2UZ1A

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BENZALDEHYDE LYASE
publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 187
structure length 554
sequence length 554
chains with identical sequence D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1A02
3ZG6A 1X7WA 3HYLA 2BFEB 4MZXA 5EJ9A 2OD2A 1S7GA 1D4OA 1U5BA 4Y6QA 1QS0B 1Y9DA 4JSRA 4BVBA 1V16B 1TKAA 4IF6A 3EXEA 5ERXA 5FYQA 4F4UA 4UTRA 2VBFA 4KXQA 3LQ2A 1OZGA 1S5PA 1UMBA 1V1RA 5K3SA 5ESDA 5BWLA 1PO7A 2OZLB 2C42A 4V1CA 2DJIA 1HZZC 5DGDA 1W85A 4KXUA 1M2KA 1OLUB 1KEKA 2G25A 3K35A 1YI0A 1QPBA 2VK8A 1YHYA 3ZHRA 5K2OA 2H4FA 2JI9A 2BFBA 5HHTA 1X7ZA 1WCIB 3JR3A 4KXXA 2JI7A 3U3DA 2Q5JA 1W88A 1IK6A 2BFDA 1YC2A 4RJJA 4KGDA 2IHVA 4GG1A 4K9KA 1T9BA 3DVAB 2H2GA 1T9AA 4K9MA 1M2HA 4QELA 1Q6ZA 3FLMA 2NYRA 2XTAA 4JUAA 5IMSA 5MFPA 4K9LA 4L2IA 2O1SA 2C3MA 3AHFA 4ZP1A 2VBGA 2WVAA 1TKCA 1NM5C 3FSJX 4FZ3A 4UUAA 3M7IA 5MGNA 4UTNA 3ZGVA 2X7JA 1L8AA 2G67A 2R8PA 4TWIA 1Z8NA 4R8MA 1NI4A 1DTWB 1X7YA 2EZUA 3GLSA 1XLTC 3RIGA 1PNOA 1SZCA 2W93A 4KPUA 1UMCA 4QPZA 4K9QA 3LQ1A 4RMGA 4GM0A 3DUFA 3ZHQA 1B0PA 4X3OA 2BEUB 1Q1AA 4UTXA 4RJKA 1BFDA 4D5GA 5HYVA 3LPLA 1T9DA 4GP9A 2BRUC 2QTAA 2VBIA 5BWNA 1YTLA 2BP7B 4BVGA 4BN5A 1X80A 1M2JA 1EFPA 5MFZA 2BEVB 5I51A 4BV2A 1ITZA 4UTZA 1YNOA 1PT9A 3PKJA 2UZAA 4KXVA 1OLXA 4JU9A 4TWJA 1OZHA 1OLUA 1U2DC 4JUDX 3AHJA 3F6BX 2AG0A 1M2NA 2R8OA 2VJYA 2NXWA 1M2GA 3DV0A 3E9YA 2B4YA 2VK4A 3AHCA 5EXEA 2JGDB 1X7WB 1X7XB 2XT9A 2IHTA 4JT8A 5DEIA 3EXHC 1N0HA 1J8FA 1POXA 1YHZA 1T9CA 2FN3A 4D5EA 2VK1A 4C7VA 4UU7A 4Y6OA 4GM1A 1PVDA 3EXG2 5K6RA 1UMBB 2JLCA 5EJAA 1PYDA 2J9FB 1PI3A 1V1RB 2E6KA 2JI8A 1UMDB 3D81A 4HD8A 2BEWB 4V1CB 4RJIA 3EXIB 3ZHTA 1OVMA 2H2IA 2BFCB 3D4BA 2AG1A 3EXG1 1NGSA 3CLSD 5AHKA 3EXHA 3RIMA 1OLSB 1DJLA 3OOYA 4JD5A 1X7ZB 5DGTA 2PGOA 2UZ1B 1W88B 2BFDB 1YC5A 2O1XA 5I5GA 3GLRA 4Y6LA 4F56A 2C3PA 3ZHUA 5EJ6A 1V11A 3CF4G 1UM9A 3OE1A 2C31A 4GPEA 5MF6A 5D7NA 1U31A 3GLUA 1V1MB 2A1UA 4J1TC 4BV3A 2BFFB 3EXFB 2PDAA 1EFVA 1UPCA 1OZFA 4MPPA 2WVGA 3EA4A 5EJ4A 1U2GC 4G1CA 4K9NA 4COKA 4JT9A 4ZZIA 1U28C 4WBXC 3CLRD 4FVTA 2BFEA 2EZ9A 1NI4B 1X7YB 5EXDA 2EZ4A 2QTCA 2JI6A 2JLAA 1UPBA 3PDHA 1QS0A 4MPJA 1V16A 2Q28A 1UPAA 2FRDC 2Q27A 4O8ZA 1GPUA 4GM4A 2A1TR 1ZPDA 2C3UA 3DUFB 2PGNA 4XEUA 2OZLA 2OO5C 4RMIA 5ERYA 4C78A 3L84A 4JUBA 1X7XA 5BWOA 2R5NA 2C3YA 3AI7A 3ZHSA 1MCZA 3HWX1 2H2DA 1WCIA 3MOSA 4KXWA 4FEEA 1X80B 3AHHA 4BN4A 2XT6A 4JU8A 3UK1A 2OORC 4IG9A 2Q5OA 2EZTA 4I5IA 3ZGOA 3DVAA 2J9FA 4K9OA 5HJEA 1U5BB 1UMDA 4KXYA 2IHUA 3AHDA 2FSVC 2BEWA 3AHIA 3EXEB 4HDAA 3EXIA 4IAOA 2BFCA 1OLXB 4UU8A 3KOMA 1R9JA 4BVEA 4MPRA 1YBHA 1E3TA 1O96B 3RIYA 3IAFA 4RMJA 3DV0B 4J16C 5EJ7A 3CLUD 1AY0A 1OLSA 1RP7A 1W85B 2YIDA 4L3OA 4FEGA 1MA3A 4BUZA 2UZ1A 3EY9A 1V5FA 3EYAA 3ZHVA 2Y0PA 3AHEA 3M6LA 2G28A 2H2FA 1DTWA 4V1CI 1TKBA 2WVHA 2BFBB 2OD7A 1V1MA 3U31A 1ICIA 3M49A 5EJ5A 4UUBA 3LQ4A 4K9PA 2BFFA 2QQFA 3EXFA 3D7KA 1YD7A 1POWA 3HWWA 2BEUA 2H2HA 2H4JA 5EJ8A 2V3WA 1V5GA 3CLTD 3AHGA 1PTJC 1O97D 4MQ5A 3M34A 2YICA 4X3PA 1PNQA 2FR8C 4QQ8A 1SZDA 3EXHB 3GLTA 2JIBA 1YI1A 2BP7A 5FEMA 4JUFA 1Q14A 4UTVA 2H4HA 3FZNA 4BVHA 1JSCA 2Q29A 2Q5LA 1V11B 2BEVA 4Q9DA 1UM9B 5I4IA 2OD9A 4BVFA 3PKIA 2H59A 2Q5QA 1QGDA 3F6EX 2QQGA 1TRKA 4RMHA 2C3OA 2IEAA 4JUCA 5C4IA 4C7XA 1UMCB 1V5EA 2PANA 5K6TA 5I5EA 3UPTA 3JWPA 2FWNA 3IAEA 1Q17A 4C7BA 2EZ8A 2HJHA 5HGXA 5EJMA 2JGDA
chains in the Genus database with same CATH superfamily
2ZRIA 3FI9A 4IMJB 3OIVA 1ADGA 1JLSA 4M0CA 5B1SA 1XTPA 1JWAB 1ONOA 2B2CA 3NHYA 5CH3A 2X0RA 4OXYA 1H4SA 1NE2A 2IZ1A 3C4JA 1JR3A 2WKRA 3QE0A 4J49A 2PUWA 4RESA 1S7GA 2VP3A 2IHKA 1NW3A 2UDPA 3G89A 2FR0A 2A30A 4H31A 1TU0A 2H07A 1HF3A 3K0AB 1K68A 1Q16A 5DI3A 4H9GA 5JDIC 3LD9A 4BUJA 1RTKA 3K1JA 1OBOA 1R64A 2CLIB 2QRGA 1QOZA 3I2GA 1N7GA 2H2AA 2OM2A 5ERXA 3UBMA 3VH2A 2XYVA 4DJEC 4UTRA 5IYZB 1X1CA 4ZU6X 2CBXA 3SXUA 4KXQA 3LQ2A 4QJBA 5T7BA 4IDOA 1H2XA 2XX3A 5JASA 3BXPA 5CYGA 5HGJA 3COWA 3RFXA 4DANA 3U16A 1XDGA 4EJ6A 1WD5A 1IZZA 2ZK7A 2EIXA 4ER7A 2VDPB 3JQAD 5A3SA 2DJIA 5CX4A 1QG0A 3JQFC 3LPNA 4EQ6A 1N4DA 2QZJA 1PJTA 5ALPA 2PVSA 1DUIA 3SQOA 1MZVA 1KVQA 1YQDA 3K35A 3T9BA 5A9SB 4RH1A 1COWA 4R2LA 1Y37A 2IH4A 2Q9CA 1YHYA 2CNNA 3ZHRA 3IEVA 3GYBA 4LJ8A 3HLTA 3EWSA 4J7AA 1RJ9A 3H6GA 1NURA 4YP9A 2ZSBA 5AKZA 5KVQA 1F20A 5L4LA 2GEKA 5GMOA 5CCEA 5AVZA 1WV1A 2BI8A 2HCRA 3BMQB 2YJTD 1IK6A 3WYNA 1E1RA 1NYLA 4GKJB 2G17A 3I42A 3S2EA 1BVUA 1JA1A 1KI8A 2B7BA 4J4BA 1L7VC 1ODSA 5G1NA 2B0CA 2C58A 3CZ5A 4BE4A 1NXVA 5BUZA 2WD7A 3Q7IA 5KNCD 1QVZA 1VFPA 4RH3A 1PK7A 2BEJA 2AI3A 3M5DA 1N75A 4GHWA 2MR6A 2O1EA 1HT0A 3JZAA 4GXTA 5J4VA 5ENVA 3TZKA 1MAAA 3NVKI 1RQ2A 3OCYA 4C0JA 4UAUA 4CQMD 2FF5A 3FLMA 2EJVA 2XYGA 3KPUA 1PL6A 3PNMA 1G6Q1 5JAIA 5M7EA 1QRTA 2UZ4A 4FNMA 1E3IA 3L5OA 2Q5IA 2O1SA 1CUWA 3S8EA 3Q88A 2ZSFA 1C8LA 2JFOA 3GDOA 3L2OB 3V00A 2WSSD 5CJJA 3GIDA 2IXAA 2VAPA 1C1DA 3HLKA 3DE0X 5IP5A 2CYAA 4H18A 1I32A 3TD2A 5F7OA 2HJVA 3U4GA 2QZZA 4ZO4A 3AGPA 3CX7A 2JGNA 1GARA 2Z2XA 3HS3A 4JBHA 4YGYA 5MGNA 3M3DA 2P5SA 5JRDS 3GGDA 4PCLA 