA 3VR3D 4Y2PA 2Z6AA 3AHGA 3HZOA 3ETEA 4CM7A 3UTDA 4X63A 1T5HX 3TLXA 5JEDA 1XZDA 2QL7A 1IJBA 2ODEA 4HYYA 1WABA 4JYCA 3FI0A 1J6UA 2W6NA 3BF8A 3EDMA 2ZE8A 1CUDA 3IVAA 5HIMA 3UWMA 5JMWA 4HWTA 1VJDA 3EGWA 1DOAA 1UXGA 1ABBA 1KEZA 3GD7A 3P2OA 1AUPA 2IHTA 5LBTA 3E9ZA 1M9NA 3T0FA 1UKYA 3WQQA 3MMZA 3BSSA 3I6YA 2BM9A 2YHIA 3SKVA 1WD7A 5DX0A 2FHPA 4ETMA 2QRQA 3AERB 4A27A 4RTJA 3FDIA 4L78A 5K01A 4PHFA 2REBA 2A6PA 5DF1A 4K7JA 2B99A 1BE0A 4AKGA 2AI2A 2ZBPA 3P9PA 4FBMA 3CH4B 1OZAA 3CR3C 3FVWA 1EX7A 1XTUA 1GV0A 3U4QA 2XUKA 221PA 2F43A 1UPCA 3U6KA 4WNCA 1DGQA 4C29A 3FOAA 4BASA 3CR8A 5A02A 3A0RB 3WXMA 3RIMA 2BOVA 4QGFA 1HTTA 1YVRA 2I99A 3EQ6A 3FDJA 2GN8A 1DJLA 4HB4A 1X7XB 4FP9A 4Y6RA 4LHZA 1R5NA 4E7PA 5GJCA 3MLBA 4BBAA 2FU5C 1RHMA 4R51A 4RTPA 4HLUC 2ZJ4A 4CKBB 5H81A 5BOVA 5BSRA 5SZKB 1NL3A 3ASVA 2P11A 3O74A 3LF1A 3TXAA 2V9CA 1CF4A 1C7ZA 1O95A 3M6FA 3ZGNA 1NR7A 1OBOA 2ZZKA 3N2YA 1GG5A 2UVPA 1Q16A 1W4BA 4O33A 4ROSA 1D7OA 1GQOA 4CMIA 2C3YA 1Z0SA 3QM1A 1B8OA 2FPXA 3PFKA 3TL6A 2YV1A 4BECA 4FCVA 5AKZA 3EB9A 5E1BA 2A88A 1GA6A 2OFXA 2VAXA 3AVOA 1ECPA 1CZHA 3B48A 4CDGA 4E21A 4JVSB 3UG7A 1L5GB 4XYBA 1MRNA 3KOMA 4M4SA 3DBVO 5BNWA 3B3QA 2J59A 3PSAA 5JRZA 1RWMA 4Q4HA 2RGRA 4ZO7A 2CJYA 1WBJB 3IELA 3L7DA 1Z0FA 3EZNA 5DNEA 5JHGB 2JCXA 3KYCA 4QYTA 3ZV6A 3EOAI 1Y81A 3W4JA 1ZHHA 3MEQA 2D54A 1L4HA 1SJ9A 3E9YA 3TMAA 1PE0A 4DG5A 3UVEA 5FD8A 4NS1A 4EG5A 5L3QB 4QE3A 1TRKA 3ETCA 2Z5FA 5CM2Z 2ZUEA 4OHZA 3L0DA 5FA6A 4MQFA 1E6CA 4D80A 1ZVJA 3ORQA 3V8MA 1N3LA 3AH8A 2GPSA 1ZEJA 4B3FX 4KSCA 3R75A 2FY8A 1K6IA 2LCIA 2Q7DA 4QKQA 4EDFA 5DLPA 1TMOA 1N3IA 3GGGA 5IU6A 2P9BA 3AXTA 