2UZ1A

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords BENZALDEHYDE LYASE
publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 187
structure length 554
sequence length 554
chains with identical sequence D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1A02
4BVFA 2EZTA 1TKCA 3ZHUA 3DVAA 1V16A 3AHGA 3GLRA 1V5EA 3HWWA 1EFPA 4RJKA 3OE1A 3UK1A 5BWOA 1PI3A 5MF6A 1T9AA 1OLSA 3GLTA 4JT8A 2R8PA 1O97D 4GG1A 2IHTA 2BFDA 1O96B 3FZNA 3D7KA 2BFFB 3EXEA 5EJ6A 2H2DA 1UPBA 1AY0A 4GM1A 2VBFA 3CLTD 4WBXC 1V1MA 1UM9A 5AHKA 1Q17A 1YTLA 1Q1AA 5DGDA 5IMSA 4L2IA 3OOYA 5DGTA 1GPUA 5EJ8A 1QS0B 3LQ4A 1UMBA 2WVGA 5HJEA 3EXIA 1TKAA 1OLXB 2BFCB 2BP7B 5DEIA 3ZG6A 2OD9A 2BEVB 3EY9A 2G28A 4UU7A 1JSCA 2C3MA 2H59A 2H2HA 4KXUA 1M2NA 1V1RB 3M34A 1NI4A 4K9MA 1V5GA 1QGDA 4D5GA 1X80A 2R8OA 4RMIA 4MPPA 2JIBA 3EXG1 3F6EX 2JI6A 4JD5A 3EXFB 1DTWB 2UZ1B 1W88A 1ICIA 1BFDA 2NYRA 4UTNA 1ITZA 4Y6QA 2Q29A 4MZXA 1PNQA 2VK1A 2PANA 2OORC 1YC2A 3DV0B 1PVDA 4TWJA 4K9LA 2OZLB 2BFBA 1HZZC 5FEMA 3EXHA 5I5GA 1X7YA 4IAOA 2JLCA 4UUAA 2B4YA 4D5EA 4UTZA 4K9PA 2OD2A 1M2KA 3K35A 1IK6A 1ZPDA 1YNOA 2C3YA 3RIGA 1X7ZB 3JR3A 3PKJA 4GM4A 4JUAA 4UUBA 5I5EA 3KOMA 2EZUA 2BEUB 1SZCA 1OZHA 3CLSD 4BVBA 1T9DA 2BFEB 1SZDA 3RIMA 1EFVA 3PDHA 3ZGOA 1WCIB 5EXEA 5K6RA 2XTAA 1OLXA 2BP7A 5EJ5A 3F6BX 2BEWB 1U28C 1XLTC 4C7VA 2J9FA 1W85A 3D4BA 1NGSA 1POWA 3AHEA 4V1CA 1U2DC 2C3PA 4K9OA 4KXQA 4XEUA 3M6LA 3UPTA 2UZAA 4R8MA 1X7WB 1DTWA 2UZ1A 2OD7A 4C7BA 4RJJA 4F56A 3DV0A 1NM5C 4J16C 4K9KA 2W93A 5HGXA 4BN4A 2Q28A 2JGDB 3IAEA 2AG1A 2AG0A 4GPEA 3L84A 2H4JA 4FVTA 2FWNA 1N0HA 5EXDA 4UTRA 4IG9A 5MFPA 2VK4A 5EJAA 1M2HA 1M2GA 1U5BB 1X7ZA 3M7IA 3AHCA 4JUDX 2C42A 4F4UA 1V16B 2FSVC 4TWIA 1UMCA 4UTVA 5FYQA 4X3PA 1YC5A 2A1UA 3ZHTA 2H2IA 2BEUA 4QELA 3DUFA 1QPBA 2QTAA 3IAFA 1UMDB 4UTXA 1OLUB 4JSRA 5EJ7A 1Q14A 4GP9A 3AI7A 2PGNA 1L8AA 5I51A 1X7XB 2WVAA 5MGNA 4FEEA 4KXVA 3LQ2A 1UM9B 2EZ9A 2XT6A 1M2JA 4RMGA 2YICA 1UMBB 4BN5A 2PGOA 2O1XA 3FLMA 3MOSA 2C3UA 1YD7A 1S7GA 2X7JA 4KXYA 4KXXA 4UU8A 5K6TA 5C4IA 2BFFA 2Q5OA 1J8FA 1V5FA 1UPAA 1X80B 2EZ8A 5ERXA 1QS0A 5K3SA 2H2FA 1PT9A 4Q9DA 4BVEA 1W88B 2BFCA 4KGDA 2BEVA 5EJMA 4COKA 2PDAA 1V1RA 3CLUD 4MPJA 2QTCA 1Y9DA 2BFBB 4BUZA 1PTJC 4ZZIA 4Y6OA 4FEGA 2FN3A 3AHHA 4RMJA 2JI8A 2HJHA 4RMHA 5MFZA 3EXHB 1X7YB 2G67A 2JLAA 1OZGA 3EXFA 3CF4G 2Q5JA 1U2GC 4JU8A 2VJYA 2Q5LA 2XT9A 1YI1A 2A1TR 1TKBA 5EJ4A 4BV2A 4MQ5A 3AHIA 3AHFA 4JU9A 5HHTA 3E9YA 1S5PA 2BRUC 1POXA 1UMDA 1V11B 1OLUA 2QQFA 2OZLA 4FZ3A 3ZHQA 2C3OA 2NXWA 1DJLA 1E3TA 1PYDA 4JUBA 4K9QA 2QQGA 1X7XA 5BWLA 2IHVA 4QPZA 2JI9A 2EZ4A 4JT9A 2O1SA 2OO5C 2DJIA 1KEKA 3EXHC 3ZHRA 4GM0A 4RJIA 4V1CI 3CLRD 3DVAB 2J9FB 1W85B 4X3OA 4I5IA 4V1CB 4MPRA 4J1TC 1YHZA 2YIDA 3ZGVA 1UPCA 3JWPA 5D7NA 2BFEA 4C78A 4BV3A 1RP7A 1YHYA 2VBGA 1PNOA 1OVMA 3PKIA 1OLSB 2FR8C 3RIYA 1WCIA 3ZHVA 2BFDB 2G25A 4C7XA 2WVHA 3EXEB 4BVHA 3GLUA 2Q27A 5BWNA 2BEWA 3LPLA 4IF6A 4ZP1A 1V1MB 2V3WA 3LQ1A 1R9JA 5I4IA 1YI0A 3HYLA 2H4HA 4L3OA 1YBHA 4JUFA 3EXG2 3M49A 4HDAA 2H2GA 2IHUA 3EXIB 2Q5QA 2C31A 5HYVA 4JUCA 3D81A 3AHJA 3EYAA 1T9CA 3U31A 1T9BA 2VK8A 4K9NA 3U3DA 1X7WA 4QQ8A 2IEAA 3AHDA 4Y6LA 2R5NA 4HD8A 1NI4B 1PO7A 3FSJX 5K2OA 5EJ9A 1Q6ZA 4G1CA 1V11A 2VBIA 2Y0PA 3GLSA 3ZHSA 1D4OA 5ESDA 2JGDA 4KPUA 5ERYA 1UMCB 2E6KA 3HWX1 1MA3A 4KXWA 1Z8NA 2FRDC 3DUFB 4O8ZA 4BVGA 1OZFA 2H4FA 1B0PA 3EA4A 1MCZA 1TRKA 1U5BA 1U31A 2JI7A
chains in the Genus database with same CATH superfamily
4UC0A 5LXTA 3PC8A 2OLEA 3ZLTA 5FI0B 3MT0A 5AVOA 2DBZA 4JI7B 1QDEA 3NPAA 3A37A 3WMEA 1PT5A 2YUIA 5HOEA 2FZ5A 1NBMA 2HYIC 4ODIA 1NY5A 4BO5A 4F5DA 1H9BA 2I5PO 1N5RA 4CKZA 2IRWA 5CU7A 5JLJA 2VHZA 2GFQA 2XZPA 3O1LA 4O4HB 2F9FA 2WU3A 2VP9A 3DEFA 4II3A 1SCUA 1XA4A 4MAMA 4LVOA 1M67A 1N3BA 2UXDB 1QP8A 3GRFA 4NNOA 3FVVA 7MDHA 3VMFA 4CKCB 2BSAA 3O3OB 1BMQA 1PGOA 4JT8A 3BXEA 4R7TA 1ESNA 1T0BA 2Z0MA 4ZAFA 4D8YA 2WY2D 4Z4GA 3PENA 4MWOA 3IVGA 1J8VA 2O8EB 2QUHA 3FNGA 3KWJA 5MGBA 4AT1A 1UJCA 4UAGA 1ZUD1 4WBXC 4CI0B 2H06A 3ZDCA 4YI3A 3OPYI 5ALGA 2IJGX 4EO9A 3H5OA 3A4TA 5IMSA 4YCSA 4RVDA 3M9WA 3RVQA 5DSXA 1K2VN 2GN1A 4YJKA 2A7QA 2EKQA 2Q1WA 3DVQX 2I1VB 2OM6A 1NN5A 4X84A 2EKLA 2JB9A 2XUDA 4YRIA 2G28A 2VTVA 3HBAA 1ZGJA 1H2XA 4KO8A 2DPMA 4O5OA 1YFKA 1C8VB 1E2UA 3AETB 3QTTA 1QKKA 1UK7A 2R47A 1S3GA 2R4QA 2X9LA 1P2VA 4GEGA 2Q6IA 4F93B 1N2JA 1VRVA 1GL6A 3G17A 3CNBA 3L8CA 4NICA 3EZYA 1DZIA 3ABRB 4DR2B 3KQTA 3DFUA 2PKRA 4RELA 4A2PA 1YS2X 4JBLA 1JWAB 3DDNA 3L6BA 2FZ4A 3G02A 3OJXA 4MKGA 3VO9A 3ZHXA 1BN6A 3EZ2A 4G67A 1FS4A 4GMFA 2BUCA 2JK1A 4M22A 3H7IA 3D3WB 5IN5A 1JDUA 1J5EB 4EF4A 5L3SA 2I91A 2W37A 2W6CX 2XRYA 4Q4AA 2HF2A 3QELA 4WY2A 3SFZA 5G1PA 1DIBA 2NADA 3ZK8A 3O2SB 2I6TA 4TV9F 4J3JA 4OGKA 4LRXA 4WBNA 3H9EO 4ZYTA 2AIRA 1CUVA 3GRAA 3JRWA 3CEAA 3QX8A 2I2DA 4WFIA 4D97A 3VU9A 1P18A 5F64A 3GPBA 2Q1SA 2X5JO 4IH4A 2JFOA 3WGGA 5D8DA 1RDFA 3IIEA 3GH1A 4QOGA 1YK0A 3GU3A 2O23A 4Y6PA 3ZWDA 2GD6A 1L7XA 2VH1A 2CUTA 3VSBA 1NAIA 1P81A 3QPBA 3TOSA 1U9YA 4TRNA 3V4VB 1N75A 2CLOB 3BRSA 3EXHA 3Q9UA 2BZ0A 3Q3HA 3R3ZA 1CY0A 4KSBA 5I5GA 