2UZ1A

1.65 angstrom structure of benzaldehyde lyase complexed with 2-methyl- 2,4-pentanediol
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BENZALDEHYDE LYASE
publication title Structure of the Thdp-Dependent Enzyme Benzaldehyde Lyase Refined to 1.65 A Resolution.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 187
structure length 554
sequence length 554
chains with identical sequence D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2uz1A01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2uz1A02
4UTVA 1UPAA 5MGNA 5HJEA 1W85A 2QQGA 5EJ9A 4BN5A 1QS0A 5DEIA 2VK8A 1Q6ZA 1DTWA 3EXFA 1YI0A 5HGXA 3DVAB 3ZHTA 4GG1A 3DV0B 4COKA 1IK6A 2WVHA 1UMBA 4UU8A 3EXHC 1V1RA 1Y9DA 4KXXA 3EY9A 2YIDA 4K9MA 1YD7A 2BFEB 3LQ2A 1WCIA 3HWX1 3K35A 4I5IA 1NI4A 1M2HA 5K6TA 3PKIA 4JUBA 2H2DA 2BFBA 4BV2A 4RMGA 2PDAA 3HYLA 1UMCB 4XEUA 1M2GA 4V1CA 3GLRA 3EXHA 2QTCA 3EXIA 4BVHA 3U31A 4IAOA 4UTXA 1YI1A 4BVFA 1EFVA 1W85B 1YBHA 4GP9A 3AHIA 1QS0B 2C31A 5ESDA 4F4UA 3DUFA 2J9FB 4Y6OA 1U2DC 3L84A 2V3WA 3EXFB 2C42A 4K9PA 2IHTA 2BRUC 3AHEA 2H4JA 4HDAA 1OZHA 5EJ7A 1PT9A 4JUDX 1E3TA 4FZ3A 2O1XA 4IF6A 4K9KA 1UMBB 4L3OA 4GPEA 1DJLA 1V1RB 2JI8A 4RMHA 1X7ZA 4JT9A 2BEUA 4Y6QA 3AHGA 2VJYA 4BVGA 2C3YA 3M34A 2FWNA 5EJ4A 5BWLA 1UMDA 2BFFA 1OVMA 1WCIB 4JSRA 1NI4B 2H2FA 2OD2A 4MPPA 4ZP1A 4KXYA 2C3UA 2VBIA 4UTNA 1S5PA 2XT9A 3JR3A 3AHJA 4V1CB 3EXHB 3UPTA 2H4HA 2QTAA 4J1TC 2PGOA 3EXIB 3AHFA 4JD5A 4KGDA 1NGSA 2VK4A 1PNQA 5HHTA 2QQFA 1KEKA 1HZZC 3PKJA 5EJAA 2UZAA 3HWWA 3RIGA 4G1CA 4C78A 1T9CA 3DUFB 3EXG1 3RIMA 1V5FA 4C7BA 4ZZIA 3JWPA 3FLMA 2Q5OA 2G28A 1N0HA 2OZLA 3D81A 2B4YA 5AHKA 1OLXA 4UUBA 1SZDA 2C3PA 2VBGA 4Q9DA 1X7ZB 2J9FA 2BEUB 1UPBA 3EYAA 3EXEA 2XTAA 5BWOA 5ERYA 1UMDB 2BFFB 1U2GC 4KXUA 2Q5QA 4GM0A 5IMSA 2A1TR 3LQ1A 4C7VA 1YHZA 3PDHA 4MZXA 2BFDA 3ZHQA 2BP7A 2A1UA 3M7IA 4RJKA 1UM9A 4KXVA 3AHHA 2Q28A 4GM1A 1MCZA 4QPZA 1V5EA 1X7XA 3ZHVA 4X3PA 1V1MA 2G67A 4BVEA 4RJJA 3IAFA 2UZ1A 3LQ4A 5HYVA 2Y0PA 3CLTD 2FRDC 2OZLB 4FEGA 5EXEA 1JSCA 2XT6A 1QGDA 2H2HA 1OLXB 1X7YA 1TRKA 4KPUA 2FR8C 3AI7A 5DGTA 1Q14A 1U28C 1YHYA 1Q17A 2Q5JA 3MOSA 4FEEA 1M2KA 1PNOA 3EXEB 4BUZA 3D7KA 3EA4A 4JUFA 3CLRD 2JLAA 4HD8A 3UK1A 3IAEA 2JI7A 1S7GA 1X80A 5MF6A 5ERXA 2H59A 2AG1A 1UPCA 3FSJX 1B0PA 2BFDB 3EXG2 2BP7B 4JU9A 3M6LA 1Q1AA 1UM9B 3ZHSA 2IHVA 2C3MA 2Q29A 4QQ8A 2PGNA 5FYQA 1X7XB 1O97D 1V1MB 2JLCA 1QPBA 5MFZA 4JUAA 2EZTA 2UZ1B 2FN3A 2DJIA 4UTRA 4D5EA 2OD9A 1OLSA 2BEVA 2Q5LA 2IHUA 2R8OA 2VBFA 1MA3A 2R8PA 4R8MA 1TKCA 4O8ZA 1X7YB 5FEMA 3D4BA 4F56A 2EZ8A 3ZG6A 1L8AA 5I4IA 3CLSD 2Q27A 1ITZA 3ZGVA 2HJHA 5EJ6A 1X7WA 2C3OA 5I5EA 2JGDA 5DGDA 1D4OA 5K3SA 4D5GA 3FZNA 2JI9A 2OORC 1X80B 1T9AA 2BFCA 1POXA 4RMJA 4K9QA 1YC5A 1BFDA 1TKBA 1OZGA 4K9LA 2WVAA 3F6BX 1U31A 2PANA 4Y6LA 1V16A 4TWJA 2WVGA 5EJMA 2H2GA 1OLSB 1U5BB 5BWNA 2BEVB 4J16C 2AG0A 4RMIA 2YICA 3AHCA 4KXQA 5EJ5A 2NXWA 4GM4A 2H2IA 1R9JA 1EFPA 4QELA 1X7WB 1GPUA 1V11A 2G25A 3F6EX 2JGDB 2EZ4A 5I51A 2BEWB 4IG9A 1AY0A 2VK1A 4BVBA 4MQ5A 1YNOA 2BFCB 3ZHRA 1W88A 2O1SA 1RP7A 4JT8A 1OLUA 3KOMA 1O96B 3OE1A 3AHDA 1PYDA 4V1CI 1NM5C 4MPJA 3CLUD 1M2NA 1V16B 4L2IA 2EZUA 5C4IA 2EZ9A 4KXWA 1XLTC 2JI6A 5MFPA 1PI3A 1ZPDA 4TWIA 1T9BA 2NYRA 1DTWB 2R5NA 5EXDA 1T9DA 4JU8A 1PTJC 4K9NA 3CF4G 3GLSA 3RIYA 2IEAA 5I5GA 1YTLA 5K6RA 5K2OA 5D7NA 1U5BA 4UTZA 2W93A 2OD7A 4FVTA 1V11B 2OO5C 3U3DA 1YC2A 3DVAA 3ZHUA 1OZFA 4K9OA 4BN4A 4RJIA 3DV0A 1V5GA 1ICIA 3LPLA 3E9YA 4BV3A 2H4FA 1SZCA 2E6KA 4C7XA 3M49A 2BFBB 1W88B 1PVDA 2JIBA 4UUAA 1PO7A 1POWA 1M2JA 1OLUB 1Z8NA 2BEWA 2BFEA 4MPRA 2FSVC 2X7JA 4JUCA 1TKAA 4X3OA 1UMCA 4UU7A 3OOYA 5EJ8A 3GLUA 3GLTA 4WBXC 1J8FA 3ZGOA
chains in the Genus database with same CATH superfamily
2XB2A 1Y7IA 1ZINA 1P5RA 3ABIA 1WXDA 3E9RA 4GU5A 4HWKA 4WKOA 4MYCA 4XIGS 1PR9A 3Q7TA 3REOA 1W85A 4EBBA 4MUMA 1XTUA 3QSGA 2Q2WA 4KE6A 5AUOB 1S1MA 3ODGA 2XIQA 3V8MA 1IXYA 2XIJA 3OJLA 1Y5MA 3H75A 1KAQA 2I6SA 4J0CA 4MIEA 3EUEA 5FTWA 4BJ6A 1QS0A 3BJEA 3C5HA 4QU5A 1SA0A 2D1FA 1VGRA 2QPAA 3IXLA 4HTFA 4ZHQB 3IR5A 4KLAA 1QF9A 2AFHB 3BILA 4I4LA 5TPWA 4A03A 1GPBA 2JFFA 4C3VA 4NECA 3D4IA 1FFEA 5B37A 3A04A 1NFRA 4HGQA 3DV0B 1NSYA 3WG9A 1MW8X 1GT91 3BWDD 2G1KA 3OUTA 4YP6A 2B5VA 5KQPA 2P6UA 3UF0A 2EKDA 3OJFA 2ICAA 6REQB 2VDVE 3N2KA 4OOEA 2OECA 1ENOA 1DFGA 3RUEA 4F5DA 5KTOA 3A6JA 3TQCA 1XR3A 1VE6A 3GELA 2HK7A 1Y8QB 1R0SA 4KAXA 2X9NA 4LDAA 3F96A 3HJHA 3JYNA 4QPDA 3NBAA 4S05A 5AVXA 2NUTB 5CAEB 1V3QE 3QW4B 1O7JA 4GXRA 4K9MA 4WCFB 3SIRA 3M6XA 3V9PA 3DT8A 1ICEA 1MAUA 4D3ZA 2QM8A 2V5AA 2GVDC 2ZSUA 4QULA 4GVXA 4OL0A 2DFTA 2YMPA 1G3IA 4DEVA 2IT1A 1XKLA 1UBLS 2J7PD 4INZA 4DRXA 4NZNA 1VPEA 2B0JA 1QYRA 1M2GA 2VHXA 3HYLA 4HNHA 5EVCA 4BQQA 5JJIA 3MJ4A 1QIEA 3F46A 1H3EA 4V2UA 5IKMA 4LF7B 4N0DA 3AERA 1L4HA 1ADCA 3DOHA 7ADHA 4FNOA 4ZCLA 4MROA 4KJXA 4WIAA 2ZE6A 3EDMA 4PZYA 4ZGBA 1LNQA 1OFIA 3MEQA 1RRPA 1TLTA 2QMUA 4YQEA 5SZIA 3VYVA 5C9ZA 1HR0B 1KO8A 3C39A 3CWZA 2ONJA 3RV3A 1UDAA 2GAJA 2ZIGA 4RBNA 3U62A 3UENA 1Q0QA 3BDAA 3L9XA 4UREA 1RADA 4AECA 1U98A 3EXAA 3NGLA 1GLGA 1PT7A 3IDZA 3ICWA 1PZMA 5ECDA 2BZGA 2C31A 