3TS1A 1PQYA 2D8AA 4NYJQ 3KQMA 1J5EB 1HI9A 3OFND 1VPTA 4ZYTA 1VOTA 1Z8NA 1ZGGA 5U9CA 4G37A 2HHLA 3KP1A 4KVFA 1QDUA 1ZYUA 3JQGB 1VSQA 2I7DA 4L15A 4WW0A 1CQIB 2EFDB 3SJZA 1HXHA 1K6MA 3I2YX 5ALIA 2Z3VA 4DARA 4KLNA 1L4FA 3E9QA 3GA0A 5KYYA 2WMDA 4A91A 4IEEA 3KDSE 3SHWA 3EZXA 2QLMA 4J0HA 2Y92A 3ZWOA 3HYCA 3ND5A 1ND5A 1Z4QA 1W19A 4M0PA 5TJ9A 4C3ZA 1D2NA 3GDWA 5D00A 3K20A 5LUAA 1R0YA 1RHJA 4OUDA 1R0KA 2GPNA 4B5LA 1W4AA 2W4QA 4DLAA 5HQ3B 3D64A 1DWPA 3R44A 3A1TA 1ZGJA 1E6KA 2IP2A 3L7CA 1G3UA 1V3TA 1ZJ6A 2EFGA 2QNBA 3HCRA 4FR0A 4QUBA 4X7MA 1WKBA 2IELA 2XUHA 3B6ZA 3FF4A 4GI1A 4BKPA 3AVXA 3U7FB 4YRQA 4OKSA 5BOSA 3IRVA 4NK4A 5CA1A 2NVOA 3UK6A 2PXCA 3HU3A 5AVRA 2HTEA 2C2GA 5MN6A 1X94A 4BBZA 3I58A 4GP9A 3JAKB 2CNWA 3GJSA 3LXRA 2DY0A 5BWNA 5E9AA 5CVJA 3TUJC 1BRMA 2WRZA 2XB6A 4EM6A 3GJ4A 2FOIA 4NBNA 1XQ6A 2C7PA 1RHRA 1SBIA 2QT0A 5JDCC 4A5SA 1PKEA 2YQ4A 1SU4A 2FQWA 2Q4DA 2WU3A 5GGYA 2K7FA 1GPLA 2ATEA 1ODIA 3R6LA 4NFYA 3ZY2A 1RAAA 5GADl 3NC0C 1CJTC 2GZ3A 4F0JA 4IJUA 3K9NA 3MA0A 5K45A 3ZU3A 1ITZA 1NVFA 1QFJA 1PGJA 1DUSA 3DEHA 3PNQA 1I2ZA 3NBUA 4O4LA 3AUKA 4P92A 4W7SA 2BGUA 4LHZA 1QHXA 4AG3A 1YNOA 2IZ6A 5J3JA 1OBCA 1X1TA 3FSGA 4AMUA 4X6LA 1H05A 1SVSA 4QATA 1NNUA 2VUIB 4HEHA 3AR8A 4EB3A 2G9VA 2QRJA 1TK3A 1WXGA 1EQAA 2ZJBA 1OLUA 2GESA 1KDTA 4CG1A 1TGYA 2V7XA 1T0PA 4MCHA 4L6CA 1U2PA 3EVNA 1EKXA 2ZB4A 1O87A 4D26A 4LJSA 2Y66A 4NPAA 1MT3A 2EWWA 1KPHA 2J8ZA 4K46A 1RLJA 4U0KA 4ZK6A 5INTA 3HKEA 4UFOA 1OASA 3G02A 3AG6A 4PONA 2QU8A 4K2HA 1SOVA 3GFQA 3SYLA 1J1UA 3ZVMA 3N0WA 5K0SA 3O03A 3NEYA 2DG2A 3Q3VA 4FYWA 1RRMA 1OFIA 3VJMA 1PJBA 4BVJA 3F3KA 4U2KA 4JXXA 1YL7A 1VL8A 3SLRA 3TR6A 5J2UA 2P9GA 3BK1A 4LTDA 5EN4A 5GONF 5IT9A 1Z88A 4QOEA 1YBAA 3O8QB 2B99A 3N87A 1POXA 5LQNA 4MW6A 1AKVA 1YL6A 1YHZA 4XDHA 4ARVA 2HMTA 2WHXA 3IP7A 1KDZA 1ULTA 1ZXLA 1A7AA 1L0BA 3L02A 4CCAA 2UYHA 5CFOA 2BBWA 4EF4A 5GY7A 1QJCA 3I1YA 5IJWA 2VXOA 3DZIA 4DRYA 1BYIA 1V1RB 3DVRX 2MJLA 3L18A 5KOHB 1KZ1A 3DE1X 1PR9A 4GOXA 3X0DA 2BEWB 3I34X 3N05A 3TECE 1H8EA 1KAGA 3UUGA 4D6XA 2EDCA 2XKKA 1X8XA 1FS6A 5DK6A 2BM9A 1YK1A 3CM0A 3KU4A 3U61B 4DE5A 2AG1A 4RM2A 4RF3A 3FR8A 3ZGNA 3FPBA 2L69A 4WHMA 4N7BA 4DY6A 2PWPA 4WY8A 2PIAA 4R3UC 5EP4A 1E64A 3UT0A 5LSAA 1NR7A 5ABPA 3K1AB 5HJ5A 1JPNA 3F3MA 4M54A 4JS0A 1DX6A 4RK0A 1AGXA 1FTSA 2AVDA 1TJYA 1L5YA 3TSWA 1NXWA 1GN9A 2ZB2A 1UWCA 3OPYI 4U1RA 3RK4A 3UYLA 5BNZA 2E2WA 3QEKA 4R9VA 1JYSA 1U7WA 2JL1A 2WW8A 3BYZA 3ZE8A 3PQ5A 3WKBA 2BFDB 3G8DA 4WDRA 1KK3A 3PPXA 4TUYF 1XI2A 2ZJYA 2V9CA 3OBBA 1GCGA 2PT5A 3KLBA 4G0PA 4IS2A 3LL7A 2P78A 4OI4A 5EI5A 1PJLA 4BKMA 4MW1A 1UK6A 4ROTA 2X6QA 2GNAA 2I99A 4BNMA 2R7MA 4CJXA 1F38A 4Q9HA 3L92A 1H3EA 1C9NA 3GG9A 4DLPA 1NR5A 2W6MA 2XD4A 3A1FA 5CNIA 4RTRA 2XDYA 3E70C 1LFAA 5HX7A 2HPZA 3IXMA 2QYOA 3MSCA 4XA8A 1MN6A 1J7KA 4N47A 3JD2A 4GLBA 1KQGA 1PJCA 4UFNA 4FFSA 4PYQA 5KTNA 1GXSA 3FW1A 5D87A 1AGNA 2C95A 1JPVA 3HJNA 3EUAA 4ZZIA 1KZ9A 1XX6A 3KK0A 5B2ZA 3S8YA 3V7YA 1B3BA 2R7AA 4H7HA 1ESNA 2DFDA 3L6RA 1XEXA 3EUFA 1D5WA 2ZYRA 5DYTA 2HH9A 5ERGB 2GETA 3SIPA 1RQNA 4A16A 4F9EA 2QVXX 4IX1A 3TDNA 1RWVA 4LOIA 5EWMA 2DQKA 4PLZA 3DFFA 4WDQA 2IYFA 1FFBA 3DE7X 3OCUA 4NBUA 4WXHA 3IUQA 1QLJA 4DUGA 1REQA 3AJ8A 5C5CA 1XA3A 5KIAA 3WKEA 1TIBA 1JHMA 1AKQA 3V34A 2J85A 2Q28A 2VHVA 4NMMA 5DNAA 2CNDA 2QLFA 1TO1E 1PZGA 2F1KA 2P6PA 3LPAA 2QLNA 3LTNC 1PV1A 2Q27A 3I62A 4YCBA 4I4IA 5A7FA 3NM6B 4GM4A 4QNMA 3BXHA 3KRTA 2Z43A 2RHJA 2OECA 3MMZA 3IPXA 3QWAA 4H7KA 4IIFA 5PNTA 4E1BA 5KYXA 4FMBB 5CGZA 1CUZA 4HDRA 4PXSA 3VPDA 2ODEA 2W2XA 4A26A 4JLJA 3RQSA 2GCIA 1KH1A 2V96A 4IVNA 5JZVA 1N5MA 5HK8A 2YOGA 3CH4B 4MK4A 2TECE 4MIEA 4NNPA 2W9XA 3QEOA 2RK3A 3BWYA 2A92A 5G0WA 5JFTA 1KK0A 4A9AA 5BWOA 3OIFA 3C5WP 1XTRA 5CVEA 4KFTA 2PS9A 1T2CA 3BDVA 1ZRHA 4OIMA 1VCMA 3OHPA 3G0CA 5EUQB 5CB4B 2FRXA 4JNCA 2R11A 1YBFA 4KXWA 5AQEA 2O3RA 3FDZA 1KZHA 2QTFA 3P32A 3O3CA 5CDHA 3RAEC 2WV7A 5E6SA 2B30A 2HKIA 4XYBA 1C7FA 2R6JA 2OORC 4MW5A 2O0MA 1N5OX 1TMKA 2BDTA 2Q1XA 1SB8A 3SXPA 5A03A 4HR7A 1SCJA 4R2XA 1FVFA 3MINA 5DI3B 1ST3A 2JFHA 3A70A 4S2EA 4UHEA 1MKYA 2OXCA 3DQPA 4GOOD 1YMQA 2XXBA 4KN5A 4QFMA 5CM9C 3VJKA 4ZDJA 4JJKA 4YNBA 5L40A 5DBIA 3SXUB 2I80A 3QBEA 1V5IA 4HB0A 1L5KA 5LZ7A 3OWHA 4GNKA 3JCZA 4PGAA 5MHTA 1WO8A 4HFJA 4P0TA 3A1NA 4ZRNA 2B78A 4E2XA 2AXPA 3PNBA 5REQB 4JP8A 1QIIA 3DV0B 4P98A 5CG2A 1L5RA 1AY0A 2OUIA 5KQMA 1RP7A 3G9UA 5EJFA 3R6DA 5CGQB 5HM8A 2WSYB 3K72B 4AN0A 4JLMA 4ZVOA 3BMCA 4E33A 4J7CA 4XIJA 1IM5A 1Z29A 1O6GA 5DW3A 2G40A 1ZRMA 1MX3A 4US1R 5LOVB 3K1YA 3PICA 3C3KA 1F12A 1HY3A 1U8UA 1ZCFA 1UK7A 4F2HA 3H6HA 3L4SO 1EGAA 5SZJA 4O4IB 2Z6AA 3NIFB 1WXIA 5EOVA 2PQ6A 2Q3LA 4H6XA 3RU2A 3W90A 4P4SB 3IDQA 5TR9A 2VS1A 3WGOA 5CCBA 5BMOA 2IBTA 1U8ZA 4PZDA 2WD7B 1PD0A 3OJFA 2XVYA 2Y68A 2MMCA 1CR2A 4BZZA 3GY0A 4OB7A 1CUXA 3GLKA 4HLCA 1MAWA 1NUQA 5E1BA 3LUCA 1EMDA 2OHFA 3ZK8A 2WM3A 4NYMR 4RFVA 4Q1VA 5GJCA 5I3ZA 2H1RA 1J2UA 1NW8A 4MAFA 4O2BA 1OJ7A 4IJ6A 1LS6A 4KR3A 2CZCA 3FZGA 4Z51A 1MXHA 4M7PA 3CEAA 3M34A 2Y67A 3SHTA 2A9KA 2EERA 4HDNB 1T5IA 3KT6A 2PTHA 3KUUA 3MCVA 1J33A 2QL9A 