3EIEA 4HL6A 2BFOA 2PX2A 3HXTA 1DAOA 3L40A 3M5DA 4YJGA 2BGIA 5HF5A 4A0QA 3BH0A 3EVCA 2WD8A 1ZAYA 2FSGA 3OZFA 3OCWA 1DOHA 2CFOA 2EG5A 3BWXA 5TF0A 3CH7A 2BGJA 4TWBA 1FNBA 1G18A 3WLJA 3VX4A 3MHPA 2CDCA 5DU2A 4QJ3A 2GO7A 1RHJA 2X7XA 1OTHA 3CX6A 3GZNB 1SU8A 2IYRA 4HYTA 5HDQA 5DYGA 3T5GA 1MV8A 5CVEA 3GLVA 5DHSA 4B47A 2UYYA 3HVUA 1QKIA 2AUNA 2QS9A 3C6YA 4ZI5A 2BMEA 4B4KA 1G8GA 4JNKA 1IOWA 4JR1A 5L7YA 4CMHA 4NESA 4K6FA 1A1VA 1DO8A 2IBMA 1T2AA 1E2IA 4MAMA 1R66A 3KALA 2IX3A 5FWNA 4OA8A 1K5HA 3CISA 3PC8A 3HNRA 1UBGA 1PT8A 3TLZA 1Z5VA 2L82A 1KEEB 1W52X 4R9RA 3V7FA 5IKOA 1G42A 2QUHA 1G8YA 3M2PA 2YRWA 3B5EA 1QO9A 5CLHA 2I4LA 4S1VA 5JCOC 2MYTA 1JU9A 2RGWA 1JZQA 1H2ZA 2AYZA 3TCXB 3T7DA 2A4KA 2JGIA 3HY6A 5IJWA 4AUEA 5KUTA 5FPTA 4EHKA 2BF4A 3AUTA 4POOA 1BXZA 2QD4A 1TEZA 2C2HA 4B32A 5KWSA 3U44B 1KEVA 4LF5B 5F4BA 3H87A 1WNTA 1AN0A 1FVOA 3KB2A 1OHHD 5CVJA 3ZGLA 4JXZA 5JY1A 4LXTA 5UKDA 1T8RA 1YB5A 3G2QA 4ZOLB 3D81A 4JI2B 1VC2A 3OFJA 2DHEA 1LJUA 4EDHA 4HHEA 1FBTA 3L1IA 4DMLA 1ISGA 3NFRA 2EVWX 4N3BA 3ZD8A 4R9SA 2WG2A 4FQ7A 1T9KA 4PS0A 3M1AA 2P2DA 4HZIA 4KPUB 1O3YA 3S8YA 1AG9A 2J46A 4H6WA 1WCIB 4FFBB 2ZULA 1JHMA 2YMQA 3EXIA 3IRVA 1U5BA 5AXDA 1AKUA 5JSZB 3Q2IA 1OBFO 3DC7A 4KXVA 4NAHA 5BYKA 1PR5A 4RZSA 4ZTBA 2QD2A 2I8LA 1LFDB 5EXXA 1YZYA 2OZPA 1CP3A 3CIOA 3NM5A 4IEFB 4W7HA 1E8DA 2RE8A 2G0AA 4ALLA 2XDAA 2FSIA 3VHQA 3OQIB 4MYRA 4GI3A 3WK8A 2UZ0A 3I1YA 2PSHA 3EXHC 3H6GA 2VK8A 2X4LA 5EFOA 2F3TA 1XZQA 4RDCA 4TTSA 2GT1A 4AUMA 1RLTA 3I9V6 2YWJA 4GWLA 1WP9A 4OOEA 3VAZA 5KOJA 5EXTA 2E2WA 3FJOA 4IHJB 1JKJA 4NPCA 5FI3A 4AJ9A 4ZEMA 5BSFA 5JUWA 1EXNA 1M2OA 2H2GA 3EY9A 