4XOIA 2PO7A 1EX9A 1DLIA 1OWNA 3DUFA 4QQKA 4UCFA 4F4UA 3FB1A 3ROGA 2CBZA 4U7DA 2BFPA 4U02A 2EG5A 1MKYA 3IMCA 3RROA 1KIAA 2LZ0A 3C3YA 2BMAA 1QQ5A 3L0ZA 1MQAA 2WNIA 3GXOA 4C1BA 1R66A 2BRUC 2H4JA 3UJCA 4F7DA 4BATA 1AGNA 3IRUA 3ZV7A 1Q6YA 1ST2A 3F73A 2B8WA 1E3TA 4FZ3A 1Z5ZA 4IFIA 1WF3A 4Y1EA 3K16A 4PVDA 5AW2A 4JQCA 4L3OA 5HTKA 4BO2A 5FWAA 1GDHA 3F5MA 1QQTA 4TRMA 1WPXA 1RM5A 3KXIA 4JT9A 3A3PA 4MLDA 4Y6QA 5FKJA 3SLRA 3T4UA 5K8JB 1U7DA 2YIVX 1KQFA 3K70D 4N48A 1CYEA 5DNAA 3WQQA 4D9FA 3JPWA 5J2UB 4JBLA 1JIQA 2FRVA 5JI3E 1KYXA 3Q2OA 4UM7A 1EE9A 4NATA 1T5BA 2Z6VA 4K8RB 1ID8A 1W73A 2H2FA 2RC5A 2VRBA 3QBEA 3CM0A 4PG4A 2QA5A 3T3HA 3RR2A 2VPQA 1RAEA 1P4GA 1Z33A 4CEJB 5CVTA 1JFSA 4QGBA 1I7PA 4P82A 2Z8XA 4D44A 1AT1A 1Q2UA 4RMNA 4W9NC 3QA9A 5HCIA 3W6ZA 4Z7OB 2JJQA 5CXSA 5WRFA 1JIKA 2FWMX 1H8ED 4MV1A 4UMDA 4QFCA 1V8PA 5DGHA 2PGOA 5AXCA 3TO5A 4EPRA 4F9GA 3T5AA 1AGPA 3FYUA 4YASA 5DMHA 4J7UA 3O1LA 2VRCD 3JWGA 5JPCA 1UBSB 1IZ7A 5BQ3A 5T6MA 2WUWE 3ZUPA 1K88A 4UDXX 3NHAA 4O2RA 1X74A 2PXXA 1F1JA 1SKYB 4FIDA 5CB4A 1DWOA 2FMKA 1Z6QA 1Z0UA 1EBFA 3GUCA 1XALA 2F1OA 3LIPA 4W9NA 2J5KA 2FPGB 3A6HA 3VOBA 2XB9A 3NATA 4OCZA 1PHPA 3TVDA 3AH8A 3E7PA 3LT5A 2GM4A 4IV5A 2FSSA 2JH9A 2Z95A 4R6XA 5KINB 3UMVA 3W3AD 3K8OE 2CW5A 1Z4MA 4HNUA 5BRNA 4D42A 3QWAA 5FCDA 1L5LA 1BX0A 1EWVA 3D64A 3D3WB 5DM60 5B1SA 1NXQA 2D00A 3KD3A 1ZISA 2NN3C 4MCHA 4NG4A 5DNWA 4DXHA 4QO8A 4GI5A 2V7EA 3WMXA 4OQ4A 1SO8A 3PIIA 4RA6B 4RZXA 4W8GA 3HB9A 1IVYA 4G65A 1XU4A 3CRZA 4V0OA 2BCJQ 1H2YA 1KVQA 3O75A 4ZU6X 3ZDYB 2GK7A 1LY1A 3KVYA 2F3PA 4RH3A 2FQYA 1N5MA 3ETJA 3K8QA 3ZDXB 1JU4A 4EFDA 5BNTA 1N6LA 4NH0A 1C3OA 1QQ6A 3AI2A 3A9WA 1T8RA 1W581 4LOHA 2WHQA 2K4MA 4CKCB 4RD0A 3DTVD 2FUKA 1H6BA 4WEQA 3EEFA 3AHHA 5JS1A 2Q28A 4YJKA 4CCSA 1RP1A 2BMDA 2IYLD 4ZV4A 3OM9A 3VDQA 1PW5A 4HYEA 5JAOA 4QPZA 4EGAA 3NM4A 2G67A 2D2IA 4EZBA 3DLCA 1TTQB 3AXSA 2RKWA 3L7KA 3HN2A 5LQSA 1KJYA 2A1TS 3LLUA 4M1KA 2IYTA 5A4JA 1PR6A 1N8NA 4O4JB 4KPYA 4MB0A 5AM4A 3D4PA 4AY5A 3JQBC 5CITA 2JHGA 1OH7A 3H9CA 3E5RA 4A0FA 1VLQA 3L7NA 3V46A 5IDWA 1KEWA 2ZXFA 3G2IA 2J5XA 1G8HA 1JHMA 1R6TA 1TT5B 1Q84A 2OXRA 2R5FA 4L8WB 4WZAA 4ZGWA 4NE2A 3WIDA 3TLBA 3UT5A 4Q1DA 5AW6A 3EIQA 2O06A 1TVKB 4NJMB 4ACAA 4QLBA 1GTG1 2HM7A 2QTWB 3B70A 2PMBA 5EXPA 1VHQA 1IC6A 5AI6A 1SCIA 4DUPA 5KNCD 4XYGA 3ZYCA 1BO6A 3U4HA 4DA9A 4CEHB 1KMIY 1KZ7B 1IQPA 3L49A 4EKGA 1PNOA 2PL9A 2JVIA 3JY6A 1U1FA 3NAMA 4IBOA 4Q24A 5KI6A 5DNCA 1P19A 1IJEA 1QNLA 5JSZA 1XZDA 5KB3A 3A1NA 3ZWDA 2EDCA 3A8TA 5EN4A 3IS3A 1S7GA 5AJWA 1ZC4A 4YAUA 1AQJA 4QVIA 2BR5A 5GV7A 1JIXA 1STOA 2BONA 4U0JA 5CXUA 3DC7A 2R7AA 5FWXB 4MUEA 2DBZA 4N18A 2DFNA 3I2FA 1CWUA 4CTJA 1R8XA 2R7LA 2RAPA 3GA7A 5JANA 4K6HA 1I3MA 3UJ6A 1PNRA 2YHSA 1YS6A 3O74A 5LQKA 3R1IA 1XNQB 5BSUA 4PVCA 1NQWA 2W71A 3LUPA 4RVUA 4WNIA 4W7HA 1RJEA 1VLJA 1D1PA 5ITVA 3EASA 1J0CA 4B6QA 2X15A 3JX9A 2QMQA 3N0WA 1VG0B 2E2WA 5CVVA 1FMLA 3U3MA 3KFVA 1JXQA 4UXIA 5E1BA 5G0UA 3SBXA 4C43A 1K08A 1BRTA 3FTPA 2FXIA 4MRMA 2VATA 2VYQA 5ALEA 4EUKA 3LUDA 2C97A 2O2JA 3KPVA 4N6GA 1OSNA 3GAFA 4TMKA 4UDNA 3FCSB 4AC9A 4DV3B 2W0MA 2O2GA 3OX3A 3KOWA 4MI1A 2Q5LA 1JAZA 1QVWA 2XUPA 3IQFA 1GTZA 1EBBA 1K1EA 1K3FA 1MQ9A 2JCSA 2ZW9A 3TVTA 4L51A 4G5OA 1LJUA 2OC9A 2KX7A 3CLVA 1Q1GA 1B1CA 1FUEA 1PX2A 1DS6A 5AFSA 4OJNA 1THZA 3I3OA 3ONEA 4KN8A 3AU9A 3CX8A 3K71B 1J1ZA 2EZ8A 2C5FA 4JB0A 1H3FA 3HCFA 3RVPA 1RJGA 1SEPA 2C2ZA 4QOSA 1KHTA 1CJMA 1VL8A 3QGMA 1ZW6A 2OZKA 2ZIXA 4ILKA 1CRZA 4MGHA 5C3UA 2BGNA 4BLTA 7REQB 4ZT4A 3S7ZA 1G7TA 2N9UA 1RJ9A 4JOQA 5E4FA 2PSJA 1TAGA 4O59O 3LW8A 3SS9X 1BWPA 1Z26A 3N3AC 1ESEA 2BDUA 1JH8A 2VBCA 3FYCA 4J1TA 1FYWA 5K0JA 3CF6R 3OE7D 4XQEA 1EUYA 5B2FA 1MEEA 3DEAA 4MULA 2F3QA 4HT3B 3RG8A 4YUAA 2GZMA 3AJDA 4FGLA 3PFFA 4NZ9A 1WY7A 5A6SB 4NOLA 3ZK9A 5LP6F 5B58T 2NSYA 1KEZA 1ZMXA 2IBSA 2MSLA 1FDIA 5DGCA 3IE0A 1XEXB 4QRHA 5G0TA 2I7CA 4GLBA 4XCXA 1DXYA 4RSRA 4AF8A 3EQ7A 5JTUA 4CODB 2PKYX 4W5NA 1BFDA 2P91A 1YOVB 2PT5A 4L8FA 1OFVA 1VL6A 3KZ1E 1JEEA 4W1QA 2AUMA 4Y1RB 1OZGA 1ISMA 1HM5A 1JKJB 2IUTA 2XMBA 2JGAA 2Z8YM 2ZYIA 3FR7A 3PE4A 4JT4A 4CIAA 3ZHZA 2PUCA 3ZD7A 4WX2B 3X1XA 3V7WA 4M55A 1Z4JA 4CIBA 1QPGA 4TWJA 1JRLA 3AY3A 2IH2A 4LYAA 1M8FA 3L05A 3K20A 4PE5B 1WQ1R 2DX7A 3UUEA 3B5IA 3RWMB 1Y34E 4G5QA 1OKKA 4QEDA 2ZJAA 3LLCA 5GTDA 2CCJA 2PX3A 3BIOA 3IJPA 1EAYA 2GSDA 3M83A 3HWSA 3ZNOA 3W6NA 4HRXA 3T3EA 1DX4A 1T15A 2HMYB 3BMOB 4LWPA 3ZLTA 3SHFA 4AKEA 2Y1CA 1U2GA 4US2R 3DEIA 1IJKA 3QBVA 4B3IA 5LYJB 2GD6A 3R6GA 4AROA 1XDDA 3VR3A 1BYIA 3AUAA 2C5LA 4TMFA 5CVJA 1BZYA 5BN3B 4BMDA 5IT5A 4QPJC 4JNKA 3PRJA 1SQSA 1RLOA 4RKWA 2Q0XA 2AFRA 2OUKA 4ZEXA 3R9IA 5AJUA 4C0WA 4NS4A 3IIMA 4S3MA 3NLLA 4DJ5X 5JALA 2Z9BA 4I50F 1UXKA 3G7NA 1XRJA 3MUNA 2C8KA 4RZ2A 2FJPA 2RHRA 2VK1A 4A5SA 4UHBA 4WVFA 5IBCA 2GZAA 5HF8A 1WM1A 3ICCA 3LK7A 3QI2A 4J0DA 4WKPA 2NSHA 3ZDEA 5KYWB 1SCBA 3OMWA 1YA4A 3C74A 1OFTA 3RRMA 4UD6A 3WYAA 1C1DB 2HU8A 1YR3A 1QTRA 3EVCA 3MWDB 1XMJA 3FVTA 4HAVA 3IQXA 4GOKA 5BNZA 5LYJA 1IWBB 4FU0A 1Y6GA 5HE9A 4IM7A 4KE7A 4RHTA 4R8VA 2C8LA 4TPKA 5ES3A 5CPBA 2OOKA 4JDPA 2R44A 1SEVA 1QMPA 1GZ5A 3UMCA 