2UZIR

Crystal structure of hras(g12v) - anti-ras fv complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-RAS FV HEAVY CHAIN
publication title Tumour Prevention by a Single Antibody Domain Targeting the Interaction of Signal Transduction Proteins with Ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uziR00
3MSXA 4URYR 4DHEA 2W83A 2IYQA 2F1HA 1KZ7B 4KYUA 2QN6A 1KK3A 4E07A 3I61A 5TB5A 3I32A 5CJPA 2GBLC 4Q9LA 4BZQA 3A1WA 2BBOA 4JLBA 4PHTA 2WWGA 4RD0A 3THWB 2P2LA 2DR3A 4JT2A 2OV2A 1AKYA 3T61A 4HAWA 3CR8A 5HE9A 3ZD6A 1N6IA 1KYIA 4II7A 1R6BX 4Q18A 4D6PA 4OL0A 2ZRBA 3H0KA 2QAGC 3Q7QA 1BOFA 5AJZA 2AFHE 1A2BA 4XVUA 5EE1A 2OCPA 1G6OA 2RHDA 1U8AA 1VG9B 2QQEA 5C1BA 2GBLA 1Z0JA 3NHAA 3WNDA 2BVNA 1E2FA 1N0UA 3U44B 3CW2A 3NKVA 4Q4JA 1ETUA 3O8CA 4C9BA 1NKSA 2VH5R 5H8WA 4U02A 2P0EA 2C95A 4LC0A 2QAGA 2F9MA 2QQ0A 3VFDA 2B6HA 3GMTA 3B60A 2VIIA 1IHUA 3SE0A 5GVRA 1G9XA 1LF0A 1PLKA 2GNOA 4OK6A 4ZV4A 1YKSA 2D74A 1OFHA 4US0R 2CL6X 2JDIA 1V5WA 4BLSA 4GOKA 2CMKA 2GXUA 5BXQC 1II0A 2ZI3A 3VU9B 4BLOA 2A78A 2EVWX 3SBDA 2CNWD 5FL7A 4E22A 2XAUA 2FFBA 5KPJA 1YRBA 5J40A 2P6UA 1NVVQ 3SHFA 2J0VA 2YNMA 3TBKA 1CS4C 1Z29A 2B92A 3THXB 4L16A 2FZ4A 2ZVPX 2AKYA 3QKRA 3SBEA 1LS1A 3CPHA 2B7BA 4CVNA 5H70A 1E6CA 4QL3A 5EXPA 2B8WA 3L2OB 3RC8A 4RFSA 4D4JA 2EFHB 2BIFA 3AP1A 4PPQA 3AVPA 2OLKA 2QGNA 3K9NA 2NIPA 2VHCA 3RANA 3PUVA 5EUMA 3CX6A 1P2VA 4HB0A 2BKUA 1G3MA 1ZAKA 3B9PA 3B78A 4RZUA 2CJWA 5HZKA 1E9CA 1ZD8A 2ZSEA 4NYMQ 3U7HB 4IFEA 5H1YA 5GJWC 2BEJA 4HZUA 4C0KA 2IYWA 2ZYUX 4HI0E 3N70A 3IQXA 2I4IA 3GLHB 1JXOA 1G4AE 1UFQA 4PANA 2IC5A 1Q57A 3BORA 4RCZA 3RDPA 821PA 2FG5A 2PEZA 1R0WA 1ZM7A 1G8FA 1WMSA 2NO9A 5L3QA 1YE8A 3KXKA 1AZTA 4PSAA 2PT5A 3B1ZA 5HE8A 2WSSA 2BEKA 2QBYA 1E1RD 2FZLA 3QG1A 2W6ID 3F3YA 4B3XA 4G5SA 2YWHA 4ARZB 1GTVA 1N6RA 2HJGA 1U2RA 3GLHE 3GLGB 3T15A 3KTAB 4YMVA 1V43A 4FWTA 4OQNA 3M6AA 4EPTA 4IVQA 1K5GA 1P61B 3B6EA 4LJ7A 3HPQA 3BH6A 5FBRB 2FPMA 1RRFA 3QF4A 2Z0MA 1A5TA 1HE8B 2UKDA 2WWIA 3GLGE 2RKOA 1QHSA 1D9XA 2O8FA 1S8FA 1PVOA 3DKPA 3QXCA 1DAMA 3WP1B 2P5SA 1E9BA 4NYIR 2R9VA 1VYVA 4TMXA 3ZDQA 1GL9B 2GESA 3OEEA 1MOZA 3LA6A 4A36A 1N2CE 2IYTA 4EPYA 1DAFA 1XFAA 1FTNA 3FTQA 3K53A 3VR2A 1M8PA 4JKIA 3PEUA 3R7WA 3IO5A 4DEXA 2ZYTX 3T06B 2ZRGA 4XWAA 1N5JA 3Q9LA 1QDEA 1G3RA 2FF7A 4Q1FA 1HT1E 2GXQA 4GZMA 4M1OA 5FL7D 1AN0A 1KDOA 2J87A 2QP3A 3QPUA 2ZSAA 1CJUC 4KXFB 4Q4AB 3GFTA 2IYSA 1OH5A 4WZ6A 1NMYA 1Z6TA 3WY9A 3QUSA 4O25A 1Z2AA 3RS4A 2ZVQX 4PQRA 3N2IA 3TUJC 3JVVA 3IILA 1T4GA 1WBDA 3AF1A 3EWAA 2R2AA 5C2JB 2ZANA 2EWVA 2CVHA 3HP1A 4DRZA 3DZDA 2RB4A 2XITA 3K0AB 1EFRD 5TXGA 3DOFA 3BJIC 1A2KC 3EZFA 3ZS9A 1E2LA 1IXZA 1OKKA 1KY3A 3GQBA 2KB0A 4LV8B 2QGZA 1TEXA 3R8CA 5FTKA 1OH6A 1FX0B 1X8KA 3AKCA 4AKHA 2WJIA 3DVLA 1G291 2WIBA 3FFAA 4RSGA 4YLGA 1Z63A 3TR0A 4MGKR 4LJAA 3GCGA 3MUFA 1YU9A 3NHBA 5JWRA 5JHGB 1E2NA 3FMPB 4MRVA 2HT1A 2JIZD 1E2HA 2OEPA 3EIHA 3KKOA 3VHXA 3F0TA 4AI6A 3OF5A 4Q9JA 4EFLA 3TNFA 4NYJR 3NC1C 1OJLA 3A1VA 1E98A 2ZRMA 4BEJA 1NI3A 4Q1DA 4QC2A 4LV6A 4A6XA 3TK1A 3HJNA 1XEXB 2IXGA 3C8UA 3GJ3A 2TMKA 1AIPA 3NWJA 4AG5A 2IS2A 2BKEA 1XMVA 4PAMA 3LDAA 4BQSA 2BCGY 4QM7A 4IOKA 1W4CA 4QBFA 4R2IA 4D82A 4HAYA 3KFXA 1RKBA 3QEOA 2Z6VA 4HAZA 3WNCA 1FMLA 1CKEA 4ZIRA 2O52A 2XB4A 2C8VA 3MWLA 3X1DA 4LJ5A 4RD6A 4Q02A 1TU4A 4UNQA 3NBYC 4AKGA 2IWHA 2H5EA 1QG4A 4HZIA 4V0LA 2HXSA 3QVVA 3T35A 4A8JC 2PT7A 4QHYA 5AWFC 4C0BA 3PEWA 1XXHA 2QG6A 4FI3C 5EZ5A 4ZCIA 3THYB 4C2UA 2GILA 2H92A 4NCJA 1MO6A 3LXRA 2XXAB 4TLBA 3HR7A 4B3GA 1N6NA 2IWRA 3ZH9B 2WKRA 1CJKC 5EE3A 5LB4A 1IY2A 4CRWB 3IPXA 3TVTA 3CO5A 1COWA 1XTJA 4WA7A 2W58A 4A8JA 3ICQB 4YMTA 1E2KA 3BH0A 2EFEB 3KFVA 3H1TA 3QXSA 2QSYA 2FSHA 1WRBA 2JATA 4B34A 1TU3A 2NZ8A 1RZ3A 3FYHA 4L15A 1F2UA 2VL7A 1CJMA 2A30A 3CNNA 3CBQA 3LNCA 3G82C 3R9WA 3QEJA 3KL4A 3SN6A 2XNSA 4HLCA 3Q5DA 1NN1A 2HF8A 4LSGA 4W5JA 4B3BA 4L9WA 4B43A 1G5RA 4B74A 4IHQA 4Q01A 1GOTA 1L8QA 4LHYA 3IBGA 4UNRA 1A1VA 1DG3A 3HWSA 4WZAE 1VIYA 4JVNA 1PJRA 2ZRDA 3U7GA 1UKVY 3KKPA 5FTMA 1FQJA 3PUWA 5DLQC 3AVWA 1N6LA 4G5GA 2Z43A 2WWHA 1GZSA 4Q48A 4HUQA 4NHOA 3RVBA 3W6NA 4M1TA 4D25A 4HLQB 2IYUA 1MRNA 4JJZA 5BYKA 2GRJA 3SFZA 4JLJA 2F9LA 1E2QA 4NP6A 4RVCA 3VR3A 1J70A 4HSEA 5HCIA 3GD7A 2FU5C 4OQMA 2XOKD 3FMFA 2IEYA 4DZZA 3SQXA 1Q1ZA 4U7DA 2R6CA 5FUYA 2JCSA 1G5TA 1GRRA 4PO8A 2YKGA 2A7QA 2PZEA 1G1MA 2GK7A 3T1OA 3TRFA 3SR0A 1UDWA 3ZQ6A 4QRHA 2VTKA 1YZGA 2OLJA 3P4XA 1FOEB 3KJHA 4YMWA 2H18A 2KE5A 1SKQA 4D4MA 3AVTA 3D7MA 1I2MA 1WA5A 2DFKB 2QMHA 5FOVA 1Q1BA 1ZJ6A 2GJAA 4IJMA 2REXB 5LDDC 3OFND 2EWWA 2ZI4A 1NN3A 3AF0A 5TDHA 1R0YA 5J4VA 1NG1A 2AK2A 2X2FA 4TL9A 4WW0A 1ANKA 1BYIA 4LJ8A 1VCNA 5EP2A 5EP3A 1Z0AA 1DADA 3PUYA 1SXJD 3ADKA 3BFVA 3SYNA 4ZCLA 4A6PA 1UBFA 2WWWA 1OE0A 3BWDD 3OE7A 3RC3A 5A4JA 2VBCA 1COWD 3OAAA 1KKMA 1OF1A 5FOTA 5F9HA 2ZJ2A 1K6MA 4M1MA 4MYTA 1KSHA 4HLDA 5TV2A 2N42A 1N6PA 4I4LA 5KNBA 1KO5A 3RNLA 1ZNZA 1M7GA 5TARA 4HDQB 1KHTA 4G1UC 2ZJBA 2JJ8A 4LHXA 3P32A 2RHMA 2IS6A 4MA4A 1NY5A 2X1VA 3EZ9A 1X6VA 2EFDB 2V1XA 3CPJB 2BWJA 1TAGA 