4C89A 3HCCA 1LD3A 1LQTA 1KWKA 2Y67A 1KAEA 3TOXA 3FG9A 4HJXA 2PZEA 2Y2VA 2FPGA 3U56A 1Z7GA 1G0NA 2P2SA 3HJTA 5CNIA 3BMOB 2VT6A 1Z2PX 2C83A 3TEFA 1BMFA 1FXWF 3C14C 4AJ9A 1JXMA 4KMMA 1Z75A 2PLRA 3VSEA 4B6QA 5LQKA 5EWMB 1PFVA 4JVMA 2RJ3A 2HJVA 4YIKA 4J2TA 5ALFA 2Z2IA 3T3IA 4ZVSA 1BS1A 4KQMA 3SKXA 2AEJA 2REQA 3DPIA 1QQ7A 5K7SA 2OPBA 1K9VF 2G3YA 1CDZA 3CZ4A 1HYEA 2Q3JA 3ZR4B 4F85A 3GXOA 2X86A 1Z4QA 2J3QA 4XX1A 5G41A 3L49A 3OLQA 4AZ0A 2EZUA 4S04A 4R16A 1NBHA 1AGNA 2ANBA 1OZHA 2NZYA 3A11A 3P0HA 1XK7A 2P6PA 3CMMA 4L0DA 4LRUA 4Q6BA 4TQAA 5AD1A 1PG5A 1EA7A 4DYVA 5LP6C 1YDGA 3OZAA 3QKRA 2OTCA 1WIWA 4B0OA 2B9EA 1ULUA 5K6RA 4M7PA 3NALA 3K6JA 3WGJA 2F1IA 1CRLA 1T2VA 2Z1MA 3OP1A 4KDRA 4ZYLA 2FJ0A 1J2YA 1XZNA 3BGSA 4X8MA 1HKUA 1GD1O 2EKBA 3VPCA 2IP4A 5ELMA 4ZZ1A 4UCXA 2NZUG 3HMKA 2GEBA 3Q7EA 1DXHA 5FA6A 2BSQA 3OUUA 3EMDA 4HQOA 1FFYA 1XZMA 2IT1A 3KLBA 1E1LA 1NVDA 3EXAA 1UEXC 1GTZA 2WHXA 5KNDH 3DE0X 4IFEA 2G4CA 2PLNA 4HN4B 4R6WA 3DXYA 5FPHA 4EITA 4XM0A 1C1XB 2PRSA 2I6QA 4EUNA 4DDUA 2VXBA 4LKOA 2ZIXA 4V03A 4BEVA 1ZR4A 1J00A 3IIJA 3U39A 3KD3A 4AAYA 1UEJA 4IQ4A 3W34A 3QVUA 3V55A 3MJEA 1ULSA 2O4CA 3MBIA 3RTAA 3GBSA 1I94B 4E6PA 2CL0X 2RHOA 2F7SA 3CHYA 3W2FA 3A05A 5FTNA 1BH2A 3B8EA 4XYEA 4JFRA 5D3MB 1N2BA 1SVWA 1JA1A 4HWOA 5NLLA 4COOA 1KMCA 1P2BA 4P7FA 4PZLA 4Y1FA 3L3BA 4EOGA 4NYJQ 4UXHA 1EM8A 3AU9A 3UPUA 4RHTA 4IJ6A 4EG4A 3HRHA 4UCFA 4B3MB 1EAMA 2DUNA 5DBOA 2WV7A 2WJPA 5CT9A 5DRTA 2XZOA 1D6JA 4XUGB 1V45E 4ASUA 4BXOB 1LEHA 2FMTA 3PFBA 1NBME 2O2JA 4ZRMA 4N7MA 1JDPA 4ZVMA 1SG6A 2PLAA 3P1JA 3O4IA 4NP6A 4OB6A 4P35A 1J1UA 3UGQA 3ZZTA 2D62A 2FPIB 3AUUA 3K9CA 5FWXA 5T6MA 4B48A 4D96A 5IYZB 5KYGA 2LV8A 2VDRB 1GPMA 1F2TB 3GP5A 1ULHA 3THYA 1T6ZA 4JIMA 3KSDO 5CYPA 1UAAA 5DNDA 4GL2A 3KJNA 1CY1A 1Q50A 5EHIA 3TRFA 4DA8A 2AZTA 1WE2A 2GSWA 3QF7A 4H4CA 1GILA 1RXVA 5BNTA 3PNMA 1AQIA 3PQ2A 4HXFB 5AJZA 3KSMA 1B41A 1MVNA 3COZA 3QPDA 3UJ6A 1N7JA 1F0KA 3MHPA 4F4IA 1O4WA 3H5AA 2ACKA 4MUEA 3UEOA 4EB6A 1CUDA 1SUIA 1VE7A 3M6UA 3OJLA 3ZYZA 2CV0A 3NYIA 2UVPB 3K1ZA 2RGGA 4GMXA 4KGVA 2H00A 2Y05A 4WEQA 4C7OB 4DA0A 1AUQA 5FH9A 4I55F 5CA0F 2FK7A 2FQYA 2X42A 3N75A 2IVFA 5EVCA 1PL7A 2WFLA 1H5NA 5BR4A 4N5MA 4BFLA 2OBLA 2JZCA 2RMKA 2ZI6A 2AXPA 4LMBA 4S1PA 4E09A 4E7PA 2IGBA 1COWA 2XPCA 5CK5A 5H59A 4A8JA 3TL6A 1LDEA 1Q3KA 2EFCB 4DBZA 4DZTA 5FI5A 5J4VA 1EWRA 3DP7A 1T1EA 3DXZA 5G0TA 3WLRA 3S40A 3K2QA 3MWKA 3QYFA 2LW7A 4IOLA 1WWKA 1DX4A 1T25A 4DNXA 1UM9B 3SNHA 3MJSA 4TPKA 1G8KA 3E8MA 1AHHA 2RK3A 1W87A 2PWZA 4FSXA 5DBHX 5HDQA 1FIUA 1TTHA 4KAFA 4A8JC 1NOJA 4LN1A 4RUKA 2V9PA 1PQPA 1RLIA 3QZUA 2GZAA 4KXXA 2TMKA 4BYMA 3WWYA 2PS3A 3FUWA 4Z5XA 4ZI7A 1NJSA 2RARA 2WZBA 1IZ0A 5ITWA 3H2SA 3OIYA 1KJ9A 4WKGA 3QNUA 1P9OA 2FK8A 3T4XA 4E3WA 4P83A 3W6ZA 1BEUB 3RKRA 1D8TA 3WKBA 2O5EA 3DWGA 1U0FA 2Y27A 3RF7A 3DS8A 1TQDA 4OQZA 4CF7A 3HXQA 1YFLA 5ERXA 1ZM7A 4NCJA 3TEJA 4LEIA 3LFTA 4GPTA 1ICEA 4JAVC 4B82A 2EYUA 4BGVA 4U2DA 3LT2A 4M1EA 4F04A 4QYXA 2PSDA 1AUOA 1AKEA 2XE7A 3MN1A 4Z0NA 1FP4A 2GCEA 3MJVA 2PFSA 1E58A 1LV8A 5J40A 3JQEA 4BFTA 3OFVA 4EHHA 3EAGA 2PUEA 5DHAA 4RXMA 4NNPA 3LFHA 5B4TA 3HJRA 2DH6A 4RF3A 2WE7A 2VDLB 1V1RA 3CEPB 2H1HA 3K1AB 4US1R 2P0AA 1OTXA 4QVIA 2CKDA 1N3IA 2QPTA 1SVUA 3GEMA 3QPWA 4FE4A 2A5GA 2YCLA 5EMKA 5C7IO 5EHZA 1IONA 2PWBA 1WY7A 4PSCA 4Y6OA 3T6KA 3ZD8A 2I7XA 5HNKA 3QX9A 2A3RA 1EVQA 4JXXA 3QGMA 1E1QA 4I66A 4OXNA 3V6LA 4YYEA 1G8HA 2O3TA 3V2HA 2OEPA 5DPMA 4KAXA 1OAKA 1OBOA 3W5JA 4QT0A 3GQBA 1VMAA 4CTMA 3Q9SA 4P53A 4ENWA 1EK0A 2D5LA 2XT9A 1VOTA 4GRDA 4TWAA 1Y0BA 5EQFA 1X9GA 5HQ3B 4R1SA 3H1PA 1FFSA 3QE2A 2ZRNA 4FN4A 2IY9A 4IICA 1Q0RA 4RPJA 3E4DA 3MWEB 5BRJA 3OOHA 5KYVA 3KXKA 4TTTS 3GFGA 2FHPA 1NC1A 3IOCA 3ICCA 3M6IA 3PTAA 4V38A 1QO0A 2AK3A 3AT1A 4BNKA 1CD5A 1WHSA 5H9WA 2VN8A 2K7ZA 2YJZA 4NEQA 4O4JA 4BLUA 1DC6A 1JW9B 4CGZA 2LRHA 2AR7A 2POCA 4G1VA 1F9EA 1PVVA 1FFGA 1RJWA 1RYEA 2JI9A 2P0YA 4PXAA 3HO1A 2OGZA 5T57A 1ZD4A 1XQ6A 2GZMA 4R31A 4QKQA 2Z3VA 1NUAA 1UCFA 1UPXA 3MUEA 4TT3D 3THRA 4JJZA 1BMFD 3A3YA 4FZRA 1U99A 2D7DA 5IK2D 1V37A 3H1BA 1M2VA 1ABFA 1VSBA 3PU6A 3Q41A 4L4RA 3RS8A 3VNBA 3ZE7A 3OEED 1Y3CE 4EY5A 4XA8A 2Q1TA 1BNCA 1E2EA 2HA0A 1RMQA 5JSUA 1LRJA 2HQRA 2GUWA 2QF7A 1SPXA 3G6WA 3LD9A 5E2IA 1JXOA 3ZDFA 3PX7A 3JWPA 4GEKA 3CR3C 1OFUX 1DC7A 2OB1A 1QHYA 3LGXA 3SQNA 4C78A 5SV2A 3V5NA 1DEHA 4AWXA 5EA2A 2VR1A 4UW9A 4U4AA 3UXYA 2CVOA 1TL7C 2MR6A 4PZYA 5EN4A 4YRJA 2R6HA 3A6GA 5ALDA 3WSTA 1F0NA 4TQGA 5EP3A 3PDCA 1JYFA 1TVMA 1YRLA 3ESAA 4PNPA 4RC9A 1ZD2P 3SF8A 4OQPA 4DSUA 8LDHA 1LDGA 2C59A 5K6AA 3K0SA 1U0BB 1BIFA 2A1IA 5JNUA 2FP4A 3N8GA 2V65A 1LQUA 3DKRA 4R2HA 1MJNA 5TR9A 3KFVA 4WLOA 3PSAA 3TL3A 2B7BA 2HV9A 2XR1A 4KDCA 4MYRA 1R9JA 1KO5A 4AMVA 4JEUA 4WBNF 4MUHA 5EIEA 2HB6A 1TCBA 4D4HA 1LPPA 4PO8A 4CM3A 1A04A 1PUJA 2COUA 2IHUA 3EXIB 3F9RA 4JOBA 2X2PA 3K0CC 4JELA 2Z4RA 4RCYA 3AHJA 1LJUA 1WCYA 2Q4DA 1HFEL 3UUFA 1GYRA 2QVBA 2VT3A 3PEEA 2RCNA 2GNPA 2PZMA 3W5SA 3IPRA 3RFUA 2D2IA 1WXGA 2O07A 2PX6A 3U0VA 4F2GA 1F3LA 1NONA 1M34B 1IVNA 4XYMA 2AK2A 4AO8A 1V43A 4OQDA 1PQ4A 5CIWA 1E64A 