1SMKA 4B6FA 4MKIA 1ZD2P 4XFJA 4CKZA 5C1DA 4U8GA 5KKNB 1J49A 3T9CA 1J39A 1UK8A 3CJRA 1N0IA 1Z2OX 1TUGA 2YV5A 3RO7A 5MFPA 4AU1A 3JD4A 3KUKA 1ZAKA 1ZPDA 4TTVA 1N77A 2C4TA 2Q3FA 4QC2A 1AU9A 3FSGA 3W2HA 5CA0A 4QHSA 3RIYA 3D6FA 1PN3A 3D8UA 3H05A 2XF8A 2G88A 1Z8DA 4M0MA 3ROFA 4EECA 3RSSA 2WUEA 1LPAB 4CTMA 2WM2A 2LR0A 1ESNA 1NG1A 2NU9A 4JSYA 4LVNA 3STTA 4OKSA 3SYKA 1KQOA 1N2OA 4QAJA 1J0DA 4QX6A 5DJ5A 5B4UA 4CLEA 1TAQA 4N0MA 4LHWA 3WB0A 1FP2A 2QP3A 4GBMA 3SCZA 1WMAA 2YTZA 4RIEA 2YJ3A 2YHBA 1LPNA 4FVTA 1H8HA 3GNSA 1TUEA 3I92A 1S3SA 2LBPA 5EKUA 5GM2A 1Q57A 5REQA 2DJ5A 1OIXA 4NH4A 3GJ4A 3T5TA 1J24A 1RE1A 3C45A 5KPDA 4F2DA 3ZHUA 3C6QA 1E0JA 3HBLA 4K9OA 2GHIA 2Q3DA 2X0RA 4GNKA 1QIGA 3VPFA 3ZIAA 3DAYA 3K1TA 4KLRA 4ALKA 2H16A 1A82A 1MO5A 3PF8A 3EGEA 2GI4A 4B4DA 1EP2B 2C95A 3M49A 3G9QA 1E2DA 1QRAA 3MB8A 4G5YA 1BX3A 1Q1ZA 4HB3A 4PYJA 2C9ZA 2H1SA 4RD3A 1CEXA 2GJSA 1G5PA 1OLUB 3L9WA 3SEZA 5TE9A 4RPCA 3BWCA 1RABA 4TLDA 4XDZA 1KWGA 3OEYA 3L0YA 4NXMB 3TRJA 2PH1A 3QIAA 3OE4A 4FR0A 1KP9A 4XYMA 3KUCA 3F74A 4BGUA 1N9GA 1WU7A 2IKSA 4H7FA 4B45A 3R3ZA 2PWPA 4DG8A 2VPYA 2JLBA 3DCNA 2O4CA 1N3LA 2HF2A 1MBZA 5AUNB 3ZDZB 4DV1B 5HUHA 1ZN2A 1VJCA 3HMQA 3A31A 1UPUA 4IRXA 3VVCA 4EWLA 1XAJA 3EARA 1ZRHA 4U7TB 3I0MA 4C30A 2GBGA 3T1OA 2UZ3A 3OWOA 4EPYA 3DMHA 1JSXA 3F6SA 1IUKA 4IIGA 3H3JA 2Y1FA 3FROA 2A86A 4BCBA 1EK5A 5FPKA 5KJ1A 3WDKA 1UPAA 5EZQA 1QVAA 1P2GA 4H9GA 5JCZA 1TF2A 1I5RA 5FJJA 3I6QA 5CFOA 2BFOA 1YA8A 3GZNB 5K2MA 4DLBA 2JIDA 1FRNA 3AF4A 2ZJBA 2H7CA 2NOAA 3HWRA 1PNTA 1I10A 4FC7A 3KCQA 4OMDA 3VM6A 1PJZA 1J5PA 2OHXA 1Q3TA 3L2OB 2H63A 1Q6ZA 2YYSA 1VB3A 3ZW9A 3H87A 1GRQA 2B6NA 1RMYA 2WF5A 4EYEA 1ZUNB 3CEJA 1T0UA 4FKZA 4JA2A 4K7JA 4GRDA 2ZAGA 2Y6UA 3OT1A 4FGZA 4XYBA 4JYCA 2XGSA 3TRHA 4GG1A 5LD2B 1I3CA 1X86B 2PFKA 1UANA 4RF4A 4YJFA 5F5LA 3VX4A 1TM4E 1ZCZA 3W9BA 4LJRA 3OPMA 4HNTA 5DK6A 4KWTA 3QMVA 4WT7A 3EVGA 2VUTA 1XCOA 3UAWA 3FNFA 5CUQA 2DR2A 1KI3A 3C16C 3OIYA 3ZQ6A 3MT9A 4Z6KA 4GGOA 1JA1A 2XEDA 5IM4A 4G1FA 4QDUA 2NO6A 2XE6A 3F71A 2AIRA 4D2IA 4ZQHA 3TZLA 2WJ6A 5JCPA 4J16A 3G0IA 1FMCA 1Z08A 1KYZA 1TZCA 2QLFA 2RCNA 5ALHA 1QU3A 1QFZA 4Q93A 4I36A 5CNKA 2B8TA 1K9SA 2YV4A 1MOZA 2CHQA 3FBWA 4FFVA 3DBOB 3EH2A 2NM0A 4LUCA 4MITA 3U4GA 3VR4H 1KE2A 4ZN6A 3U09A 2QJOA 3BT7A 2PVPA 4FYIA 4YK7A 5TNXA 5THXA 1SU6A 4PYQA 4Q9JA 1WBBA 3QKRB 3WGOA 2VF4X 1QRTA 5IU6A 2K2QB 3BCSA 5GM1A 2Z6QA 1LDMA 4KEAA 4EX6A 4QXAA 3D3EA 3RYCA 1WX1A 4RDHA 5CCDA 3ZU3A 5B6JA 4H0CA 2BFWA 1A5AB 1H4QA 1JAHA 4N1AA 3L82B 4BP9A 3CN7A 4AJEA 4ZAGA 4BCDA 5JLJA 3MHPA 3UAOA 5FQNA 4CLHA 1RKQA 3EZNA 4YLGA 1JEAA 4J1NA 1RXIA 4CQMB 1XA0A 2AUNA 1SBYA 3BKWA 3C3CA 4RF3A 3WLKX 2BM9A 5BNIA 3F7TA 3PU6A 3WJ1A 8ABPA 3RT1A 4PM4A 2QV0A 1UQUA 4BGIA 1DP4A 1DIRA 1MB2A 1WV1A 1U7ZA 5H4HA 5A9SB 1YNSA 2A78A 2XHZA 3KAJA 3H42B 3K5IA 3R5HA 5FXMA 1O03A 5HG0A 3THYA 1S4QA 2QM3A 4PQGA 3ID6C 1D2HA 5B36A 3FCUB 3GMDA 2VDMB 1A98A 1EGHA 1QX4A 1UJ4A 3B1XA 3KJXA 2HCRA 3MUFA 4AO8A 4BJ5A 4BQSA 3OG9A 4NSNA 4QATA 4J0IA 4M9QA 2FZCA 2G1UA 3CLUC 4RY0A 4ERXA 2BGRA 2RGNC 5D86A 4HUQB 5BWLA 1FUUA 2HWXA 1KR5A 3K4HA 1O6BA 2RGAA 4IIVA 4JLDA 3WY9A 5B57C 1ML4A 4AJHA 4FDLA 4OYLA 3NDBB 4AZ0B 2Q9AA 3ONFA 3I32A 3H6KA 3GRVA 3OLWA 2VUIB 3FDJA 4D9CA 2H9YA 3ZVLA 1TDJA 3VH2A 4J8PA 4NV3A 1XP8A 4FS8A 3NVAA 5KTRA 1CB0A 3C8HA 1UP7A 2P2YA 3I3SR 2I1LA 2OLKA 3IV7A 4U7FA 4CM7A 1Y8AA 1WUHS 2P8SA 3STYA 3HKEB 1NOIA 2VK4A 4B7CA 3AM5A 5T3UA 1VE5A 4CMIA 2X22A 4MCJA 5KU7A 4GDFA 1NQUA 4EQZA 3OOSA 4DDMA 2WVJA 2YRFA 3U60B 1CVLA 2B21A 3IBFA 2PH3A 1JPNA 4I1OA 2QT9A 1TTPB 1K4YA 3OECA 4Q1BA 4ZVRA 5L7YA 4WV3A 4CFYA 1U0TA 4H6PA 4NE9A 4DFDA 4YJDA 5CFPA 1YJCA 1UZAA 3KEGA 3PI7A 2G4LA 4RS4A 5BWCA 2TYSB 3LRPA 3D5QA 2R96A 1TAHA 4BPBA 2Q5CA 5FR2A 4R1PA 2WA1A 5FH9A 1NNEA 1KGSA 2B4YA 3EFHA 3ER8A 1V2GA 2YVKA 1R4MB 3KLPX 1GUAA 4NBNA 5DFAA 1AO0A 2P6MA 5MN4A 3G7UA 4JLWA 1P9NA 5EI5A 2XCQA 3OZIA 5HRCA 4UUBA 1ISFA 2F9FA 1P4HA 2QENA 3OZVA 4G5HA 4LTMA 1GRNA 5BNFA 3VISA 3W8DA 3PXAA 2QN2A 4D9EA 4F04A 2AX3A 4Z4CA 4RGQA 2BTOA 2XSZD 4U5QA 2OP0A 1Y3AA 3F6CA 2VH5R 1C50A 4A92A 4W1PA 2PS0A 5CURA 3GJYA 4YDRA 1G8YA 4ZPXA 3WGVA 3YASA 1PJAA 2WYIA 1GU0A 1P33A 1VSQA 4ZO6A 1Z5OA 4ZI3A 3A1DA 1M1YB 2I71A 3EOZA 1UEIA 4LG1A 1XDBA 2JVKA 3CZ5A 2PS9A 1IM8A 4OBBA 4C4SA 2OT3B 3T95A 4WBNA 4WDQA 3T5DA 2G36A 3IHWA 4P2BA 1EIZA 2PXCA 1U90A 3DLAA 2GLTA 1EEHA 3MLBA 2UYYA 1O8BA 3HYRA 3MJVA 1BVRA 3IR6A 4PINA 3UV6A 3K9LA 5LQRA 4GM1A 3C3MA 4ITRC 3ZI7A 2WM8A 4HNQA 2HDWA 2J9ZB 1RWQA 4ZRMA 1WBJB 1KC3A 2E87A 3PCXA 3ZJ4A 1W8IA 3HJFA 4PYNA 5DZSA 1Z17A 4C2BA 4JGGA 1Z5PA 3IQWA 3JQ9C 3KQSA 4TLEA 3N0XA 4MVCA 1PJRA 4CM9A 4MEBA 1EM8B 5LP6C 1LRKA 2HA3A 2QM0A 4Q1AA 1MG5A 1ZI8A 3JD2A 3WNBA 1ATIA 3DZKA 5E0OA 5EHIA 3LRTA 3DWFA 4YGYA 1Y1SA 3OP1A 4IQ4A 5FBZA 2FZWA 4B3MB 1J2EA 2A3NA 4HFMA 1XZQA 3WO0A 4XX0B 4BFYA 5ARBA 1BHSA 3ACCA 4QQFA 4RK4A 3JAKA 1Y42X 4NBLA 1I33A 1OAKA 1VCNA 4WGFA 5BXYA 1BW9A 2JFGA 4QD3A 2KB0A 2VUHB 4MS4A 5BSVA 1C5KA 2FR8C 2FETA 1NE2A 3U1VA 3B7GA 5HK9A 5LDDC 3O8CA 1YF3A 1OJLA 1F6WA 4JJIA 3PF9A 1KZGB 1XXHB 2BBOA 2FEAA 4WLOA 3IOBA 2R11A 3K0FB 4MVXA 2ORWA 