1U0HC 2W2TA 4UXIA 2O8CB 2JJ1A 3THWA 2IYXA 4AK9A 1P2TA 5A0FA 1FQKA 4OK5A 4ASUD 2A5YB 4PR0A 4BFVA 1G64A 4UNPA 5K8LA 3K0FA 4H9GA 2BM0A 4ITRC 3C7KA 5EE9A 1W47A 4CZ2A 4TZ0A 4GRAA 2ZAMA 3BIFA 3BXZA 3WYAA 3CONA 1IM2A 1Q21A 2IUTA 3GLFB 1L2TA 1NVWQ 1KMHB 1S9DA 4WBSA 1SVSA 1VPLA 2N46A 3MJRA 4BLQA 4OI1A 1W48A 5DE3A 3T1TA 2Q9CA 2WKPA 3U3JA 1XBTA 4Q03A 4OYHA 2BBWA 5DYIA 3W8RA 2YJTD 4LWZA 5EZ6B 4OI4A 3LAWA 3GLFE 1NN0A 4IDHA 4PZLA 5JCZA 2BOVA 3EG5A 4MYCA 3IEUA 4KO8A 3ZZ0A 2WKQA 2VP9A 3UATA 1X3SA 1GWNA 2OM2A 4LBWA 1XTSA 4UKDA 2XB2A 3VU9A 1ZNWA 2Q3MA 4NE2A 2ZREA 2EQBA 2GF0A 1OH8A 1M1YE 5CYPA 4HB4A 4XTCS 1E2MA 3GJXC 4Q19A 1G8GA 2NTYC 2O5VA 5TY0A 1US8A 4AWXA 2ZJZA 3LBHA 1KJZA 2YWGA 1GKUB 1P73A 3L8YA 2C77A 4V0OA 5M04A 4CEIA 2ATVA 5IK2A 1GVNB 5DNYB 5EJEA 4ERNA 3DM9B 1CR0A 2ZJYA 2VYFA 1KGDA 4PTLA 1GFIA 5KNCA 3AP3A 2FV8A 4EPXA 3B82A 5SZHB 3B1XA 3OAAD 1IONA 4W5HA 5E7JA 2WOJA 2F43B 2ZE5A 4ON9A 3X2SA 4GDFA 3AF4A 3WHLA 4G01B 2IXFA 4JJKA 1FMJA 4PPNA 2JEOA 4IVRA 4IDPA 4AY2A 3CRMA 4Q21A 3CX7A 5KSPA 3GLHA 1GP2A 5KSZA 4M9SA 2I1VB 3O8BA 4LJ9A 3Q7PA 4LOAA 5CB8A 4OJQA 2V7QD 3SOPA 1SQ5A 5EP4A 1Z6YA 3CF2A 3CRW1 1PLLA 4GI7A 4KCGA 2JJ1D 2WICA 4V0MA 1OXSC 3GJ4A 4FN5A 1X8JA 3G0HA 3DOEA 3I1FA 1SXJE 1NP6A 2FEOA 3B7GA 4MDFA 2A5GA 4Q9KA 4CT4B 1Z2CA 2QP9X 4MUAA 2NO6A 1ELOA 1E2JA 3I73A 1WBBA 2FJUA 4DCSA 2N1BA 2D06A 2D4HA 4Q9HA 4PHHA 4A92A 4A1FA 4QJ4A 3REGA 5FTNA 3A6PC 4AD8A 3B1WA 2C96A 2AWOA 2GF9A 4DDUA 2OXCA 1OYYA 2YZ2A 4N1AA 2MSDB 2WIAA 2VQSA 2WJJA 1LF5A 1XD2B 4C0AC 4GPTA 5KUTA 3VKWA 5FPHA 3UWKA 4MITA 2ZSBA 1XMJA 4XTRA 3RS2A 2AHOA 1J8MF 2ZR9A 3BC1A 4JVSB 5IDVA 4Q4LA 4D0NA 3ZGXA 3ZVLA 1FP6A 2EFCB 2EU8A 2PJZA 5K8TA 5LD2C 1RVDA 3R20A 4B2IA 1VG0B 5FH9A 5EQTA 5AUPB 1E0SA 4B3FX 1G5PA 4MH0R 5BN5A 4BZXA 4C30A 4D26A 3KQUA 2IS1A 2WWFA 1HA3A 5C18A 2IXEA 4V03A 1GDDA 3GFPA 1KI2A 1II8B 4X8MA 5IF9A 3U3RA 4Q4AA 2VLIA 3EPHA 3DM5A 2NPIA 1CEEA 2H1LA 5CIWA 3FHTA 4EPRA 4NL4H 3VHLB 3TW8B 3R8FA 2PX3A 3OESA 1MABA 3GLIA 4FXPA 3EW9A 4LV5B 1FNNA 4PXAA 4TL8A 4ESVA 3RS0A 2JLXA 1U0LA 1E1QD 3TSZA 4PZYA 4DIDA 2VSOA 3MJHA 4RZ3A 3TJZA 3L0OA 5B30A 1HT2E 3EZ2A 5FBQB 2Z4SA 3AKEA 4KFUA 4CGZA 1JR3D 1EESA 1YR9A 2XGJA 1XEWX 1GUAA 1XEFA 5CLLA 1FX0A 4TTQA 3K70B 4OQFA 3NXSA 4P33A 4TWZA 1DAHA 3CRRA 3CM0A 3BS4A 4Q47A 4Z1MA 3FE2A 4EDHA 5IRCD 2I3BA 4KSBA 1RRGA 4KV9A 4ZI2A 1QHXA 2ZI7A 4WIAA 5EE5B 4QNRA 4BPBA 1G21E 3QKSB 4HAXA 4HYYA 4LGMA 4PHGA 5D3MB 4XWOA 5FBVB 4HDCA 1KI3A 1UPTA 3KB2A 5EP1A 4DLXA 4G0NA 1IJEA 2DWQA 2FPKA 5JSZB 1EXMA 4PAQA 4WVFA 1E9SA 2HCBA 1LVGA 2JLWA 1LNZA 3AQ4A 1DVRA 5AJXA 4ZDJA 5K8UA 4Q1AA 4NKRA 3U61B 2IYVA 2J45A 1XJ0A 1E1RA 1UKZA 1Z0DA 2GCOB 2W6IA 4ZDWA 1P7CA 2FFQA 1ZUIA 4GFDA 1OFIA 1UDXA 1NLZA 4RCYA 4YDHB 4F38A 3IDQA 3B5JA 3SYLA 1I4TD 5FOXA 4Q7JB 1Q1EA 3UG7A 1DAKA 3AKYA 3I72A 4A0GA 4D81A 2D2FA 4OBEA 2OBNA 3X1WA 1NMXA 2YOHA 1W0JD 4KI0A 4MQBA 2OT3B 2BMFA 4DCTA 5HKKD 3BOSA 2CHQA 1S9HA 3L8ZA 4DVGA 4IDNA 3CUEF 4DBLC 1T9HA 1NBMD 2QPAA 1SULA 4B71A 1OT3A 3QF7A 4DDWA 1IN7A 4M1WA 3N5CA 1OSNA 1UM8A 4C7OB 3BK7A 2FH5B 4BLTA 1M7HA 1QHYA 2FE4A 2GA8A 4Q1BA 1R5OA 1TUIA 4LHVA 3LX5A 4NTZA 2CHVA 3EA0A 1KI6B 2JLVA 2WJGA 4YQFA 2Q21A 5JEEA 2OBLA 2SHKA 3KKNA 1N5KA 4GNKA 2C03A 4TLEA 2G1KA 2PCJA 1Z6GA 3RYTC 1Z08A 4PC7A 5FTLA 2IUSA 1O3YA 2HUPA 3HPRA 3MLEA 1S3GA 2R6FA 2VHTA 4TMTA 3U7FB 1G7RA 4X8OA 2IYLD 3UKDA 2ATXA 3FKSD 3NIBA 3EC1A 1CRPA 4S2EA 4Z1MD 4ZDIA 5C4GB 1G3IA 1I2DA 4LJ6A 4YXWA 1U9IC 1LTQA 3EC2A 3KX2A 4QGFA 2DCUA 2YV5A 3MRSA 1IQPA 3B1YA 3TVDA 1EFRA 1YZLA 1ZCBA 2A5FA 1T5IA 3VR1A 2AL7A 1YZTA 3UK6A 1OXTA 3CB4A 4I1VA 3UMFA 1YQTA 4JS0A 2BCJQ 2X2EA 1RW4A 3ZQJA 2ODNA 5L3SA 2CBZA 1ESMA 2IYZA 1U9IA 2Q9AA 4LYAA 2V1UA 1A4RA 2ZI9A 2JLYA 2JIZA 4TN1A 2DWPA 2VP4A 3NH9A 4NBSA 1JR3E 2WSMA 1M6NA 1NLYA 1ZU4A 2J59A 3RS5A 4E03A 3TE6A 1KNXA 1AS0A 5KU1A 2R8RA 3PIRA 1KDTA 1ZUHA 4LBZA 4V0KA 1JQJC 1KO1A 2AXPA 5SZJA 2NQ2C 1G18A 2FOLA 3A1SA 3PFIA 1U99A 1VMAA 4BWYA 1AQUA 3QI2A 4X8HA 2ZJ5A 4EFNA 2A9KA 4POAA 3W34A 5JLJA 3A4LA 4TLCA 5D3QA 3IPYA 1DBSA 3K9LA 1CR4A 1W44A 2UZIR 5JHHB 5DI9A 4D4LA 3KQLA 3PJRA 4CEHB 3LVRE 3AM1A 3QKUA 1SHKA 1AKEA 2JAQA 4LUCA 3T1QA 4B33A 1EX7A 2G9NA 1UBEA 2BM1A 2X19A 3KXIA 2GETA 4K81B 4PPGA 1VYUA 4F93B 1ZINA 4FCTA 2VEDA 3T34A 4XSHA 3SHWA 5DGXA 2A3RA 1D2EA 4YC7A 3SNHA 2V6JA 4P4SB 4A0HA 4TYNA 3DKVA 4ESHA 3IKJA 3KUCA 1W5SA 2MMGA 4G5OA 2V6IA 1YR6A 2CL0X 2A2ZA 1NIJA 5FUXA 5EUQB 4BFSA 5CIQA 1W46A 1RYFA 1HUQA 4HB2A 5AUQA 4FMDB 4QNMA 4XIGS 2O8CA 4DLRA 3VNUA 1XJQA 1W1WA 2KBFA 1HEIA 1P5ZB 1AS2A 3I5YA 1CP2A 5B64A 1JBKA 1ONBA 3EPKA 2RCNA 4XH9B 3KKMA 3B2EA 4US1R 3WMGA 1Z22A 1NBME 4EPVA 3E2IA 4UNNA 1G41A 4QOSA 2HT6A 4YXWD 5JFGA 5FUVA 1K5DA 1TUEA 1KSGA 1FP7A 1E94E 1XZPA 5SZIA 3ZYCA 3FVQA 2C9YA 5J4KA 3KJIA 1XMSA 4ACBA 1VKJA 1E0JA 3VNVA 2FGJA 1KMHA 4EFMA 3TAHA 4B48A 3CWZA 4XVRA 3TAUA 2ZETA 3X1YA 2B7CA 2ZR7A 5IT5A 4RZ2A 5CJ2A 1H65A 4N0EA 1B0UA 2VP5A 1WF3A 4B73A 1XTIA 2F6RA 4Z54A 2NPFA 1EK0A 4IOMA 1TQDA 4EPWA 2NOAA 2GTPA 3QVUA 4K46A 2GAAA 1W36B 1CBUA 4BASA 2KBEA 4JL5A 