1EHCA 1OSNA 3KOYA 3W7BA 3ND5A 4G89A 1FFXB 1ZRHA 4FHDA 3FKQA 4L0QA 3A9WA 2VP2A 5TV2A 5EJ9A 4F4JA 1K98A 4YPFA 3FOBA 4Z3KA 5E9JA 4D4GA 2UKDA 4Z9AA 1JKMA 5ESDA 10MHA 1V9CA 4JJ7A 4JLAA 1OPXA 2F64A 3R6TA 3UKOA 3AV3A 4ZVKA 5SYMA 4O2LA 1YS9A 3AGQA 3ZWNA 1IM8A 1S4QA 4ND8A 5K4HA 4OF4A 1GO2A 3OX2A 3PNKA 5E0OA 3RS4A 4CV3A 2GYVA 4QBFA 4JI2B 4CQMA 3DKVA 3A27A 1QC5A 1ZXBA 1K8YB 3ZVKA 3BFJA 4TUYB 5CT4A 2YXPX 2PSEA 3PJRA 3KE8A 1RZVA 2EFDB 3HHEA 3OA2A 4A5SA 3E9DA 3FB4A 1I4TD 5E6SB 3LPCA 3SC4A 1DBIA 3Q7RA 4OL0A 2NTEA 3HZZA 5COQA 1QWOA 7ABPA 2BBSA 3KCNA 3PHLA 3H9GA 1XNRB 1CUEA 3DBLA 4J0JA 3PRKE 3K8OE 4MKZA 4XFKA 1A2KC 1A8QA 1C81A 1SCKA 3ZZ0A 5A5VA 4J90A 4R01A 4HQ0A 1FPQA 1O95D 2JIOA 2OOKA 3KKKA 3KQMA 2ZPTX 2Y77A 4G81A 4GSLA 3HB0A 4MS1A 1XTVA 1A4IA 1E3LA 3LKVA 4GWGA 5EQTA 1U4NA 4M1ZA 4P5EA 1DUVG 1OWNA 5IYZF 3ZDQA 1A9QA 4C0AC 4I50B 1MXHA 5TDHA 1S0UA 4Z86A 2HBYA 4X7PA 3TR5A 3W7AA 1Q1QA 1GEEA 3RV4A 2PK3A 2B6HA 3BMCB 4RGBA 2WLTA 1QGOA 1QHHB 4JLWA 5AW5A 1ISGA 2O8NA 2R1VB 4EVSA 4R0NA 1GGMA 1ODFA 2JJ8A 1C3OA 5BQXA 1B7GO 5EJ6A 3QOWA 1HDRA 1FS6A 1UPBA 2YV3A 1ECBA 1WO8A 3H5IA 3PHCA 3INGA 3M2PA 4XYGA 3RC1A 3TVTA 5JWRA 3I53A 5IDQA 4KREA 1YZTA 1XYGA 1Y3AA 1T5SA 2ZP1A 4MLDA 5JS8A 3FGNA 4WOJA 1I3KA 2ZU6A 3GFQA 3Q0TA 4N3GA 5DGDA 5EXSA 4YDHB 4DIFA 5ECWA 1OILA 1U8XX 2C9DA 1KE2A 5FUVA 4C22A 3G0GA 5J63A 4CN8A 4O4IB 3VZDA 3TSWA 4D79A 5JV5A 5J2TA 2GILA 3C2QA 5EIBD 1L5GB 4FQ7A 2BLNA 2ISSD 3NONA 4ONEA 4QPCA 1FLDA 1EZZA 1CQIB 2ZTLA 3FY4A 5DEIA 3HBMA 2NVUB 2H1OA 2FFQA 2QU7A 1NQOA 3GP3A 4L76A 4PX9A 5EEHA 3DMHA 5EJFA 4FR2A 3S1LA 3T34A 4AP9A 1RZUA 2A0KA 2FWMX 2H59A 1Z6XA 2H2HA 3AEKB 3Q1LA 3UMCA 4R51A 2P30A 4F4HA 2HIGA 2CLIB 1N5JA 2HGZA 2VAVA 3MYYA 1JT2A 4HWRA 4C2TA 3RROA 3HB9A 2AWOA 2OBFA 2AG8A 3R6DA 4BGUA 5E9WA 1KO8A 2YNMA 4OI1A 4AMUA 4MYUA 1ONNA 2B1QA 2ET6A 2UVQA 2YIVX 2XCTB 1U3TA 1CUUA 3ZGVA 4DLKA 1D9XA 4PLCA 1GPYA 3OX3A 1DTWB 2GASA 1XIVA 1ELOA 1QYCA 1W88A 2JIMA 2Z2YA 4AJOA 2DWPA 2NYRA 3PCTA 1W581 2AG6A 1H1LB 2RHLA 4Q3NA 3OLZA 2FUNB 3EPLA 3KQSA 2VK1A 4B44A 1TCUA 4BRZA 4BTVA 5K0CA 1G8GA 1VRCA 1XAIA 3D02A 4DUGA 3PDIA 1GPNA 3HYNA 2P9GA 2X4LA 4D45A 1FW6A 2DHDA 4LXGA 3TNDA 5DWQA 1G9TA 3ROXA 4BKPA 5JH7F 2PS9A 2Z2XA 1EP3B 1WPQA 2NPOA 1FVHA 2B92A 3NXSA 1UXOA 4ZVQA 2HA5A 3P2YA 3WKCA 2GESA 1H69A 4EFLA 1K86A 3CZRA 4B5LA 5DCWA 3QVSA 1L4YA 1IHPA 1O1YA 1I30A 1VHQA 3B1WA 5CFRA 2WYHA 1AU9A 1E1QD 1KZ9A 3INNA 5CX4A 3VJRA 3VI4B 1M2KA 2WAOA 3MJCA 3RU7A 5FRDA 2HA6A 3OESA 4W1SA 3UAXA 2XBMA 3W05A 3R9XB 3CRMA 4KTVE 2VPWA 3TJRA 4X6UA 1ZN2A 1MO2A 2QROA 3AB8A 4CLXA 4DCOA 2JEYA 3I62A 1RBYA 1RAAA 4WN3A 1RXYA 3AEYA 3BXZA 4WE3A 4MGEA 2ZUSA 1XTUA 3B1KA 2P3QA 4LDJA 3ZN2A 1NN3A 2VZ8A 4JKIA 5ADVA 5I5EA 1GY8A 2FR8A 3IO5A 3W5UA 1JIVA 4PPQA 3Q11A 3KKEA 1W4RA 1XT6A 3MCUA 2RGWA 5GY7A 3RVRA 5D00A 1A2OA 1GAEO 1KZYC 1D5CA 1EYZA 2OBMA 3FPBA 4BQPA 1KOGA 3QEOA 2ROQA 2W5UA 3VR3D 3L05A 5B6IA 3H42B 5EJ2A 4B17A 3SYKA 2P91A 1A9XB 2DFTA 4KH1A 4GI7A 1FYVA 2AI3A 4UE2A 3SD7A 1KS9A 3RYTC 4R3UC 2DR2A 4E21A 1H3FA 1L7RA 2VLBA 4PZEA 7REQA 4Z9XA 3JQAA 1X0XA 1QH9A 4HVLA 3ET4A 3A2NA 3PDWA 1IUPA 2XVMA 2A9PA 5ILGA 3M9XA 5DBFA 5BSMA 1Y7LA 2RHHA 3AHEA 2V7TA 2Z6VA 3MS4A 3VR4A 8ATCA 4H7DA 3HY3A 2O0JA 1WBDA 5DSZA 1U94A 5T4EA 2AI2A 4M1OA 3LCUA 3SSAA 1SD5A 2XRMA 4JJEA 2G77B 1AV7A 1FVFA 3K0AA 1ZQ9A 3OMLA 2CW5A 4RJTA 2QI9F 5KYUB 2EQAA 2Q07A 3QNWA 4UKDA 3L1VA 3H2KA 1VCIA 4M55A 4KLNA 5B53A 4Q15A 1J25A 1U4SA 5TEVA 4BZZA 3KJXA 1ISIA 4OHCA 2WT9A 3QF4B 5GZ1A 2EL9A 2JKYA 2CVQA 2OUKA 4RJJA 1BJRE 3T94A 1TEXA 1P39A 2CJXA 1CUCA 4L6AA 1SXQA 2F90A 4M0LA 4RV4A 3U7RA 1UJBA 3UJ7A 2H9AA 5BN3A 4UUNA 1GPH1 4F7DA 3AF1A 4BWGA 4DS3A 1XVLA 5FOTA 1V6CA 2D6FA 1NVAA 3K6KA 4BN4A 2B7LA 4E2WA 1P9NA 1ZUIA 2WK1A 1IBMB 4CI9A 4DLAA 3FSEA 3S5UA 2AG0A 1ZN9A 2REOA 4P7KA 3CNLA 5CDUA 3UMYA 3GA0A 3AUFA 2H1IA 3ZEAA 5IKEA 3C3AA 4LC0A 3QU5A 1M1NA 5KVSA 3PE6A 3Q3CA 3I1YA 1EGHA 3RJMA 2I6GA 3W9BA 4X92A 3ZOZA 4R71A 1QPGA 1UBKS 4UREA 2IBTA 1VTKA 5HG0A 5I9SA 4K7JA 1KPGA 5EP2A 2AHOA 1GLVA 3WMRA 1WBJB 3VHXB 1RNLA 2VFAA 3H8VA 1QSGA 2RGAA 3QENA 3U4AA 2QMUA 5LJLA 4BX2A 2MINA 3BTOA 3DEZA 3P71T 4I1RA 3HU2A 4EJ2A 3DLBA 1J0CA 2XKKA 4XWTA 4X1YB 3RUCA 3T7AA 4TYYA 1MAVA 1D1PA 3NRCA 5D85A 1E63A 4F4UA 1UBUS 4M38A 5BPHA 3MGAA 2HREA 1WQ3A 3P9QA 4FYPA 3RD5A 4XX0B 3WBFA 5I7WA 3Q6IA 4ARUA 4KQJA 1Z08A 2G07A 1O0BA 2BBTA 2BUBA 3EGDA 3IP7A 3KKQA 4B9AA 5THXA 1JS1X 2RAPA 3ZCRA 1KRHA 1LNQA 2RK6A 4UTXA 1RBMA 3F97A 3KEMA 3Q2KA 1G4HA 4RGYA 3CXUA 5LBIA 2HXSA 2PGLA 3QW4B 4EATA 3IBFA 3OCWA 1OAAA 2VDWB 3OSUA 3ZV7A 3RAFC 2H92A 1N5DA 3AKZA 1L8AA 1NZFA 4U00A 3DNFA 1NJ6A 1JHVA 3NC1C 4O2BB 1EMDA 4F3NA 3DEHA 2XOKA 3IKVA 1P7ZA 2JLRA 3FWZA 5I9BA 4ZJPA 1AHPA 4OP2A 3AMVA 3EIUA 2Q45A 3K5IA 4HLDA 1NR1A 3LTEA 2ZWMA 3O3NB 2BM1A 3AFHA 1F48A 3U26A 3TZEA 4PPFA 3F7MA 4YUWA 2QEQA 3STVA 1SGWA 1YD7A 4KNVA 4NS4A 1EWVA 1O6BA 1T9ZA 1LLUA 1E6MA 1KFKB 1ZRSA 3VKFA 4TUYF 3UMBA 3WIDA 5ELXA 1EVKA 2Z1NA 1WTCA 3ZX4A 3R5KA 3UCEA 4AY2A 3HYCA 2OHXA 4U9UA 2PTGA 3HLKA 4BNUA 1J4AA 3ILXA 3LMKA 3R7LA 1AXEA 1GM5A 1TM3E 1BE0A 1DCTA 