4U7GA 4ZAVA 3EVZA 3EXEB 1W59A 5LP6A 4LXHA 1KSGA 5BV2P 1KEEB 2D2EA 3UC5A 2APJA 2GERA 4OJMX 2XE4A 5E2AA 3R76A 4DZTA 3HCDA 2YY6A 3O82A 1MRSA 2ENUA 3V2UA 1SJ9A 1R5OA 1XZPA 3C87A 2QXYA 1C9KA 9ABPA 2C1XA 2H8GA 4GEGA 5TX7A 5C8XA 2WJVA 1B0PA 4O2AB 2EHDA 1ISPA 1NFQA 2HLDA 1Y5RA 4MUXA 2FR8A 1TJYA 2PX2A 4QUKA 5JYDA 1UC4B 3W5BA 2IYFA 3QELA 1XRPA 2J0EA 4N41A 4HQRA 1C7IA 3DPSA 2XUZA 3HUTA 3C6XA 2QT0A 4KLNA 3FKJA 4Y2XA 3AUFA 1RWWA 3UJPA 1YR9A 1ZM7A 3EFBA 1KZHA 5ECYA 2XF2A 4MTLA 4EKNB 1SVNA 4MOWA 2V0GA 4A0HA 1JVBA 4NCKA 2UXBB 1JG7A 4IUYA 4UJ5A 2ZI9A 1KYVA 3DO8A 2AOWA 4JC4A 1XMVA 1B3BA 1SHKA 1KI7A 2OD9A 2RK3A 3KTOA 1I1NA 4J9UE 3GT7A 1DWQA 1W19A 2FGJA 3DGFC 3EPKA 3BRCA 4MV0A 4IIJA 3NXKA 2W2XA 3O4GA 1OGIA 1N2ZA 5AKLA 4F97A 1S2NA 4CT4B 1DKRA 4WWHA 1C0EA 1VECA 3C1OA 4EX7A 1TM1E 1U6JA 2ACWA 2QJRA 1E9AA 4DJFC 5IAAA 3BWYA 3P2YA 4M6WA 2J0SA 5JE8A 1GP2A 4F4FA 3W8FA 4DXAA 2EP8A 1I24A 3QENA 4DHEA 1XE3A 2W00A 1D8TA 3NIWA 2F6RA 1OXTA 3QU5A 1KBZA 1YJQA 1RWOA 4Z0HO 4LW8A 1NPYA 2P6OA 4K6OA 4Z7QB 1JJVA 4KQWA 4L4UA 5C4GB 3WWZA 2XDAA 2GR9A 4F1JA 3FNHA 4U00A 2JLVA 4D3XA 4OSEA 1P18A 4C4TA 2IELA 2ZKLA 2W6OA 3ESXA 3SE0A 4PFQA 2PUEA 4Q39A 1RBMA 2VDWA 2PVCA 2ZWPA 3FWYA 1FFSA 3OJOA 3BZWA 5A5VA 2AFHE 4K0RA 4BQFA 1GAEO 1RC0A 2W8BB 5A06A 2QLJA 4EL0A 5DM4A 1ZGGA 4UARA 4HP8A 3CHYA 4N5DA 4PLFA 2WWVD 4G8DA 4TLAA 2WD9A 3P97A 1F60A 3C43A 1Y33E 2ZTSA 4K9LA 2WABA 2AXNA 2IOQA 4CYMA 4QT4A 3E3LA 1MIOB 5HE8A 3AVUA 4IFTA 2AMFA 2AOVA 1QKKA 2GRJA 4UCWA 4BKOA 4LV5B 2X9LA 3L5OA 4D3DA 5A3QA 2IYZA 1CZLA 3PFHA 4CMJA 4QYMA 3DAHA 1ZU5A 1BNCA 3ET5A 4K87A 4P53A 5IFKA 1Z36A 6YASA 1YA6A 2X4IA 3Q8WA 2YWXA 1K89A 4W7SA 3MBIA 1U6IA 1L5GB 3WV4A 1P72A 2VT7A 4XIJA 1E4EB 2MSKA 3OQ1A 1QLHA 1OUMA 4NBTA 4E2ZA 1ZMRA 3C6YA 5LJIA 5EFOA 5FBQB 3QUSA 1PUJA 3ASVA 2H1VA 2ZSHA 5K3EA 2NXWA 1FYXA 2HMAA 4GM4A 4M99A 2Q1XA 4KFCA 1I80A 3BE5A 2ZUWA 1YS1X 4G97A 4J3FA 5IYZB 1JBQA 2W8ZA 1M76A 2EFDB 2J3KA 2OP1A 4OHWA 5HKKA 2OHJA 4CKWB 3NVKI 3P9ZA 3QHQA 4XD7A 2F59A 3PJGA 5DLYA 3UMSA 2HLHA 1H5QA 4AAYA 1B41A 4TUYF 3E5HA 4RAQA 1M8PA 5ITWA 1EFRD 3HA7A 1JALA 2WF9A 2PA0A 1PFWA 4OREX 5CLFA 2WUVA 1AY0A 4FEAA 1GKUB 2XB8A 4C87A 4GGMX 3WLEA 1WOMA 4QUBA 1E1MA 5HJ2A 3INTA 4Q4HB 4ENVA 4AMGA 2XW6A 3FSEA 3CX7A 4AYTA 1W1IA 3WGHA 5FORA 5KC8A 4KR6A 4MUGA 2WQZA 1RYEA 1I9GA 1RCTE 4I14A 4CM4B 5JXGA 1EVQA 2DLCX 3CZCA 1AK9A 1NMEA 3LSYA 3EEBA 4ZT5A 1K7CA 5AVJA 1V4VA 1GO2A 4EG5A 1ORHA 1RKUA 2DHRA 4I0WB 4ENTA 5HFAA 1FIUA 3I5AA 1QYDA 1T6YA 1AKUA 3LP8A 4ZVNA 1GYQA 3QX7A 3ZV4A 3R3HA 4RZSA 4EI7A 3FTFA 1WXIA 3K09C 1HYBA 4G8CA 3HJRA 3C7AA 3EIOA 4IPTA 1J56A 3WL8A 3MLAA 4FFRA 2JCVA 3CNOA 1H0RA 2Q5HA 3FFTA 4RACA 3GEEA 5IDVA 5D84A 1ETHA 2WHPA 3BG5A 3RTCA 1D4FA 1GGFA 1XX6A 4Y6SA 1CUZA 4BL5A 2A9VA 4JR0A 4AP6A 1ADYA 3TW6A 1L1EA 4UPDA 4XI9A 1P7ZA 1XK6A 3LGSA 4NFLA 2NUAA 4O4IF 5F2EA 5BYJA 3C97A 1DARA 1JNYA 3FNBA 4YNBA 1YVEI 4DY4A 1ECCA 4JI0B 3GBVA 5IJZA 4PG6A 4YAEA 3WTBA 4EM6A 5IS2A 2OWDA 3B1KA 4C0KA 2QUBA 3KT6A 4FDTA 3IOYA 1SBCA 3ETDA 4IDEA 3K09A 3A06A 5BSHA 3GW8A 3Q0EA 1GM5A 2IPLA 4BGEA 1ZXBA 1EQ2A 5CHYA 2ZAOA 3VH4A 1JDNA 5JD6A 4A0GA 3L77A 4LCBA 5A0VA 4KVFA 5TT1A 3WNZA 4D3YA 5B4VA 1EVYA 1PKEA 3AVOA 3S40A 1FX0A 2RHWA 3ZE8A 3IKTA 4M21A 4JIMA 4C9BA 1XZMA 3FPEA 1SKYE 3E9YA 3L4EA 2R6R1 3B51X 3BA6A 4JHXA 4YJHA 5KNDA 1B6RA 3LUFA 1H5NA 2CEAA 2IRWA 1AQLA 4I5GA 4ZQGA 1RAGA 2AKAB 1OYWA 1S9DA 3CG4A 4Y2UA 3CKKA 3CUKA 3D6TB 4CLRA 2I2XB 1KMHA 1G5QA 4OQXA 4R8RA 3KAQA 4UHEA 5FOVA 2G80A 3K05A 4ENUA 3I1YA 3M1IA 5J40A 1MR3F 5TQJA 4X1KA 3DKRA 1T5SA 4GUAA 5EAIA 2EP5A 1E2UA 2PWBA 1K5GA 3JQ7A 3P19A 2E6UX 2FH5B 1XEWY 4IP0A 4ME6A 5J2TF 1YR2A 3OAAA 5BV1A 2ZYHA 5IC4A 2VN8A 2XUDA 1SKQA 2FUCA 1SKMA 2CNLA 3EOAI 4ZIRB 1CY4A 4MS1A 5CCXA 2F1JA 3P20A 1ZVVA 2BDTA 2AZDA 2R6JA 2ARKA 2KHZA 4MV6A 3Q3EA 5CT6A 4WJLA 4LRQA 1NUPA 4ND5A 4G1EB 1HKHA 4ZYUA 3OIVA 2H48A 1YCFA 3LY7A 2JGRA 2UKDA 3ZKAA 1ETUA 4M53A 3W5DA 3J81k 3P4UA 1Z75A 5CLLA 4DIOA 3K0AB 1XZJA 4X0EA 1RWPA 2VWHA 3VAAA 5MGNA 3HRKA 2CWWA 2CL5A 2VPZA 5FQOA 4RTJA 3QF4B 2GN9A 5EJFA 1P17A 3KOUA 1VG1A 3P1JA 2J6CA 1RXEA 2AYYA 2VJOA 3GGSA 4EO4A 3I5YA 1B23P 3KXPA 4P32A 4FMDB 5EZYB 5EJAA 3EBPA 1NW4A 3CUUA 2JLQA 5DEIA 1YUBA 3QNMA 4C3OB 4YV0A 5THKA 4JJKA 1S9HA 1E3WA 3F7OA 2W6JA 3AUSA 4HLQB 4L9SA 4ZYWA 1NC1A 3WAKA 2QAGC 2XI4A 4F0JA 4KN5A 3CB2A 4D0RA 1U8TA 1R0XA 2H0RA 2IZOA 4C14A 5BW5A 4CNQA 4EY8A 1JQ3A 4YCDA 4MRSA 3P0HA 4B8WA 1YK1A 3CVOA 5K8CA 2FPWA 2NSJA 2FUNB 3O92A 5EUCA 4KGVA 4UMFA 4TSFA 3HY6A 2JBAB 1NONA 5C18A 4PXSA 1RTKA 5EERA 4B7UA 1UK9A 1L7XA 1V1RA 1VKJA 4JBIA 4I6GA 4KX5A 3DNPA 2FSPA 3GFBA 4YMVA 1CY0A 4CVNA 5DW0A 2ZOSA 4YA6A 4MV9A 5D3MB 3MOGA 1P1FA 1UBJS 1P2DA 3N8NA 3QVSA 1V6SA 2QUIA 3PTLA 2GYUA 5EGSA 3L8GA 4RXUA 4WOPA 1ENPA 3NOOA 5AT1A 1D6NA 3A0UA 4ALJA 2WYWA 2BFEB 3E0QA 4BNDB 4DLSA 1ORIA 1SVSA 1PGPA 2FFHA 2N3ZA 2P1ZA 3F67A 4ZCQA 4Z7NB 1E2JA 3DFMA 1E1RA 1JHXA 4PTYA 4Z9AA 4HJRA 3V4PB 3B1FA 4X6YA 1BX1A 4E7PA 2VR1A 4YLEA 5KTTA 2PDAA 4C0JA 3A4VA 4GX5A 3WSVA 2W48A 1QC5A 1RQNA 4V1CA 1W0JD 4PC3A 3NHUA 3ONVA 5M7EA 2CMDA 1J2RA 3FD8A 1PGQA 3HYSA 3I39X 3WLSA 3IBYA 3NG1A 