3DPUA 1F2TA 4LHWA 5GJBA 2CDNA 4DLVA 2GEVA 1OYWA 2ZI6A 4URUR 3M0EA 4BFTA 1T3SA 2ODWA 2XEXA 3AVVA 3ZJYA 1MV5A 5TVKA 2ZS7A 3F5FA 2XOKA 4C0LA 4MDEA 4C0QC 2WAYA 1JR6A 1VCMA 1P9RA 1XTRA 4R98A 1QF9A 5ANRB 3Q8XB 4EJSB 4CW7A 4M9XA 1XB2A 3RS7A 1EFUA 3PUXA 1DAIA 4FD2A 4JT4A 3IBYA 3A1TA 1OB5A 1SXJC 4P4TA 4MRSA 1KAGA 3GFOA 3B85A 1CJTC 1ZBDA 2F43A 4DWJA 3TW4A 2KWIA 4H1VA 4TSFD 2RH5A 4DC9A 1G16A 1OXXK 1HYQA 2EW1A 3IQWA 221PA 3OFNA 4TQUS 2YHSA 2GXSA 2Q6TA 1HY3A 1YVDA 2G0NA 2G3YA 2OESA 4ZI3A 4B3DA 2ZRNA 5B57C 3CF0A 4LHZA 5L8VA 2HJVA 4AYXA 4XWKA 1QVAA 2O0HA 5FOSA 5FTJA 1SXJA 4PHFA 1PZNA 3HDTA 5SZKB 3AVYA 5FOUA 1EGAA 2GAOA 1SZPA 1FZQA 4UJ5A 2NO1A 1KK1A 4AKIA 2YWFA 4QFMA 1E99A 5JRJA 1VHLA 1EWQA 4MRRA 5EXXA 2YINC 1X1RA 3KQHA 2BJWA 1T6NA 2PZFA 1MT0A 4QBHA 4JLVA 1U98A 4L4UA 3TLXA 1UEJA 2DBYA 3C15C 1E0AA 1TQ6A 3PITA 1O87A 3L0PA 3UMRA 1JALA 5JI2E 3QXHA 2QL6A 4GZLA 4QGGA 4E5UA 4KFRA 3C41J 1GKYA 2CCGA 1ZNXA 5CK5A 1XD2A 1IY1A 3FPAA 4URZR 1W4AA 2VF8A 3T12A 2ERXA 5DHAA 4ASUA 4B2LA 1P4SA 3VKHA 1S2MA 1N0WA 3RRMA 1JPJA 2ANBA 1DAGA 2O0KA 3AGQA 1T0HB 1F5NA 2HYDA 5EXTA 1VIAA 5TMPA 4W5WA 1IOZA 2E87A 2FNAA 3DMDA 3LLUA 3O8DA 1SVIA 3S1AA 4PO9A 1R0XA 2C2HA 3U4QB 4H1UA 2CLCX 2H7VA 2J0QA 4JBYA 3W5IA 4TT3A 5KOYA 1WB9A 3SJAA 3CZQA 4JVLA 2REBA 3U3OA 1XU4A 2Z83A 1II8A 4OQXA 3QKRB 2VSXA 4TLDA 2YC2C 1WP9A 1ZM4A 5BN4A 4UXJA 4F91B 3G5UA 4RFSB 5P21A 4EAQA 1YZKA 2OUKA 4JLDA 4KITB 3ECCA 3K70C 1ODFA 4EQ6B 2AKAB 4A2WA 4OJKA 3TQFA 4DLZA 4GT1A 2A5DA 2G77B 4LJYA 5FBLB 3TR5A 2VRWA 1XZQA 3TH5A 4WAUA 3AGPA 3GJ7A 1U81A 3P4YA 4CT5A 4IDQA 4KJZA 4X8LA 2VHJA 3EARA 1D5CA 1Z0IA 2WV9A 4DLYA 2R65A 2ZE7A 1RC8A 1P9WA 2D62A 3CH5A 3FDIA 3TSWA 2BMDA 3PV0A 2RAPA 1M7BA 3A4MA 3H4MA 4EIWA 3VTKA 4AYWA 4F4CA 3KKQA 2UZ3A 2RGNC 2WWYA 5E4FA 1XCPA 4B75A 1BS1A 4L5BA 2RGEA 2G6BA 2GEDA 3U7EB 4DB4A 4ZDKA 3A8TA 4HAUA 2H16A 5EXSA 4D0GA 3W90A 3QF4B 4B6EA 4I81A 5FPKA 5JSZA 2ZSDA 2ZPTX 2UVQA 3RS3A 4FWIB 1F3OA 1FL9A 1NVVR 4M22A 3AH8A 2QORA 2E9SA 1R5BA 1E9RA 1TX4B 4TTPA 2RGNA 1OXVA 3M4YA 2XZLA 2V7QA 1EFTA 4RY2A 3L0SA 4C4PA 2WMNB 1E79D 1ZW6A 4KU4A 1ZC3A 3THOA 1IN5A 3ZZUA 5AUOB 3QXXA 5L3VA 3ADCA 4HEJA 3H86A 4QHSA 2QI9C 1XJCA 3TIFA 5DISB 2BMJA 3R7WB 2ZXUA 1AGPA 4NYMR 4NONA 2BJVA 2R6AA 2CEAA 2IL1A 2F1RA 1IN6A 4B76A 3FHCB 3U3MA 2NMVA 3V00A 4LBYA 2DWOA 2XNDA 1F6BA 3U44A 1XP8A 2G88A 3NC0C 3UMSA 4TT3D 4BECA 1U8YA 4BEBA 2RGDA 2VHQA 3IO3A 2D3WA 4C0JA 4JLOA 4MYHA 2FPLA 1Q0UA 4Q7KA 4NPHA 4MGZR 1EFCA 1OW3B 2W00A 3CR7A 4C7OA 5EE0A 4M1YA 5J5CA 4FW9A 1ZCAA 1GL7A 5CM8B 4B3CA 3D3QA 3SFVA 4E09A 1SVKA 3K0CC 1MRSA 4PFSA 3TSOA 3U3KA 5KHOC 1Z07A 1I4DD 3LD9A 1KI6A 1E9FA 4M2LA 2ZTSA 2GVZC 2HLDA 1UEIA 1I4LD 1G4UR 1YZQA 3RRNA 3QKTA 1E96A 4DCNA 1TTTA 1LV7A 3LQQA 1JEEA 2BBTA 2VSFA 4MUBA 2GZAA 2XTZA 4A15A 4TMZA 1TQ2A 4XOIA 2ZEJA 3K70D 3FWYA 4DCVA 1MR3F 3K1JA 4OK3A 3THXA 2HYIC 4BLRA 4KFSA 3K0CA 4BFXA 2F3RA 2AWNA 4NYIQ 5JS7A 1NMZA 1ZMXA 2WBLC 4ZPXA 3K8YA 1CR2A 4C3ZA 4Z8XA 1YJ5A 2MMCA 2OCYC 5B2ZA 1DO2A 4PO1A 1E1QA 5FUWA 3OIYA 3CF6R 3IGFA 3BH7A 1E2EA 2W0SA 3D8BA 2O0JA 3GJ5A 4NH0A 1U90A 2XTMA 4IVPA 3KQNA 3FGNA 3TUZC 2ZITA 5CDFE 1XEWY 3LY5A 5AUNB 1JR3A 5G3YA 2ZSFA 2FSFA 1JB1A 1IN4A 4ZKEA 4JYCA 2J1LA 721PA 4ZIRB 1U94A 3CIOA 1AJEA 4YMSA 1NL3A 2O8EB 1SHZA 4GMDA 4NDZA 1GL6A 5AR1A 2ANCA 2F1IA 2QPOA 3NTUA 1NNEA 1NF3A 4KSCA 3VAAA 4N3NA 1XPUA 4IKEA 1XRJA 3D6TB 2ZJAA 2ZS9A 1FPMA 2YYZA 4ARZA 1NIPA 3CRVA 2EFGA 2Q9BA 2VF7A 1MO4A 1IJFA 4LYJA 3GLGA 1PUJA 1XXHB 3AVQA 3KTAA 3RSOA 121PA 4CEJB 1DG1G 2CLSA 2ZYVX 2DHRA 1KAOA 4XJXA 2R6GA 5K8IA 4Q7LA 4TQAA 4GL2A 1W49A 3TUIC 2ZU0C 4I1SA 2OSBA 3ZS8A 2FSIA 2ORWA 3PR1A 3QBTA 3IIJA 2D7DA 4B6FA 3FB4A 1GITA 4KAXA 1KSJA 1G17A 5JI3E 3ZD7A 3VX4A 2XNDD 4P32A 3BB3A 3UWOA 1XTQA 4FMDF 2R62A 4FMBB 1P62B 3W3ZB 4A0RA 2QZ4A 2BC9A 2FX3A 5UKDA 3QOFA 4Q4HB 1H8HD 1E0KA 1JNYA 1ZIOA 2JA1A 1KDRA 1QRAA 1U8ZA 1Z6XA 2OAP1 2ZRHA 2YWEA 5CLQA 5KSYA 1W7AA 4GSYA 4NYJQ 3A37A 3KDSE 4W9MC 5FI1B 1W0JA 5FR1A 5DHFA 4OKSA 2O8DB 2GDJA 5CYOA 5HKKA 3KJGA 3SQWA 2WHXA 1QHNA 1PUIA 3RAPR 1JAIA 2HLDD 3SJZA 1ZD1A 3UXMA 4TTRA 2ZUCA 1NBMA 3ND8A 4TMWA 2OCBA 4BFUA 1QZXA 3CNOA 3LX8A 2ZRAA 3FMIA 1GKIA 4UNSA 2R44A 3LH5A 2QNRA 4F4JA 2AK3A 1T3HA 5FPSA 1A82A 1GSIA 4MRNA 5JS8A 2PEYA 3T1VA 4EKDA 1T8UA 5F2EA 3K9HA 1R8QA 2CK3A 2OE2A 4I1OA 3CNLA 3MD0A 1HURA 5HPYB 2VA8A 1DPFA 1ZP6A 1RFLA 4C2TA 4IXNA 3W3AA 3K0AA 2WM9B 4WZBE 4DLTA 3C5CA 4ABYA 1ZU5A 1GNRA 2QT0A 4KBGA 1W36C 1ZC4A 3DHWC 3MMPA 3U5ZB 1P3JA 4P4UA 2ZYWX 3U6KA 2J7PD 4A82A 4RD3A 3AVOA 1HTWA 2IF0A 3FKSA 3T5GA 4RKEA 2B8TA 3DEFA 2NO7A 1ZYUA 3AKDA 3QPVA 1RIFA 5GJVC 1TL7C 2QTFA 5G41A 1G19A 1OXUA 2Y8EA 5KDLA 2OG2A 1R8SA 2Z4RA 1SVLA 3SDZA 2P6RA 2PMDA 4XSGA 4OI2A 4AKEA 2RGGA 5J4HA 3MWYW 5LB2A 3ADBA 4KVGA 4ZO4A 3K0EA 2RGCA 2HF9A 5JZVA 2HEIA 4DLWA 4QKQA 2FA9A 2GHIA 3QNUA 5HZHA 1J7KA 1XEXA 1B23P 1RJ9B 2V3CC 1S1MA 2XJ9A 3QIAA 4A9AA 1IY0A 2W0MA 1N6KA 5AK0A 1SVMA 5AJVB 5E3HA 4DLUA 1N6OA 4PZZA 521PA 4KLNA 4NU0A 1AQYA 4IW3B 5DH9A 1PV4A 2ZE8A 2LKDA 2QTHA 5G40A 3V4FA 3JZMA 2RGXA 4U5XA 