1W2WB 3A2LA 3ETCA 2XT0A 2JI4A 3TRKA 4DHEA 4RIHA 3GJ7A 1N34B 1BAPA 1KBQA 1SIBE 5EP4A 4DMGA 2BTQB 4BO0A 3TTYA 1A8HA 3FHOA 2NPIA 1KIAA 1O77A 2KLHA 3KDPA 4N8SA 1E3IA 3U3RA 4E30A 5JAUA 3RASA 3HXMA 2QZ4A 2P1RA 1VHJA 2YBEA 4LSZA 5AJHA 3ZH2A 2R2AA 3TLGA 2ZYUX 2RKWA 3RBVA 3H1FA 4R2WA 3GUZA 1MV8A 1OASA 1SD1A 1P62B 3EMVA 3H17A 3PV0A 4IXMA 5EJMA 5C3UA 4DJAA 5FWDA 3X1XA 2PMWB 4GYKA 3DBVO 4N5IX 4W8HA 3H7AA 4XOUA 2AG5A 4PZCA 1KAHA 1V6SA 4JI1B 2W8ZA 1LY1A 4P4SA 4G0QA 2CFTA 5H81A 3JAKA 5JTUA 3WQSB 3CLUD 1UQUA 2VSFA 2BJVA 4MPJA 2ZUTA 1XZ8A 4TTJA 3KRTA 1E4VA 1KGSA 2DB3A 4MWCA 4TMFA 3U7GA 2I4NA 1B8OA 4L7QA 4C30A 3GEDA 3UXHA 1ZNZA 2CZGA 3A6LA 2PUWA 3UATA 3SM3A 2JI8A 4NZOA 3H84A 3QUTA 2FV8A 3HS3A 4JJAA 3BF8A 1GU7A 1H2RS 2RI1A 3H65A 2FSUA 3L79A 3MQFA 3JASB 4WZ6A 4YXWD 1SRRA 1HTBA 1KJZA 2H5JA 4IKEA 4BMCA 1HFJA 1G291 1E66A 1IHXA 1UBLS 3B9BA 3MWLA 1NR7A 3GVXA 4ZWNA 2X0KA 3E2PA 3FTQA 3ZNNA 2I78A 1GCOA 3DE3X 2C7QA 4HR7A 3AHFA 4FMDB 2XMSA 1TVKA 1NVKA 4JU9A 1I4OA 4G0PA 3WWZA 4HRAA 4JWKA 5JYDA 1Y7PA 1POXA 3EWAA 1P4RA 5DYWA 5CVTA 3ES9A 3RSGA 2GK7A 3F90A 2ZS8A 3LM8A 3MMPA 2Y93A 3S99A 4BP3A 1KKUA 3ZHQA 3DLHA 3WMXA 2RE8A 2G7MC 3C4QA 3Q3JB 2KBFA 4Q1CA 1NBEA 2H4YA 2VLIA 4GR9A 3DZHA 4LYFA 5K3EA 1X7XA 1W5SA 2NV6A 4GKJB 4U2GA 3SWWA 1USWA 3DE5X 2P2GA 1VHDA 3Q15C 3FWNA 1YCGA 3KR2A 3PXAA 5G4KA 4E2FA 1IZ9A 4B33A 5ADHA 1E18A 1SCQA 1X3SA 3GYGA 4KZPA 1WY5A 4Y2QA 3RSSA 1M8PA 1DV2A 3ZDAA 4BJHB 2ZB8A 1V3TA 4AQ7A 3DV2A 3CX7A 3RUHA 1OTHA 4BVFA 1P5ZB 3N8IA 3URKA 1WVIA 4YONB 2QM3A 2HKIA 3DDCA 3R5JA 3ZE2B 4R1TA 3S70A 2FW9A 2OLKA 3DBHA 5FKJA 4I14A 3ESRA 3HDJA 3CSUA 1U0RA 2PGDA 1XKXA 2ZRDA 3WI7A 5JAIA 4L27A 3CFYA 4UEWA 2PX0A 1Q0UA 3P2JA 5AK5A 4ZDKA 2V1XA 1ADCA 1JAIA 1CP2A 1PSZA 3F8TA 5FHQA 4MQUA 2WZQA 1FU4A 4XRRA 4GKKB 3EDCA 2BV3A 4PEVA 1MXFA 1OVMA 5ESRA 1OLSB 1BQ4A 4IWYA 2VPQA 3P0JA 3MINB 3VPSA 4F5WA 4LZOA 3T3MB 4QXQA 4QAJA 4O0MA 2J5BA 1KIMA 1XTTA 4DMRA 4F9EA 4J1SA 5I7HA 1R8XA 1NASA 5REQB 1T2DA 2CFOA 1U81A 3M89A 1TXGA 4P1ZA 5K3AA 5WRFA 3DOJA 4OBBA 1SBZA 3OPQA 4R8SA 5HKKA 3IGFA 3VPBA 3DHYA 3BIFA 2C4NA 3GLFE 1K8RA 3M1IA 1GPBA 2XXBA 1TFRA 3G6KA 3HYLA 3NHAA 3JQAD 3DQZA 1RCFA 5A6SA 4CT4B 4MKRA 1S2LA 3C16C 2A57A 4EKDA 2VP6A 2H2GA 2PR7A 3M6WA 4HQNA 1WB9A 1PL6A 2P9JA 1QH1A 3P2OA 5DT9A 4N3CA 3GT4A 3VU0A 3U31A 1JHUA 4P3KA 1ESMA 4HDMB 4ZI2A 4A3SA 5JZSA 3DZBA 2DY1A 1YDFA 4PR3A 4NBSA 2CXQA 2WI8A 1G64A 4OIMA 2QRNA 4G5SA 4F72A 3ZJTA 4TSRA 1AQNA 1YDEA 3LIIA 1V9LA 721PA 3HXLA 1XZCA 3E81A 1Z5PA 1RWOA 3FRJA 4FGJA 4NESA 5JVDB 1R8SA 2IEBA 5BNFA 4ZQIA 2DHEA 2IX3A 1K5HA 1VKOA 2BUAA 5DBIA 3OC6A 2AH5A 4GW3A 1A72A 1R64A 4QPJC 2GEDA 4G41A 4R8RA 3WB9A 1RM4A 1VMDA 3GLSA 4FB5A 1W44A 4GXRA 3TIGA 4R3WA 1NURA 1K5PA 5T8KC 2D2EA 3SIWA 4OU4A 4P84A 1M1UA 3DO6A 1JLHA 1UK8A 4MAAA 3W0LB 3VTZA 3FFBA 3ZGNA 5IBPA 3L43A 4QYMA 1QG0A 3E6AA 3KPJA 3P2EA 5AI0A 2L42A 4KQGA 2GYWA 3VGPA 2JFPA 2A1TS 3EQ9A 4MWDA 3V1YA 1OZFA 3ED5A 4HV4A 4BATA 4EKIA 4BFYA 3GEIA 2YTZA 1Z06A 3VOSA 2G9ZA 1T5TA 3DVSX 3AZPA 5ICEA 3FYUA 3I5AA 2QDKA 3PWTA 3MGBA 2DFLA 5FIUA 2G80A 2RGEA 4CQNA 4FDVA 5KYWB 2IV2X 3K9BA 3CSSA 1ZHFA 3PEYA 4KDFA 4A8HA 2CC2A 4L9RA 1W6UA 1M72A 3NTUA 1XVTA 2B0CA 2VDQB 2QYTA 3E48A 4G36A 2ST1A 2IH4A 1TM5E 4YRLA 4HMOA 2AOXA 1H22A 1JFRA 4JBYA 1RXIA 4B85A 1LQ2A 2GM9A 1CF9A 1DAKA 4U6SA 4Z3DA 2DXIA 4KR6A 4S1VA 2D8MA 1MJGA 2ZR9A 5ETJA 4E11A 5KOJA 1B6GA 1NF9A 3LUAA 1K5DA 2ZR7A 1S8FA 4NKRA 3KZKA 4IINA 4GM1A 1ORVA 3PGA1 5DYNA 4RY9A 1E7QA 1YOBA 3DE7X 3JTMA 1ZOSA 4E46A 4YX9A 1EFAA 1EJ2A 4Q4JB 5DF1A 2PYIA 2AKYA 3DNMA 4C6RA 2A92A 3D8TA 1O94D 2WWHA 4I81A 3ESYA 3O4JA 2FRDA 3NORA 4QBKA 2FYTA 1ZOIA 1EFVB 1KFJB 3L1KA 4QDOA 4RV9A 2NQ8A 4PQFA 1YAHA 2QLMA 3OKFA 4N65A 5DTIA 2CL7X 1TKAA 2PRZA 3B3FA 1FFAA 4F1KA 2ZEJA 4UU7A 2GZRA 3CJRA 3H5RA 3JQ8A 2X0FA 2C8LA 3IUBA 4DCJA 4UOZA 1RWNA 1J9EA 2PY6A 3X0DA 5D6OA 4DEYA 1KU6A 3MSCA 4QUAA 2ONJA 3IMFA 1M2NA 2G0TA 3GCGA 1JA9A 5TPWB 3T4EA 3M34A 3GFSA 1E6EA 1TT5B 2OV6A 4B3IA 3ZLJA 1MIHA 1PL0A 4QXOA 5KJ6A 2VNJA 3AUTA 1VKNA 3PE3A 3FYDA 1P5HA 3SCZA 4NIMA 3BEOA 4ZT6A 8AT1A 4PLYA 1US8A 3JVUA 2G17A 3T8YA 3IAXA 3K9LA 1N2SA 3BBLA 1R9NA 3DSRA 4BEBA 4RSGA 2UZ1B 4RF5A 3HU5A 1GGKA 1NJGA 1GQQA 3A1DA 3HCWA 2Q3HA 4HDRA 4JI5B 5C53B 3U62A 1G4AE 3LX8A 4YMTA 4QWWA 3KQQA 4MIYA 1PNQA 4I8XA 2JDID 3GIDA 1Q95A 4X1IB 3O7WA 1PDWA 2O5RA 1J0EA 5IC5A 4ZGGA 2WM9B 2JVIA 3A9RA 3DV0B 1TF5A 5ESXA 4JLVA 4CG1A 5EI5A 3L9XA 4HOYA 4LUCA 2EV9A 4YJ2B 3DDSA 3KT0A 4URYR 2P4EA 3GOHA 4QTUB 3EPJA 1ODTC 1U0OC 2JAOA 1LPOA 4TVSA 3EARA 3I9NA 3DWEX 3O93A 3ONVA 2H7VA 3TZBA 2KYRA 4DLTA 4WIAA 1HSOA 5J1SB 3CTMA 4YFYA 1BKSB 3DMTA 3F6YA 4EY8A 2CSXA 4WCFB 1Z33A 3EH2A 3F47A 4GR5A 2J3EA 3DHVA 3JQ7A 4W5WA 1CJMA 4BQSA 4E31A 2R62A 2WG1A 1LK7A 5BRAA 2QLTA 3BM5A 4HDCA 4PXYA 4X97A 1RCUA 5HJ2A 3ZJVA 5JCJA 3K70C 1LJ8A 4MP8A 1O0SA 2H11A 1GTL1 4M9UA 2XVYA 3FGOA 4F86A 4YIHA 3QIAA 3LCMA 2QQ5A 2SKEA 2ZRGA 3JZMA 3TMKA 2AOUB 3O0TA 4RA9B 3HUDA 5KQGA 3QFRA 1MABA 5H02A 1V7QA 4KO1S 3HVKA 3K6SA 1Z62A 1WUJS 1FJHA 1CEXA 2XBLA 4GYYA 4DBLE 5JBNA 1EIZA 2BMJA 1LI4A 2FWRA 1ZL0A 