4GPD1 4IIHA 2Q3JA 4HPWA 1Z07A 4JKOA 4WX2B 3QBVA 3VOAA 3I9NA 1E5TA 4AF7A 1JG2A 3GLTA 2ACEA 3CO5A 1RP1A 1SUDA 4QZVA 3VR5H 4YBZA 1JWBB 1O6FA 1UODA 2FWMX 2IOFK 2W0SA 3A27A 4HQNA 1YR7A 3LS2A 4GICA 4YHBA 4EHLA 1M1UA 2UXCB 4TUYB 3K8OE 2DH6A 1DEAA 2ZDHA 4HQOA 4U0JA 1KEEA 1ZCJA 2H1IA 5BW8A 5JNUA 4PNHA 3UAOA 3CKLA 1U04A 2GRAA 3WBBA 5LJIA 1UZMA 1K2WA 3ANYB 3LOQA 4IFTA 4JP5A 4OG2A 4RVHA 4XSVA 3MM4A 4MKGA 4G1UC 4QNNA 1R6BX 2SICE 3E3MA 5HCUA 2ZSHA 3GFVA 4BVAA 2BGIA 1P44A 3DOJA 3MJTA 3OC6A 4C7XA 1KL7A 3NC4A 3PPWA 2EG5A 3IOCA 4Z7NB 4LHXA 1GUAA 1GZHB 3HJRA 5FEUA 1S2GA 4OHPA 3PDCA 1F1JA 1J8QA 2J5RA 2ZIXB 1X0XA 4HGNA 3KTFA 1A04A 3IELA 4N5IX 2P6UA 5J47A 2ZXUA 3U09A 3GD7A 4J29A 4P7JA 3MD9A 2Q5EA 5AOCA 3T9EA 1FXWF 1NMYA 3EIEA 4TS1A 3UB3A 1IHPA 4BO1A 3D0QA 3ZD7A 3DLPX 5K0JA 1HE8B 1MORA 3D8BA 1GPBA 4F3KA 1YQUA 4RETA 3IT1A 2FSHA 4HMPA 1GEEA 5SYAA 5CA1B 3QXXA 3HCFA 3IA7A 3MC1A 5KYUA 1G41A 3CZPA 4JCCA 1D9ZA 1ECBA 4EHBA 2E37A 2C4NA 2A1IA 4TTPA 2QHXA 3KC2A 3HJGA 1I13A 1AZSC 1NVXQ 4EITA 5JAMA 3KJNA 4KG7A 1XU4A 3R5XA 3S7ZA 1DKUA 2Y0DA 5JZBA 1U5BA 2HAEA 5J4YA 2V54A 2QL7A 3KIPA 1YA8A 2VDOB 3PTAA 3EXEA 1G8KA 3OQ6A 4KX3A 4EFDA 5FYQA 3VX3A 3T35A 1IEWA 1UBEA 4Y30A 5D51S 4WADA 3V1UA 4A73A 2R44A 1RI5A 2I65A 2ZROA 3BD9A 5JSZA 1JVNA 3EIQA 2O0LA 4URYR 1E5DA 3TXYA 1EWKA 2FSGA 3RVMA 3DPIA 3NRBA 2P9TA 2OO5A 3D0RA 4QPDA 4TYQA 5AKIA 3WGHA 3G2JA 1DC3A 1WXHA 4A8PA 4O59O 1PUJA 4KW7A 1CUAA 2N9UA 1UK9A 4C88A 1LDMA 3LAWA 3JYHA 3N86A 2GO1A 4P5EA 4XB2A 5F73A 3SZUA 4DV6B 1OLUB 4ZXFA 2H1HA 4EYSA 3VV2A 5CXUA 2ECPA 1KI6A 1WRBA 2ZRNA 3SR4A 3EHEA 3E05A 3UCEA 2O05A 4PR0A 4RZSA 5HF8A 3ZDDA 2EGGA 3ZBUA 1YVRA 1RM4A 1ML4A 1ZUHA 1P1IA 2BGTA 4PRYA 1S3IA 1XRLA 4QSMA 4TKZA 3O82A 4EHFA 1N25A 1QLHA 1BMTA 1RAFA 3LIPA 4QIHA 4YRJA 2NYUA 3TVTA 1LZLA 2R8EA 4IR7A 3GVPA 2WAYA 5KTOA 5AVOA 1SUAA 4H6PA 4YONB 3LXXA 4W1QA 5CLQA 2HC9A 3FIUA 1A0OA 4KGDA 4MRMA 2LIVA 1TMYA 1PVOA 3RAFC 1WCWA 4U6QA 3T0FA 4BCBA 3I9MA 2LR0A 4HAYA 1BH2A 5AKLA 4O2RA 3G2MA 2OGZA 1WXQA 5DXAA 2IPXA 3A8TA 5G41A 2BGGA 2VJQA 3UJ6A 2WOJA 2DBZA 2MYNA 2QPAA 3KWMA 4DZZA 1P7ZA 1A8IA 3ISVA 2GEJA 2GF2A 1GPAA 2C3MA 3HR4A 4EGCB 1W0CA 4GOND 1XNRB 5HUJA 2XNHA 1QIGA 4J91A 2CVOA 5EMKA 4D43A 5DTMA 1DKQA 1Q0RA 3PLAE 5K3AA 3T7TA 4Q66C 4U6NA 5TXGA 1EFLA 4X6XA 1DOZA 5J4LA 3WK6A 4O2AB 1U63A 5GIPE 2V6JA 2XIQA 1QG4A 2IH5A 2HDWA 4IM7A 5D5PA 4GW3A 1TT7A 4ZHQA 4YJDA 4R6XA 5B12A 4ATNA 1RBQA 2FW9A 2Q0SA 2YINC 3GZNA 3JS5A 1PSWA 2WB2A 2PRSA 1K7CA 1OOEA 4D02A 2D5IA 5HWSA 3MTDA 2O2EA 4C4OA 3IURA 3DW1X 5ITWA 3KU1A 1DTWB 3NHSA 1JH9A 1US8B 1Z6XA 2VSQA 3AOGA 4PPNA 3OLWA 1RW4A 4PHTA 4WE3A 2A5YB 1SXGA 4MTCA 5EKDA 5DTEA 1WPQA 4KQHA 3PC6A 2EFHB 5C9ZA 1PD1A 3S70A 1EP9A 1IBCA 3KBBA 3QGMA 4X7RA 2HYIC 1KNXA 4Q4JA 4OKNA 4CM4A 4RFLA 1CY6A 4LRWA 4LRQA 4MGHA 3FPJA 1YR2A 2G5GX 1ZL2A 5EYPB 4PG4A 1KXZA 5IWCA 1N8SA 4C5BA 1CUJA 4FYVA 2JAWA 1G16A 2PPVA 1XFAA 1YFJA 3DUFA 1IE3A 4E31A 3SVZA 4ARBA 1U8EA 4HH4A 2JBHA 3KLPX 4YH1A 2RH5A 5I3CA 2BEUB 2DHRA 4MV0A 2RC6A 5F2OA 5JMTA 4O02B 1Z36A 2ECFA 5C7OO 1VG8A 4LA4A 1P60A 1U7XA 4XPZA 4Y9RA 5L6LB 4J6EA 1EFCA 3Q0IA 1BDHA 1E4VA 2FUG1 3FFAA 3NXSA 3VAYA 5K99A 4J07A 4PFSA 4QA9A 1N5RA 1U0NA 1GGHA 4XWAA 3WDKA 4EKDA 2PUGA 3VKFA 4NE2A 4HWSA 4EHAA 1TM3E 2QTAA 3C3EA 3DYIA 3FYUB 4MKRA 4X61A 4P35A 1VLHA 1USIA 5FO0A 4UQLA 4LBVA 1OXSC 5TARA 3IDAA 1ZS9A 3L8GA 4IJKA 4B0OA 4BP3A 4DEXA 1OTYA 2IJGX 3D8HA 1YULA 4TTAA 3G2HA 1WMSA 1XEXB 4YB8A 3L46A 1D1SA 3NTVA 4RA9A 3WHPA 2VDQB 3GPIA 4MW2A 2I55A 4ND4A 4F38A 4TQGA 1WKVA 3V8MA 4F5EA 2OXFA 3UMFA 4TOIA 1REQB 1NYRA 2CHQA 4J1QA 5CLIA 4OIFA 1MO2A 5K8UA 3KT3A 4GSLA 4N82A 5F9HA 1N8TA 1AQLA 1C0LA 2WICA 4M36A 1ZLXA 3BXGA 4PGMA 4RNCA 5BUSA 2VYCA 4GQIA 3A7DA 1HDXA 2L17A 2PX0A 1J7JA 1DAOA 3EEFA 1K88A 5IXSA 4NI5A 1QHIA 4MULA 3U1TA 4EYGA 3KVVA 1NWCA 3L1JA 4GKVA 3JPYA 5YASA 1G9TA 3WVNA 3TRIA 5BN5A 4L8YA 4HDRB 4KFUA 4XDZA 3UKDA 5CAEB 2GILA 1LJ8A 3CE6A 3GLIA 2YVAA 4YRDA 4DVGA 4ZVQA 1X13A 1XEFA 5F5LA 1DCMA 2ZRMA 4K8RB 5F3RA 3E27A 5BVGB 2HRRA 1XTIA 1I1NA 2PO7A 3NHBA 1BOFA 4RSRA 4B09A 1SXQA 1DT5A 3HJTA 3CLKA 3HSYA 1X7WB 3WQRA 5BNIA 4JX9A 4LJ6A 1BGXT 3D6NB 5SYMA 4TV8F 5ALMA 2O8CB 3DTVA 3K8QA 1PJ2A 1O8CA 2X5XA 3LA8A 1UANA 3N8DA 1QIJA 1XU9A 1XZNA 4G9BA 3ZWQA 5IASA 1WY7A 4RZXA 3IVXA 1QF9A 4P84A 4J03A 3DDZX 4F5WA 5KTMA 1FFCA 1BMFA 2P0EA 3VH4A 1GU1A 1XZQA 1T6XA 3ZHBA 5E6SB 2R0QC 2TMKA 1XTBA 3RTCA 4ZI2A 3FZEA 4UNNA 4Q7LA 1I7QB 1G6KA 3EVZA 2RB4A 1OD6A 1Y42X 3DOOA 5SZIA 4N4AA 1YS2X 4F85A 5CEJA 1L7EA 1T6BY 1N57A 1PI3A 3K1ZA 1XDSA 2A1TS 3AZQA 2AXQA 4PG5A 5BUQA 1X87A 1H65A 2COEA 2Q99A 1NW5A 1XB2A 2RKWA 5EIHA 3H9BA 4I19A 3WLIA 1XHFA 3CBQA 3FN4A 3P9PA 3AETB 1Y81A 1WUYA 2QN6A 4ESOA 1GUBA 1U8AA 3RVKA 4CEJA 5FA5A 3KQKA 1R15A 4CODB 1NN3A 4EPTA 4OLJA 2E0IA 1KI1A 4FOSA 4GL4A 5AHKA 2EVWX 5AJHA 2Q1SA 1Q57A 4R5HA 5LXTB 4BVKA 2AV6A 3LDHA 4YBRA 4YT2A 1L7QA 1UM8A 2D4HA 4RAOA 5F64A 1DQYA 3RIMA 1QRUA 3KLMX 1SHJA 3C6YA 4JD5A 4B7XA 3HY6A 2ZBPA 4X20A 3FYUC 3I2HA 4FSDA 1P1BA 2DPXA 2ZJFA 3CNBA 1YJ5A 5E95A 3H19A 5CHEA 5FO1A 3SJUA 1B74A 2XMZA 2JVIA 6LDHA 