421PA 4MGIR 2VP2A 2P67A 1S96A 2H8KA 3SZRA 2NG1A 2OFXA 2IX3A 1TPZA 3L82B 2GK6A 3I92A 3DDCA 4OHWA 1Q3TA 1Q22A 2V55B 3C5HA 4AIIA 1E9EA 3PCRB 5C4MA 1TADA 4HLUC 1Z5ZA 4O2LA 3THYA 1H8ED 1J2JA 4DIEA 1DE0A 1DEKA 3EZ7A 3LV8A 2ONJA 3WBKA 1CRQA 2XXAA 1UBCA 1LW7A 1FUKA 2QE7A 3DMNA 3TKLA 4F4IA 3BE4A 3K09C 1G7TA 1GNQA 2DYKA 1QHHB 1Z47A 1IAQA 4O3MA 3PENA 1D6JA 4D4KA 1N0VC 1YHNA 2CE2X 2WJYA 4HLUA 1EX6A 2WVJA 3K0FB 4Z8YA 3LXXA 3SS8A 1W0KA 2WPDD 2XX3A 1R4AA 1DAEA 4IOLA 4LJ4A 4QHTA 5FFMA 2QM8A 2GJSA 5DIFA 2CK3D 3Q72A 4ZKDA 5B58C 4G3XA 3QG5A 4OQLA 2W6JD 1MO3A 3AF3A 2GXAA 4URVR 2W2VA 1F48A 3FFBA 4IDOA 2EYQA 4LX0A 3K09A 3T5DA 5JECA 1ZNYA 3W6PA 2CCKA 1P72A 1MKYA 2O8BB 1X86B 1AK2A 1UADA 2C9CA 4PC6A 4JKYA 3EPJA 3NBXX 4CDGA 2ZI5A 2V8OA 2JLQA 1ZUNB 3ZZTA 1YZUA 2JLRA 1OIXA 2HV8A 1W2GA 2J46A 2ZQ5A 3PQCA 4RD4A 1OHHD 2BHRA 4OHYA 2FFAA 2DFLA 2J0SA 4DSOA 1HH4A 5JJKA 4CYMA 1C4OA 3BERA 2WJHA 3KUDA 3P1JA 4RD2A 2W2XA 3LBNA 1W36D 4ZCMA 4P3YA 1E4YA 2RMKA 3U4QA 2ZRFA 2KI5A 1L4YA 1Z0KA 4PC3A 4CIDA 3HYRA 3C14C 1JI0A 1US8B 4Q5IA 3E70C 4GOXA 1C1YA 4CEIB 2NGRA 4DLSA 4LBVA 4I1UA 1DOAA 1IBRA 1GRNA 4NZYA 4KFTA 4URWR 1NRJB 1KY2A 4YDSA 1P2UA 4M1KA 3EWSA 3MGCA 1KK0A 3PG5A 5BYJA 4EQ6A 2QY9A 2XZOA 2I1QA 3JZAA 4TLAA 1D2NA 1N6HA 1OIVA 2JLUA 2BMEA 4WXPA 1E2GA 4UXHA 4JIMA 1E32A 1N5LA 3E5HA 4KHZA 2ZS8A 1E2DA 4WXRA 4RD1A 3EIEA 2IYRA 4RKFA 4PAOA 1CJVC 1G6HA 4MRPA 4BRWA 1ZIPA 4QG7A 3GJ0A 1NKTA 1BO6A 3BAFA 4JYBA 1DS6A 3RHFA 2R6DA 3O8RA 2JLSA 1XMIA 5GJCA 4LYHA 4PPFA 3RABA 4BUJA 4LCBA 4TYQA 2OHFA 2QE7D 3RRYA 3LW8A 1Z06A 4Y0VA 3RWMB 3LO5A 1AGRA 1D2MA 4F7WA 3W8NA 1YR8A 4Q66C 4BFYA 4DXAA 4TSFA 1Y3AA 1CULC 4FMCB 1JXMA 5FI0B 1W0KD 4A0FA 3LRPA 1KDPA 4IFBA 5JBQA 3HYTA 1G20E 3REFA 1II9A 5KTYA 4V0ME 4NCNA 2GCPA 4JL8A 3UIEA 2FGKA 1HV8A 2CVFA 2C99A 1ZD9A 3CX8A 4LPKA 2LKCA 4AG6A 2J5XA 1S4QA 2VP6A 1OH7A 5CK4A 3NEJA 3EZ6A 3I4LA 1FFHA 1QG2A 2QRNA 4C0HA 1VG1A 2X8AA 2ZUDA 3RSLA 2QMOA 3FKQA 2QSZA 2B21A 4LC1A 4R71A 2JGNA 4LYFA 1BYUA 2ECKA 2QUZA 2ZE6A 4MGYR 1KK2A 2P65A 1P60A 2YVUA 4TQ9A 5F3WB 4IRUB 3A4NA 5KDDA 1P6XA 3RRZA 2JDID 2FEMA 2ZRJA 4YMUA 4F92B 3TGPA 1R7RA 2QPTA 1SKYB 4R9UC 2FFHA 2V4ZA 3CWQA 4AC9A 4L9SA 4W7SA 3GLFA 5DSZA 1SGWA 1MO5A 2ORVA 3B13B 5J47A 3WYFA 1NG9A 1UAAA 4L8GA 1RYHA 5GVSA 3A36A 4CF7A 1MABB 1UKEA 1VDZA 3V9PA 5LD2B 2ZM5A 5DI3B 3GLIB 2OXRA 1SKYE 2WZQA 5JRZA 2J41A 1OV4A 4HDOB 4HB3A 1E4VA 1GILA 1A7JA 2V9PA 5E95A 4FCWA 3WHKA 3W5JA 1LY1A 2GZHA 2CCJA 4Q1CA 3ZVRA 3AVXA 4N0DA 4Q9IA 3WNBA 4LI0A 3MAAC 2OAQ1 1Z83A 3Q3JB 2RGAA 3GLIE 2XJ4A 2OCAA 4PQYA 3WXMA 1D8TA 4DSTA 2IF2A 1HQYE 1NY6A 2AD5A 2JJ2A 1NSFA 2ZAOA 3AVUA 2YOFA 3J81k 1EFHA 1P2SA 3GEHA 4O2RA 1RRPA 4HATA 5FPYA 3U2QA 3OIUA 2G83A 1R0ZA 3ASYA 4G5RA 4NCHA 4PC2A 3LW7A 2G0TA 5CDFA 3ETLA 4JSYA 1TEVA 1ZVQA 3I8SA 1CXZA 2WSSD 4TL7A 4NMMA 4DT1B 4DSNA 2L0XA 3C16C 1Z28A 3P26A 4M4SA 3EXAA 1L7VC 5AJWA 1WXQA 2J0UB 2J9RA 4JBXA 3X1ZA 2PLRA 2XTNA 2OBMA 3E1SA 1NLFA 5IHPA 3I3SR 2KSQA 3CKLA 4A2QA 1Z3IX 4A4DA 4DSUA 4BZPA 1NVUQ 2OO7A 3LQRA 3LVQE 4M1SA 1CLUA 3SYKA 2IHYA 4TZ6A 1WDTA 1Q20A 1T0JB 2Q3FA 2ODBA 3SC3A 2QM7A 2GVDC 4G5QA 5JMTA 2GEUA 2H17A 2O8EA 4D0LB 1XD8A 2BBSA 3FMOB 4DUGA 4IEEA 1CU1A 1GNPA 2J7KA 3OEED 3BFKA 3ZVNA 3WMEA 4DCUA 3EX7C 3D31A 2P5TB 1UJ2A 1NVXQ 4R7ZA 1DTSA 1KTVA 5DN6A 5BWMA 4CEJA 3MG9A 3U60B 3B8HA 4QJ5A 3ND9A 2GJKA 3WP0A 3O47A 1Q44A 4M21A 4DKXA 1XPOA 1KO8A 3L0IB 4GP6A 2ZROA 3LWNA 2ZIAA 3SJBA 1EWRA 1X8LA 2J3EA 5L3RA 4PQFA 1KMQA 3BD9A 4Q4JB 4KLZA 4TYWA 3MFYA 1KOFA 3U6BA 5HCNA 1E79A 1XTKA 3ADDA 2Q0HA 3BFXA 4B2PA 2WWXA 1XF9A 5JJLA 1W2HA 1UKYA 3ZIAA 4KBFA 1XNJA 5KDOA 1S0UA 2QAGB 1YRAA 5LBIA 4M53A 1X1SA 4OHXA 4UJ3A 5FPTA 5A5GA 1CR1A 1GRQA 3QY0A 4Q4HA 3PEYA 2P6NA 3QXJA 1OFTA 5HTKA 1UF9A 3DL0A 3OEHA 1YZNA 4TMVA 1S1CA 3BB4A 1RPZA 1KIMA 1GM5A 2O8DA 2XSZA 3EA5A 1G3QA 3AUYA 3AB3A 1OKKD 2VO1A 2WJVA 2QENA 1Q12A 1TNDA 3MWJA 2ZRKA 3AP2A 4EUNA 2DPXA 3CLVA 4OHZA 5LPNA 5BN3A 5BW8A 4GMXA 4OHVA 5G3ZA 2JJ2D 5F98A 4BGDA 4MKHA 2IHBA 2BV3A 1CTQA 3HR8A 2AX4A 4JLNA 4Q1EA 2F1JA 3VR4A 4V0NA 4BE7B 4JLMA 1VTKA 1P9NA 1T5LA 5FBWB 2K5UA 1XD9A 1BKDR 3B9QA 4FIDA 1Z6AA 2GCNA 3GJ6A 2REOA 4MYUA 2CJWB 2QAJA 5KPDA 3QSYA 4KYIB 3Q5EA 4PX9A 2JASA 5E7MA 1ZRHA 4JBWA 1M74A 1TQ4A 3AUXA 4P31A 3WBJA 3PVSA 4HZUB 4B44A 2AR7A 5L3SB 4AYTA 3IEVA 2GKSA 3NH6A 3N2EA 1R2QA 1VHTA 4RZXA 4LRWA 2OFOA 1IXRC 5L3QB 4M0LA 2C78A 2C5LA 4RJLA 1GIAA 1LS6A 1XCGB 2PLFA 1OPXA 5FL3A 1G8HA 2MSEB 1RRCA 1E2PA 1Q3HA 3GP8A 4DDVA 5CITA 2ZR0A 2X77A 2QBYB 4B47A 4DUGD 5JWHA 1TMKA 1JECA 1P75A 4C0SA 5HR5A 3QKSA 5D3MA 3H2YA 1T8TA 1N3BA 1KI7A 2C9OA 3W9YA 1FTSA 2ZRPA 4B35A 4BFWA 3NDBB 4QM6A 4KVAA 5DN6D 3F8TA 1RJ9A 1JAHA 2IW3A 3KXLA 2ZRCA 6Q21A 1OIWA 1JQLB 5J4YA 3SU8A 3BGWA 8OHMA 1L4UA 4JZKA 2O8FB 1NSTA 2IT1A 4JMPA 3WRXC 2IK8A 2CHGA 5KO2A 4JL6A 1DARA 1G7CA 4XD7A 2CXXA 3OZXA 1J8YF 1IXSB 2C98A 1F60A 3Q85A 2GCOA 3NDPA 3ZIAD 1E2IA 3RLFA 1W4RA 4AURA 2FDCA 1YR7A 1KJWA 1J90A 3AF2A 4TYPA 3QJYA 1VYTA 3MCAA 3I62A 1VCIA 2Q3HA 2ZJOA 3QQ5A 3K9GA 2IYYA 3OEHD 4KODA 1KKLA 4LK2A 