2QB5A 1ARZA 1VMKA 2XD4A 1LVUA 1EUZA 1TEHA 1Z8DA 2WQ6A 1TW2A 4HHEA 1MDFA 2P4HX 3AKDA 1XYVA 3O83A 4G8BA 1N2IA 5CK4A 3F73A 2QRQA 4J9VA 6CHYA 1FMCA 3E61A 3ZGOA 4AQDA 2PL3A 1Q7BA 3D6HA 3O4RA 5FL7A 1IZ7A 3KEGA 4Q0MA 4BFVA 4IO0A 4TTIA 3GY0A 4XWKA 5KX5F 2OXTA 1EGAA 1C7QA 3NIDB 4TOIA 4GPD1 4INPA 1Z56C 4TX1A 2ZJZA 1E5TA 1KSFX 4PF1A 1DTEA 2V4UA 3EW9A 3HR8A 4CYMA 2GXQA 4OAOA 2ZR0A 1DUSA 1P8JA 3OY2A 3TX6A 3GJ4A 4B3CA 4V1CA 3G7UA 4E88A 2CGEA 3E3LA 4ALKA 4PGMA 4E14A 4P0PB 4Q9IA 5JSZA 4XM2A 3LVQE 5BSHA 1Q11A 1YMUA 5DK6A 4ID3A 3T3OA 4M9QA 3C8ZA 4XQEA 1N57A 5BRNA 3UWMA 1N1GA 4U02A 3WLQA 2AR0A 5KTOA 5LVAA 2LDXA 1J21A 3P45A 2C4VA 4RHUA 4IPTA 1I3LA 2MU1A 1I13A 5AICA 4TRJA 3KPUA 2E0IA 3C4VA 3GEEA 1X74A 3K92A 3LYUA 2H08A 2XODA 4KR2A 4CEJA 5AWFC 1G8YA 2X7HA 2PUJA 2W6OA 3MCAA 3T4PA 3CG0A 2HO4A 1SUFA 2FR0A 1NX6A 1IUOA 2Z5VA 3OLWA 1CQXA 2E37A 2PZFA 3DL4A 3NUGA 4GX5A 1ECJA 1PWHA 3L0SA 1TJYA 1PD0A 2ADFA 4MARA 1T0JB 3B6ZA 4PYQA 1EUDA 3GFOA 2X6QA 2PZKA 1PG2A 1ETUA 1PDVA 4DIKA 4D9KA 3CURA 4RK6A 4ZZ3A 4AZVA 2BGMA 1BFKA 1RRCA 2OENG 4B3JA 1E60A 2LVBA 5KNDA 2O5VA 2C03A 1R8JA 4GZ3A 4KQWA 5JS7A 1EIWA 1YVUA 3MMZA 4WXMA 2OGSA 3JQBC 2X41A 4JN6B 5HCIA 2HA7A 2ZAGA 4WW0A 4MCJA 5E3IA 2HUNA 2P62A 3GGOA 1RQGA 4NFHA 5JNRA 2G8NA 3W6OA 1KDRA 1ZJ5A 3FNHA 1M2HA 1C7RA 1OYYA 3G5MA 1A9TA 3KTDA 3O92A 3OEHA 4RL6A 5F73A 3UZUA 4DSTA 4F6RA 1ZA2A 5KHOC 2ZLBA 2NO1A 3FW1A 4FWBA 3ZCPA 4JXJA 4ZYZA 5G3ZA 1WSAA 3C7KA 1XCLA 4NDZA 4TXLA 3RANA 2IOFA 2FSVC 4BNLA 4IIJB 2VWGA 2YWEA 3PDJA 4PPGA 5CURA 4YMSA 4ZQCB 1ZNXA 5BNIA 4N48A 2H2IA 4GHWA 4JYBA 1K8XB 4FD3A 3PF9A 3UFXB 3FHLA 4ZEVA 2VTDA 3BRCA 1UMDB 1L7MA 1VJ5A 3ESBA 1XNGA 4HNAA 3N0TA 1D2GA 2A5LA 2AN3A 2FVXA 3UWOA 5B1HA 3OT4A 4I36A 1RC0A 3VKVA 3B6EA 5KQRA 4YJHB 4EYQA 1S3FA 2JFFA 3CRRA 1H1TA 1RT9A 2D59A 4LXQA 4EO7A 1M1YA 1RKVA 2HSJA 5B4UA 2P4SA 2YZNA 5F5NA 1UC5B 4ZD6A 5LA6B 1E2MA 3TSAA 2BH9A 5EZYB 3DC7A 4EUKA 3IMKA 1UBJS 3PSHA 3OP4A 1TJNA 4I4TB 1CS4C 3CC8A 3I1IA 4MHTA 2B99A 5EINA 4FYXA 1OYOA 1QYXA 1ZLXA 2W0MA 3CRW1 1THZA 1YDMA 3PVSA 4Q7JB 2NU8B 4O4HA 1ONBA 4D6XA 1E94E 1L7QA 4OKIA 4RXTA 4XCQA 4J7XA 3W06A 4KVGA 4F4DA 1EP2B 2GEFA 5JMWA 2IUTA 3NRJA 4ZVTA 2IQ5A 1KYIA 3O9VA 2B2NA 1H2WA 4PC1A 5IT5A 1N4AA 4J8PA 5LQMA 4O2AA 1Q7RA 3G89A 1FFDA 3LQYA 1IG3A 1JVBA 1MLDA 3E3MA 5AI4A 4MTLA 2B1RA 2PZGA 4LRYA 2X8WA 1S9DA 1J8FA 1TGVA 1V5FA 4QDTA 1BDBA 4AZTA 3CJTA 1UC9A 4A2QA 1U8CB 1QUEA 1V47A 1X80B 2C5EA 4PFJA 1V41E 1V1JA 3L9WA 5DW3A 5FBVB 1MB4A 2CYCA 5J58A 1LNZA 2PFGA 4Z1MA 1QYIA 1CBUA 1TTQB 4HS4A 2NN3C 4F21A 3N2YA 2CVHA 2YZ7A 3AKYA 4EFNA 1YA8A 3AVUA 1U1FA 4LJAA 3BX1A 1SB9A 2AYYA 5IAGA 1QGUB 3EJWA 2WHPB 4RZ3A 3S8MA 1SKYE 3IHLA 1EGVB 2EGHA 4U6NA 3EEYA 1A9SA 1IOLA 2HC9A 2Z2KA 3AETA 3UXMA 1IEXA 2ODPA 3OWOA 4LDQA 4KUGA 4M76B 4QYIA 4E6EA 3QKSA 5LYJB 1E3QA 4ZEMA 1YNSA 1TD9A 2UYQA 3M5DA 3P0IA 3JWHA 1XV5A 1T24A 2A35A 2NZVG 3BWYA 4H59A 4N3BA 5GV8A 1L5HA 3SGLA 1ZZEA 3CVWA 2IOHA 4N76A 1XCMA 4JI3B 1H2YA 4LZNA 4P5PA 1XQ1A 5I45A 2BTEA 1OYVA 1YQEA 3MELA 3CWZA 3F0TA 1CTQA 3WSWA 1II9A 1QTRA 2I33A 2HIMA 2P4QA 2PUTA 1S8OA 1U2GC 3PNPA 4NX2A 5J59A 3I1FA 1A7AA 5TNXA 3FHJA 5CDTA 2OQ2A 3LVFO 3SVZA 4AN1A 3ZH9B 3FROA 3EZLA 4K81B 4I2NA 1R5OA 2EJBA 2VNHA 4YO7A 1N6HA 1TKBA 2PX2A 4MNTA 4Q39A 1SHKA 3SR4A 5LQUA 2LIPA 2WJ4A 3B51X 3PEVA 3VKWA 2W8BB 4X71A 1WF3A 2G1JA 1EAYA 2R6DA 1P4GA 2HNKA 3BFPA 4PV7A 5FUBA 3NBYC 3TTWA 5DLQC 4BVHA 4HY3A 3OPNA 5BMVB 3K6RA 1PR5A 4XGKA 1ZI6A 4G2NA 4CUJA 4ETMA 5L8VA 2DHRA 4NYJR 1DJLA 4PG6A 1NXXA 2AS0A 4M54A 1C4KA 3CKLA 2J0SA 4BMVA 3M6XA 2UUPA 4HPJB 4CODB 4QYWA 2JBAB 1S8NA 2Q2QA 5LZ2A 3D6JA 4DR4B 2VL7A 2C92A 1RWPA 3E5MA 1LSSA 2EZ4A 3A9TA 4UMVA 3ZCQA 3BMOA 3RK0A 4YRMA 4LBYA 2HBZA 4BNMA 1M2FA 1HEUA 2PT6A 2GF0A 3NBUA 5K0JA 4BNNA 3SQWA 3PK0A 2QQEA 5EWMA 1P1CA 5AM2A 3O9ZA 2WAAA 4ZTBA 4CDRA 1K7EB 3NYWA 3SC6A 2QTLA 4YBRA 2W42A 3HCDA 3DLPX 4DUZB 2QPAA 4D41A 3GGDA 1F60A 1OJLA 3B13B 3IJEB 2F17A 3ZE9A 1XDGA 4DCPA 1NQAO 3ML1A 5KDLA 4CCYB 5AKJA 5FO1A 2Q2NA 3AF4A 3O31A 2CD9A 3PFGA 4NULA 1ECPA 1IBSA 1RVDA 2I65A 1IN4A 2RI0A 4U0JA 2VHTA 3IEXA 1OZAA 1AZSC 4LIPD 4YAOA 2V9CA 3V4SA 1THMA 5EHNA 4MUNA 5KNLA 5A71A 4DLVA 2JD2A 4GMKA 3OJCA 3OTQA 1YS6A 3ORYA 5KMGA 3MGGA 1SA0B 4HPXB 1P44A 4UEKA 1JHMA 5A7FA 4YT5A 3NKVA 5FD8A 3KAKA 5H3HA 4I1PA 3QEMA 1IWOA 2Q27A 2P9ZA 4MLPA 3NO4A 1NIJA 3OKPA 5CMLA 2QLLA 4HWSA 1JE0A 4IIYA 3ZS9A 4R1UA 3W3AH 3D6MA 1M10A 2WTNA 2V3WA 1PGNA 3IE0A 1QHNA 1U8TA 2JAWA 5C8YB 2XAAA 1EDOA 1K7CA 4U2CA 1KEVA 1QGAA 4F71A 4HDAA 3WGUA 3COYA 2C2XA 2XYQA 3U40A 4JQCA 4M46A 5JXGA 5DOZA 5HYVA 4R69A 1YB6A 3HJFA 2O2HA 3HM2A 4N6GA 3I92A 4JK3A 1P8AA 4FNGA 2E55A 3W4KA 3WLJA 2DCMA 4C20A 4CLEA 1E20A 1NZDA 1A8PA 3C3YA 5BWNA 2YXDA 2EC5A 4S2UA 3KPWA 2GKOA 3OHMA 4AY3A 1K3FA 4ZXFA 4NH4A 3HCPA 4DXDA 2H2AA 5CITA 2ECOA 2PCLA 3OD5A 4PE5B 4JODA 1PDOA 1Q12A 1VSTA 2WPDA 4JSTA 4LECA 5T4FA 1MU0A 2BCJQ 1SVSA 5AUQA 5K0GA 4EB8A 2J3MA 3PXDA 5ALSA 5F3WB 4IDFA 1BHSA 3L0OA 4X64B 1NF3A 4MIEA 3RRNA 2P68A 2IEIA 1UDAA 1QE3A 2WFMA 4ZO9A 2C2YA 3DZIA 5BT9A 1QOZA 1M1YE 1S6YA 1YA6A 1DV1A 1XF9A 