2O1XA 3PT5A 3BCSA 1XMVA 3ZHUA 5G02A 3ZXSA 1VRVA 2WWXA 2ZVDA 4HDQB 2IZ5A 3M3HA 2QKYA 5CDFE 1Z0ZA 1FXUA 2W2PA 3GLUA 5TQJA 1OAKA 2VA8A 2YJGA 3OZGA 3C48A 4JP1A 2MINA 3RLIA 4IG4A 2OHHA 1FTWA 4X44A 1AKUA 3BWDD 3O0TA 1SD2A 2EKBA 3AEYA 4UXJA 4GE0A 3H7IA 2GVDC 3F96A 3NATA 4HSEA 2GAOA 1A2BA 3QPBA 4R71A 2P1ZA 3HJBA 5KZMB 5CLFA 1N78A 2F64A 4PFKA 2X0DA 1LPSA 1YNSA 2E49A 2JATA 3AW8A 3VPXA 4XVCA 1LI7A 4DNPA 5K8TA 4FYKA 3STUA 1RI1A 5DFAA 3TMKA 1TW2A 3WXMA 5LP6F 3P4XA 4O2BB 3ZE0B 1GHTA 3SVLA 2DEUA 2VF7A 4LS3A 2RK4A 3AF5A 1AB6A 4RM3A 1IY2A 4OCZA 1WOMA 4EJFA 1ZX1A 1LK7A 3DTNA 4LSWA 1I7DA 1GILA 2G83A 1E3MA 4XLTA 3JQAA 3PFKA 4R05A 1W44A 2IYOA 4U8HA 3SZLA 3WBJA 2UYCA 2VDKB 4B3MB 2VPTA 1V8PA 4P8RA 1NI4B 1X7YB 2WT9A 4OD0A 2HOQA 3ZWXA 1LFDB 4PLPA 4NEHB 1MEOA 2DB3A 4G5XA 3A1WA 4ZREA 2FWBA 2H9IA 3OOSA 4MPJA 1E61A 3QFRA 1C4OA 4WOKA 5MN4A 1DAGA 1GL3A 4G8BA 2P8JA 2ZJ0A 2IYVA 4OAPA 3D02A 1KEEB 1G18A 2V6GA 1GPWB 3PC4A 2OLKA 4N1AA 3OFVA 1VPLA 3K4HA 3RSHA 4CBVA 3QKTA 3NPMA 3HK2A 4HQFA 1N2CB 3GGPA 3EULA 4XW2A 1TE2A 2XGSA 2ZB7A 5H3HA 3IIIA 1P0IA 1MA0A 2O4CA 1DC8A 3DR5A 1YQQA 4HDMA 3DW3X 3ZWCA 1NMQA 5KNCA 3Q9NA 3BJEA 1XPJA 1E2LA 2Y3IA 3BHJA 1JIUA 2W6PA 1S3FA 3AY0A 3FBWA 3NALA 1R8QA 4UNQA 5JWOA 5H16A 4CQMA 3UC9A 3I9FA 3ZWYA 3KYDB 4WXMA 1S3GA 2OENG 2REOA 3LJKA 3ZW9A 1MJHA 1WMDA 2F6RA 3P94A 4K2AA 3NT2A 3H2JA 2YMQA 3SSOA 3AI7A 2PMFA 3O4HA 3QPAA 3HB9A 2WSSA 4OP2A 2MCFA 1K7YA 1ONSA 4JITA 3HXPA 3RC8A 4LJ9A 4BRSA 2NW6A 5KYUB 5B6PA 1AU9A 1K9VF 4GI5A 4U7HA 1U3DA 2I2AA 2GR9A 2IEBA 2ZYSA 4FFBA 1JV2B 4NCHA 4Y0AA 1SCDA 3QVGA 2BTEA 3I5UA 1UUFA 1YZQA 1XJ0A 4RIGA 4MICA 4AJKA 1THZA 2BM8A 2I34A 2M1ZA 1ORTA 1PV2A 1U5BB 2JC3A 2DUWA 2Y1LA 3OFNA 3ZLJA 3EXEB 4MQEA 4MV9A 4JJIA 3T5AA 3TD6A 3IC5A 1Z38A 3QOWA 4JL8A 4DV7B 3AEUB 2GS9A 5KBYA 5AI9A 4WNAA 5JAUA 3HI6A 2VUUA 4LZWA 2CLSA 2IPAB 3G2KA 3Q72A 2RGYA 2NZXA 2QD5A 1XCBA 1Q7TA 1YR9A 3RS9A 4EG6A 1BFUA 3R3UA 4YREA 5BQPA 3ROTA 4WLOA 3NKLA 4RJ2A 4E7PA 1A8SA 3FHLA 1O0CA 4OAQA 4BJ6A 1QH9A 1IL0A 1XDDA 2G3YA 3HCOA 5CA0A 4LMPA 3T0GA 4ZD6A 1B0ZA 4BUZA 4L73A 2FQ1A 5DCLA 1MRZA 1MW9X 1U9ZA 2UUCB 2EG9A 1LSUA 2Q5FA 3NYIA 2HL6A 1T5OA 1SD1A 3CV3A 4DBLC 4PYRA 3HXOA 1BEUB 3BGVA 3CNLA 4FMPA 2FWAA 2XZDA 4MIOA 3TVDA 1Z2OX 2B6HA 3NT5A 3RRJA 3GX1A 2XNJA 2WHRA 3DLCA 3WGVA 3B9PA 3A3YA 3H3XA 3B1XA 1E6MA 1OILA 3W5UA 3IYLW 4MS4A 3O2JA 3PJDA 3I1JA 4ZQHA 4DGSA 5IU6A 3N8HA 3RFCA 3RVPA 1RCUA 1JHAA 4P93A 3QHQA 5FBHA 1RYYA 3MWKA 3DAOA 1AS2A 3F6RA 4ZT6A 3VR5D 3WWOA 3NANA 3UWDA 1F51E 1FU7A 3LYLA 2AXNA 5DRYA 4C6HA 1FYWA 4R2MA 4PM4A 1GV0A 3GV0A 3OQHA 4ARIA 1U02A 1Q50A 2IPNA 2CZQA 3UGTA 3T7DA 3Q98A 3FWNA 3BWVA 3HV2A 3WG9A 3QW4B 5AJXA 1E96A 1AQYA 4H7IA 1RPNA 4ZYWA 3NBFA 4DIDA 4RLSA 1EP2B 2OBYA 4OSOA 4IGEA 2DVMA 5FB3A 1T8SA 4LCJA 3N7AA 3IQWA 2WWTA 4DXHA 3TUZC 2XF2A 3RIEA 3OEHD 1D2CA 1SZDA 3HDGA 1SCAA 1FNBA 3JRNA 4TXLA 1NW7A 3QPDA 4YAOA 1V4BA 3PLNA 4ZHQB 2UAGA 3A4IA 3IQHX 5EQTA 5J59A 4L5BA 5EE1A 5D1HA 2WJIA 1KMHA 1Z6QA 3OIDA 4NCIA 3TRDA 4C3UA 1ISHA 3WIUA 5CYOA 2FZWA 4RCYA 3S5JA 1A9OA 2ZRQA 3OLZA 4UDXX 4E4YA 3A4NA 4JI3B 5AICA 1XL1A 2C5HA 2H59A 1E0KA 3E15A 3CUVA 4GI3A 4MGEA 3ODPA 3U4IA 4G3XA 4RYLA 5EE0A 5J2TF 5K0BA 1X1EA 3SSAA 1T15A 4DQUA 1DAEA 4Q4JB 1PFQA 2HB6A 4RZ3A 5IBCA 2IHNA 4ND1A 2XRMA 2BF4A 1NA5A 4JBWA 4XUEA 1JR4A 2WYVA 5HW0A 3FYHA 2NSDA 1ZM3A 2I2CA 3IP8A 1NOKA 3OF2A 1SKAA 2A9VA 3IAAA 1VECA 4ND7A 5E3JA 2Q62A 5A0TA 1T4GA 1CDZA 2Z98A 3X2SA 1ORRA 1ATIA 4JOQA 5DLYA 1D1PA 4JR2A 3T7IA 2J48A 1LRLA 1S2LA 1A1VA 4DCNA 4YAUA 3AESA 4X97A 3GRPA 4YCAA 2OCBA 4XGQA 4EG5A 2GK7A 3ETNA 1G7CA 1ABBA 1N2HA 3UAYA 2GN2A 1OY1A 3P9RA 5EA2A 4BU0A 2RCYA 2YYYA 5B57C 1J1ZA 4QGGA 5JEDA 4M98A 3ZCQA 5H80A 4F71A 2NO7A 4TSKA 3ANLA 3MELA 1BEZA 3NOQA 1Y33E 4EGQA 3EG5A 4Q9AA 4RA9B 4G6ZA 1R8YA 5AP9A 2YWEA 4DR4B 4QYIA 3RW9A 3WGJA 1OXMA 3I45A 1JQJC 2ID7A 4HUQA 4IMPA 1QH1A 2IIQA 4ARZB 5JV5A 2XZPA 1VL2A 1V0JA 4RV5A 1EWRA 1UFOA 3GR6A 1IHDA 3TQCA 4CTNA 3VPSA 3M3PA 3ZTTA 5ALLA 5EWJA 1CRWG 1QCYA 2QVYX 1Q19A 2EAUA 4MO2A 4U9HS 3SNHA 2LIPA 1YR1A 2X8WA 1W85A 3DBLA 2AOTB 3L8MA 1TQHA 1UZNA 1J06A 2I1WA 2C0QA 1YQEA 4BN0A 1DQZA 1VC2A 1I4WA 5KNDH 1Y3AA 1TC1A 3DZKA 1XAJA 2VK8A 4LJ5A 1WSAA 1DRUA 1ISJA 1TT5A 3MS2A 1ZNXA 3Q1KA 4YUWA 2ERXA 2HXYA 4UE2A 4O6VA 3W6OA 2CVZA 1U8YA 2ZJ8A 1UINA 1W93A 5UKDA 2JI9A 3T1VA 3T7AA 4ETNA 4PN7A 1FJXA 5AVUA 1LW6E 1MAUA 1UJ6A 4JBXA 1SHZA 2P9BA 1N9GA 4JK3A 1W88A 1UIMA 2QGFA 3NWOA 5L6MB 4B4KA 1MD9A 2P2NA 1YE3A 2P75A 1GJRA 2YV1A 3L8CA 3WIOA 4BV9A 3F4BA 4A2WA 3C97A 4DIMA 2JPDA 3ZIDA 2WJ3A 4O4HA 1EBFA 1RBZA 3GFRA 3DWFA 3I92A 4QU5A 2P79A 1G42A 3OM0A 4OMDA 2W4MA 4WLFA 5B7QA 4CLRB 3IQZA 5CIWA 4MB0A 4JGBA 1G0NA 3DQQA 2NVUA 1A82A 4QVGA 1WTAA 1TUGA 3O4VA 3U5TA 5KVSA 2AOXA 4Q18A 3WMWA 5T5QA 3FOZA 3TPCA 4RDHA 3R0XA 3TMAA 4LXXA 4ALNA 4EEKA 2H5LA 2X9VA 4IDPA 1SUPA 2YX1A 4JBIA 1KS9A 5AXCA 5K0FA 2PQ2A 1RWXA 2P9YA 4UM5A 1Z6YA 2JJ2D 5KYGA 1ZVKA 3GXOA 1W52X 4HX2A 2H1VA 4BEVA 4M1QA 1ZL0A 2GJ4A 4P3KA 4AN1A 4ZVSA 2V3CC 2BCJQ 1R5OA 1R74A 5D6NA 5DX8A 2FXIA 5SZKB 1R4NB 3SZMA 2WIKA 3ZGVA 4ZAXA 4C0WA 