4IAOA 5K3BA 4Q19A 3ZOKA 3KKEA 1R4NA 5K6AC 1P44A 1QNFA 4DR7B 3VYTB 2CVFA 5DSZA 3MWEB 1U7UA 4EL5A 5KHLB 2WWRA 2HN9A 4YDQA 4IHKA 3GLVA 2FE4A 2GEUA 4Q02A 3DR5A 2BJHA 2QVCA 2VJCA 2E85A 3HBJA 2NQ8A 1SWWA 3RVOA 3LUHA 1IIBA 3P96A 4MDFA 5AI4A 2YWBA 2AA3A 2YIMA 3BXFA 3PDIA 1BKDR 4AS3A 2B8EA 3M81A 1C9EA 1GA1A 2QTNA 1R0LA 1FQOA 4RV5A 1EU1A 1HE4A 5EIAA 3AHEA 4HDAA 1RRFA 5JISA 3VR5A 1EUCB 4JUDX 2MYPA 4DV6B 5FUVA 1ZH8A 3B2EA 3WWPA 2QQEA 3UO8B 3KJGA 1OAAA 1SKAA 4IF6A 1QH0A 1C80A 3VYUB 2YINC 1KYYA 1L4NA 3IVAA 1DBVO 1MZVA 2NYVA 2IEDA 3NEYA 1ZGJA 3AIKA 3L8FA 4AX8A 1AZTA 2JGKA 2JKZA 3SM3A 1L4YA 1V2HE 4BZXA 2XAAA 2IU3A 1LVUA 3TOXA 3TIGA 2LWIA 1W5AA 4IXMA 2X1VA 5J2UF 1BROA 4RZ3A 4KR0A 4X00A 2ZYTX 3DEZA 2OD2A 2ZYSA 3NKLA 1DCFA 2WYVA 3B1JA 3NCHA 2NU7B 4ZP1A 3RK4A 4AB1A 3CH4B 5FDFA 4GKAA 3SZRA 5HX7A 1CYDA 3L41A 4INJA 4WK4B 3EGXA 4CZ2A 1M7GA 4QDOA 5K4HA 4ENRA 2Y1DA 1R0KA 3K0EA 2NO5A 3OLQA 4IQFA 3TZQA 4C03A 5IJXA 5K3AA 3GG2A 2JRLA 2BUAA 1RLUA 2AXEA 3PL1A 3NRJA 4BO6A 1YRYE 1M6VB 3UB3A 3OQNA 1IULA 4MI3A 4H7DA 3ZV5A 4F2PA 5DASA 3UBTA 2TS1A 4CIYA 1Y7HA 1NN1A 5EMNA 4DCSA 1QH8B 1BEUB 1Z39A 3MPOA 1B8OA 2ODQA 2H17A 2B69A 1LC3A 4JKYA 3RIMA 2BHRA 2CJXA 4KR2A 4ZARA 1ZESA 3OCWA 2KI5A 2NPFA 1XZNA 2DQSA 2YZNA 4JJAA 3TLZA 1A9XB 1GPDG 2AD1A 3L0PA 4YFYA 5F2OA 2ZSAA 1E20A 2P4QA 4HQKA 4OGWA 1IAQA 2LPMA 5AK3A 5LJLA 2IP4A 3FPJA 4Q1CA 1MEOA 3DA8A 3GGOA 5ENDA 4EDFA 2O8DA 2C5EA 1PDWA 2ODWA 3K9NA 3N3BC 4OIFA 2J3HA 2ZJFA 3RQIA 1WY5A 1E7QA 3TKYA 1DX9A 2XDQB 5HZHA 4M0DA 1NVAA 3P94A 2QPLA 3QQ5A 3WGGA 2EF0A 3AR8A 3C1TA 4C06A 5HFJA 1NW8A 4G56A 5EESA 3V1MA 3MAAC 1XA3A 2OG1A 2Q5QA 1GTJ1 2ID4A 1U8CB 1MZPA 4WN3A 3VSBA 3ZDDA 2VSNA 2BLNA 1NASA 3L7BA 4BB6A 3AY6A 5JO9A 1KSJA 2FVYA 3RVRA 4WK0B 2HWKA 4CTKA 2ZVPX 2W43A 1SU7A 4RJKA 1QO9A 1UM9A 1E1QD 3QOYA 4H7HA 4MR8B 4XPIB 4J29A 4K86A 5CRIA 1FMFA 1MVOA 1HT0A 5DBFA 2PKQP 2HQRA 1VYHA 4FONA 4E3WA 2I6XA 5E7IA 1FY2A 2PD6A 2DE0X 1E3EA 4C4OA 2HA2A 5BT9A 3CBQA 4MR9B 3VR2D 3H5WA 1EA7A 2RGEA 2EC5A 4FE3A 4ZVOA 3KXDA 2ZT6A 2OCDA 4MRPA 3RVDA 5HYVA 1V1JA 1S96A 1GZ6A 1EJ0A 4BQNA 1CR2A 4PHFA 1YRBA 1JIVA 3NWBA 1OFUA 3KL4A 1E6LA 3PZRA 4J49A 3NYWA 4ND2A 4Z8YA 3N1UA 4O4JF 3ZU2A 9ATCA 3JATB 5K0CA 1ISIA 4EW3A 1E3MA 2QEQA 4GI3A 4IIYA 1V3TA 4OHXA 1A9YA 1ISRA 2C88A 4I46A 4X8MA 3WRYC 3N2LA 1ZLYA 3CVWA 1KC1A 3KYBA 3HI4A 4I2NA 1SBTA 4PZCA 4K05A 2JK1A 2H1LA 2PG3A 3ZD6A 5TIIA 4FLFA 1ZS9A 1G41A 4UEQA 3UQZA 1P29A 4F3KA 1ZNQO 2ZIAA 1YRWA 3E03A 5L4NA 1JU3A 3PT9A 2KBFA 3ZXXA 3MA0A 5F9HA 3KVOA 2ZULA 4UMEA 4UEOA 1Q0RA 3PJRA 1M9NA 2PZJA 4HGZA 3FGNA 3RI3A 2Q9UA 3R2JA 3N7UA 4HD8A 3RFTA 2UVPA 3M33A 1AB6A 1QONA 2JFXA 4YTEA 1PRYA 1ZJJA 3PGMA 5MF6A 1WXFA 3IEKA 2M6SA 4B74A 3WRYA 4TS3A 2IIPA 1I7DA 2CDBA 4LYGA 4MVJE 5BVHB 1VPVA 1NNLA 3LKDA 4RY8A 5A2GA 1SQFA 3AJ9A 3F9IA 2J7KA 1EZZA 4DMKA 3O6VA 2HW8A 3UWOA 1RHQA 3AETA 5HCUA 2O8NA 3BUSA 3DNMA 1HXHA 3FA2A 3LOUA 1T4DA 4GOND 4GI7A 4NCIA 5AJTA 3NTVA 3O8LA 4XM0A 1QPBA 3WZLA 5DVZA 2DY0A 5EA2A 4HDMB 1X0VA 2GBFA 4JUAA 4YR9A 1E2GA 2QL7A 3LWDA 1JN0A 4P4SA 1CP2A 4U7WA 3SSNA 4NPAA 2FN3A 3E9DA 5A5GA 3FX2A 2WSLA 4I4TB 5DBOA 1GZVA 3X43A 4YRSA 1ONPA 4GVPA 3MQFA 1P2TA 1E4YA 4CTNA 5FADA 4E6EA 5ESXA 4EB3A 1D2GA 2X6RA 4YY3B 2B7CA 1T36A 2E5FA 1LVGA 3AG5A 3PYXA 3R44A 1H42A 2G82A 2YJ6A 5B64A 1BU5A 1OX4A 1YRQA 5FFFA 2HF8A 4QSMA 4Z49A 4CMHA 4OOFA 5FEMA 1LTHR 3CR7A 4HS9A 3QEOA 3HKBA 5J59A 4N3BA 2OK7A 5FI3A 4QM7A 4S12A 5ETJA 3L6BA 4JI3B 5E4JA 3KLOA 4DPLA 1Q0PA 2VHVA 3DDOA 1YZTA 2ZI4A 3JQAB 3PUYA 1XA4A 1QR6A 3MJTA 3DDUA 3CF0A 3CKLA 3PX7A 4NPHA 3VU9B 1W2WB 5JMPA 5KKAA 4RK1A 1X2BA 2B3TA 3JWHA 4JL5A 4D25A 2XZOA 5CB8A 1Z13A 3HHEA 1PWYE 3GD7A 1IONA 3G02A 3I30X 3I8XA 4FPXA 2HDOA 3UT6A 4EF5A 4G0PA 4I1IA 3ZNNA 1AHNA 5E3HA 1GTRA 4Z4GA 1AMUA 1V35A 3W78A 3RH0A 4IV0A 1UJ6A 3C7KA 2ZUEA 1CCWA 1WZUA 1ZD5A 2ZSKA 4ITUA 4LTNA 3ENWA 4MJ7A 4PONA 4KR7A 2O05A 3UJAA 3N53A 1GUZA 4LXIA 6CHYA 4D9HA 1UFQA 3AOEA 3ZWPA 1B42A 1GGMA 1XMIA 5F5NA 5KYUA 4BKQA 4ONEA 3GJ3A 2D2FA 2QLTA 4QTTB 1RXYA 1SCKA 1VDMA 3F6BX 5G0WA 1VXRA 4ECEA 4R1OA 3I2KA 1M6YA 1NBWB 4KQJA 4E1BA 1XOIA 3DOJA 1JHAA 2EQAA 2FEPA 4C6TB 1Y1KE 2IYQA 2QTFA 4HBZA 4E14A 1J23A 2XTNA 3VPAA 4WI1A 3U0VA 3H2GA 2WSYB 1VIVA 5DF1A 3CKMA 3LPAA 2WHRA 5BMOA 1DT5A 3IKMB 4HAWA 2FX3A 4N03A 4EGJA 1QZXA 1J6UA 2Y1EA 3AHCA 4Q4AB 2VSYA 1KPHA 5F1YA 5I9NA 3KFLA 4W63A 1QDLB 2FP4A 1CJSA 1OXMA 2XQKA 1U8XX 2BD0A 3ZJYA 1F1BA 3U6BA 2DG2A 4UATA 5FB3A 4TQ9A 3PIRA 3L1HA 2O8BA 2XUGA 1HDOA 4AZVA 4NZMA 1BGWA 4EHDA 1O58A 1K63A 3G0CA 1L3BA 1ZO8A 2Z5LA 3DOOA 2Y4NA 1ZRMA 1F0KA 4OHCA 4OLBA 2BEWB 4CLXA 2COKA 2F90A 1P1IA 3ESAA 4S1NA 2V9ZA 1U0SY 2GAAA 4DHWA 2R65A 1PZEA 5KX5B 2GA8A 3JALA 1VKHA 1Y9ZA 3GRCA 3IOEA 1PFVA 4G24A 4NEQA 5A4KA 4WOKA 3QVOA 5DW3A 1YVDA 3N86A 1P81A 5I4BA 1ZITA 2VOEA 2IW1A 3O91A 1WHSA 5B6PA 2R6HA 1QJ4A 1HDXA 3CPEA 3PQEA 4D92A 1H85A 2XD4A 3V42A 3ZGYA 1ZBDA 2GEJA 3K9QO 1DEHA 3WBKA 1A9PA 1MC4A 4KYTA 2Q6KA 2Z9CA 2M6LA 4BQRA 1WRBA 1LDNA 3EA0A 4H1HA 4LHZA 3WE7A 3S3TA 1TPYA 3KJQA 2IEZA 4RGVA 4TTQA 1JP7A 2PRIA 2Q99A 1L4KA 1HTWA 4N49A 2G1JA 2GPJA 1UDXA 5BT8A 5KQGA 4ND8B 