3TDKA 4OJMX 1IN6A 4WXEA 5DASA 3VYRB 3ZI7A 5IANA 3NTXA 1PLLA 1RPAA 1UMCB 1MG0A 2AMYA 3SJAA 1K89A 2CEKA 3JD2A 1G42A 2KMLA 2X0RA 1SQ0A 2DCUA 4F2WA 1PWYE 4HNGA 3GAMA 3JQDA 3OIGA 4QEZA 3RREA 3QEBZ 3BEDA 2BZGA 4NPHA 5DFAA 1NN0A 1TADA 3NH9A 2V1UA 4AD8A 4BJ3A 1JV2B 2JHPA 2EU8A 1W96A 2PL5A 3H1EA 5EKUA 2XW6A 3BFXA 1JEQA 3LWZA 3PVZA 4GBED 3QHAA 4CCYA 1C30A 2JI7A 3CW9A 3ETEA 3NDIA 4IRMA 3THWA 3A0UA 5ALQA 3WGKA 2PT9A 5DOVA 2X14A 3EHEA 1O9GA 1UXIA 1JJIA 4RU1A 421PA 1DJOA 1EM6A 3K0CA 1T2EA 3MTEA 1FXUA 4AJPA 2FZLA 4RV5A 1LW7A 4C7OA 4LHEA 4IFTA 5ICFA 4CIDA 2ENUA 1XOIA 1DKQA 1Z4IA 3ITEA 3DBOB 1PT6A 3QQ5A 4LNAA 3E58A 3JARA 4KAJA 5CNJA 3L7NA 3UENA 5I9NA 1QLHA 4RK7A 3WGHA 1DSSG 3JRXA 3AC0A 2N1MA 2XKBA 4EMSA 1UAYA 4LC1A 3CH7A 5DYTA 4M53A 4MW6A 4I6JA 1J5PA 2H2DA 1PT8A 5E1MA 3ZE8A 2YIJA 2CVFA 1JH9A 1GLGA 3LXMA 4ZOQI 2VF5X 4LK2A 1V1MA 1UM9A 3LUKA 5EPOA 3D0KA 1ODJA 1WM1A 4L6CA 2HJGA 1Q1AA 2XVAA 4IIJF 3V4OA 3T41A 4JB8A 1R74A 2CSUA 5DGTA 3QKIA 3X2EA 4YUZA 4DSOA 3A6ZA 3N0RA 4Y1RB 3U3MA 4GXTA 1C9JA 3ZKWA 4H6WA 3PC4A 4DPLA 3TLXA 2IZ1A 2Z5GA 3BMQB 5HJEA 1I7DA 1WBBA 2FQWA 4QZVA 2PO5A 3EGEA 4MQFB 2QMEA 5F5XA 1O7JA 2AW3A 2XTMA 2Y76A 1W9MA 3GVCA 1YUNA 3BA1A 5LP6F 4CKEA 3VKHA 1B3BA 4QJBA 5K4AA 3EDRA 4FILA 1XMVA 4KTTE 4KXUA 2BJHA 3E9NA 2W2PA 2AE2A 2X77A 5LA6F 3KQOA 4A0FA 3OLXA 3FHTA 2QVGA 5EZYF 3THXB 2OE2A 4LJSA 3IERA 4K9RA 4ZOLB 1XXLA 1VLVA 1Q0PA 4GGPA 2Z57A 4L72A 4QLOA 2IS2A 2D1YA 2Q2WA 3UH0A 4XD7D 1EDEA 1H42A 1DARA 3F5SA 3ISTA 4MW9A 1DKLA 4QTZA 3WR5A 4DLRA 2PPLA 4H27A 5JHHB 1MENA 1C0EA 1N2CA 1E1MA 1WG8A 1ICIA 2ZJ4A 3ELUA 3WMWA 4D3YA 1Q2UA 3OJEA 3W8RA 4TTAA 2XV1A 4PG8A 1DNPA 3KPYA 5KJEA 3SQDA 5AVUA 5C31A 4GZ5A 3BGWA 1CQWA 3PG5A 4RHCA 4W9NC 4ZQHA 1SHLA 1YC2A 3WDSA 3DO8A 2ORYA 1IY8A 2ZAOA 1I7SB 3U16A 4CL8A 4WX2B 2ZSIA 3BAZA 3KU1A 4E5MA 3GGPA 4LFAB 2B3DA 2X6RA 2LWIA 3FTDA 3WL3A 4HNUA 1KP9A 4KBYA 2PL1A 3OCZA 2UYCA 2GXUA 2NGRA 4EQ6B 2YL2A 3ABSB 1V5WA 2YWDA 3UC9A 5CXUA 3QJGA 1QGYA 1JL3A 4YRSA 3QHPA 2ODQA 1G21B 4E5DA 3G2MA 1M1XB 5LFAA 3T7IA 4HH1A 4YI5A 3MAJA 2BI7A 3QMMA 4I7EA 4DARA 5A9TA 2Q9BA 5CNKA 4EGQA 4UM9B 3MEQA 1F20A 1R0LA 4LMPA 1DVRA 1XZLA 5GMOA 5C18A 1R0ZA 2OVFA 1CY8A 4BMOB 3K35A 3VYWA 5LIRA 2IDKA 1QHIA 5HQ3A 4PQRA 2PRJA 4MWBA 3L7MA 2V8OA 5IJWA 1TU4A 1L7VC 3BGOS 3CUTA 2HTFA 4REMA 5L3ZA 4ERXA 5ILOA 3COJA 2I9PA 2A9JA 1CVRA 2C8JA 4MH0R 4BLPA 2J67A 1GNPA 3MWEA 2BKEA 3K73O 4BCBA 4RVHA 2B21A 2QZPA 3DMPA 2VYCA 1HFKA 1U3UA 5DN6D 4M8KA 1RFLA 2D7CA 1MG5A 4O2AF 5HBGA 1SEPA 4ZVNA 1KE1A 1W7AA 1DS6A 1BXGA 3MWDB 1IWPB 5CVUA 5IJXA 2DPHA 2W2VA 4K9SA 4WADA 1JQ3A 3CIOA 1T6XA 2HBQA 3BMNB 3U13A 4MW7A 4BVBA 3D8RA 2Q4EA 2QMZA 1KXZA 1U0SY 3QV2A 4MXDA 4G4IA 4WNIA 4N0DA 5A0FA 3TBFA 4EPVA 5CDHA 4F45A 1H0KA 5E6RB 2DWOA 1KZ1A 3DFZA 3PQ6A 4CU5A 2PJRA 3EISA 4ZK6A 2DH5A 5AVXA 1D3AA 4QT4A 2PQ0A 1ZU5A 3JPWA 4A8TA 1GTRA 1OLXA 2CLFB 3EQ7A 3OKAA 4PHGA 2JA1A 3FR8A 4DA9A 5C80A 2ZB2A 2QT9A 2XA1A 4PZ9A 4UU0A 2P8SA 1NXQA 3RI3A 1JZSA 2WD8A 5AR1A 2C7BA 2FWIA 3D4BA 4WASA 4EMUA 3W5DA 4JLPA 2JG3A 1XNQB 3KR0A 3FTEA 4TMZA 3TPCA 4MYCA 2WHRA 1C9YA 3HR4A 1LPAB 3W5HA 4CEHB 4JLMA 4ZK2A 5A04A 4KXQA 5CX1A 2QLBA 4ZCPA 3HWRA 5AQ1A 1XPJA 3M6LA 1TLFA 3BUSA 1BE6A 1L4KA 5LZ8A 3ZV6A 4WEOA 1FYWA 1GL7A 3G5LA 1QVRA 3ZD6A 2QVXX 3IOYA 1NIPA 1P6XA 4QRDA 4YYZA 1JEEA 3JYPA 2R7KA 2CZQA 4PQYA 1OXXK 4HMPA 1R5BA 1FDUA 4UD6A 4ZDWA 1JJ7A 3X2SA 5JAOA 5JJ5A 3GJ3A 1HT0A 2HIHA 4O59O 2PN1A 2OOSA 3D1JA 3EIOA 3K5WA 4LOHA 3EOBI 3RSOA 3CLTC 1CYEA 3M0EA 2P9TA 5G1OA 5IU6A 5BVGB 2ZYTX 5B2EA 2HHHB 2QV7A 3RJTA 1L4GA 4CTNA 4G4SO 2DF8A 1MO3A 1Z6GA 4YRZA 3UHPA 3FOZA 2PA3A 5A3RA 5HGXA 1UBCA 2RHWA 1W9HA 4HH0A 4RZ2A 3ZWMA 2W43A 3N8DA 2FDCA 3PGLA 7MHTA 1XEXB 1KAMA 2H8KA 1FPMA 1PGQA 1GKUB 2ZBPA 5LDGA 2O7VA 2BEJA 4RZIA 5LDDC 1OREA 1USVA 4L85A 4FR5A 2NXJA 3ZWBA 1U1EA 1IJFA 1ZYUA 1OFHA 2RCYA 5DGCA 3V4FA 1JAYA 4ADSG 1IRXA 1ECCA 1N0HA 1XVAA 3DMDA 3EDQA 3IEUA 1Q22A 1M0TA 2YHIB 4V39A 4E1AA 2P11A 2QL6A 1M34A 3A1CA 4ZC1A 4A6XA 4JYMA 4BMDA 3Q7TA 2NTYC 2GEUA 4IXTA 3VPHA 4A6EA 4B2LA 1L8XA 4L4YA 4NBUA 5KVVA 1SVNA 3FPCA 1T3ZA 1IAQA 4QQKA 5EXXA 3SZOA 5AM0A 1FA9A 5LR6A 2C5SA 5JZMA 4B84A 4OQEA 1V8BA 4NCIA 5FR2A 1LXCA 2W6ID 5BPFA 4ENTA 4L74A 3L8MA 1CY6A 4IRUB 2FMFA 3R44A 3DBRA 1JXQA 3K2EA 2REXB 3WYNA 1KVSA 2QRMA 3H3JA 3STWA 1TZBA 3KT8A 4CMIA 3H2ZA 4I5DA 3AB7A 1TYEB 1R2QA 5B37A 2YXLA 1KQPA 2XNCA 3QWHA 3RDPA 1XN1A 1XR3A 2EXXA 4MR7B 2Q4OA 1WPRA 5LZ5A 2DTEA 2BZ1A 2CJFA 5FAKA 1WSDA 1XROA 1FXSA 1G18A 2QG9A 4Z9BA 3VA7A 1HUQA 1WOYA 2XITA 2I6FA 3EZGA 3QX7A 1XRLA 2R2GA 5E3JA 1E7RA 3R77A 3NS7A 1RE1A 1L9KA 2C0PA 3KEFA 4LV8B 1P29A 2ZIZA 5FXMA 4CF6A 5ADUS 5I7UA 1BE8A 4ESHA 1CHNA 3FJ1A 4TSFD 4QDUA 3GLGA 3HY6A 2CMHA 4OKNA 1ADBA 1SEVA 4I50A 4RAQA 3OIFA 4ZHQB 2QRVB 2OCXA 3F4BA 1N2CE 4OSPA 5F7ZA 5IUNC 1Q84A 5DTQA 2ZXUA 3STHA 1QHHA 3EBOA 3TLAA 4B4WA 1RFGE 5F4ZA 4K03A 4B40A 2QRKA 1VGRA 3HBJA 3PL5A 4HZUA 2IOFK 4DMLA 1DIGA 1C7ZA 2EWVA 4X1KB 5A3VA 1KOFA 1E8MA 4ZQEA 5TVKA 3NNNA 1IK4A 4UBJA 1QHSA 2FPRA 2R48A 3LL4A 2YW9A 3V2GA 3AILA 4P22A 4FS8A 4RFSB 2EZ8A 1PKXA 2J3IA 