5JS8A 4EHIA 3TW4A 2X0FA 1ZGZA 3QZUA 2O2GA 4JXKA 5GZ1A 4WZAB 1SOUA 1YRAA 2FRVA 2KSQA 3UQZA 3L4EA 3QYAA 4YYZA 4ETMA 1IJKA 1IUOA 3RIGA 1Q3HA 1VYUA 3OU7A 4AF8A 1CDDA 1GD1O 2QWXA 1T3LA 2C2YA 3D3JA 4M9SA 1I1HA 3U4CA 3P45A 4DA0A 2FPPB 1YR8A 3HKCB 3Q8LA 3Q3JB 5DHTA 1VBMA 4RZ2A 1M3SA 2Y71A 3H0CA 3PE6A 2AJDA 5HS6A 3ZNQA 3C7AA 1NZFA 1NI3A 1RJFA 1I7PA 5CBPB 4Q9IA 1QTNA 5BMVA 2Y1CA 3TZLA 3L4BA 4D8TA 1CJBA 3WHLA 4Y0NA 3T3GA 4ZV4A 2NV0A 2FQYA 3QXGA 3VNRA 3QVSA 2V58A 2CC2A 2XMCA 4P3PA 3UHJA 2RIPA 1EA7A 2MINB 5LNK6 4RUKA 3PYMA 4BB5A 2XE8A 1JG7A 4B3DA 3WK7A 4N7JA 1QYDA 3QXJA 2QI9F 1VDMA 1KJWA 2VTKA 5JROA 2FFHA 1BFDA 3BRSA 5FP0A 1EUYA 1EHYA 5FD8A 4DBZA 3B8HA 1XBTA 2W4IA 2JLVA 3TIGA 1OXBB 4FBGA 4HFNA 1SUIA 4IJMA 4Y2UA 4WZBA 5T3UA 3WKCA 1QF6A 1YE8A 4UC0A 3TX2A 1O6BA 3I9LA 3KOZA 3UO8B 3UOWA 1EH5A 4CV0A 1NJFA 1WXWA 2ENUA 3SLKA 1UJ4A 4B7CA 1DPFA 3P0FA 5ER6A 1BW9A 4B6FA 1F5SA 3QBJA 1NMSA 2CJFA 3KEOA 1M2JA 2I2DA 3K96A 5DK4A 3A9SA 4K9RA 5A4MS 5KSYA 1L4HA 2Y1DA 3T1OA 4OOEA 1G17A 4AZ0A 3BXXA 2XCRB 1C41A 5ALJA 2GUGA 2C9CA 4QU8A 5J2TB 2ADOA 1UXIA 3BA6A 4BAGA 5AK4A 2G0NA 2UZAA 3K70D 1XJQA 3DOUA 3HLYA 4CM7A 1PW7A 3GP3A 3OSUA 2BKUA 3GJZA 1HEYA 1CXZA 1DIGA 1SXIA 2J1LA 4I66A 5IRCD 3R8FA 4QGFA 1P0MA 1WMBA 4K6CA 5HM6A 3RYCB 2G9UA 2JASA 3P71T 4M1TA 4R8RA 4XWOA 2JEZA 3AT1A 1UBSB 1R1DA 1FFXB 3EEQA 5KOYA 4HDMB 3I4LA 4IIUA 4OX9Y 1JU9A 5ER9A 2WA2A 4TYPA 2EQAA 3EVAA 3G2IA 1G19A 4NJEB 5EZSA 4TTJA 2Q45A 1KBQA 3EA0A 3OJXA 5I7VA 1Z2NX 1GQYA 3B36A 3HMQA 2XQGA 4B6QA 3WA7A 3DMYA 2XT9A 4A0GA 2EKDA 1BA3A 3BPSA 4GT1A 1NF9A 4D81A 4OTZA 2LP4Y 1VI2A 1DKPA 1XROA 2Q49A 4JT8A 4CR6A 4J4TA 2QTWB 1YUBA 4RY0A 2FEOA 2E21A 3K5IA 4PCUA 4QX6A 3V32A 2J3KA 3B48A 1PGPA 3GZJA 2IYYA 2D4AA 4J3FA 3L3BA 1T9CA 1T0HB 2ZI6A 1NXOA 4K5QA 1I4TD 3HXLA 3DJFA 2EBWA 1D09A 4L08A 3RLFA 1XMQB 3THWB 3T1YB 3H2KA 5EJAA 2QPTA 2WQ7A 4E09A 1Z37A 1NUUA 4M1WA 1VE9A 3I3SR 2G72A 4OMFG 4HD8A 4PAQA 3TLEA 2VJKA 2YYSA 1SM4A 4E2WA 5K6AC 2OC4A 3MLBA 5KHAA 4RORA 3RFUA 4YCDA 5ED4A 4WNAB 5DSTA 2Y1XA 1EGHA 1NQOA 4UAJA 2PR2A 2D1TA 3AF4A 3GJQA 5GZ6A 5IABA 1NNEA 3LZ6A 2HWKA 1NR1A 2VJNA 4KIWA 3CLSD 1D04A 2CDRA 5KQLA 1F8YA 3DONA 1GTJ1 4IIEA 4IVQA 1SHKA 1GZ4A 3L7JA 3BTSA 4G23A 2Q46A 4IIDA 1NHGA 4BEWA 3EXHA 4HXYA 3HL4A 4K6KA 1MGPA 2PH5A 2XCSB 3QF4A 4L5YA 3N8NA 1W75A 1WSDA 1MDBA 1RWKA 2AE1A 1JDZA 4NBWA 4H0CA 2B20A 4ID9A 3USCS 2JLBA 5H9WA 5CA0B 4WECA 1PX0A 1IMOA 4KSYA 3W2TA 2VSOA 5DJ5A 4CG3A 4GH5A 3MWEA 2EIHA 2XUFA 3UWKA 3F3SA 1MB2A 1U7DA 1Z0IA 4WK6A 2MYPA 3H5TA 3JQ8B 5THQA 3TW8A 2Z5GA 1FLDA 2H29A 4M0FA 5CEFA 3U49A 3FTNA 4MYSA 1U2TA 2P3LA 1OR8A 1GQRA 2GJAA 2ZS8A 4BXOA 3QF7A 3BIWA 4MS4B 1X19A 2H7YA 5JH7F 1TFUA 1VHLA 1K98A 3MWLA 4Y2SA 4LF8B 1YACA 4QODA 1GTVA 1E9DA 2E7ZA 1QDLB 4Q7QA 4N5MA 5KX5B 2FPIA 2WFMA 2BR3A 1AZWA 1JQKA 3GD5A 1H22A 2PMEA 5FNZA 1P4GA 3OTIA 4Y67A 5AW0A 1RQGA 5F1KA 1PQUA 3S27A 3TAHA 1QHSA 3OJOA 4RKWA 3VQTA 4ZAVA 2I6FA 4PYJA 2CMKA 1P5HA 1WY5A 1G5TA 4G1CA 1C9MA 2DKOA 1OIXA 1WCXA 2PU5A 4XR9A 3CWCA 3S1AB 4JC5A 3W04A 6GPBA 2C9MA 3EGOA 1GA4A 5EMMA 2ZWAA 1U9YA 2QP4A 5AI8A 2JIZD 3DMFA 1Y7PA 3KKPA 3RC2A 5KAPA 1SOMA 1S1CA 4TYYA 3G8AA 4FHFA 4BBJA 5EXDA 3W2EA 4EMUA 2ILTA 1A98A 2FI1A 1OKKD 3AUYA 4HBZA 2ZSJA 1ZUNA 4J1TA 3UC5A 5I7RA 2I6TA 4EZBA 1I36A 4KQIA 4G8CA 5T3YA 3ZKAA 2GTIA 4PLCA 5K5EA 2BFNA 1GZ6A 2H65A 1Z5GA 5FA8A 2ZYWX 5LLDA 1P91A 3F6SA 3LBHA 4UXIA 3ZHXA 4LC1A 4F5DA 4ENQA 5L3SA 1C2YA 1QAOA 4LYHA 4FNOA 1TVKA 5I48A 2ECOA 1FZQA 4L4ZA 2ZDGA 1UWVA 3O2QB 1PWHA 1V48A 4ZT5A 3LSYA 5HQTA 3D8UA 2WP0A 2H1FA 2XSZD 4RMIA 3R3ZA 3TQHA 4N54A 4FMCF 2B36A 2CK3A 1O03A 1XD8A 2M32A 2VDWB 3PC8A 4JB8A 1XU7A 3VC3A 5HZHA 1IN6A 1ULHA 3NKFA 2LKDA 1JAIA 2DR3A 3KAQA 4KHPB 3B78A 2NQTA 4HJXA 4RS3A 2FK8A 5LB2A 4AROA 4CDRA 1QBKC 2C3YA 2DYKA 4YJGA 5CDGA 1LV7A 1FP7A 2XUOA 2F4NA 2IKQA 2QY9A 3KKEA 4LDRA 4NPHA 4KQJA 2JI4A 5EJ2A 4DJTA 3PUHA 2JD1A 3G82C 4HNAA 3CT4A 3WB0A 4LFBB 3H8VA 1YIAA 2Y1GA 1ZH0A 5GONA 1D7AA 3Q7TA 3I52A 5I9LA 4XIGS 4DDVA 3K09C 2O7VA 5KC9A 3JAWA 4EYQA 2ZYDA 5G3YA 5HFJA 3R9IA 4CKZA 3KXLA 4ITRC 4JLDA 5K0CA 4OO3A 1Z6AA 2Z83A 4L8LA 4OF4A 4BFSA 3G2OA 4IAOA 4TKVA 5EXSA 2F2TA 3NHLA 2ZR7A 1N1MA 4LSZA 2DKNA 4M2LA 4XSHA 1WDKA 1XZHA 4L9AA 2HIAA 4BQRA 4E2ZA 4E5YA 5FI0B 5EWJB 1U9IA 3CU5A 3IVGA 3F6PA 4MHOA 5U4XA 2QT9A 3MGCA 4JEIA 4J2HA 1ZKDA 4UJ5A 5GOZA 3B1JA 5H02A 3SMVA 1ZHOA 1W85B 2Z5VA 3LRPA 4DR6B 3EBLA 1CF2O 1KZ4A 4LDJA 1LY1A 4CRWB 5DN6D 1WZUA 4PS1A 4L50A 3EYAA 2MYUA 4U9IS 3DBHA 5LWQA 5ADVA 1NDUA 2FPRA 4NEGA 3D8TA 2YWJA 1NXTA 3IKVA 4BQOA 4B32A 5GJBA 4R3NA 5E3IA 1CU1A 3ISJA 2GASA 2ZE6A 2C92A 1KAMA 4GQBA 4PCAA 1DKMA 1ONNA 1TYEB 1USWA 2NM0A 2Q0QA 3Q2OA 3C3DA 4K1LA 2JGFA 4R1MA 4YALA 5KDOA 1RLOA 1HC7A 3UANA 2QQFA 4INZA 3JXEA 3OFJA 1POWA 2PGJA 1DCFA 4GF5A 1BJKA 3H11A 1LDNA 1KAOA 1MR3F 2WNIA 2WJ6A 3O38A 3ESXA 4TMXA 4FQ8A 5EHZA 4H7FA 4R2KA 2B98A 1BXKA 1JNXX 1P0QA 1YDWA 2XITA 3CX8A 4ILEA 1II0A 2D2IA 1E2FA 2EDAA 3DWIA 2KQUA 2PYZA 3H75A 1CIPA 1UBJS 2JH8A 2PLAA 3OFKA 4O29A 5DX1A 3MMXA 5GZ3A 1M0TA 1O97D 3NM4A 2IYUA 1A8UA 3O8OB 4NZ9A 5KQRA 3I01A 