1Z3IX 5D87A 1E6CA 4WKBA 4YJ2F 1HQCA 1MGOA 3C70A 1BCSA 1GU7A 3W5SA 3C0KA 3D8BA 4E6PA 2HV8A 1RI2A 1H1LB 2JA1A 3JQ6A 4OXYA 1EP9A 5BORA 3DB1A 3ZDRA 3THWB 2EBWA 2G9VA 1GCOA 5ER9A 3ICEA 2OVBA 1MT0A 3DL0A 2C5GA 1TE2A 4M1QA 3IEUA 2WJ4A 1XYVA 1YTLA 3GJSA 2Z08A 3GEGA 5LSAA 5D7NA 2QG4A 4WCFC 2GPTA 4ZHSA 2PX0A 1IOLA 4ZHQA 2AFHA 3B53X 3G0BA 4G0NA 3SEQA 9GPBA 1ZK3A 1A88A 1B8NA 1TB4A 4M9ZA 2ZB7A 1HF3A 1TI7A 4N7RA 4GQIA 4ICIA 4MVJF 1BRMA 1UK7A 3DV0A 4DCJA 1ICIA 1NT4A 2Z30A 5LD2C 2O59A 1USIA 1KKLA 2I6FA 3K5HA 1P1BA 1JR2A 1SZCA 2AKYA 2C82A 6REQA 3ILHA 3KZCA 5CW2A 3TSYA 1E6KA 2IXDA 4OBEA 4QJ5A 4UUMA 2GMWA 1PO7A 1Y8QA 1TD9A 2GN1A 3EBLA 5FFMA 1HG1A 2NUTA 5CAEA 2UUPA 4WCFA 1NAHA 1BHQ1 1DNPA 1TCBA 3GYBA 4NYIQ 5JSFA 2CV1A 1O4WA 2J1LA 2Q2QA 1XYYA 4JT2A 5C35A 1OLOA 1YE8A 1FFWA 3E3OA 4MPRA 4OQDA 4Q18A 4Y30A 3J80A 3B12A 2PZFA 1MABB 2QTMA 2R6CA 2XOKA 1KOGA 2B5OA 3CUEF 3E2PA 4HZGA 4X3OA 1YQWA 4IICA 5AVOA 5KQRA 2R2AA 2R84A 4CGZA 1JPUA 2QROA 1CEQA 3ND5A 3OOYA 1BYUA 1OQAA 1OYOA 4PU0A 4DWVA 1XXLA 3M4NA 2A0YA 2RKOA 2EW1A 5TMDA 3AKCA 3AEUB 4CUZA 1M1YE 2X4LA 1T29A 3ZYZA 5CFQA 2GZDA 1A27A 3ADOA 3OTGA 2X6TA 2DKOA 3PX3A 4NZOA 1SC1A 5ERGB 3W2GA 5EPEA 1RLTA 2FW9A 3VR6A 1JH9A 2I87A 2Q8QA 3TB4A 3JVIA 3C41J 1T34A 3N8HA 2BH2A 2P2ZA 1VSBA 3MFYA 3MELA 3WOHA 4BN5A 2X2FA 1KJZA 4LXQA 2YZGA 1XTPA 4QVKA 2PNJA 1F0PA 1QGUB 1XLVA 5F3RA 3R3WA 4AJ2A 4KIGA 4LRTB 4RETA 3GJXC 1T1GA 1VP3A 4RKYA 1R00A 1Z47A 3QY9A 1W4RA 2XCUA 2J3MA 2O7QA 3MZ0A 4JWTA 1XO1A 2F3RA 3CRMA 2DFLA 3V4VB 3SJUA 3HUEA 1XZCA 2B2CA 1PSWA 1WDLA 2CD7A 2PRZA 4I1UA 3ZX5A 3M8KA 5FI1B 2PZEA 4YMLA 3CNLA 4G81A 4D45A 2RGGA 2XRZA 2MMGA 1PZHA 3ZJUA 2VLIA 3QMWA 1DC8A 2D8AA 3LQ2A 1JXOA 3K35A 2EFYA 5ALWA 2AHOA 3FRHA 3GX1A 3K9GA 4PCLA 2IHBA 1Z0KA 4EW1A 4J0GA 4TS4A 1BVUA 1VYTA 1XXHE 3C5CA 3PHHA 3DJFA 5DLEA 1L7PA 2A5JA 3FNIA 3BZBA 2VT3A 2FW7A 1QORA 1D1QA 1T8PA 1Y3FE 4DLNA 4BQPA 2PAAA 1YB5A 1NXWA 4Q4LA 5D5QA 3AC0A 5A71A 4URUR 4BMCA 4F5ZA 4AQDA 1UAAA 1VJTA 2OCYC 2Y1OA 3OM0A 3SICE 3CJTA 4BVFA 1FA9A 2IE8A 1D7AA 2P9TA 3EAQA 3KQNA 1N5JA 2Q7DA 1ISJA 1SUIA 1YBHA 2JGLA 1NYQA 1UFKA 3F3KA 3PQ8A 5ILGA 1DAEA 3HXLA 5E38A 4ZFNA 2CUZA 3RIEA 4EEZA 3KR9A 1HY3A 4NOMA 2I55A 2C4HA 1OXSC 5AOCA 1N6NA 4I9GA 4TVKA 3UW1A 1L7DA 1PE0A 2ZEJA 3PWSA 2C96A 3JARB 4IKOA 1CHNA 3IDQA 5FPYA 3DHYA 3ZI4A 2FPGA 4TV9B 2DHEA 1LX7A 1QV9A 4G23A 4ESOA 3A25A 2G08A 2BLLA 2HHLA 1RI5A 1X1CA 2WWWA 1K7YA 2G5GX 1PDOA 2IBMA 2JJ2D 4Q3OA 5EJ7A 1A2KC 1VL0A 2HD4A 1U94A 3L43A 4F5YA 1I51A 4LV6A 4F71A 4N76A 1FXUA 4RNDB 4YRPA 5EKXA 1D2MA 1GGJA 4LZAA 5IARA 3D3WA 2GUGA 4WSOA 3FGZA 4FUTA 4JP3A 1NBIA 3LT0A 1T9GR 3H5AA 3HDGA 3WR5A 3LVFO 4YUYA 4RA6A 1Y5NA 4NC9A 2JDID 5LZ4A 4OHYA 4ZRDA 2ZVQX 2I4MA 3ZVKA 1KTVA 1IMJA 1TYZA 4LE0A 4NENA 4X94A 4HN4B 3HJUA 5EJ4A 1Y5IA 3DUWA 4P08A 1RMQA 2Z04A 2HO5A 4TX1A 4YJGB 1SQ5A 1QIHA 3SIWA 3KYDB 3UEOA 2FSUA 2QE6A 4UBMA 4DMHA 5ENVA 2YQZA 3AUKA 2BZ1A 3GT3A 3PGLA 1NQVA 4J3NA 2AJTA 4PWYA 5FA5A 4CN8A 4CKCA 1TUBB 1HYHA 4WRRA 3ZTYA 4XXHA 1X42A 1JQBA 4NJEB 3TLCA 5C80A 3AVYA 5FT9A 1A8HA 1N5OX 5FAXA 3PR3A 3QUAA 1IZ9A 3A6LA 3K6JA 4RPIA 1Z6ZA 2NZVG 5KYVA 4BX0A 1WU8A 1JLKA 2BBTA 1JW9B 2OHOA 3LS2A 4QHYA 3RLFA 4IDPA 2K87A 1S3GA 5LR6A 4XWAA 5AUQA 3PJDA 2QQFA 5AJVB 3SXUB 2GAOA 5HHTA 1Z6TA 1FOEB 3HL4A 1NRXA 1QIIA 3WLJA 1LNZA 1PV2A 1CFJA 3BJMA 3W7AA 3HZRA 1SD2A 3OZUA 2H2WA 4KVAA 5LZ8A 1E5VA 4P4UA 4MRNA 1J8YF 2RHOA 1J70A 1M2FA 4QJ4A 5EIBC 2JIQA 1M1XB 4B3BA 5CDYA 3R40A 3Q87B 2JRCA 3PHBE 1GPAA 1TT5A 5GZ3A 1W2GA 1IYZA 1DHTA 3HUDA 3WQSB 2WSSA 2FDRA 2OV6A 3A1WA 2HSGA 5AHKA 1EWTA 3E3NA 1GJRA 3PYMA 5FLYA 2ISSD 5D85A 2V7QA 4KZKA 1TVKA 2J0UB 3OKFA 4NJMA 3PHLA 5DCLA 5KDLA 1TMYA 2FW1A 3O5AA 3LC2O 4IDQA 2R48A 2NU6B 1ADFA 1L8OA 4XUEA 2QRQA 4RTMA 4GOOD 4CEHA 1B6TA 4X7BA 4EARA 3AX6A 3EYAA 1SBQA 4DLLA 5KDDA 2JIZA 1SC6A 4ZKEA 2VL7A 1T6BY 3O90A 4MV7A 1CR4A 3KEMA 2D7DA 4PW0A 4GHWA 1DV2A 1UMDB 1X8KA 2DQKA 2IZ6A 4R8KA 1XB2A 4X7PA 4BNVA 2GVZC 2W6QA 1UXHA 1BDIA 1FW8A 3TNFA 3C4VA 5DRTA 4JYPA 3KBBA 4YRLA 4BZPA 4XZ3A 3F2VA 4C0BA 5FWXA 2P65A 1W35A 4H4CA 2CLSA 2ZJ6A 2V65A 2IHYA 5CH8A 3W5UA 3ACDA 5HGJA 3BORA 3F8TA 1KMMA 5TMEA 4O4HB 2GHRA 1W34A 1RYMA 1SXHA 4NCJA 2KSQA 3TLGB 3UIEA 3BCRA 4LOJA 1JB9A 4A8TA 3EVAA 5L7WA 3UOAB 4KRXA 1PL0A 4X71A 5IZCA 1HI9A 1Q1BA 3OT4A 4O1HA 5G41A 2JI4A 3LQ4A 2WJHA 3INGA 1Q0HA 2ES4A 1TA9A 1OWMA 5EQTA 3FY4A 2IHZA 3HYTA 4PLTA 3VPBA 5KTMA 4XLTA 1TU0A 3GK3A 2GJ4A 3G9TA 3FDXA 3F1KA 4IINA 4WJZA 4AZ3B 4Y2GA 2WTUA 2GBIA 1JIIA 2A0XA 4L8LA 1E66A 2ROQA 2ADFA 1E77A 2GETA 2D3WA 1PEAA 3NEJA 3OPXA 3RS8A 5ELLA 4HNGA 1K75A 1MIHA 5ALTA 5KJ6A 3F6RA 1SUWA 1VC2A 1YU6A 2BKXA 4WLNA 3U5ZB 4KR9A 3ZE0B 7REQA 1SD1A 5DXJA 1RM3A 1QMGA 2XGOA 3KKLA 3RUAA 3TXXA 1SRQA 3TM5A 3WGYA 4URXR 3A4TA 1H66A 4R9NA 4ZDWA 5JR3A 5LBIA 2MSDB 1JHRA 1YZVA 2JAPA 2ZBVA 2B4QA 3JR7A 3USES 2Q1WA 3ZC3A 3KQHA 5JI2E 1P0IA 4KIWA 3FFWA 3JSXA 4ALIA 2JI7A 5E1MA 3WB1A 1AKEA 3USCS 5A6SA 5JWOA 4FE4A 5BSMA 3UXHA 1NW7A 2RG1A 3JXEA 1PHRA 3P0RA 4KNWA 2B99A 1BD3A 1XEXA 4ABTA 1TF5A 1I0LA 1NXVA 1QDEA 4B2IA 4EA8A 1LF0A 4MUIA 4WKNA 2OCIA 3KJIA 5IDXA 4YXFA 2O3SA 