1RTTA 3KU4A 3EVTA 3CRQA 1GG8A 2BN4A 4O4IA 4Q7KA 3OCVA 5CVCA 4I1SA 3ZWXA 4D8TA 3AJ9A 1A71A 4F06A 1ZI9A 1CQIA 3QVMA 2NVUA 3S27A 2FY8A 3KKMA 1CUYA 1Z5UA 2AL7A 3KBBA 3MQ4A 1IMJA 3TF5A 4L5CA 3RYHB 3L7JA 2MWMA 4BYGA 5HSGA 3FYSA 1ZK0A 1B0UA 2OESA 2UYOA 3SN6A 4DIUA 3BWCA 3O2NA 3WOVA 3FR7A 4RVFA 4BVLA 2OXFA 2CLEB 1DRUA 2BFBB 3L82B 2B4AA 4MV8A 1G98A 3E70C 4BUZA 3BF7A 1YQUA 4FU0A 1IHOA 2VQSA 1MKYA 4WN9B 3TEMA 1E9FA 3B2QA 5KNBH 4X90A 2WU4A 3T15A 2G67A 2ZRLA 3KVRA 2IODA 3OEYA 1UBRS 4UM9D 3W2EA 1PV2A 3ZE6A 1KFBB 2FMXA 3EZNA 3ILHA 3LJKA 3V80A 4JU8A 4CLDA 5JU6A 2XTZA 4PLZA 4XUEA 2RBEA 2WR8A 5AHRA 1H1LA 2XNKA 4MR8B 2C57A 1DJPA 4IQ8A 2XWPA 3WBJA 4BV2A 1MC4A 3DDWA 4HQRA 4E51A 3VR6H 1QIMA 4CJXA 4RD1A 1Y8RB 2GBIA 1V11B 1KBOA 2HPVA 3SG0A 1EBUA 2WSYB 3MJRA 5J43A 1LWOA 3FF4A 3L7KA 4LNUB 1OKKA 3TK1A 4Z4QA 4JI0B 5BYBA 2HJRA 4UUPA 4EF6A 4KPUB 3OOSA 1NXPA 3QG1A 3ZY3A 3J80A 5BV7A 1HETA 1SAYA 2Q5HA 5BWLA 1YB4A 3B60A 3K05A 5D5PA 3QVOA 5H16A 4XYLA 1Y1SA 2P5YA 1JTEA 5ENVA 5AXBA 3U1VA 1DG9A 2HU5A 2P3LA 4OLAA 2DFNA 3WADA 1FZTA 1IOZA 4NL4H 4IHJA 5EYPB 1FSGA 4DC9A 1BHO1 3WP1B 5AI9A 1ZNYA 3QPCA 4M87A 5A3QA 3R9XA 3L6RA 5FBLB 3H99A 4FC6A 4DZZA 4AP5A 1P1KA 2UXCB 4O4LB 2QLNA 2YJGA 1YL5A 1OX5A 4B3FX 4C0SA 4ENSA 3IAS1 2WA1A 3SYRA 2JJ2D 1NVFA 3AV0B 3LC2O 1I7NA 3MCZA 5LN1A 1XD8A 3DOOA 4NNJA 5DI3B 4GNKA 1XAHA 2P77A 3OA0A 2VCYA 1KS2A 1Q7EA 3PICA 1ULTA 4QXRA 5C5CA 3AM3A 3COVA 3UWSA 4S1OA 1JLLB 2QY9A 2YHUA 2AF4C 4OATA 1W8DA 5LNK1 3U7JA 1G3UA 4AJ1A 2ZVQX 2V6FA 1J07A 1YHYA 3LZDA 5A5EA 1ZDMA 4HEA1 3FAKA 3I5YA 1RRPA 3WB1A 2E4VA 2ZJ3A 4NLLA 1GG9A 3L7OA 3TTSA 3ZHVA 3G9UA 3GDHA 2B6NA 2BFDB 5DISB 3H3XA 2E5LB 2QJRA 1O08A 5J4KA 3I2JA 5JAPA 1XPRA 2DERA 1BHQ1 1CP3A 5TGTA 2F4VB 1JKJA 3A6JA 1M34E 4LDPA 5J2UA 3PFFA 2REBA 4N5NA 3HH8A 4WDQA 3R8XA 3PX2A 3KB8A 1TQ2A 2X5NA 5DX8A 5BYJA 2WMOB 2FRVA 5KREA 1YI0A 3ELWA 4WSOA 1WXQA 3QLEA 1LPNA 4YO8A 4EQZA 3R41A 5A9SA 1YI8A 1HFWA 4ND6A 5ALUA 3B20A 4H9GA 5JFTA 2BM0A 1CRPA 1LBEA 4YY3B 4G07A 1G6Q1 1PJZA 4W1PA 2R6R1 3QLVC 1IIRA 3PB3A 1GT91 5J5VA 1B76A 2AUNA 4LE1A 4MIKA 3UHFA 2HY7A 4DMUB 5KWSA 4QATA 2XVZA 3PPXA 2QD1A 3GRZA 1W46A 3C3EA 4OQNA 1JQLB 1HQDA 1K3TA 2Q6KA 1RAGA 3DAYA 4A0SA 1GG5A 1FZQA 1HNWB 1CZUA 3IYLW 2GLTA 5JECA 1Y3DE 4HD8A 3NM6B 4MUKA 4FT2A 5L53A 1KAOA 4YMWA 1U9CA 4P38A 5JAMA 3SLRA 4F9FA 2X2FA 5F7JA 2C4MA 4ZOAA 1WP9A 3ZVLA 3TNFA 4EZIA 4WUTA 3T9EA 1A5BB 2ADMA 3VBCA 4L73A 3OX1A 4XDZA 4CMCA 1NTRA 4HDSA 3RTEA 2R84A 1TNDA 3LL7A 4PNEA 3NMUF 3WISA 3EBPA 5HK8A 1DAMA 1GG2A 1NVEA 1QIDA 3STUA 4DC0A 3P0RA 4XR9A 4CR6A 4OJNA 2A1UB 4ZCQA 2H1WA 4OTZA 2WYIA 4DM4A 2Z04A 4Y2XA 3GLGE 4NK4A 3WIOA 1U3VA 3DL2A 3PXBA 5ES3A 4G25A 3VHXA 2F8LA 3LOPA 1XQVA 1HDYA 2JA2A 4IJVA 2RONA 2J0QA 4PAOA 4L9AA 1MCZA 1TRKA 1CZNA 2GVDC 1G9XA 4MVJG 4JR1A 2PX5A 1GAJA 5EL0A 3GNLA 3HBNA 3L2OB 3DKKA 5BW4A 4X1YA 1JZQA 1NVUQ 3HCBA 1T91A 4XJVA 1MC8A 1BMDA 3GNQA 1R0SA 1KAQA 2JAHA 2PKYX 3HN7A 4NONA 1FMTA 4TXHA 3UV6A 4ACAA 1PV4A 2CB0A 3CUKA 4HUQA 4M60A 4LI3X 4G86A 1VE6A 2BYTA 1JVSA 1NE7A 5KVQA 1E0DA 1LBSA 3DGEC 4XE5A 2QTZA 5DX0A 3BH6A 3VR5H 2WA2A 1L8OA 4GXQA 2W2XA 3OSZA 2GF9A 2IHTA 1KERA 2F1KA 5HR5A 5JYCA 4F11A 3R8CA 3PJFA 2XNSA 4IUYA 1J8YF 1QHFA 5E7MA 4F9GA 4BGEA 4P36A 1B15A 4CM1A 1RYFA 2Y2UA 2Z30A 1AV6A 2X40A 1YJ5A 3DOIA 3LY5A 4C4YA 4E33A 4EHAA 3T7RA 1ZEMA 3WHIA 4F3YA 3LVBA 1J20A 2ZJ8A 3MJDA 1IXKA 5DB4A 3QJYA 2P3OA 1AVTA 4GRIA 1EVZA 3C6MA 1UXGA 4UBMA 4OK5A 2Q7OE 4DFDA 2BP7B 3ASZA 4R1PA 4QL3A 5AM5A 2JIDA 3DH0A 4Z0PA 1SXJC 3EPRA 4XUCA 2ZSHA 2CLCX 1SCNE 3F98A 4AUNA 4BX3A 3EWNA 2GF2A 4BFZA 2VZEA 3CQ9A 4R9UC 4B7CA 5B1SA 4BE4A 5EWLB 1ORDA 1MA0A 4O1IA 5KBYA 1TM7E 3LBIA 2YKGA 2QU8A 5LD2C 3DONA 3OZBA 3RARA 3RYCB 1VKHA 3QMPA 1QGDA 5EUCA 2BTQA 3B6KA 4RPHA 1KJ8A 3NM5A 4M4SA 2IEZA 1M3SA 2R8OA 2EF0A 1Z2NX 2C82A 4NVRA 4FN5A 4WESA 1O3YA 1Q77A 1II8B 3DAOA 2XKJE 3L1IA 4NEHB 3RKSA 5K8VA 4ZHQF 3G8CA 5DXAA 5IM5A 1TQ6A 3TB6A 1KEZA 4CV0A 4D02A 2J41A 3RF6A 3DTTA 4DW8A 3VYVA 2P2YA 4L22A 3LK7A 1YZYA 2COKA 1Z2EA 2R97A 1GFWA 1A5TA 3FSRA 5G2OA 4Z3OA 1KVRA 1Q0SA 1PK8A 3PDUA 3FDZB 4K9LA 2RHJA 4DM7A 4IXDA 2FPMA 3CRNA 2NOAA 4AY6A 2OGWA 2V6GA 2F62A 3TZ6A 2BWJA 3C3MA 4JITA 2QMOA 2PUCA 3DHWC 3GWZA 4FX5A 4C0KA 3VV3A 4JZKA 3WIBA 5CB4B 4Y8VA 1N1EA 4JQYA 1U7HA 3KYCB 2OXIA 3UT6A 1ENOA 1I4DD 2JIRA 4HAVA 2XIQA 3TQRA 3NOVA 1J7KA 2O8VA 4K9PA 5FUMA 5GGXA 1FTGA 3MRSA 3TG8A 3OIUA 5DHPA 1FTSA 2EJTA 2SBTA 3K0BA 4BJ1A 1L4FA 4HGOA 4H35A 4DPMA 1BFUA 1YGYA 1UXHA 3PBKA 2XCLA 3BH7A 4DV1B 3QLTA 4XFDA 1IDN1 1XJQA 2EWMA 1I1OA 5KQSA 1TFUA 1U2PA 1XBTA 1H2FA 2LCFA 3L6CA 3QPUA 2ZUEA 4GOOD 3HKDB 1HNNA 4D82A 4O6VA 3LV8A 1CJBA 4PR0A 3JAWB 5TE9A 4OREX 5K8IA 1GSAA 4JUAA 5K3FB 4CM8A 1N9KA 1NRWA 5F12A 1IDOA 4PYMA 2O8BB 3EPPA 3E03A 3QPAA 4FHEA 5C7OO 1CRZA 1EVIA 1XRNA 2XCUA 1TAHA 3ORRA 1R1DA 4QXMA 4REQB 1BTOA 1DC5A 1IB0A 1IPHA 1GQOA 2C84A 2HBRA 2ONYA 3UHAA 4F5EA 1UKEA 4QFDA 1JEDA 4D0RA 1QIFA 1U1IA 4BKUA 1JHZA 5IZCC 4CL2A 2IXEA 5FCDA 1GFZA 5BN1A 4FGLA 2VVTA 3U7QB 2WP0A 3CZAA 3NHWA 4TWBA 4TVOA 4ZANA 5HWSA 5KTMA 4LV6A 1FE8A 2OZKA 4RD3A 3VSCA 