3OMXA 3C15C 3D2CA 1KMCA 1AUQA 1STOA 1MU0A 4ZOQI 5E4FA 3PFIA 1IZ7A 4KX5A 1DS6A 3P9SA 1J1IA 3WGTA 3TTXA 4X92A 1TTTA 1IWOA 4JJFA 4OQQA 1PR5A 3C24A 4PNEA 2OHIA 5FBKA 1WB6A 4DQVA 3NEJA 5ALQA 3ROGA 1C50A 4M86A 2OYSA 2GTHA 1N5IA 2VF5X 1RJGA 3IQDB 4CF3A 1UBLS 3OF3A 4FJ0A 1P74A 2BC9A 3D5QA 4CUKA 1JN0A 4TMKA 3CVXA 1Z5PA 1DCKA 3ZU5A 2FVYA 2YJ5A 3BD6A 2GYYA 4HGPA 3RK0A 3TZ6A 2XGOA 1R10A 1VE5A 4W63A 3PB3A 5A5VA 3E3NA 3K0KA 1KXJA 2W2LD 2H7XA 1ZH6A 4HTFA 4WKGA 5DHUA 2O2DA 2RKBA 2NT4A 2Y76A 4BP9A 1E9BA 1F0NA 4FHEA 4EKNB 1PG2A 1IQRA 3DL7A 5K6TA 3LHSA 3QVWA 3JVVA 4JODA 3ZJUA 2GZDA 3L0PA 1E2GA 3FMPB 2BTQA 5I01A 5T6BA 5IHXA 3VO8A 1BE0A 3B13B 1TB4A 3F4LA 4DNOA 2WWGA 2ZIZA 3SYNA 5CMLA 1Y1PA 3OUZA 5EJMA 2H5IA 2AJLI 2WAXA 1CY1A 3LLUA 3RBAA 2ZS9A 2DSTA 2VWPA 4IMIB 5CM8B 4WSOA 4YRKA 4O5AA 4CCWA 3EDQA 3V4VB 4MDFA 1F4PA 1U0EA 3AX6A 2VJMA 3FCOA 3HO6A 1Y6QA 3CRZA 4ZJZA 1AF4A 3P8ZA 3UV7A 3T99A 4FINA 4HDSB 3FI0A 4RVOA 4P9NA 4WUTA 4CTOA 2CB0A 4HNHA 1A9PA 1JI3A 1LDGA 1ZLYA 3Q7PA 5DRTA 5KNDD 1T8PA 1KRXA 3OOHA 2WDZA 4L9RA 4F4UA 1WU7A 3SF8B 3PXGA 2JHAA 1DC6A 2F3UA 3JYNA 1L4NA 2YFHA 3MIIA 1B6TA 3LO5A 4AZ0B 3KAJA 4EIWA 5LZ4A 1S5PA 2Q41A 1FYVA 3FHCB 3HDJA 4FONA 4BZQA 2FFBA 3ICPA 3QP9A 3GFSA 5HMMA 5IKEA 5IXYA 5JQWA 2ZYHA 3QV2A 4MW7A 4EL5A 5KJFA 1WW3A 3KKLA 3QLUA 3H9CA 5I9SA 3AXTA 1U0LA 1KI4A 5CDTA 4FMCB 4RD0A 1VXRA 4OXKA 1FIUA 4CKBB 2GFQA 4YASA 1OA1A 2AN4A 2WTEA 3VU9B 4X7BA 1KEKA 2CEKA 1L1QA 4B3IA 3BEOA 3AG5A 4RLFA 5DBFA 3THRA 4YRMA 4BJ1A 3LKDA 3SYMA 4BLUA 4YT8A 5DKFA 1P17A 4GEGA 3HUTA 3S2ZA 4DC9A 4RQAA 1MB9A 4G4SP 2WYUA 3LQFA 4ECEA 3I23A 4C0LA 1L5MA 1H2BA 3W7VA 1QC5A 4PZPA 2GFIA 2KWIA 4ZEOA 3L5KA 4R9RA 1T13A 4YJ3A 3WQBA 1KR5A 2Q5JA 5B53A 5I9BA 4R0MA 4BNWA 4U3JA 4B83A 4C6TA 2ZM5A 1MO4A 2R1TB 1YRHA 2X6TA 3P2EA 1FJGB 1U0RA 1Q0QA 2EW8A 5HTKA 1I3NA 1SUBA 1AGYA 1GSOA 5JVDB 2H2GA 2HHHB 4B80A 1T9AA 2WSBA 1P1KA 3L6DA 3OPQA 3DHYA 2LD4A 3IT3A 3BRCA 4IXMA 5T4EA 3EVBA 2AC4A 3IOBA 4EVSA 1SH7A 1U9JA 2HU5A 3LNCA 3NDJA 4AS3A 1DBIA 4F4HA 4ZCRA 1YFZA 2WFLB 2WJHA 2AZMA 3R40A 1H2ZA 5JW6A 1MQ8B 3FCAA 2B8TA 3JAMA 1WPGA 5HCIA 3JYQA 5IAAA 3G0DA 5G1OA 4AS1A 3QG1A 3I01M 1SWVA 3U81A 3L4BC 3H2ZA 3R0IA 4YO7A 1ZW1A 3M6MD 3GFPA 3ZR4B 3UMRA 4FZ3A 2OO7A 1T2UA 4Z7QB 1JEQA 1A2OA 1Z0FA 3E3AA 2FLKA 3MJ4A 4JJGA 2GJ8A 3U60B 2YS6A 4UATA 4KVAA 2CNOA 3IR6A 2DWUA 3RWMB 1H5UA 1UZAA 2Q8NA 3SQMA 3KTAA 3TL3A 1K6EA 2IPLA 4NV0A 4DCUA 1E3EA 5IEBA 2AI2A 1DPGA 2CDCA 5ILQA 1VL6A 2W58A 2ZSIA 5DNDA 3LWBA 1RWWA 1RHMA 3BS4A 2WI8A 4FYHA 1GL9B 2JJ1D 1MVOA 1P4AA 1MT0A 2FY8A 3OUUA 1QWOA 1RHUA 2HK8A 3MNFA 4LZPA 3AUTA 2IV2X 5LBUA 4DRXB 4QGSA 1KYYA 2JFBA 4UM9B 5DCUA 5BQXA 2G6BA 1SHLA 3O4FA 4HYTA 3IAM6 4DABA 1IVSA 2WSLA 2DTDA 1O0BA 3TINA 1EEHA 3TW8B 3RYIA 1JL3A 1JLLA 4MI1A 5FOVA 3VC1A 4KO8A 1I8TA 3U44B 3G88A 1NU8A 1PNRA 3PGMA 3Q11A 1M34B 1PRYA 4W7IA 3VVCA 2XKJE 1CWUA 1GLVA 5JS6A 4HVTA 3IUPA 1M7HA 1YZLA 5KOJA 2Q1TA 4N3AA 3S2GA 3QU4A 2QRKA 2IS4A 3A2MA 2R6FA 3FSRA 2GD0A 4RQUA 2OQVA 1JJ7A 5BV2P 3KJIA 3GEBA 2ISQA 4H17A 1P9OA 2VNAA 1H0RA 1PJSA 2AIRA 1OX4A 4JT2A 4AO6A 4BL5A 4Z54A 4LJAA 2HK7A 3L1KA 1CRZA 3PZRA 4TN5A 4WZBE 3DZBA 1NVMB 4UBKA 5DULA 2IA5A 2NMVA 1G55A 4YJHA 1KHHA 3RDPA 1FXWA 2BE9A 1GT6A 2XCQA 3B1ZA 3P9CA 2AJTA 2PH3A 4L51A 4MV4A 4MQBA 4X00A 4XI9A 2PZLA 4A3SA 3W9BA 4Z2AA 1NY5A 4GMDA 1HT1E 1UADA 2C5SA 3KPYA 1J8DA 3M9LA 4R8KA 3V3TA 3K4QA 2JA1A 3CVJA 3CUUA 4DNFA 3PEYA 1CR4A 5H83A 4FMDB 4QTUB 4S12A 3AEKA 4LBYA 2QG4A 3MOGA 2CD9A 4UPDA 1O3YA 1D3AA 4HDOB 4EGAA 1R0WA 3O91A 3EJWA 1L7NA 3PF9A 1KSGA 3LRTA 1LTKA 1NQVA 2JHCA 3IP3A 4R3WA 1EM6A 1ETHA 4FGZA 4RV4A 1ZUNB 2HCFA 1XYYA 3NV9A 3WGUA 4MKZA 4RKRA 4F4CA 4NTZA 3OJEA 4ND6A 4ZYZA 1WSWA 4HGQA 4OMUA 2HMVA 5JG7A 4YUYA 5BNWA 3DXZA 3NFRA 2KB0A 1H2RS 2QSZA 2VRCD 4G5RA 1JXOA 1GAQA 2NP7A 5EE3A 1UP4A 1XJ5A 3MCWA 3QV1A 2P4QA 2IDZA 3AHJA 5L3SB 1UOPA 4MDEA 2AG0A 4I7EA 2FUNB 3FVQA 2FPGB 2GH1A 2JF0A 1M1NB 2AFHB 2NXWA 2NXCA 2YWDA 3FH0A 1VHTA 1J0AA 1LWNA 3H2IA 4LOHA 4CKWA 4XX1A 3AHCA 3NGXA 4MLPA 4E5VA 2IV7A 3VR5A 1HPLA 1AQJA 2JGDB 4KJZA 3IKTA 4TT8A 1RS0A 5SY6A 3TIVA 3RI3A 4BMZA 2BFOA 4QJ3A 3HCCA 1P2DA 2PMDA 3D6JA 4IV5A 1NC1A 4QUGA 1H2EA 3B1FA 4EABA 1Y6JA 4D9HA 2SCUB 1CYEA 3EFOB 4QUJA 2O3JA 2L42A 4UM7A 4YJGB 4RD6A 3EXHC 3L01A 1CSEE 5LD2B 4JI5B 1KERA 1P5RA 1UC4B 3LXUX 4LRTB 4Q7MB 2V8BA 3KB1A 4R8VA 2OILA 2XZTA 3FCSB 2F3SA 3E7DA 3OEHA 3TM4A 2DAPA 3A6GA 1PX2A 2VK1A 5COAA 4D5EA 2F43A 2FVXA 1O54A 3IL2A 3TEMA 5EEGA 4NY1A 5JD4A 1TA0A 2XCIA 4S1PA 4AECA 2V45A 1Z6GA 4B3TB 4G85A 3TKLA 3JAWB 3LCCA 1T5SA 2EJUA 3E61A 2F1HA 1JKIA 2FN7A 1VZ3A 3R9KA 1J42A 4J1SA 2EBUA 2J4CA 4ND8B 2HA2A 4A6DA 5CXQA 4PN3A 5D7BA 1KY2A 2P6NA 2ZZNA 3T15A 1KK1A 5K01A 3UAWA 1AS3A 2J9RA 4Z9XA 1LNSA 5TQ0A 3ZY4A 2CT8A 2HBQA 3EGEA 3RVBA 2IITA 2WAOA 4UEJA 3KYCB 2I2WA 4ERNA 3R7AA 1SOWA 1YDHA 4MKXA 4B79A 1Q20A 2BT4A 3FTFA 4FEAA 4E46A 1IZ9A 1XD2A 1ZIOA 3G8CA 4ZYXA 1Y5RA 4RPCA 4M9UA 5U1PA 2ZAYA 1N8NA 3RJ5A 4G81A 4Y2JA 1YS9A 3VR0A 3N2LA 5KWJA 1A9XB 1FPMA 5T8KA 5G53C 1DIRA 3GXBA 2BGKA 4J0FA 5IUKC 1G21A 4PBRA 9GPBA 1B1CA 1KH3A 