4NCKA 4MKIA 3OHMA 2D7CA 3KQKA 5CB6A 1KNQA 2XSZD 2PJRA 2ZU6A 3EASA 2MSCB 2RGBA 3LBIA 1KO7A 4GP7A 2HXYA 1XPRA 3BB1A 2DFTA 2V54A 1AA9A 3UPUA 1FW6A 1QHHA 4TYYA 2PBRA 1SVWA 4HUTA 2VPPA 1KZGB 2PMKA 3HU2A 1H8HA 1UBGA 1XCMA 1XX6A 1KO4A 2AD1A 2YOGA 3SEAA 4JLPA 2DY1A 3KJEA 1JJ7A 4JSTA 3NBFA 1Z0FA 4HAVA 3HU1A 1NJGA 4JVMA 1OB2A 4S35A 3EAQA 2IA5A 1BMFA 3ASZA 3L43A 3R9XA 3CPEA 2QTVB 3LFUA 3VX3A 3EIQA 5JWOA 1XDBA 4US2R 2LCFA 4NCIA 5FOWA 3CH4B 4TMKA 2QRZA 1QHIA 1HE1C 2O8BA 3UG6A 4M8NE 3FHOA 5J4LA 2KJQA 4BRUA 3I5XA 2AFIE 3B1VA 2F55A 3GPLA 4MKFA 3MWKA 3CRQA 2ONKA 3BRWD 1D9ZA 1ZM9A 2P3SA 2GZDA 2DFNA 2PZGA 4BLPA 1F2TB 1KI4A 2HCJB 2ERYA 3X1XA 3WYGA 1PLJA 1DELA 5ELXA 2WOOA 2QMEA 2AXNA 4B32A 4PSVA 1ZM2A 1JEDA 3QE0A 3M1IA 4A2PA 3PUZA 4DJTA 2AN9A 4RFVA 2JLZA 1LFDB 2ZRIA 3OIVA 4IEIA 2J7PA 4WOPA 3VKGA 3PXGA 1E69A 1KI1A 4OI0A 4Q00A 1N5IA 3VR6A 4QBGB 1GG2A 2QEQA 3ICEA 1Z8FA 1FUUA 1TF2A 2FMXA 1AM4D 2H57A 2CE7A 1JJVA 3OE7D 4ILEA 1NJFA 2ASEA 2PX0A 1QVRA 3QPWA 4M9ZA 1RE0A 1ESNA 4Q7MB 4XD7D 4D80A 4QJ3A 5F9FA 2ZUBA 2GWHA 2G1JA 4P0TA 2E1RA 4DB2A 2LWIA 3UANA 1M34E 1G3UA 4Z51A 3GJ8A 4FMCF 3AV0B 2QA5A 3A58B 4BFZA 1ZM3A 3C4JA 3NG1A 1KI8A 2CLDX 3K0SA 2ORIA 3NEYA 3SI7A 1SXJB 4GOJA 1AS3A 3ONWA 4QGHA 2ZRLA 1XXHE 2YC4C 4TL6A 2QU8A 4GBMA 4A8JB 5KYKA 5G53C 4CEHA 2FSGA 3ZVMA 1E9DA 4FINA 2EYUA 1EG7A 1WCV1 1T3LA 4DEYA 621PA 1U0JA 3HU3A 3VR5A 1F2UB 1TF7A 2OILA 1OLOA 3BBPA 1N25A 4FCVA 3EPLA 3WMFA 1R5NA 2GJ8A 3A1UA 4JLKA 5BQ5A 1SVOA 3ZLJA 2OFWA 1H8EA 2QT1A 1R10A 1BMFD 1G7SA 1VCOA 1J99A 1E9AA 4P4SA 3JVUA 4I99A 4MKGA 3CZPA 2OZEA 1JPNA 4XVQA 2VP0A 2QP4A 5H68A 4LDJA 1G8PA 1Q1QA 3V4RA 2D2EA 5JJIA 1VG8A 1CF4A 5DO9A 1OFUX 1QBKC 5JCPA 2WTUA 3DO6A 5FR2A 4QBIA 2XZPA 3P20A 2IS4A 2HDNB 2WPDA 5JEDA 4JLAA 3R9IA 4LZZA 2CL7X 1KI9A 3KZ1E 4HUQB 5AJYA 3S1AB 2W6JA 1C9KA 2ZJ8A 2VHUA 4Y0AA 4DDTA 3IHLA 2GJ9A 2Z5FA 4IXMA 3WRYC 1BIFA 5DYGA 5C46F 1LB1B 2IEZA 3TQCA 3SJCA 4U00A 3OIWA 3QENA 1M2OB 3GEIA 5GADl 2PH1A 2FN4A 1XWIA 1MH1A 1OHHA 4IOJA 5KSOA 5KNDA 5IK2D 1BH2A 3IHWA 3P27A 4M9QA 5DI3A 2PL3A 1Y63A 1TF5A 4PC1A 2IUUA 2DB3A 1WE2A 3NVAA 1GAJA 1G8YA 1W4BA 3RWOA 3VQTA 3GEEA 4D2IA 2PCLA 1DO0A 3W6OA 5CM9C 2QMUA 4URXR 1AZSC 3IUYA 4EJSC 4PSKA 4YONB 2IBMA 2CNWA 1VECA 2C04A 2ODEA 3I8XA 2WMOB 4QGAA 3IIKA 2QROA 3TMKA 4ACAA 4R2HA 4K8OA 1KJYA 4J0QA 3H84A 2FWRA 2NO0A 3NBZC 3QBVA 1S3SA 4LPSA 5E7IA 1E3MA 1KSFX 3KB1A 1IN8A 1WQ1R 2BDTA 1NN5A 4EJSA 2A5JA 2NZJA 4QXAA 1W5TA 1FNMA 1HQCA 2F7SA 4UQOA 3AEZA 4O0MA 3VMFA 1CIPA 3LLMA 2F3TA 4DT1A 3FOZA 3PEVA 4V02A 2J0UA 1K8RA 3IIMA 1QHGA 2WAXA 3DZ8A 4LY6A 1T91A
chains in the Genus database with same CATH superfamily
2EERA 4X1OA 3WKCA 4DHEA 5LYYA 1T6YA 3KETA 3FPCA 3H2KA 1H6DA 4F85A 5CA1A 2CXPA 1KK3A 3V1NA 3T38A 2JH9A 2IUEA 2R97A 3I32A 2ILVA 5CJPA 1VL0A 3PHJA 2QRGA 4Q9LA 1RCFA 1PGNA 2Z1NA 4ZHQB 4JLBA 4K88A 2WWGA 3G2JA 1ZH6A 4PHTA 5MHTA 2OV2A 2AH5A 2CFTA 1AKYA 1YQQA 1SEPA 2MSWA 1RBQA 4CLHA 2HSGA 2FMHA 4R2XA 9LDTA 4PLGA 2GGSA 1BOOA 5DPMA 2FW1A 1N6IA 3NVMB 4II7A 2H1OA 621PA 3QHPA 4Q18A 1QO0A 3H0KA 4D6PA 2PIAA 4OAQA 2IBTA 2CB0A 3E9RA 5A0TA 4Z0HO 1K4MA 3RYCA 4MR7A 1JH9A 2CW5A 3JSXA 5C1BA 2GBLA 4MPRA 2AF3C 2ZCUA 3Q9SA 1M8KA 4K6FA 2OV3A 4E3WA 2JC3A 3O1JC 1Y7LA 2R5WA 4H7DA 1E2FA 4F21A 1BDHA 4S1VA 1VB5A 4MR8B 3O8CA 1JFRA 1YA6A 3N2KB 1RIIA 1BWRA 1VL1A 2P0EA 1XJ5A 1PR0A 1RWBA 3R8XA 1LEHA 1TT5A 2C7VA 3UFXB 2VAPA 3JYOA 2XF8A 5LFAA 3VYSB 4DA6A 3B60A 3IALA 3SE0A 1J0CA 5GVRA 5CT9A 3DE1X 1DDGA 1WDKA 4BE9A 2UYOA 1YKSA 2NVOA 3WGUA 1SPBS 1V5WA 1DCFA 2CMKA 4DDHA 2ZI3A 1HOXA 3R9XA 4HH1A 4XYEA 2HSEA 2CNWD 5A5DA 3D8HA 3CX4A 3P9PA 3OOWA 3S2SA 1T9BA 2P6UA 3SHFA 3EIWA 2J0VA 3TBKA 3L18A 1KRHA 2X9LA 2BGGA 1RU3A 2SCUA 4L16A 2FZ4A 4DQ0A 1FFAA 2BM8A 5DLYA 3MNFA 4RMJA 3MBIA 4UTXA 3L07A 5DASA 4QL3A 5LZ5A 1L0BA 4QUEA 3S6JA 4DXHA 5LZ9A 5HRAA 1NWHA 3GDWA 3L2OB 3NCHA 4IS3A 2Q7DA 1AE1A 1QFYA 3HUUA 4D4JA 4LS3A 4KQHA 5ALYA 4BMXA 4P84A 1WAMA 3NHKA 1OX4B 1JTVA 2NIPA 4JB8A 4KKXB 5JS6A 1Q0PA 2Y76A 2UU9B 2ZWPA 3QW4B 3WIEA 4L2IA 4ZGBA 1WUKS 4HB0A 4ERXA 3VJRA 2O05A 1G3MA 3B78A 3FETA 3WKAA 4X1YB 1E9CA 2FQWA 2ZSEA 3U7HB 2G9VA 4H7IA 3WVNA 1U1EA 1N9GB 5IJ9B 5GJWC 4C0KA 1IWOA 1BAPA 2C97A 4A27A 1UFQA 3DOCA 4RCZA 3B5IA 3VZDA 1VFPA 5EMLA 5J43A 2FG5A 1NLMA 1JG7A 4U39A 1JEYA 4QUAA 5CLJA 1G8FA 2XUHA 1YE8A 4MPDA 1WZUA 3KXKA 4PSAA 1TFRA 2PT5A 1M8GA 5IPFA 1XMPA 2BEKA 2W6ZA 3S27A 2QBYA 2FZLA 3F3YA 5LMZA 2PU5A 3DO8A 3EDQA 4OUDA 4ZYUA 1V8BA 1PGOA 1U2RA 3GLHE 1N0IA 3TF5A 2W4IA 3STYA 4CQMB 3FPJA 3GLGB 2VH2A 4Q3DA 3KJQA 5DTEA 3I1YA 3TDKA 2AOWA 4UEQA 3ZDEA 1O0SA 4U63A 3K5IA 1K5GA 1RADA 1T4MA 2G72A 2IHVA 5KINB 3BH6A 2QN3A 3Q6MA 3QF4A 1XHLA 3JARA 1EE1A 1N2CB 3WWCA 1HE8B 5IN4A 1TM5E 1XCLA 2PYDA 4ZU6X 3HXTA 3JATB 3Q15C 1D9XA 5HZGA 1PVOA 1ZHOA 5GGYA 2CLHB 3UK2A 1T0IA 2M6RA 1QCZA 6LDHA 5KJ6A 2QUBA 4P2BA 3QXCA 4NNJA 4PYIA 1W9HA 4HRAA 3DP7A 5EG5A 2QLTA 2R9VA 2ZJ4A 1NM5C 2GESA 2H5JA 2I76A 4CBVA 2UZ4A 4CDMA 4WBNB 3G9UA 4XGNA 3DT6A 5K0ZA 2CUNA 2SNIE 1KOJA 2VHXA 1DKQA 3EDCA 4TV9F 4BL5A 2W8BB 3K53A 