2XHEA 4FX2A 4LXXA 1YOVA 4RZIA 1KO5A 4S1VA 3SBOA 2B4AA 4O2AF 3WLFA 3HI6A 4Y1RA 1PR4A 3FMGA 4L0DA 1YDEA 3TSOA 2MSWA 4R71A 3S55A 1HDEA 2PNFA 1UF9A 3GNQA 3M9WA 3LDAA 4LI0A 2J59A 3KP1A 1D0SA 3SC3A 4D82A 2IEGA 2JZOA 1KDOA 3U49A 1VPDA 1ZNZA 4P3PA 3INNA 1LNSA 3HDJA 2WHEA 2X8WA 5FYDA 4TZTA 3IDSA 1ZWLA 3T3PB 5JZSA 3I37X 3Q7QA 1Q7TA 2BTQB 3SZOA 1CIVA 5DK4A 1RXCA 3O94A 1PV4A 3LC0A 4U6SA 1PBTA 1FNSA 1IZ0A 1C7JA 3CVJA 3BMOA 3JQCA 3LDHA 1T9HA 2V6FA 4US1R 3R0VA 1NJGA 2V4UA 4RYDA 3S44A 1M74A 4JJGA 1GPNA 1JAIA 1BQ4A 3DE3X 5H1YA 4YQFA 4B5LA 1WHTB 1XSEA 2FY8A 3K9CA 5C8YF 4AKIA 4PX5A 4Y2SA 1C30B 1A9RA 3E15A 5BN3A 4RDIA 1ZM4A 2C4MA 1N6KA 3FI0A 2VTVA 3FXAA 5BPHA 3EPRA 1F0YA 4HSGA 2I34A 2CXNA 1QFJA 2QKYA 4L57A 4TWZA 3GJZA 3TOVA 1FNNA 3HABA 3O9ZA 1XNJA 3S1LA 7MHTA 1DJNA 2C8VA 4E21A 2GYYA 4KYIB 5EE1A 3GRZA 5IBPA 1XCMA 3ZQ4A 4I4NA 1L5ZA 1ZOPA 2OM2A 4TWBA 3TGLA 3FOEC 1QOQB 3RASA 3VMFA 1WG8A 2JKVA 2WF7A 3HFGA 4YJ3B 5IK2D 5KYWA 4P83A 1BXGA 2W2OA 2RGDA 2ZRHA 3KCNA 3A0RB 1G2IA 1A76A 3P4XA 4PANA 1L1QA 1RXSA 2P3OA 4RMJA 1WMBA 3BA1A 1C1DA 3HEAA 5KAPA 2FWIA 1CC1S 2ZU0C 4OAOA 3L0SA 3MWDA 4RTQA 3OJ0A 3TLKA 1WUYA 3ESRA 2QIOA 2G04A 4JGBA 1DEXA 5DSTA 5KAMA 1P9RA 3UCXA 4YS6A 3IEPA 3TCNA 5ALJA 3QPDA 4OYYA 4KAFA 4AS1A 1TAUA 3DR3A 4DTCA 3D3KA 1WZNA 2QYTA 1MC5A 1UCFA 4YCBA 2GBLA 5EJMA 5BRJA 3UJDA 4RVGA 2WMDA 1SUCA 1X8JA 4CL3A 5BWMA 3P26A 4YCJA 5K0SA 2HNKA 1XVUA 5BWBA 1GCGA 3O93A 4B1FA 2R3SA 1QF6A 4RK7A 3ZI0A 3T54A 1M6NA 4ZAFA 2QQ5A 3IAAA 4OFXA 1RAHA 4Y8VA 2BCEA 2PD3A 3FRJA 3UOWA 2WQ7A 2RCYA 4LFAB 1P45A 5KVVA 2A67A 2PQMA 3GCWA 1PT8A 2VRNA 1NLMA 2VYFA 4WESB 3TEFA 1EFPA 8AT1A 4QELA 2X8JB 4MVJA 1CG6A 1XQWA 3FF1A 2A9PA 3TI9A 3FHOA 3QP9A 3UK6A 5IYZF 3FPCA 2G25A 4W1SA 1YFJA 3FUUA 4YAJA 1MUUA 3UJ7A 4LDNA 4TT3A 4D8VA 5AW4A 1DJQA 3NAZA 5IX8A 2W90A 3GL9A 4MRAA 3HN6A 1Z62A 2NUPB 1YMUA 4UBIA 2Q07A 4UVHA 2D13A 3UUFA 4REQA 4EG3A 2ASEA 2BFCB 3EZ2A 4F86A 1E2EA 3UMRA 3DWGA 4RSHA 3K70B 1G3QA 2FWAA 1TVEA 3P9CA 4DA0A 1XLUA 1OLUA 2VA8A 1MO4A 3KWFA 2H3EA 3VO1A 2WJAA 5GOZA 1TEHA 4LZPA 1V47A 2ZATA 4I4IA 5DNVA 3T1HB 4JX9A 1QK3A 1PR5A 3H4VA 3O8RA 1XTTA 4I8IA 2ZYDA 3G5TA 3M3HA 1DAPA 3OEWA 1R12A 4OXNA 4DMCA 3EPHA 3NWJA 3CNQS 4FT4A 4KQIA 4TQGA 4QUGA 3SHWA 3T7CA 3PRKE 5C4IA 4YV1A 4MYSA 3BE4A 4I3FA 4I6EA 3CSSA 4MJ3A 2C20A 4C4YA 4TTSA 4IJ6A 3JU3A 2JI6A 1BJTA 3LCVB 4ZAYA 4QPNA 1CLEA 1R2QA 1XRMA 2OCBA 3D8TA 3NGMA 2XA1A 3H5IA 1NVTA 4OJYA 4K9NA 3SVTA 4C4ZA 2VJQA 4OBWA 1K0UA 5FUXA 3GZNA 3AI1A 3R3UA 1T8WA 1SD5A 2FG6C 2JJ1A 3FZQA 1DKLA 3NV9A 2C83A 1RRCA 1VZ2A 1LPPA 2AMLA 1GNPA 2I8CA 2UDPA 3PLAE 5E4YA 1N2HA 3VKVA 4P4GA 3O83A 1X1QA 1RW4A 3RSQA 3CU5A 3TG2A 5JAIA 1CUEA 1JVSA 1ZUNA 1E9SA 3WBFA 1B4DA 2VP5A 4NEHB 5BSTA 3WLIA 1RQRA 1YC2A 4CCWA 2WUDA 3B3JA 5M29A 2ZG6A 2ZZNA 3Q7IA 2AQHA 1OZFA 1U2EA 1J0XO 1KAHA 1D2EA 1L4GA 2BDEA 2RI6A 2EAUA 2Q21A 4OF4A 4GBGA 1GTL1 4B3GA 3MQ4A 1IBCA 2HYDA 1IWPB 3WIBA 4XX1A 1YVRA 4E5VA 3LOPA 1RWKA 3NHRA 3QXSA 3EDRA 2IU6A 3DLHA 3FPGA 2B9VA 2OCLA 1WTCA 1NVBA 1D4ZA 2O5CA 2NZ2A 4N6NA 2AG8A 1GPH1 4MUFA 3I6ZA 3OU7A 3R0ZA 2Y4OA 3TZ6A 2UUBB 3I53A 3BDIA 1NN3A 2Q1UA 2ZM5A 2FSVC 1JQDA 4S1PA 5DV9A 1RWBA 1DINA 2QR2A 4L8YA 5BURA 3DTVB 1M2OB 1S2LA 3S4YA 3UHOA 5C5EA 3QKRA 1USUA 4E15A 3T0FA 2IYRA 2ZI5A 3WS7A 4QUEA 1KU0A 4Y7CA 5FL3A 3DGEC 3OZ7A 1GRRA 3G2QA 4X84A 3UJ8A 2TMGA 2PZLA 1DV1A 4ZJYA 4FGWA 1TU3A 4BKRA 3CLSC 1TIBA 2GJKA 1R15A 2OLJA 1W5FA 1KSHA 1H1TA 4Z9XA 1T5OA 4JY7A 4U9UA 5M3BA 3U7QB 4EJSB 1KDPA 1KEVA 2I2DA 3Q5DA 1IOVA 4M0FA 3PHJA 1HNNA 1CE8A 1QO0D 3B52X 1TPZA 3CSUA 2D5AA 3IAHA 4HH0A 4NQRA 2Q3CA 3RB8A 3ROTA 2QUAA 3CJQA 4RULA 2E49A 4TM7A 4ZMBA 4QL3A 3P2EA 1ZH0A 3S2GA 4M3NA 4E5UA 4RY9A 5DHTA 4QTXA 4RE5A 3SJZA 3TQQA 4BNFA 2Q3MA 4R3WA 1IEXA 4RK6A 4LWZA 4UFNA 1JE0A 2IDJA 5A9SA 3PEVA 3R8XA 3KK0A 2GQ0A 4EA6A 2J8ZA 3ND6A 1Y98A 4RVCA 5FR1A 4NY1A 3DE7X 3EUAA 3KHSA 3R74A 3HTXA 1S6YA 1EESA 4XQGA 3W9SA 4OHPA 5ED4A 4AI6A 4B2PA 5L6LB 1I4OA 1SXJD 2RI1A 4E70A 5ICSA 3ND9A 2DM6A 4XSVA 4C4RA 5I7FA 4M0EA 4F8YA 5CDTA 3LP5A 1KDTA 2Y0BA 4HUQA 4E30A 5ALMA 5J4KA 1IVNA 3FYUB 4MEJA 1PJCA 5E2BA 9LDBA 3DHVA 2PKWA 2E1RA 4URYR 1EHYA 1U8FO 4GRIA 4I2VA 2OPHA 1QHFA 1V0JA 1Y6JA 2GK3A 5KO2A 1TK3A 2BFBA 3CRQA 4AZ0A 1IVSA 4GMDA 1L2TA 1U0EA 2EFEB 4J4TA 4A8JC 2NZWA 3MB5A 4QUHA 1ADJA 1FRZA 3PFBA 2WF8A 4UKDA 2XE7A 3KEOA 4D7AA 5HRUA 2EEZA 3HR4A 3AVTA 2AXPA 1BMTA 3R8CA 3UATA 3LFHA 4L72A 5K3CA 1ZZEA 2P2NA 3HKEA 3CZMA 4MV8A 2YN0A 1EZ1A 4MYHA 4TSRA 4BQIA 4RPJA 2JLYA 2ZCJA 2QVZX 3T1QA 5COBA 5D7BA 1AURA 4HNSA 1XP5A 1TQDA 3GR6A 4QNNA 4YECA 3W5IA 1N0VC 2P2GA 2A1IA 3AHIA 3NNNA 4WA7A 5L45A 3D7NA 4TLLB 5CIWA 5LL6P 1H2FA 3TNLA 2PCJA 1MORA 4D9JA 1U9JA 2AXQA 2IS1A 3CZAA 1BS1A 4EAAA 3SYTA 1N32B 3H0CA 2QLLA 4HH4A 1PLJA 3AL2A 5B7PA 2V7GA 4GX1A 1U63A 4U7PB 1R4MA 2C84A 1GVHA 3A1TA 3CEPB 4K40A 1SZPA 4I55B 4WOJA 521PA 4OLFA 1DAKA 1T3HA 1V3VA 5KSWB 1LCIA 3HO6A 4NPCA 1GGVA 1U0GA 4MKRA 1E1YA 5A03A 4R7ZA 1ZJYA 3BMNB 2FFAA 2XMQA 1FFXB 2YUTA 1O4VA 2VJYA 3T8YA 1ECLA 2RJ3A 4KO4S 1NRIA 1U8YA 1YZGA 1SB9A 2FCRA 3F6PA 3VSDA 1PWXA 4LCJA 2D2VA 2HJWA 3R5FA 1M8KA 1QG6A 4OJKA 4G0ZA 