1P2SA 4LGMA 3RVRA 3L0CA 2G1KA 4MRPA 1ZG3A 3NV7A 3WDMA 4J1TC 1PJZA 3ABRB 4OB6A 4Y6RA 4DDKA 5ES4B 4AJ9A 2QX9A 5KHLB 3QVMA 2ZBDA 1QQAA 4L2IB 2X7HA 3JWHA 6Q21A 3I9V1 4ZVMA 2C9ZA 1P29A 2J41A 1DT3A 1XPUA 4ZI7F 1NOIA 5TEVA 5A3JA 3IMGA 4QO7A 2BGLA 3GAMA 5TQ2A 5K0LA 3IQIX 4PC6A 4QHSA 4E30A 4M6WA 4L1KA 3L93A 5BYJA 3P97A 3DBRA 5DZSA 1R8XA 5B3AA 1FSPA 1W5FA 1V8BA 2OT3B 3KR9A 2XUAA 3NDRA 1W1WA 2DKFA 2ODBA 4BU1A 1F2TB 3JWGA 1PLLA 4UM8B 5HKAA 4HWGA 3PC8C 4GMFA 3U6KA 3RJ9A 1KQFA 2GVZC 4BBPA 1Y6GA 1XHLA 3D2AA 2IZ7A 3K8ZA 2O8BA 1SFRA 1UBGA 2EZ4A 4UDOA 4Q9JA 4XUGB 1U3GA 1DOHA 1CKEA 4I8IA 5JJCA 2O5CA 4UHFA 4ZRDA 5F1PA 5LD2C 3PSHA 5HE8A 4XRGA 2UUAB 4D0LB 1IOVA 2AZTA 3SOZA 5KSWB 5BP7A 1JXQA 1W35A 3HA5A 4O8ZA 3LX4A 3NVDA 4EG0A 5I9IA 1IU9A 4ZZ3A 5JTUA 1AKWA 1RCFA 2JD0A 4LYAA 4B43A 1MHTA 1DU4A 2JGJA 3QE9Y 5J23A 1CNMA 4NQRA 1RPZA 4IHJF 4HTFB 1C0EA 3WIDA 3K9GA 3SDBA 1RWQA 4OOFA 3UT5A 4DADA 1U28A 2ZBEA 4PGFA 3FGZA 4U6SA 4X63A 5EGSA 4YAJA 3GLFA 5AOBA 4C78A 2JLUA 3LWZA 4ZVUA 2IYTA 4ZZ0A 5J43A 1ZIXA 3WB1A 1T5BA 3N07A 4A8TA 3RG2A 1HKUA 4L78A 3HXMA 2IHJA 4YP6A 4JGGA 5C2JB 1U9IC 1HGXA 4IUBS 1EDZA 3P9KA 4PLVA 4X1OA 4B34A 3SM9A 3G5AA 3VR4H 1MCZA 3SBEA 3DFKA 1CJKC 2X8LA 3GCGA 3KPJA 4TV8A 1S9HA 3ZKWA 2PKEA 5KU7A 1XRQA 4FBLA 2VUHB 3DWEX 2JJ2A 2FMHA 3JYOA 4Z0HO 4JU8A 1AMUA 3R7WB 2Q1WA 3EMVA 3H18A 3W4JA 2IYQA 4L75A 1C4XA 3HJHA 4FWIB 3M4ZA 4CLEA 4E03A 2QW0X 1BKDR 1CJUC 3QENA 3QKIA 1NE7A 4Q1BA 2IHUA 3AU8A 2GSDA 3H5IA 3DEFA 2HCBA 4Q03A 3ELBA 1BH6A 3ITKA 4DZTA 1AT1A 2AR7A 5HRCA 3PK0A 5JNVA 1R5BA 1OLXB 1QMPA 1YR3A 4IZ6A 3KOMA 4B81A 1Z6ZA 3GAZA 4MPRA 4BNUA 4BVEA 2C0CA 1X39A 3FWZA 4IO1A 4RDIA 3VU8A 4FCTA 3L0YA 4K28A 4V0RA 4G0UA 1IBKB 1M74A 3HDQA 5BV7A 4AKSA 1NFQA 3SG0A 3ZN2A 3T3OA 1Y9ZA 1BOOA 4O8CA 4QJIA 5EJ7A 4AP9A 3O4RA 1OU0A 2FSIA 4MRVA 3CVOA 1MA3A 4WGFA 3UFBA 2R96A 1IB6A 3TW6A 3KKZA 2UZ1A 3L0IB 4MJ7A 3G0IA 1NBAA 3E1SA 1L5QA 1MO3A 2OBXA 3M6LA 3T3HA 5SV2A 4D9MA 1IATA 4ZOAA 3EVGA 3SKVA 2EYQA 4BUCA 1NF2A 4JJ8A 3UIEA 1I51A 3SD7A 1Z6TA 3R6WA 4TL9A 1BFKA 2WVHA 3NDPA 4OYRA 2EFYA 3NYWA 3K2EA 2A5JA 3C5VA 1L1EA 5CYPA 4MYRA 5FPPA 4DKXA 1JUDA 1QRSA 4QUHA 3PCXA 4XX0A 4MUAA 2EBFX 3GUUA 3LQ4A 2VSYA 1B93A 4ZDKA 1U0HC 3EXFA 2UYYA 1DDGA 3ILVA 3KTOA 4U7WA 4H77A 1YQGA 1L8OA 4ON9A 2UKDA 1R5JA 4ZGGA 2GXAA 3MT0A 1TYDE 5BSVA 1V7QA 4GX0A 1M76A 1T4BA 4HK4A 4EFNA 4DLLA 3HWWA 4J16A 4MCJA 2QAGB 4ND3A 1SBQA 4AC9A 4IFEA 3RJZA 1M2VA 1RXEA 3T4UA 4RE6A 3VH1A 4JZYA 3WDLA 4BLOA 1RWBA 2B8NA 2YXPX 5EJ8A 4WN3A 1JJFA 5JZSA 2HU2A 3GJ7A 3HRKA 4MQ5A 1F06A 3ZZ1A 1WW2A 4BO6A 4TROA 4C2AA 5BRAA 2XXJA 3B9RA 3F97A 2R7LA 3GPLA 2VNJA 4MB6A 3RB8A 3RKSA 3L7LA 3MBIA 4UZEA 4WK4B 4UQPA 1G66A 1KNQA 3EPPA 1C7ZA 1VE6A 2AMLA 4Y2YA 3R7FA 1OW3B 4R16A 2ZVPX 5CB6A 3EEOA 1NYQA 3C1OA 2B0JA 1YI1A 1SQ6A 2IP1A 1SOAA 3OESA 4R6WA 1Q14A 1V9SA 4AUMA 1EFHA 3B89A 1W4BA 2ACVA 1VSTA 4DMUB 3KTAB 2IL1A 4A5OA 1R00A 1V9LA 2NUAA 2RFLA 4PBSA 4DL9A 3A3KA 5E2BA 1HV8A 4IDEA 3KSAC 2WDPA 4C29A 3CXUA 3U3OA 1JPJA 1VG0B 4HH0A 1UFQA 3VKVA 1LDBA 2HGSA 4IDQA 3BFKA 3ZYZA 1UPTA 4K87A 4NU8X 4POOA 4MVJI 5CX1A 3CVYA 4E5UA 1G3RA 1G60A 2C88A 4HNSA 1UJ5A 4ITUA 1TCAA 1SRQA 4RCZA 5C80A 3OTHA 1AZTA 3ROQA 1IJEA 1F14A 1EFVB 4X8OA 4XSGA 4YJ2F 5BT9A 1EXDA 2AVNA 4EFKA 2FDCA 3ZLVA 1CC1S 3K6RA 2Y9PB 2GB4A 2HMWA 4YFYA 1J21A 2PZEA 1ZA1A 3PFHA 5K1ZA 4QM6A 2C04A 1Y4SA 3UB4A 5K09A 2Z8ZA 1EXVA 3QLEA 1DNPA 1ZM7A 2EEPA 4GPAA 3RNLA 2ATXA 2WU0A 3DXYA 3QLUC 1AZLA 2QD4A 3ZDXB 1L5NA 4AL4A 1S7CA 3ER9A 3ESQA 3PUWA 1RPAA 1BTOA 3HU2A 4YAFA 3IR7A 3ZG6A 4EUSA 1GP2A 4WKCA 2Q50A 3IKMB 3PHCA 5AW9A 2C4KA 2HA0A 4KC0A 5EG5A 5EJ9A 1Y34E 4JLPA 1YQ9A 3LI2A 2WE7A 4INOA 4PICA 3AF1A 2Y1EA 2UVPB 4EHHA 4FGLA 5LFAA 1D4OA 1GGMA 3O1LA 3RC7A 2ZBQA 1U8CB 5AUOB 3V7NA 4BB9A 4GBED 5IJ9A 1ZJ4A 2G82A 1JLKA 4MPTA 2N1MA 2VBFA 1P7PA 4DR3B 2EYUA 4KFCA 1IHOA 1WLYA 1DKLA 4NMWA 3BXEA 1X3LA 1UBCA 1TO2E 3OCJA 2V65A 3CMCO 3HSKA 1JFFA 1G64A 4FFRA 4DGQA 1E9FA 3DOIA 1Y8QB 1AHIA 1KETA 2GA8A 5EERA 1M1YB 2PQMA 5IT5A 4MIYA 4ZMSA 1KH2A 2AMVA 1B4DA 1WF6A 2QAGC 4IH1A 1CEXA 4OYLA 3ZZ0A 2DERA 2HFKA 1M2KA 4MKHA 4MHSA 4XM1A 5A7GA 1CF4A 1JHVA 4BFWA 3CCCA 4UHCA 4EKGA 1CK4A 2G25A 5FAKA 1N6KA 2Y77A 1XQ9A 3A26A 1W0JD 3RM3A 1I3OA 1K97A 1PR1A 1P4HA 3RYHA 3UTDA 4W9MC 3FTDA 5D85A 5JNRA 1FX0A 1NN5A 1JHYA 3IMKA 4Z0PA 1JIKA 3OP4A 3WLJA 5LB4A 4C21A 4UUOA 4ARAA 3DFUA 2WJAA 4TMFA 3V9AA 1R0BA 5ICEA 1SUFA 1PZFA 4PG7A 2O59A 3RYFA 3QNWA 3GEMA 1LTHR 1GQQA 1N6IA 1J00A 1Z74A 2E4AA 4NABA 1NAIA 2PS0A 2V5AA 4GG1A 4B40A 1TK9A 3EEYA 1PK8A 1BS2A 3A04A 4Y9SA 5TIIA 2F00A 1H9AA 5EGNA 2RHWA 1OI4A 1M2HA 1DEKA 2NSYA 4JSYA 2JIZA 1XZMA 2W6QA 3K5HA 1ILEA 4QGBA 4JV5B 1AQIA 4DT1B 1R37A 4OXQA 4R1SA 3ITDA 4X9XA 4BLPA 3HFJA 1ES9A 2I7XA 4TVKA 3PQ8A 1OKKA 4L74A 4PFQA 4X1IB 4ZCIA 1OF1A 3TFQA 1TKCA 3A4LA 1RXIA 3TJMA 2ZE5A 3UHFA 4H7DA 5BN4B 2EF1A 3FSJX 1KQNA 3HYTA 2WY2D 1RVDA 4K6FA 1EX7A 1FXSA 3BGOS 2VDVE 3M7IA 2V5UA 1QRAA 1VKJA 3AUFA 3GLHB 3ETHA 3NJ4A 5KJCA 2VC2B 5F7ZA 2NUPB 2EHDA 2NYVA 5LQUA 4NCKA 4E13A 1NASA 1K06A 1E92A 1R9MA 2A5GA 3SQDA 1CR6A 4JYMA 3V8NA 