2EX0A 3PT5A 4MS4A 2DT8A 2WYOA 3WFZA 3OLQA 4ARZA 1K8RA 3GHYA 5K6TA 4OLJA 4XUCA 5AIAA 1X1CA 3E70C 3N2GB 5CIQA 3NHUA 3D3WB 2XRMA 5A5FA 5ALVA 2PJDA 2QP9X 1BWPA 1AM4D 1ZN8A 2W9XA 4FBLA 4GXQA 4GR9A 2QX9A 2YV5A 5CB8A 3IO5A 5E8JA 4W5HA 2IRWA 2WPNA 4Q24A 3BXFA 3M49A 3E58A 4B83A 4HDRA 3ZZ0A 3FZGA 1ONNA 1RDFA 2AI1A 3I3OA 5K0NA 2ZUBA 3ETGA 3TOCA 4D46A 1MIOA 3THOA 1XCPA 4I4TA 1BU8A 4ZYUA 3K09A 5HTKA 3ROEA 3URKA 3HTXA 3MG9A 4H7HA 4ZI7B 5J2UF 3FVQA 2FUNB 2HDWA 4GT1A 4HEJA 5DFAA 3ZI0A 4QBFA 2EU8A 2XYQA 4BO7A 5TPZD 5CPBA 3WA6A 4ER6A 4LWZA 1ESNA 2HA3A 4IDQA 1DADA 3IVGA 4N3CA 1XJ5A 2VBCA 2VJAA 4ID3A 3QFTA 4RIFA 4JLSA 4L50A 1Z18A 4KQ1A 3UGJA 4DIDA 4LSMA 3ZQ4A 2W83A 2B20A 1Z88A 3WIBA 1NT2A 4TM8A 3SPXA 3CE6A 5DTIA 3SFVA 4BLSA 3A0UA 1ECFA 3B8EA 3ELYA 3EISA 3ZZ1A 1W0CA 5CNKA 4YMVA 4MGIR 5D3QA 4YT8A 3HJRA 2AC4A 5FBZA 2Z6UA 4LHEA 3SF8A 5ENZA 4UOQA 4NU6A 1GZ3A 4RPHA 1J07A 3RUAA 1O5TA 2WVGA 3E61A 5AXBA 1RYZA 4OOFA 1NY6A 1BS9A 3OD1A 4PLPA 5HBRA 3RJ5A 2GPTA 4W99A 1FPQA 3PNOA 1SKQA 4ZEOA 4CKXA 5FPKA 5AKKA 1P9NA 1GXSA 1SUAA 2FAXA 2V4MA 1GLNA 4D9CA 3ITDA 2O8FB 4BO5A 2R68A 2BKAA 1XAIA 4IR7A 5LR6A 1E63A 4RTMA 3EARA 2X8JB 1DIAA 3IOYA 3SS8A 4B3XA 1YMQA 4BN0A 4BN5A 5KYGA 4INZA 5TMBA 3MOGA 3GOQA 4MRPA 3UZUA 4C20A 4QT0A 4CV1A 2R65A 3I72A 4G86A 5EUQB 3K4QA 3UCFA 5B58C 3TLGA 2I03A 5DTQA 3A36A 2C59A 3ONVA 4ZU6X 5FOSA 1US8A 3EOZA 1E64A 3P45A 4IWNA 4JOQA 4F92B 4G1UC 4M6WB 1L5LA 3BWVA 2YC4C 4YROA 2F1OA 1KDYA 2PG3A 4Q4HB 2C8KA 4F97A 4ENQA 5C8YA 5KSOA 2XYPA 3AESA 1XHLA 2DPYA 4L5AA 1BFKA 2XGMA 3KO8A 4PC6A 5FNZA 2QVLA 4YPFA 3DL2A 4UUPA 4KGXA 2QUIA 3PR2B 2NZ2A 2VWQA 2IYYA 2YWHA 