2PBFA 2JLXA 1TM2A 1BMFD 3KB8A 1M1YA 3V55A 1C3EA 1G5TA 4B2YA 2R25B 5K0ZA 3DHWC 2KQUA 1A5BB 3NALA 3TK1A 1VRCA 4TTRA 3N70A 1S5PA 3UKOA 2A0KA 2YWEA 2JFVA 1OW3B 3BMQB 5E7JA 3FYHA 1F06A 4HDOB 3SJCA 1MX3A 4H2DA 4LEIA 1ACLA 2CXRA 3HACA 4DAOA 1EDZA 3EXIB 1NYRA 3K2EA 4YUXA 1APBA 4YEDA 3V4SA 2B0CA 4YMIA 5A7FA 3H9BA 4XCQA 5AM2A 2D1SA 2ZWMA 1AGRA 1ZBQA 4ZV7A 5KNDH 3LY8A 3UT5B 3TQRA 1UINA 3U9SA 3R9XB 1DELA 2C77A 2XXBA 1FLAA 1M2VA 1HE2A 2AE1A 3C7DB 1WEKA 1YRLA 3HVJA 2BHLA 1MF7A 2JFWA 2FFBA 5C7OO 1IRIA 1EM8A 1W29A 3TEMA 2IPAB 4MAAA 1E3LA 2EQBA 3R5JA 4PSAA 1GL9B 2JEZA 5L40A 4I1PA 3C7TA 1C1YA 2F64A 2G9ZA 2XPCA 3AEKB 2OY0A 4PIPA 4PC1A 4XX0A 4XASA 2XDWA 1ESCA 3HCBA 2HRDA 4C6HA 2AD5A 4FCWA 4DZRA 2ZYGA 4J6EA 1OU0A 1JAYA 2PD4A 4YBZA 3UH1A 1O94C 1WBDA 5JYCA 1PG2A 1V37A 2UXCB 2X5OA 5LZ9A 3FLAA 1UJ5A 3EODA 1SAYA 1XXHA 2J9FA 2O7RA 3B6IA 3TE6A 5JATA 2QU7A 3K0FA 1EFHA 4X7RA 1D7OA 3FAKA 1WMSA 3EXEA 3ZTWA 1DU4A 5BWOA 4DCCA 4RE6A 1DO8A 1KP3A 2A84A 4RDXA 5IN4A 4IKEA 5JAZA 1A9QA 4Y0NA 3QKTA 2JLWA 3I1IA 4WVLA 4ZGGA 3MWYW 4BB9A 3O2SB 1UMKA 3I01A 3LQ1A 5HSGA 1JFFB 2Z1DA 2GRAA 1JDPA 1XZ8A 1QX3A 4L0CA 4RF5A 1TA0A 2QVYX 3ETGA 4TN1A 4ADSG 4PRYA 2MDTA 3N9IA 4O2AA 5G0SA 5KVQA 3TQFA 1FE8A 3LJKA 4MHOA 5FBRB 2J45A 3TQHA 1WULS 1O94A 1SFRA 2Y1LA 3JQQA 3M7IA 3E70C 1UODA 3AWDA 1O5IA 5LB4A 3AWIA 4KQMA 4F4JA 1WB9A 4N6OA 3CGWA 4KXVA 2XUOA 5AMXA 2MOKA 1TIKA 3O1HB 2OG2A 3NDJA 4LJ4A 5LYYA 1FQJA 3P5SA 1T3GA 2R6FA 4KE8A 3UMJA 3BFVA 5FLKA 3OKCA 2EGGA 1P4RA 1EFLA 4FN5A 2YNMA 2I4OA 3CZQA 5LWHA 2K2WA 2P3QA 3KOZA 3JCZA 1WDKA 2JK0A 3MCZA 1V8BA 2IEYA 5FLEX 4OM8A 2CYBA 2D54A 1VPWA 4K46A 4O3FA 1CRPA 1MOQA 1O0SA 1TYBE 3QE0A 4ETWA 2N1MA 3URKA 2B78A 3KJFA 1J00A 3QKSA 5FTJA 3LVQE 4MUYA 3PE3A 1SHJA 4P7JA 3PNVA 5DLDA 4C5BA 1R3UA 1GKKA 5DNDA 2WI8A 3P32A 2ECKA 3R9WA 2HCBA 4Q0MA 3MTEA 4ZDIA 5JOQA 1KYWA 4L3WA 3F98A 3IIEA 4JI2B 1HG0A 3MT8A 5ISMA 1ZU4A 1NW6A 1XG5A 2WPDD 4QQRA 3CUTA 1P0FA 4ZO8A 2IXBA 5J58A 1ODFA 1QGYA 3JVEA 3WIOA 1GQFA 5E7MA 4CM3A 4G63A 4BO7A 1LH0A 1S8AA 3OHSX 3PEYA 2QRHA 3E9ZA 3BMXA 3PBKA 5KOHB 3IUNA 2UAGA 4BE7B 5DULA 1F51E 1LXCA 3D0QA 4IGEA 2ZJYA 5DX8A 4CEIB 2AR0A 2WWTA 1I32A 3DEJA 3HVIA 2VHCA 4S2EA 3KZKA 1BDJA 1JJFA 3E82A 2W8BA 3JTEA 3NHKA 4HFJA 2FPUA 4AX4A 4M1OA 3MLEA 4RAOA 4B81A 4JL6A 2EDAA 8ADHA 2BI8A 5LZ2A 2RHTA 4BN0A 4U2FA 4IGAA 5CLHA 1P0PA 2VHQA 1O5TA 3VR5H 5DOVA 2BN4A 1RWMA 3ES9A 1RXWA 2IH5A 1RXVA 1MIOA 2JLCA 5D3QA 1WKCA 2Q3LA 3JQDA 2EJWA 1O08A 5DHSA 5FLXA 2CHUA 2WKWA 1T4BA 2P40A 2BYTA 1KQPA 4IHAA 3VSEA 7MDHA 5C53B 2ZIZA 2FPPB 2IEBA 2EKPA 2DJIA 3WK5A 2OFPA 1E6MA 2C59A 4MUHA 1F4PA 1RQ2A 4F7WA 4Q6WA 5DYIA 4LSWA 4HK4A 2UZIR 1J4AA 2QW1A 4E5KA 4MV4A 1FP7A 1IBLB 1E4EA 3E5MA 4I4TF 4O0LA 1XKXA 2O5RA 1P1KA 3RHZA 2B98A 2BL4A 4IVNA 3ZWBA 4XWWA 4DR5B 2DRIA 1ISGA 1R4AA 4DE5A 4DJDC 3THOA 1X7YB 3EF3A 3EVDA 4BBJA 1Q21A 3PTZA 4WY2A 1CR1A 4FDAA 4KQ1A 1LU9A 1ZGZA 1XL1A 4N5MA 3RUIA 5IYZA 1AUOA 4JROA 4Q3EA 3KYJB 5KPJA 1HFKA 4JBWA 2PUFA 1T8SA 1GL7A 2FMUA 3CE9A 3IUQA 1O97C 1HEYA 1VYUA 2XD9A 5C1PA 3IPCA 4UOEA 3HY3A 2A3RA 2C3OA 2QTZA 3QK7A 4KUHA 3I04M 4HVLA 5JY6A 1UBNA 5CH5A 2JFOA 1N5IA 3A28A 3I9MA 1XCGB 1TEXA 3H9GA 1ZRNA 2E48A 1FP1D 1O6ZA 3FZNA 2OORC 4L4YA 2F1KA 5E9WA 1GDTA 4Q4HA 2J9GA 2OGZA 2BISA 3H5OA 3M89A 4PS1A 2NXJA 3DBLB 4PX9A 1CUIA 4GBED 2AB0A 3MT0A 5IF3A 2P90A 1GOTA 2ZU6A 2VPTA 1SOWA 4XGKA 4CM4A 3DE5X 1CX9B 1JWAB 4FYPA 1LX6A 3A9UA 4PIVA 4TLCA 3B1WA 3T7SA 2P9EA 3AY0A 2B1RA 3ORRA 3FCYA 3MMSA 3KJNA 4X9XA 1HE3A 2J87A 4WUTA 1D03A 3B7PA 2L82A 5KCZA 1IY0A 1UEXC 3ND8A 4RF2A 3BE8A 3AB3A 5IJ9B 2BGUA 2F55A 1OH6A 1R0WA 1NVEA 1B43A 2HPAA 1XVVA 1F2UB 3X3HA 5SY4A 4QICA 2WOOA 4YCSA 5JCOA 4TYQA 1CDOA 2PZBA 4YAFA 4YXWD 4P2GA 2AI1A 4MP8A 1LI4A 3I8SA 3HR8A 3VHLB 3I1JA 2QMYA 4C04A 5B2EA 1G8PA 1U8UA 4TQUS 2C5HA 1L5FA 1BEZA 2RFLA 4EY3A 5CYGA 5EINA 3EQ6A 2NT4A 3NBKA 3BGVA 5HFNA 1ZOSA 3MCVA 3CTPA 3W05A 1GZSA 2EJBA 3FNRA 5AWFC 4AJJA 5FPHA 3CLHA 3K9BA 2A5LA 4O4LA 2LKCA 1F3LA 3HFRA 1KPGA 2GNAA 3PDWA 3AL0C 3WQBA 1XELA 1YQUA 1RZUA 4N7BA 3IT2A 3B8HA 4L02A 5HIMA 3VHQA 4BNJA 1T35A 3NDRA 3HU3A 4KQ2A 2O1SA 4GICA 1EFKA 1RP7A 1JR3E 4IJMA 5KX5F 3VC2A 3PSHA 2GILA 2V55B 4R4JA 1E2LA 4P35A 1Q7CA 3A6GA 3UMGA 3GFFA 2BC9A 1X15A 2X0IA 4KQXA 2XCSB 2REXB 3QYAA 621PA 3OTHA 1ZHHA 5GV8A 4GAEA 4NCXA 5C52B 1XPUA 2QRLA 1CXZA 4K6CA 2VCYA 4CWAA 2P69A 3A1UA 3LYLA 2OXTA 5CBKA 3PHIA 4EKIA 2DBVO 4DY6A 3MMXA 5AM1A 1C0PA 1UOPA 2VQFB 4S1OA 1E3QA 2I76A 5ELMA 5C7YA 5AHRA 4RJ2A 3L0OA 3P4YA 1T4CB 4XA8A 1GITA 5LVAA 1KEPA 2FB9A 3RF7A 3V97A 2LXNA 4FQ7A 1PI3A 3THXB 1UBFA 2NYRA 3K0AA 2VYVD 2CFTA 2YXLA 5EKSA 4R2IA 1OH5A 1ZW1A 3ZV3A 3UHFA 1Y89A 2P7HA 2Z8ZA 3I73A 3OZWA 1DTSA 2SECE 3H86A 3QF4A 4KIUA 5E9JA 3SR4A 3W1EA 1O6GA 4LF6B 4WFKA 4OKIA 4V03A 1HTTA 1D07A 3OIFA 5EZYA 5IDYA 2YYAA 3EZ6A 2YZ7A 4PY2A 2ZYUX 1DEAA 5L6MB 4MUAA 1NL3A 1A7AA 4MIKA 2WINI 2GO7A 5L7TA 3R6LA 1MAWA 3WK4A 3EG5A 1E94E 2O50A 2OO5C 3ZLVA 2QTRA 3E18A 5KSZA 4N65A 2G6BA 4Q03A 1WB5A 4ER6A 1MOSA 4Q82A 1IZZA 3JVUA 1P1HA 4Q9HA 2P35A 3MGGA 1NX6A 2Q2NA 3DE6X 1XD2B 2JBAA 8GPBA 3NEAA 4C7XA 2FCAA 1ACMA 1HORA