2QD4A 5LCXA 3ZWXA 4IZIA 4JELA 2FRDC 4JKIA 1T9GS 1CUCA 1I1HA 3PEUA 4J94A 3ANLA 1TZ2A 2RK3A 3IO5A 3KLNA 4RZHA 4HSGA 5AO9A 1AKWA 1IC6A 1BJRE 1M3SA 1N5JA 4L4SA 4P80A 1PDOA 2XIJA 1HDRA 1WCYA 3FVRA 1GLGA 2OL4A 3ZHCA 1U7TA 2GXQA 1BW9B 5MFZA 1BEZA 4IZOA 4NBNA 2J67A 3I5UA 1I94B 5D7BA 4I1YA 3AI3A 4E12A 4YP9A 4LF8B 2GCIA 4NNPA 3ZE9A 2P0YA 1KYQA 4Q4AB 4KR6A 3GFTA 1DBIA 1SUSA 1XQWA 2INGX 2JGLA 1NMYA 3E9DA 1OH5A 4EGCB 1TPYA 2YASA 1GO2A 1V35A 2ZVQX 1PRYA 2VJMB 3TUJC 3NBMA 4MA0A 5EGNA 3UUFA 3EWAA 4TS4A 4CDNA 1BXRB 4CHTA 1P4RA 2PRYA 4DRZA 3HP1A 5AI4A 5IH7A 2EKBA 4UTPA 1OD6A 1KORA 4Q34A 2XITA 3IQHX 4MB0A 5A6SB 2FCRA 3EBLA 2PPVA 4IKOA 1VE9A 4FM9A 1MPTA 4GKBA 2QQGA 1IXZA 2LDXA 3NANA 1ORRA 2GT1A 2Y99A 1AO3A 5T4HA 4LQ4A 3UAOA 1XA4A 4QOEA 1FX0B 3KJZA 5ICGA 2WJIA 1SN7A 4UFPA 3NXKA 1QV9A 2WIBA 4P35A 5IAJA 2OFFA 3FZYA 3UTDA 1FTWA 1QIMA 2HCFA 3ORYA 4QOIA 4AZ3B 3RREA 1C9NA 1Z5PA 3MCZA 1E2HA 2HMYB 1MQ8B 2OEPA 1JLHA 1C3LA 2W71A 2XLCA 3EIHA 4IIEA 3VSEA 4Q9JA 3TNFA 2MSKA 4EUSA 3OQJA 3HFSA 4MJ3A 5CUQA 4B3IA 4F1JA 1LNQA 2ZRMA 4BEJA 1NI3A 4Q1DA 3SYMA 3AG6A 1KP3A 2ADFA 3NWEA 3R5FA 2COEA 2IXGA 4AG5A 5BY2A 1J39A 2TMKA 4W1SA 1WSWA 4JI7B 2ZB4A 5B3AA 1XMVA 2QRVA 1KYTA 2EGHA 4MI9A 2L69A 2XDYA 5LC1A 4QM7A 4BO2A 1LJ8A 1GZ7A 1W4CA 4QBFA 3ZY5A 3KFXA 1RKBA 1FS4A 2VK2A 5JAMA 5AVVA 1IPHA 3E0QA 2FW9A 4Z3DA 5F2NA 3WNCA 1OAOC 1FMLA 2FCAA 3FNEA 1RKXA 1PK9A 2HD4A 1T1IA 4GVXA 4U0JA 2WWVD 4ZODA 4O2BF 4RD6A 3GA7A 3ZYZA 4L07A 2TECE 3OFSA 1H6BA 1LBSA 4AQDA 1EFLA 1XZNA 2IWHA 4E5VA 4L6AA 4Q37A 5C8DA 2XXBA 1QG4A 1GDTA 4V0LA 4WOBA 3W1WA 3W77A 1EI9A 1VIVA 4P4LA 4F2PA 2Q3CA 3P97A 4M7PA 4QUHA 4A8JC 1TM4E 2RHGB 3UMMA 5MFPA 3QEAZ 3EMVA 1GU1A 3EB9A 2QG6A 5EZ5A 3N0VA 1P1RA 2IKSA 2PWAA 2BGIA 3LF1A 2ZJ6A 3SSMA 4RVSA 3THYB 5HG0A 4ITUA 5C8VA 2H92A 4M83A 4NCJA 2Z5VA 4TYMA 3IBTA 3WGLA 2XXAB 4BDSA 3R0ZA 1EWTA 3FROA 1ZR4A 3RFCA 3HVRA 1N6NA 4HR7A 1CUVA 4XPIB 1SMKA 3T52A 3AR3A 1IY2A 3Q7TA 4LJLA 3TVTA 3CO5A 3TE7A 4OSEA 3N0RA 4LDPA 3QU5A 3GCDA 3WSWA 3TM4A 1E2KA 1O96B 3MQFA 5INTA 1PNVA 1GGVA 2WYUA 3GUVA 4P38A 1PSWA 1ZK0A 3H1TA 3QXSA 2QSYA 4MCJA 2J3IA 2X7JA 3H97A 4O2AA 1XAIA 1TU3A 3GUUA 2NZ8A 4K6MA 3FD8A 3FYHA 4AF7A 1F0KA 1F0NA 5DYTA 2VJYA 2VKTA 3CNNA 5EWJA 1LI7A 1WVGA 3BE5A 3IVCA 3LNCA 4ND5A 5F5LA 1HNWB 1PEYA 1YDHA 5A05A 4EG3A 3QEJA 4U2BA 4OFZA 3KL4A 3SN6A 4Z3KA 4TUYF 5TS2A 4ZYZA 1DEOA 4OSPA 4AXBA 4LSGA 2HBRA 3IULA 3S5JA 4KPYA 2NU6A 1EFVA 3HUEA 2LW7A 4IHQA 4Q01A 5C1PA 3WFJA 1EVJA 1FNCA 2I66A 2P91A 2O3RA 2C4NA 4IYJA 4UUPA 4JUFA 1UBRS 1M76A 3EQ9A 1G5HA 3AI1A 1L3IA 3K6RA 5MGNA 2DHCA 1PJRA 4TM7A 1F8FA 2Z6AA 1UKVY 2PXXA 1QSGA 1Q7CA 4JHXA 3OO1A 4JEHA 4OKNA 5DLQC 3BWBA 4AN1A 4DANA 4BQEA 4EGAA 1OBVA 4WCFB 2BH2A 2Z43A 2WWHA 2R8YA 1CUZA 3FCSB 3C8DA 5DSTA 1GZSA 1UZAA 4N3BA 1CC1S 3P9NA 4Q48A 4WFQA 1Y6JA 2DAPA 4NHOA 5CVVA 5KB3A 5I9TA 3ROKA 4M1TA 4YA6A 3AQIA 4JJZA 4L72A 5BYKA 5JR3A 1XRNA 5EJFA 3MRTA 3SZLA 3SFZA 3BXOA 1TCVA 1XR3A 4JLJA 4MW9A 2WYHA 1BDBA 1U3CA 1T24A 3FW1A 1IEWA 1E3SA 4M99A 2P4QA 1PQPA 1J70A 1JF8A 1PJLA 3CZMA 2IZZA 5HCIA 3B48A 5HF6A 3M3DA 3FMFA 3N1UA 4TM8A 1HG1A 1QHFA 2CBXA 4INJA 4NOMA 1Q1ZA 1T2AA 3SQXA 1AKUA 1SRQA 5IFKA 3L8FA 1IQ0A 5LUAA 1R6TA 1UODA 3O4FA 1SA0B 1Y7HA 4LZPA 3GHHA 5B6JA 2FQQA 5A4JA 3PSHA 3SR0A 7REQB 4CTMA 3ABZA 1D5WA 4YMWA 1JTFA 1ZGJA 3AVTA 1L8LA 1T2EA 1YZYA 4QTTB 4PICA 1WA5A 3PP8A 2FHSA 4ZVKA 1PZFA 3AU8A 4WV3A 1X7WB 2GJAA 2OKGA 4BLUA 4F6CA 3H83A 3OFND 5LDDC 3J7AC 3AF0A 4MEBA 5TDHA 3ND5A 3DL2A 1MCZA 2VT7A 1NG1A 5CA0B 2XMSA 1KAHA 1K4KA 1ZHFA 2I6SA 2X2FA 3C1UA 3IE0A 4LDRA 4XOUA 1LKZA 2M1ZA 3FNHA 5J9FA 1OA1A 3H5LA 3X1KA 4EAAA 2FOXA 3ADKA 4FTWA 3OTGA 4TZKA 1UBFA 4Q9NA 4L95C 4RIEA 3MGAA 1YBMA 1U3TA 3GEDA 3EA4A 1IVNA 2VBCA 4MQUA 4WDRA 2WQ7A 4Z7JA 2I29A 1L5QA 5A02A 1T2UA 4G1MB 2Z9BA 5F9HA 3JQ9C 3IX7A 4MYTA 3UYLA 3REQB 4JT8A 2ETVA 4HLDA 4NMLA 3PX3A 2F1KA 2GN6A 1K98A 2QGFA 3L4BA 4IWNA 4J16A 3GJRA 1RTKA 3ZI4A 2ODQA 5IUNC 5DWQA 4BV2A 4Z4EA 3BGOS 1FJHA 3JWJA 5ADWA 4KQMA 5I9MA 3WV5A 2AJDA 3OOYA 2JD1A 3HVJA 1EA5A 1R74A 2JJ8A 4LHXA 1XK6A 4ZQBA 2GSWA 4MA4A 2O8NA 1NY5A 1PFVA 1JPUA 2X1VA 1A9YA 3EZ9A 3SZOA 2PZBA 5HQ3B 1ZSNA 2WDZA 3O3NB 2RI6A 1X15A 4HADA 4ZQCB 5LOVF 1MB0A 2W2TA 1P81A 4UXIA 3VGJA 1IHYA 2IUYA 2X5NA 3THWA 2IYXA 1B1AA 5A0FA 1UBKS 4HGNA 1QX3A 1LI5A 4NBUA 1PFYA 3MYRA 1Z9BA 2A5YB 4O6VA 3ZWWA 2VC2B 3AHIA 4ENPA 2IYAA 3WIOA 3GLSA 1QORA 4Z53A 4H9GA 1AMNA 3TBFA 2PMFA 3OQMA 1ZN7A 4QE3A 3F97A 1S4MA 4CZ2A 1ECFA 1JHQA 3SKVA 4NWIA 5DM2A 3M6WA 2C7BA 2B69A 1L2TA 1B74A 2VDWA 3R5XA 2W2PA 3CJTA 5LOVA 2N46A 3MJRA 4FEEA 3VR3D 1LDEA 3M4JA 3RADC 1FYVA 2YYSA 3QVWA 4HGPA 2Q9CA 4XX1A 2Z3WA 3V2HA 1XBTA 4DC0A 5AM2A 1ZUNA 4HNAA 1X2BA 3ILXA 1YE3A 1T15A 3L6CA 4Q03A 5BV1A 2YJTD 3LLVA 4LWZA 4D5GA 4DV3B 5EZ6B 3B6JA 1IJKA 5J1TB 1Z88A 1NN0A 4QVKA 3CKMA 4NE7A 4KO8A 3DJFA 5ER6A 3BREA 3NHPA 2WAMA 1FEZA 1X3SA 3ANSA 5CR9A 3OFKA 4GQIA 3IQFA 3KYCB 2Q3MA 2BI4A 4RVNA 1TT7A 5EMNA 3RODA 3VU9A 2H1CA 4F6RA 4CIWA 2GF0A 4CV3A 3GVPA 4MYRA 1DTWA 2VNJA 2XDAA 3GJXC 2NSHA 4DJDC 