2MWMA 1V1MB 2ODBA 1Z4JA 3HU1A 2P6MA 4KV9A 3KQLA 1PX0A 1ZUHA 1TECE 3IEVA 1NDHA 4RVHA 1N0IA 3FMIA 5J2TB 3KRTA 4PS1A 4C4RA 4ZHSA 3D0RA 3GQVA 5M5BA 3GFBA 2QTVB 1QIJA 5HA5A 4FOOA 2ERCA 2XBUA 2W6CX 3NV7A 4NECA 5DX8A 1TLTA 1W36D 3MT0A 2O59A 3M70A 2VQ3A 4P3XA 4JROA 1IUNA 1ZVMA 3KNZA 3NHWA 3KLPX 3PBKA 4F4HA 3HUTA 3MMXA 1MF7A 1QRAA 4HB2A 5K0EA 1GCIA 4RV5A 4YYZA 1VE5A 1ODTC 1WTCA 2NYRA 2OO5C 4FOSA 2F8TA 4HGOA 4NE7A 5EFZA 3S28A 2JCSA 4MEAA 3EBPA 4LE0A 1SBZA 4MR9B 4B6QA 1TEHA 4DVGA 4ZYTA 4JAVC 2BM0A 1ABFA 1PUIA 1LWNA 3A26A 1GZ5A 4TXHA 5K0TA 3FDXA 1TF2A 2C4VA 3B1YA 4CV2A 4ENVA 1VG8A 3GUCA 4FDAA 4F1KA 5BVHA 4Z0NA 4ZVKA 2DGDA 3OAAA 1JIJA 1T8YA 2P4UA 4AG5A 1UBMS 4MVJH 1QO0D 5BUSA 2Y1OA 1ZI8A 4HQOA 5LJIA 5ER6A 3C8UA 1YL5A 4O2AB 3O3OB 2ZKIA 1M1YE 1O96B 4EELA 1UANA 2QUAA 1BDIA 1V16A 3NWBA 4JUDX 5EAIA 1NY5A 5BQOA 4YCJA 3IV7A 2M6LA 1MJHA 3OP1A 5FA8A 1DFHA 5C3UA 1KDVA 3H5RA 5ES4B 2Q5JA 1MAAA 1YB1A 2ZR7A 4NYIR 1RWKA 1U3TA 4UFNA 3RSGA 1LBTA 3MMNA 2LDBA 3NHBA 3OZTA 4FMBB 4DMMA 2XGJA 4GL2A 2GETA 4J9VA 4GQAA 5JS8A 4PXYA 1NC1A 3ICOA 1HTWA 3HKDB 3L1JA 3WL7A 2GK7A 5I01A 4HS4A 1ES9A 3I92A 3NQ41 2C99A 4BMCA 2DH6A 3PUJA 3FLAA 2C9DA 3KJNA 3U1BA 1X87A 2P5SA 2IOYA 4UULA 2OCLA 3SM3A 1OXBB 2DQZA 3T1NA 3U7RA 2XQVA 4EPVA 3WMWA 3QTLA 3GBVA 5TQJA 3OSUA 5ISMA 1SAYA 1PGJA 2AK2A 4D1YA 1W0KD 2G7ZA 1ZD8A 2EJCA 3FYDA 3LWZA 4AWXA 2H1OA 2O8CB 4GMFA 5F12A 2B7CA 3NKFA 2CJFA 1ODCA 2O3RA 4PPYA 3T35A 1E1NA 2VP4A 2XCTB 1DBPA 1TO2E 3V97A 2WB2A 1BHQ1 1J49A 2AKYA 2OORC 3A9CA 3OX4A 3PUYA 1YOBA 3F5SA 4WXHA 3VKVA 1YZGA 1N8TA 4QGAA 4BQRA 4CM8B 4PLVA 4LZOA 5ALQA 1UXIA 4EY7A 1AQJA 5BNTA 