3WMFA 4WMLA 5BPFA 1SXJB 4KREA 1OC2A 2XSZA 4FCVA 2ODAA 3QFHA 4ALKA 4WD3A 1DAIA 5C18A 4C7OA 4FILA 1KEPA 1LXCA 4Z6KA 4CN9A 3UBTA 4IP0A 1YZUA 4IYJA 4FIDA 5J40A 1I14A 4YN3A 5NULA 1CEQA 4I9FA 3G1UA 2Q1UA 3PWZA 4XZ3A 3ZNPA 2O8NA 3I8OA 1UMKA 4OU5A 3RUHA 5TGDA 5DM70 2WMYA 2BMFA 2PZJA 1ISFA 5P8WA 4AFNA 5JHHB 1J4AA 2WB4A 3UMGA 2YJZA 4JHLA 2ANCA 1D2AA 1NDHA 2AW5A 2GZAA 2O2JA 2WYHA 1QPGA 3ECSA 4CL3A 1DELA 1TD1A 5FDFA 4UBMA 4K9QA 1YASA 4TV9A 5HXAA 2WIFA 3P96A 5DWVA 1RXUA 3FHJA 1DO8A 4Z4GA 1MB3A 3F5SA 1ADCA 2JFYA 5ELMA 4A15A 2G5TA 3OBIA 4BV8A 2HV9A 3N2GB 1U1CA 1WPXA 1YCDA 2D74A 1QORA 3RAJA 4JI4B 4RPGA 1LBIA 3W5HA 1C80A 1DJQA 1MFZA 4BNDB 3TBKA 4H3KB 1NTRA 5A3RA 4URXR 4PLFA 3RGGA 2Q7DA 5TQ2B 4CKEA 4EBBA 1DO0A 2H8GA 5D3KA 2FX2A 3DE3X 1SVNA 4EA7A 1OJLA 2OAQ1 3HN7A 1N3BA 1NVVQ 4M8IA 3T3PB 1EUDA 2OCIA 3T4EA 1NOJA 5CD9A 2F59A 1B42A 2X4LA 2Y93A 4H08A 4GUAA 3G7SA 3FOBA 2MSNA 3FMVA 2CSUA 1Z4OA 3CVVA 2WF8A 3FMGA 3X2EA 2OG2A 1W9HA 2QK4A 1WXDA 2YNMD 4GZLA 2GD2A 4E12A 2QTRA 1FP4A 3PNKA 5A2GA 3F49S 1ZBDA 3IEKA 5FPKA 4DRZA 1PG0A 3HZHA 3NNDA 4KTVE 2QN8A 4LY0A 4NZMA 5DN6A 2H08A 5FI3A 3TQRA 1M6HA 4TSRA 4W9RA 5FBRB 3T1HB 2XI4A 1K6IA 1O77A 2YXBA 3ISTA 4J0EA 2UYGA 5H82A 3ZBTA 1ZH4A 5ALOA 1MV8A 4KXVA 1U7TA 1QSGA 4QEDA 5ALTA 4TWJA 3ONFA 3F8WA 5JSUA 3LCJA 3SZOA 4JVOA 2W2QA 3D1LA 2BZGA 1LBSA 4IEFB 2Y8EA 4V3BA 4BNGA 4LXTA 4F3CA 3AF3A 2VHWA 1JZTA 2P40A 2AK2A 4E94A 5DGCA 1RHKA 5FL7D 1I2DA 1P5FA 2OL4A 4RSHA 2IX3A 3PVZA 3AI1A 4RX1A 4WKPA 1NTOA 5JYCA 2V6FA 4UBLA 1G2PA 3PPIA 4AN4A 3SEZA 1L9KA 3ICOA 3U2QA 2J3EA 2PUJA 4LE0A 5GQSA 3B7WA 4I2NA 3BICA 3IODA 1Z4JA 2P1DA 3UUEA 2CFTA 3ENZA 3EDMA 4IV8A 3IH5A 4GMKA 3K7EA 3TFWA 3TZCA 2OAP1 1PQWA 3FKQA 3HHPA 5BSTA 3WQHA 1SXJC 3G9XA 1RZRD 2P6OA 1AN9A 3AWDA 1T2NA 3IPYA 5E1MA 5C7IO 1Q7BA 4DV5B 3FHOA 4AVYA 2ICAA 2ZUFA 2P2ZA 1A4XA 1DXQA 4YQFA 1PTKA 1KEWA 3ZKWB 2G80A 3E5RA 1K0FA 2KMLA 4OX9B 1BQ3A 4WESA 3C70A 3ROXA 5H59A 3WLMA 3B5IA 4BDTA 1R0RE 4PQYA 4O08A 4W1PA 1JFSA 4TZ0A 1GTG1 4IUDS 3S6JA 2OBMA 3GLQA 3IMFA 1UMBB 3IVAA 2Z9CA 1SA0A 1FUIA 1XNGA 2W00A 3FVTA 3L8YA 3LT2A 5JSHA 3SM3A 2EFCB 2AHOA 3DL2A 2DUNA 1Y3FE 2OB2A 1GDHA 2A4MA 4M1OA 4RV9A 3OZDA 1ESMA 2RG1A 1QKKA 1TIPA 2DF8A 2G1UA 3DHNA 4G0OA 4PX9A 5I8ZA 3T54A 1P2TA 3EXG1 2A7QA 1XDWA 2P2LA 3DZHA 3KCQA 3QNUA 5FPSA 5THKA 4YMHA 1K27A 1B2RA 2W2LA 3DCIA 1GZUA 3HVIA 1Q83A 1Q11A 3V4SA 3C98A 2VEDA 3EVEA 4KFSA 4EJSA 3AOEA 3INYA 4IIJF 3EW7A 1RAGA 2FQQA 4B8YA 5EQDA 2XUDA 4OFZA 4R1OA 1K5GA 4BX2A 2AC7A 1UXGA 1K4YA 2PZMA 3U0VA 3O1IC 1FDUA 3JASA 1S1MA 2QQ0A 4R9NA 3WJ7A 2DHDA 1D03A 1LPOA 2BL4A 2GWHA 3C3XA 1G21E 2UZ1B 4XWGA 2YZKA 2ATCA 2GF9A 1N8KA 2XTJA 3K0BA 4LE2A 4X5OA 3UH1A 3MTQA 3OMLA 4XLLA 3ACCA 3GW8A 2R1UA 1FC0A 1V11A 4IICA 4MRAA 2QYHA 3OE1A 3QU2A 4YACA 4AJ4A 2WYIA 5I47A 5JAZA 1XRJA 1EEXB 4ZQEA 1JIIA 3LSTA 5AKYA 3W34A 3FPSA 5DBHX 4WBNF 4ZICA 4Q3KA 5BVHB 1QFXA 3RH0A 4KE9A 1L5FA 1EM8A 4KUHA 5KEIA 3R7DA 3TI9A 2Z56A 1NULA 4AXXA 1E63A 1LPAB 4CKCA 2BKAA 4EY4A 3NJ8A 3H42B 3FKJA 4FGWA 4WACA 4BECA 4BNZA 3EXFB 4M7RA 4BX9A 5IKOA 1UPCA 3W1VA 2AUNA 1Y9AA 5CB8A 3MILA 5KNDA 3H9EO 3WB9A 3MS4A 2PPLA 3DDUA 1ZD8A 2B4QA 1JBKA 3ZU6A 3AC0A 3TTSA 3Q1LA 1USUA 1Y5IA 3ONWA 3PNVA 3TNDA 3AM1A 3CJQA 3O1HB 4PSKA 2BKVA 2FMUA 4MYCA 1U28C 5KYTA 1FZTA 3BB1A 3PEVA 3LHDA 3OT1A 4WBXC 1RRVA 2W22A 4JB2A 1FBTA 1TMGE 2I91A 1FP6A 4UEKA 2R86A 5CT5A 521PA 2UZ0A 2Q5CA 1XZEA 1OFUX 1ISPA 2GXQA 4V0KA 4XFKA 2X1HA 3KD2A 4Y2VA 5CP8A 2Q9UA 2ZT5A 2CBZA 3AR7A 5IARA 5I7FA 9MHTA 2H00A 1EP3B 3E81A 4H0NA 1AIPA 4OGKA 5DSZA 5TPWB 3VJLA 2YY7A 1DIHA 2GSWA 3C7CB 4FU0A 2OMEA 2BLNA 2NUAB 2ZIWB 3IE1A 1GPUA 4ARUA 3K3PA 4BMOB 4KMRA 3VR4D 2VQ6A 1K1EA 2Y1FA 2HUPA 2C3UA 1XDZA 1Z7BA 1ZK4A 1DMRA 2O57A 2IXBA 2Z5LA 3LUFA 4WOBA 1QFZA 4RIIA 1S4MA 3VR3D 2BJVA 1CVRA 3CJTA 2QYTA 3QI2A 2JGMA 6CHYA 1KP2A 1XNJA 1ESZA 2VAVA 4MS1A 2K6GA 2XYRA 2IU4A 4GVPA 3EEIA 2OY0A 1GLGA 1PR0A 5J4HA 4NMXB 2JLSA 2Z6QA 3HCEA 2FSUA 3BIJA 3IAS6 4QTTB 1BGVA 4ESVA 4YDSA 1T0JB 5JCOA 2NU8A 1JLMA 2WAAA 3V4FA 3VOTA 1RLMA 3CZCA 3JW8A 1WW8A 4GLJA 4AUKA 4ITVA 1N32B 4B6PA 1Y1QA 3LGSA 4G01B 3WNDA 5A02A 4IINA 2P9EA 3L8DA 1UXHA 3SIRA 2FZLA 1Z33A 4KTTE 1HQKA 4PHCA 5CPBA 4EHKA 4FEEA 3ICVA 1ULBA 2J7PD 1J0DA 1X80B 4G97A 4LJKA 5E0KB 1KRWA 2FPOA 4M8NE 1SURA 3U7JA 2IT1A 5B36A 4EI2A 3BFVA 3LLCA 4YGXB 4MWBA 2W2KB 4KI0A 3MAGA 4NNJA 3O4JA 5EWLA 1UMDA 5LA6A 3WYEA 7GPBA 1S8NA 1LF0A 1E2MA 4IJWA 1FNDA 3IHKA 1BD4A 2PMCA 2P2CA 3KS9A 4HVAA 1FTNA 3OPYA 2WUVA 5B64A 4ZI5A 1RWNA 1SG0A 4LZLA 2O50A 4N3BA 3O5AA 4W4TA 2JJ1A 1JH8A 2OV8A 1M8FA 3EGCA 2X4GA 2AT1A 2F3PA 4WXRA 4DXDA 7REQB 3WL5A 1HR0B 1IVNA 1J99A 1CQZA 3PDIA 4NFLA 1JFFB 4TLBA 3RIYA 3ZWAA 2VQEB 1E4OA 1Z18A 2F62A 1WE2A 2WJVA 2GFHA 1SUEA 3A1SA 2BD0A 2PWBA 4J16C 3CLUD 4OA5A 1GO2A 1WU8A 2AEJA 4L3OA 1LNZA 3T5MA 3TO5A 3WNQA 4EAAA 3A3OA 4HUJA 4EOGA 4CL2A 1OBHA 1V7PC 4I4NA 4PRLA 1EJ2A 2XVAA 3H04A 4CTKA 4TPKA 2WIDA 3DVSX 3U3MA 3P0RA 1ZUD1 2ZXEA 3IUMA 3NKVA 3Q8XB 3TQQA 1WVGA 4TXMA 1Y3BE 3K4PA 5CXXA 2FETA 3Q6NA 1Y9JA 2WIJA 2JAHA 1YA6A 2GPAA 4FE4A 1VKNA 3KOXA 2CE7A