2O5VA 3NHWA 2QTRA 3N0XA 1R4NA 4AWXA 2ZJZA 3LBHA 4FS8A 1KJZA 4KX5A 1N2GA 5IUKC 5M04A 4CEIA 5AKXA 1OJ7A 2NVUB 4HQKA 2ATVA 3DE5X 3JALA 2BFDB 4M8IA 3DXFA 2H4JA 4W82A 5LP6B 5E6UA 1GVNB 2X8WA 3W2TA 2D7JA 2RD2A 1KJQA 3NTLA 4PWZA 4BB6A 2ZJYA 4ZOEA 2VYFA 3CNEA 3MGKA 3OZ7A 3N8NA 4XLZA 4MMZB 5L4LA 4NJMB 1XC7A 3K96A 1XQXA 2C4UA 2EP8A 4FZJA 4BVGA 1HDCA 4Y6GB 4J03A 3PTAA 4KREA 2DC1A 3EG9A 2QLJA 1XZEA 2VYND 3TG8A 1QOPB 5JCXA 4D8TA 2A9JA 5E7JA 4G81A 3X2SA 3AF4A 5NLLA 3QH4A 4PPNA 5KTPA 1NQOA 2GYYA 3BVPA 3UXEA 4F71A 2BKLA 2OD9A 3OQIA 4C4YA 3RFUA 5BSTA 2QX9A 1RI3A 2DLNA 2CEKA 1I1NA 4HQLA 3GLHA 2G0AA 1TB4A 1RHRA 2JIPA 4R1QA 5CFNA 4YHHB 4LJ9A 1OWPA 3Q7PA 1O6FA 1R16A 4LOAA 4IP0A 4YQEA 1L7OA 5EJ2A 4BJHB 5CB8A 5DNDA 1GNSA 2P0AA 1F6DA 1X9IA 5F77A 3CF2A 4JI2B 1DRVA 3CJRA 1PLLA 2GZ3A 3D3KA 1RXVA 2O20A 4HWGA 2JJ1D 4EBBA 3GJ4A 5F1OA 3K5PA 3TBHA 3Q3GE 3EC7A 1MXFA 5BSWA 1A9SA 1NP6A 2DQKA 4OOFA 3DBLB 4Q9KA 1SBNE 3TPFA 4BBJA 1HDEA 1RABA 2G71A 1CDEA 1D7AA 1ABBA 1B2RA 5I8WA 4MUAA 4BEVA 5ULLA 1Y9AA 2IYPA 4XASA 4ZVRA 2CNDA 4NPCA 4YJFA 4C88A 3DE2X 1FY2A 4HDSA 1WBBA 2FAXA 3ZDXB 2KW5A 2IV2X 2D4HA 2REQA 1R4MB 2VHVA 4Q9HA 2J32A 5FTNA 2EBUA 4B7ZA 2K2QB 1WVMA 4F9TA 1N7GA 4AD8A 2QLFA 1JQEA 4OXXA 1NFRA 2BUBA 4EW3A 1TM3E 3ZV3A 2C1XA 2YZ2A 4MJXA 1HE5A 2MSDB 2WJJA 3OQHA 3LL7A 3Q10A 4IBOA 5SYMA 4GPTA 3RUCA 3VKWA 1ND6A 3S81A 3A7EA 3AUUA 4GP9A 3LK7A 1EDDA 1H2RS 1I5RA 4L5JA 4RK1A 4XTRA 3U9LA 1HT0A 1Z6QA 5ESXA 3BC1A 4JVSB 5H7XA 2OHJA 3JVIA 4IH4A 4EL5A 1UBOS 3A3KA 1H3FA 5E2IA 1X7YB 5FV7A 3A4YA 5GONB 3IUNA 3R20A 2C7QA 2YN2A 1RQNA 1HPLA 1P2BA 1SD2A 2QXTA 1NVEA 3ENVA 1CQXA 3PXDA 5TPWB 2OQ2A 2R8EA 3DLCA 3K92A 4JUIA 3AMVA 1T4CA 3KYBA 4D26A 2PR7A 1Y7TA 3JQRA 1HA3A 5C18A 4CFYA 2A35A 4U7WA 1YQ9A 3QVKA 3U3RA 5A9RA 1ULAA 2FPOA 1ZXLA 1A98A 2VF4X 3DM5A 3GDGA 3K31A 5CIWA 1MFZA 2V4UA 3AZOA 4EPRA 3RJMA 3FHTA 1Y3BE 5EFZA 3QX9A 5EIWA 3OESA 5IVDA 3UMVA 3ZI0A 1ZK3A 1HFKA 3KQPA 1RQ2A 1N7HA 1XVIA 2Y1XA 2ZT8A 4LV5B 1KFCB 3ISTA 4GPAA 4CU5A 1CW2B 2EG5A 1ZNQO 3EF1A 3E9MA 1V5FA 1TTQB 1U0LA 3H2ZA 1H9CA 2A4KA 2FZWA 3TSZA 4JASB 3ZWOA 1C9DB 1W4LA 2VSOA 4NULA 2X14A 1TAHA 5CHYA 3TJZA 5BUCA 4IQGA 3E2MA 3L0OA 5JMOA 3IMGA 1HT2E 2FFRA 1HE2A 5B30A 5FBQB 3D2BA 5FWYB 3AKEA 5HKOA 1NQWA 5LMUB 3EEOA 4UW9A 1GZ5A 3BSFA 3JQGB 3AJ9A 4RUKA 1O8CA 3RM3A 2JAWA 3K1AA 4IG9A 4OA8A 2HIAA 3S4YA 4BKUA 3K70B 4P33A 3NXSA 1I8TA 1QB8A 2GS9A 1V9CA 2AUMA 4PW0A 4B6OA 4B0PA 1MW9X 4DFDA 4DMRA 1OXBB 4ZYWA 1QTNA 5U4XA 1N5DA 2I3BA 2F48A 2GPYA 2BMAA 2GLTA 2NUAA 3M34A 4ZAGA 1TKRA 1E18A 1TMYA 4CUKA 3I6IA 3IQDB 1QHXA 4ZI2A 2QJOA 2ZI7A 3C6KA 3FAKA 4NLLA 3JQAB 4WIAA 3F49S 1KOLA 3RGWS 5HK9A 1N33B 4HV4A 5I6DA 5CJJA 4HYYA 3CFYA 5KC9A 1ZMRA 1KI3A 1VPEA 5EP1A 2R1VB 3JSAA 4BX2A 1B26A 5GM2A 5EKDA 3TG2A 3BPSA 3W4KA 2P40A 4JBLA 5ARBA 5BRJA 3DV0A 2JIBA 3HLYA 1EXMA 3NHJA 3L8EA 2FWPA 1LVGA 2H4HA 2OCXA 4UMEA 1XTZA 1DVRA 1MNQA 1U7XA 3LJKA 4LVUA 3KBBA 4BVBA 5IX8A 2QL5A 5LQNA 4ZDJA 3U61B 5FP0A 1EDBA 1OVMA 3ZZNA 4MQ6A 2FZGA 4GLJA 3GFSA 4ZYLA 2VN8A 5K0CA 2Z3ZA 4LDNA 4KOEC 1Y6FA 2XYGA 3R7SA 4ZDWA 3OSUA 4WKGA 2FFQA 1HXHA 3W5HA 2LIVA 1UWCA 1OFIA 5CW2A 2AW3A 5YASA 3OLXA 4YDHB 5CXSA 3B5JA 2J3QA 1ZK2A 2P7HA 4TSRA 2FUG6 2PT9A 1S2GA 3UG7A 4JA2A 3TB6A 3CN7A 2D8MA 4H77A 4GMHA 4OBEA 4UHKA 2OBNA 4EJFA 2R11A 1EGMB 2GK4A 2Q2OA 2YOHA 3DF9A 3VDQA 2OT3B 1QV6A 3RC8A 1PR1A 1ZKDA 4KH0A 4DUZB 3WKBA 2PGXA 1C0LA 2WVHA 5CT6A 4C7JA 1B73A 2EATA 1SIUA 3DDOA 5DYWA 1NPDA 3CUYA 3I8OA 4EX7A 5JANA 4WNCA 2MYPA 1G2OA 1QIIA 3R6DA 1Z6ZA 2F4NA 1UPBA 1ZMBA 3IV7A 2QSUA 3I39X 3C7DB 5AI0A 5HGJA 1L5GB 3VI3B 1ADCA 3P9ZA 1R37A 1AKRA 1DHRA 1DOZA 2I03A 2YRXA 3H8VA 2D1QA 3GNLA 3QA3E 3SICE 4RF4A 5DCLA 2R751 3T3DA 3OZEA 3BK7A 3GXBA 2VCHA 4IIXA 4BLTA 1MO2A 4UAGA 3RTBA 1FFSA 1IHOA 3VYWA 3O8OA 1FU4A 1SKUA 4Z9XA 4ZJPA 3FH0A 4IJQA 3M6MD 4DR6B 2CHVA 3EA0A 1KI6B 4Y9RA 3W5SA 2C4HA 2JLVA 2GA9A 3UY4A 2MINA 4I14A 1TJ3A 2OBLA 4B5KA 1GJRA 3V1LA 1ISPA 1PT5A 2G1KA 5GV7A 4G9BA 3MHTA 3RYTC 1F7VA 1Z08A 4PC7A 2NAFA 3ICPA 1OXKB 1CV2A 3TEJA 1S3GA 3NNNA 4CKBB 4X8OA 1NXSA 1P17A 1UZUA 2VJAA 3DZCA 4ZAZA 3NIBA 3OMWA 4D56A 2ZZNA 2B94A 4ZDIA 5LXTB 4YXWA 5T5QA 4MUJA 3EC2A 3JTMA 4MWOA 3WL8A 3CUVA 1AXEA 1YHYA 1DAOA 1CE8A 2XXJA 2YV5A 5DDIP 3PI7A 4ENUA 5LN1A 1KEEB 1F9EA 5JG7A 1EHCA 3Q3CA 5B6IA 1OY1A 3VR1A 1RYYA 4ETMA 2AL7A 1ORHA 2BDEA 4JBGA 2B6NA 3D9QX 4IDAA 3UK6A 4O4JF 4DNFA 3WO1A 4I1VA 1ZIDA 1YQTA 4JCCA 4JS0A 4R1MA 5EHXA 4QFBA 3KU4A 3TZKA 2XUDA 4X65B 3S2ZA 1RW4A 2KYRA 5JAZA 2Z8ZA 3TZCA 3QU7A 5L3SA 2CBZA 1YCFA 2L42A 1ESMA 2IYZA 1U9IA 2VWPA 3N07A 4LYAA 4PGMA 3MINA 3P71T 3LT2A 3PL1A 4KRFA 5D3KA 1JLLB 3JQ6A 4P34A 3H18A 3Q4GA 1ETHA 4L74A 3NTQA 4NBSA 1RZRD 1EB8A 1DEHA 1PJ3A 1PZEA 2GZ1A 3IERA 2FMIA 1XDSA 4JWKA 4QRDA 3RVNA 2P27A 5I51A 4JODA 3TE6A 3NUZA 1PNTA 2I4NA 2NTEA 3WGNA 2R8RA 4I1IA 4OB8A 4M9RA 4YRFA 1FTQA 4V0KA 5BWOA 5SZJA 2ZGVA 1GQOA 4LXQA 3PFIA 1VMAA 3FA2A 4B40A 1U8UA 1IATA 1ZKMA 3T3PB 5CDSA 1JG1A 1R66A 2EX1A 4TKLA 1SG9A 4EFNA 9ATCA 1M5RA 2PX5A 5A5VA 4HQ6A 2ZP1A 5K3DA 3O7MA 1YH3A 