4WCVA 2DFVA 4RV9A 4Y18A 4XJXA 3TZQA 1JF8A 2Z5GA 5LQMA 1SXJD 2P9TA 2PZKA 3ZHSA 1FYDA 4I55B 4GOJA 4C6SA 4IGEA 4BNDB 2BRUA 3UMSA 4I6JA 4UHJA 1KJZA 3E9RA 4W1SA 1GTVA 4R1MA 1IAVA 1X1BA 2XPCA 1NI3A 4KNWA 1TDJA 4LC0A 1XLVA 1NSYA 2HNBA 3QNWA 4MJXA 4OQZA 2ZJ2A 4RHFA 4B9EA 1E89A 1QKKA 1XJWA 3IPXA 4Q37A 4YAJA 1P4SA 5DW0A 2NXJA 3O73A 5F23A 3RDPA 3LDGA 3D0KA 1K6JA 4OHMA 1YL6A 1MFPA 3U31A 1TVKA 3HE3A 5AIBA 3I01M 1K7CA 3CX3A 1NWHA 4W82A 3RUIA 4D56A 1Z5UA 3ZU5A 4F4JA 1T5BA 1FFAA 3A4TA 4UFOA 5DHUA 3L8HA 4ML3A 4DSTA 2Z6QA 2EL9A 3NIBA 5L9AA 3NU1A 3BWEA 1GPJA 2QPTA 3F3YA 2RAPA 2NQ2C 5D5HA 3ZUGA 3RGWS 1VGQA 3TSCA 3OU7A 1GILA 1MBZA 3N76A 1S8NA 4Q4AA 1AMOA 1Y37A 2NV2B 1JBQA 3QVJA 4G0NA 1MDFA 1SQSA 2CHGA 3CMCO 4WECA 5JXIA 2P0YA 2P9ZA 4J49A 2CJWA 4MIKA 4LXYA 2WE7A 1C3XA 4IV0A 2VPPA 1Y8AA 5CUQA 2OAEA 1Q7RA 2W71A 1CUSA 1VECA 1AGPA 1IBRA 2YYYA 4PYQA 3TZEA 3EXHA 5BSMA 5KIAA 2N46A 2YDYA 3F78A 2F6RA 4HFJA 2N9UA 3BULA 3KXKA 3VKWA 4BX3A 3V4RA 3JQ7A 3DGFC 2ZAMA 2B4AA 1ZEMA 2YDXA 3IJ5A 1TM4E 2G17A 5D5PA 2HUNA 2ZBUA 4EKGA 3N0RA 3I8XA 3P96A 4UOEA 5BVHB 1ZA1A 2GASA 2KHZA 3IAM1 3IE1A 4O2LA 2QY6A 2TMYA 5AVVA 4D4JA 2AKEA 4B79A 3RS5A 3F6YA 3LS2A 1WZUA 2FKAA 3KAPA 2DRIA 3QBEA 1UXHA 4MI3A 3AJDA 4WCFB 3N9IA 4I3GA 2C83A 5FWDA 5GONB 5DBGA 5C46F 2X6QA 4A82A 5KSYA 4ZCIA 4A15A 5DZSA 4N0MA 3B1WA 1UOOA 5CH5A 4FONA 1ZQ9A 5IW8A 1VIVA 3C3XA 4W7IA 2XWQA 4BO2A 2I9PA 2ZUSA 1ULZA 4QQRA 5JASA 3K0EA 1SUDA 2C29D 4Q3KA 4DLPA 1REQB 3SN6A 1IDOA 3W0LB 5LMCA 2J0UA 4LQ4A 2G1AA 2OLEA 1YKGA 1VCMA 3HVJA 2AJBA 2DUWA 3W2TA 1GFWA 4FGWA 2BSAA 3TOSA 3JV7A 3OM0A 4DA4A 3NHJA 1NHGA 3IV6A 3K96A 4TV8B 1QM5A