1P7WA 4A73A 2JS7A 3GVIA 5CP8A 4CTOA 5B4VA 2QTNA 4QE3A 5DM4A 2H3EA 4P58A 3NGXA 4ALLA 2Q3LA 1I4EB 1E92A 5HX7A 1CRWG 4M9SA 2A58A 4ZHSA 3EIFA 1J56A 4FYJA 2ZWOA 1AHNA 4FCCA 3ZC3A 1R0KA 3WP0A 3IIMA 4FYWA 4EYSA 5ECGC 1T6NA 1FF9A 1MEOA 1HY3A 4YROA 5EWJA 4N0EA 3TZLA 1YZUA 3HNOA 1RCTE 3TX2A 4O8CA 5EHXA 1KQ3A 1FJXA 2MMCA 2UZAA 3ITNA 4E70A 1W30A 3TPZA 1ZW1A 2HI0A 1Y7IA 4Y30A 3W3ZB 4C0QC 5BV2P 4WUVA 1GDDA 1KMMA 3MINA 3RAPR 1ZS9A 3G0HA 4LFBB 2R00C 1AXRA 3E2MA 3RT7A 2OD7A 3L0PA 4RIGA 1K6XA 1OA1A 1M7HA 1F2UB 5REQA 1PAUA 1E1KA 2VHYA 221PA 3L8DA 4O1HA 4QU9A 5H5JA 3QWBA 2ZOSA 3ORSA 4P3YA 4R2XA 4CQLA 4FLFA 3DZDA 1DFIA 4IP0A 3PI6A 4FI3C 3D8NA 4B4UA 2WV9A 3C41J 4MR9A 3I61A 3O94A 3EEBA 3CX4A 2I8AA 3CVJA 2YWBA 3CPEA 5L6LB 1RU3A 4FCTA 4Y0VA 4Q7QA 3FPKA 2X1MA 4UDYX 3ROMA 2Q28A 2CLSA 4JLNA 2GCOB 3WGOA 2WAXA 1BOFA 2ATXA 3ZZ1A 4FT4A 1OWLA 2P78A 3NHKA 5DVZA 3V8BA 5A0VA 3DEIA 4HDMA 3G7NA 1R9MA 2OKGA 2ZSDA 3Q8XB 2ZROA 4RYLA 2DHQA 1ZY2A 1T8TA 1WW8A 2EYQA 3UANA 1MPXA 2B83A 4MOWA 5D51S 3F8WA 1T8UA 3R5SA 5JVDA 4DTCA 1N32B 1JR2A 2VBCA 2VK4A 5JBIA 1GPLA 2FA9A 3C97A 3PXXA 4IHJF 4XGRA 5EJAA 3H9JA 3U7IA 3K9GA 5K0NA 3KFLA 4YTEA 3N0WA 4E2XA 5A6VA 2XA2A 3ZXSA 4IVRA 4EA9A 4ZIRA 6YASA 2J5RA 4AUMA 1ZVVA 2JASA 5IX8A 3T35A 4CKWA 3PC3A 1EFUA 3HXTA 1FRFS 4H18A 4EJ6A 4FYYA 1O8CA 2FGJA 3GROA 4MGHA 4MIOA 1GZDA 3WA7A 4NPAA 1Y4SA 4IQFA 1UBMS 2KWIA 2OFPA 4ZCLA 3G9QA 4OFWA 3CKYA 3F78A 3NBXX 3X1DA 4BX8A 2RH8A 3HI6A 4HNVA 4TYMA 1YZLA 2F8TA 2NTNA 4NDAA 4KIFA 1G7SA 2H9YA 1R6AA 1CR0A 4A82A 1OLUB 3DWIA 1E7SA 3VH3A 5KYKA 3PD0A 4D3FA 1MAUA 2I1LA 3T5BA 1C41A 1GNTA 1TYZA 5JANA 1K6MA 5AOBA 3LKDA 4CL3A 2PGNA 4Y2TA 5LZ7A 1FS5A 1E2QA 2YJNA 3KZXA 4YLEA 1KPHA 4IVNA 2G83A 1CNFA 3RVOA 2MJLA 3CNEA 1SBHA 1F4VA 3HC7A 4HLUC 5HKLA 5CA1B 1JILA 4EUFA 2MT9A 2W00A 1T26A 1P6UA 1KY5A 1XA0A 1XXHA 3FUUA 4NFLA 5IKXA 3DYVA 2FOLA 2UUBB 1FVOA 3H13A 4OX9Y 3JQBA 4YAKA 2D06A 2O1XA 2PPVA 3O3MB 2PT5A 3PC8C 4YCNA 4Z7QB 2YJ5A 3IKJA 2GSDA 3U5TA 1ESEA 4A26A 5YASA 1DB3A 2PGAA 2EW1A 3N2GB 4L8WB 3HDGA 1EK2A 1F8FA 4KQCA 3PNYA 2XI4A 4W7SA 3RTDA 4Z0HO 3A10A 4MRRA 1PUXA 4WKOA 2D5BA 1FTQA 5C4IA 4NFYA 1WZ2A 5IRCD 1Y80A 1LDMA 4H6XA 4N82A 2Y1LA 2PX8A 3NBFA 4L1KA 4MZDA 3HN2A 3HY4A 2RKOA 4UCWA 2NSLA 4NDNE 1P2UA 5JARA 2FSVA 3EGXA 1GYPA 2EVWX 5DHRA 2H3HA 1FFCA 1MGOA 3LSTA 4Z8XA 3SKVA 1NPTO 3DTVD 3VNQA 2OORA 1ACJA 1I9CA 4XXHA 2JATA 5GONF 4Q9DA 2IHYA 3NTLA 1YQDA 4K3VA 5KTYA 3QXGA 3VC2A 3I09A 3LS2A 2BDUA 4X00A 1Y37A 1PYOA 3GX1A 4D7AA 2Q4BA 1O57A 1BQEA 4YMHA 2H0RA 2QT1A 3GG2A 4GI2A 3D4NA 1XKLA 3IV9A 3OWXA 2VF4X 1KDOA 3BIOA 1N6KA 5HE8A 4H6PA 1CLEA 4GIBA 2ADOA 4MTCA 4D98A 2PAFA 4EG8A 1MZVA 4Q9NA 2YJ3A 5CCDA 3RBZA 5JPCA 1HE8B 1TA4A 2WWYA 4F97A 2VT7A 3IPCA 5BSTA 1ECFA 1QQ6A 1RAEA 2YC4C 3VU8A 4G0VA 4NEGA 2MSNA 4H1UA 4PC2A 1PTKA 1RYMA 1SOVA 3RS0A 4WWHA 3U3JA 5BW5A 1V4VA 4OHUA 5HTOA 5F77A 5JNLA 4TKUB 3GPCA 3K8YA 5ISMA 2P2ZA 3QWAA 2Z2JA 3GL9A 4NOJA 1W2GA 3KB1A 1J6UA 1E3WA 2I34A 1N5LA 4G3XA 2CBXA 1VECA 4H4EA 4X1IA 3VSAA 3E8XA 1JSLA 4X44A 3AHIA 1U2RA 4XPIB 3HB7A 3BL6A 4RKFA 2FXIA 1Y1QA 4YJ2A 3BWDD 4PU0A 4FZVA 5HKAA 3S6JA 3PUWA 1PR9A 1T36B 5FT9A 4C14A 4XWOA 1T9HA 3EMKA 4G8DA 1A9OA 4MB0A 2R3SA 3D6NB 2NXEA 3UMFA 5I7FA 5A5GA 5CD1A 2ZZMA 1K6EA 3B9QA 3NAZA 1PYDA 3TGLA 1HZJA 4XIGS 2P7HA 4C4TA 3VPDA 5LPNA 4YCAA 1RLUA 3R0QA 4WCFA 4XVCA 4DB2A 5CXXA 4BC0A 3OAAD 3AUJB 2HWWA 1PW7A 2D5IA 1ZCFA 2YHAA 1ZCZA 3N28A 4DABA 2P8JA 2JCYA 1D4ZA 2P9FA 2DBVO 3HYRA 1HX7A 1JF8A 4JL5A 1UZAA 3EXHC 1M5RA 1LVGA 3Q7PA 2Z4SA 2GO1A 3URMA 3NDJA 5GAJA 4KE9A 4PZDA 2AFRA 4Q47A 4AJNA 4IJ5A 4ZRNA 1VLQA 2CL5A 4IDEA 2VYQA 3LXUX 2PJDA 4B6FA 4H4DA 1NTOA 1NULA 4OXXA 5JQWA 4RQUA 4CM9D 1SR8A 3G2NA 2J9FB 4PAGA 1SOAA 2Q46A 3FDFA 3QUAA 4I5IA 1I36A 4B2IA 5CB4F 2YIDA 2B78A 1I1HA 1MDBA 4JGBA 4DRXA 1MX3A 5HPYB 4E5NA 1AMNA 4MGZR 3AG6A 1U2GA 5CHYA 2XGOA 1UWVA 1WOMA 5JWHA 5ALLA 2J0EA 3EFHA 3UW1A 1ORIA 3JYOA 1BWSA 1CUFA 1QCYA 2X0IA 2ESRA 3ZQKA 3DMFA 1RQLA 3JALA 1GTMA 3MYRA 3AR4A 1Q3TA 2NZJA 3N53A 3FB1A 1KEUA 1HT3A 3FF1A 4QQRA 3UWPA 3WO0A 4DLLA 5BWMA 5TQ2B 1GA4A 1HWYA 3IDFA 3DAPA 4J7AA 1Y3FE 4J0EA 4IS2A 1AG9A 1OHHD 4PTLA 1L3IA 2BTOA 2HDOA 4H7KA 4ZP1A 3ZHYA 2EEPA 2GZ3A 1NW7A 3I3SR 6Q21A 5JZOA 1I8TA 2EW2A 4MMYB 3NIWA 2AHRA 3Q98A 1GGVA 2YHBA 1XP8A 1KO7A 2ZYDA 4NAHA 4HNTA 2WWWA 2HWXA 4WLNA 2DQKA 1F6DA 1VKJA 4HBZA 4RK4A 1MB0A 1U2QA 2C31A 2V96A 4WLFA 3CR7A 4KJZA 1T3TA 4QBTA 1T9CA 1E9VA 1HMYA 1DC3A 1I6LA 2GNAA 5JSQA 1WZUA 2X3FA 4AG3A 4C4XA 3HNRA 3GLVA 4YMGA 1HE1C 1U04A 2O2YA 3GBVA 4LCEA 1T2NA 1P3JA 4Z54A 3MJFA 2VDNB 4L4SA 1LS1A 2IP2A 4ZQGA 2DBRA 2JCSA 2OCGA 3MCVA 3EE6A 4YJ3B 3K70D 1D2HA 1SFRA 4BNTA 2FMIA 3P4UA 2E89A 4QHSA 3ZPXA 4P98A 4A7PA 4PGFA 2ZTMA 1YJXA 1DAEA 1U8YA 2J6IA 3LXRA 5EHGA 3WFJA 5A4FS 3W3AA 3KQNA 4PCVA 1YCFA 1BU8A 1MH1A 3BHNA 4FHGA 1ADFA 3G9XA 3R0VA 4RYDA 1Z2OX 1SY7A 2FPUA 4KW7A 4EW6A 2P2DA 4IGFA 1ABEA 1JJVA 2CNNA 1MJHA 2ISCA 4TLAA 4WOKA 4CLRB 4ER0A 2CDBA 2W90A 1XZGA 1FRVA 1MA3A 3R3UA 1XXHE 5EZ6B 4BFWA 1TZMA 2FI1A 1GUFA 2PHZA 4MRMA 1P61B 4YRCA 3UCFA 4EM6A 1ZH4A 1J2RA 4G23