3IPYA 3HCPA 4UUQA 1DBSA 4D9FA 3OO0A 3RTAA 5CX4A 2HMWA 2O07A 3PZBA 4RHTA 4QQKA 5C1IA 4AAYA 5BNZA 5JHHB 2FWIA 1Q92A 4ZCRA 2RH4A 2HK8A 1SBIA 3R24A 3AM1A 1G9SA 4YONB 4LUCA 1GQYA 5EZYA 3RUEA 1P3DA 4EEXA 3BE6A 4MIYA 4MRMA 3D3WA 5ESWA 2NU8A 5DF1A 3KXIA 5TGTA 2Z6QA 2GETA 4PPGA 3WIDA 3O2JA 4QDUA 2I55A 2LP4Y 3H9EO 3O0DA 4CQNA 5AM4A 1MF7A 2Q3DA 1JQKA 2A3RA 4MUEA 5DGXA 3ITKA 3AKZA 3HKDB 3SNHA 3RSZA 2I6FA 1VB3A 3TJRA 4ZT3A 1FP2A 4WRRA 2Z5GA 5EMJA 2GK3A 5C9ZA 2V6IA 2CL0X 4ZT4A 1O0CA 3QFTA 1NIJA 2V6FA 2XQIA 4N7RA 1O7JA 1W46A 3CGWA 1HUQA 1VYHA 1OU4A 4HB2A 2O8CA 5IC6A 3KEMA 5FAXA 4DLRA 4DLNA 3VNUA 1P5ZB 1EU1A 3GGDA 4UAVA 4WERA 5I7FA 3FCAA 3DXXA 1JBKA 3EPKA 3INYA 4TRNA 4XH9B 2I1LA 1QGAA 1PK7A 1ZS9A 2E5FA 2H52A 2C7RA 1E1DA 1Z22A 1NNUA 2DKFA 4EPVA 2A0FA 4QOSA 2HT6A 1EM8A 4E0BA 5FUVA 1K5DA 3A14A 2WB2A 4WY8A 1FRZA 1FP7A 2AHRA 1I0LA 1ONNA 4S3MA 4OU4A 1QGUB 2Q0QA 1I3CA 2B0CA 2I7DA 2QG4A 3F9RA 5AW7A 4E33A 2XMDA 5J4KA 5KOHA 3LECA 1E0JA 3GYGA 2C5FA 3BMQA 1KMHA 4EFMA 5KTOA 3CWZA 4MMXB 3TAUA 1AVTA 5DHSA 3B1JA 2OXTA 4EATA 2NX2A 1BFDA 2LPMA 3F6PA 3LUAA 3JQ8A 4NS4A 4QOJA 3SXUA 2QDKA 2VP5A 3S1LA 1K27A 1XTIA 1DI0A 1EK0A 2XPCA 3TD2A 4DG5A 4LFAB 1IRXA 1U1GA 2EF1A 3ME5A 3GGGA 2GTPA 4ID9A 4IOMA 4K46A 4QQRA 3R5KA 5BO5A 3DKRA 5BV7A 1I9CA 2HHAA 1CBUA 4YWJA 5DBEX 1W88A 1C4KA 1BGXT 3ESYA 4K9DA 1LX7A 3KE9A 3PIIA 1HQKA 4KAFA 2ZI6A 4ZQGA 3RUPA 4DLVA 2VPZA 3FTEA 3Q3VA 4ARUA 4B17A 1U8TA 3BTUA 3E9ZA 1N3IA 3AVVA 1L5NA 4TV8F 3IKVA 1AHIA 1HBJA 4TROA 1RPNA 2VJKA 2W2OA 3F5FA 2F90A 5BRNA 3JYPA 4C0LA 1XLUA 4B85A 3V4ZA 3I28A 1IB6A 3OEWA 4A26A 2RH9B 5MN6A 2O59A 3R2JA 4R98A 4AX4A 1IOVA 4CCAA 3Q8XB 1IJBA 4X1IB 1XB2A 3KWMA 3K1YA 3QVGA 1EFUA 5I8ZA 1DAIA 1Q19A 2WK1A 3PPWA 4P4TA 3MELA 1Z33A 2PTHA 2B83A 2PPLA 4PX5A 3FPGA 4Y2YA 1T5SA 3W78A 3B85A 5I5EA 2XCTB 4DMMA 1CJTC 2Z2JA 4CKZA 4IV0A 4R31A 3JYNA 3I0MA 4IINA 2ZSKA 1O1YA 3HCDA 1X1BA 4CTOA 5JNWA 3UAWA 3G9XA 1HYQA 1Q0RA 2EW1A 3LCJA 1OAOA 1H93A 2YHSA 3OFNA 4ND3A 3ZDZB 1HY3A 2Q0SA 3SLGA 1UC8A 3JQBC 2EDAA 3O5AA 3TX6A 3CF0A 3E2PA 1J00A 1OLSB 1QJ4A 2BM9A 4HGYA 2VCYA 1BU8A 3FBTA 3S8MA 3ZBUA 4PYKA 5E4JA 3SCZA 4EB0A 2P78A 4YXFA 4R0NA 4AQYB 3EQ6A 5ADVA 1XVUA 1CB0A 4HDRA 1FFYA 1KK1A 4AKIA 2IDJA 2YWFA 2F8TA 5AQ1A 1E99A 1JR2A 1VHLA 2CVZA 3G9QA 1RI5A 4J2OA 1H66A 3LCCA 3KT6A 3R3HA 3KQHA 4ESEA 3MTDA 2NXNA 1NMQA 2X86A 4ZOLF 1PFUA 1QLJA 1MT0A 5ED0A 3SY8A 3WQQA 5ADUS 3DD5A 3QVTA 4MWSA 2HW8A 2HTEA 1YQDA 1V5IA 2O7VA 4MVJG 1Z4JA 1BNCA 5AP9A 4WESB 3IEMA 1HFJA 2PXAA 4YACA 2HQ1A 4TT8A 3GEPA 4M8KA 4HQFA 3DBHB 3QXHA 1FDIA 2C0PA 1LPAB 3EZGA 4GZLA 2YZGA 1N9KA 3E3MA 3IP3A 3WLHA 5ITZB 4DW8A 5JD4A 1DSSG 1X92A 4OGGA 3C5WP 2YY7A 4HGQA 2V7TA 4KFRA 4R54A 3IFSA 2CCGA 1I7NA 3T9DA 1N75A 4Y1EA 5JNRA 1QS0A 2AN3A 3T12A 1W4AA 2A5LA 3GOHA 1JZQA 4FHEA 5DHAA 5LZ2A 1EMDA 1L1RA 5F52A 5J1SB 2O2CA 4ID3A 5DVZA 1QDUA 1QRUA 3RRMA 3NV7A 4U7GA 4MCHA 1V16B 1DAGA 2O0KA 3AFNA 1P44A 3F1KA 4CM1A 2HYDA 1CERA 1F5NA 2XYPA 3JWHA 2JGRA 4IHAA 4HT3B 1D04A 4B3MB 1VIAA 1S5PA 4W5WA 5C32A 3EVAA 1BC5A 1ORWA 2FNAA 3LLUA 1TE2A 3O8DA 4EFKA 1NV9A 4DIUA 5F23A 1M2EA 5EJ6A 2WAAA 2HMUA 4H1UA 4MCAA 5LQRA 2EQ5A 1L7BA 1MEEA 3OIDA 2HLPA 1M2HA 1U9JA 1YI1A 4HDKA 3LDHA 1YOVA 4EG6A 3ANXA 3PQ2A 3CNHA 4H7PA 5FUBA 4C0XA 3RPEA 1MX9A 3QKRB 4DIKA 4QGSA 1WL8A 3Q88A 5FLEX 3FLEA 2ID9A 1Q0HA 1T8SA 1ZM4A 5BN4A 4UXJA 2GRUA 1MVLA 4IYRA 4J0IA 4RFSB 5P21A 4EAQA 2LUOA 3QE3A 1Z56C 4KO1S 4EGJA 1RAGA 3ECCA 4TTIA 2Y0BA 4KITB 4LGVA 1CZHA 2C92A 2AKAB 2J48A 4IGAA 2J4DA 2PRJA 2YBDA 3H5WA 3JTEA 5JAOA 3VKHA 3KWLA 5IKXA 2JB9A 4X71A 2A5DA 1F1JA 5FO1A 5FBLB 1VXOA 1NJ8A 4MB6A 2ZB2A 4X24A 5JD3A 1U81A 3HBAA 3AUAA 3WLKX 4CT5A 2E85A 3MEQA 1ZZEA 4X8LA 1C7ZA 1X7ZB 2OBFA 4IUCS 3JQQA 2YVAA 3TTXA 1D5CA 3E18A 3WL6A 1VLHA 3DLBA 5JSHA 1NURA 4CT0A 4AXXA 2BMDA 3KZNA 2RAPA 4ZOBA 1MEOA 5AVZA 5ALVA 4QPCA 1YJBA 3DMFA 2X8LA 3A4MA 2XRZA 5IVKA 3M6IA 4K40A 3K2BA 3ZJ4A 4CWAA 2HA2A 4F4CA 1FNDA 2A33A 1XN1A 4D3FA 1RLUA 4RMGA 1RXCA 4JN6B 4EG7A 3DAYA 3VNVA 1XCPA 4HF7A 2CVOA 3ESCA 2KMLA 3KE8A 2RGEA 2G6BA 2QAIA 3NCTA 2Z8YA 4K6GA 3PX7A 4DB4A 3PRYA 4QDKA 3A8TA 5EXSA 2H16A 2DM6A 3GNQA 5FNVA 2PKEA 1V7QA 1UZNA 3RQIA 1CLEA 4B6EA 4EG5A 2EW8A 5FNZA 4IF6A 3LBAA 3RS3A 2AJ8A 3KR0A 3FUTA 4M22A 3VDNB 1TX4B 5I48A 3RS9A 2J4CA 4MWBA 2RGNA 4L7VA 4KSYA 4D1YA 5IJWA 3M4YA 1B15A 5TQVA 5LQMA 2XZLA 3CH6A 4JAVC 1Z82A 3L0SA 5ECGC 1FMCA 5DM70 4Q05A 2QI9F 1BVRA 3ZWDA 4N6GA 1JKMA 3EGWA 3ZZUA 1C9YA 2XQGA 5AUOB 1OFUA 4BQOA 3BE8A 1FPQA 1ULBA 5KVCA 1XJCA 3NB0A 1N8NA 3AXSA 2AA3A 2AOUA 1GGMA 2UZ1A 4NONA 1P9OA 1YJAA 2R6AA 4B45A 4UEOA 3PDHA 2IH5A 1ZOLA 2IL1A 1RKVA 3A6ZA 3F8WA 2CZCA 5KWJA 4JI8B 3QXGA 1JLRA 1JKJA 2CDCA 4LBYA 1F6BA 4N48A 1VLMA 4LFCB 1XP8A 1N8SA 3NC0C 5TE9A 3UMSA 2BZ1A 3VKUA 3R3ZA 4BECA 4DSZA 5A6VA 3B9BA 2VSQA 3B2QA 3NFRA 5AHKA 2PUAA 2AB0A 4N3AA 1IULA 4LHEA 1J2RA 4PBRA 2WUFA 3CJQA 1SOAA 4JJ6A 4PYJA 4TTTS 4MGZR 2W00A 1OW3B 2VRCD 3CR7A 3U3DA 5TX7A 4NFLA 4C7OA 4E2ZA 1VSBA 4ZZIA 4FW9A 4JJ8A 1W5EA 5CM8B 1YO6A 3T3OA 1UK7A 2VF5X 4PFSA 3HA7A 3TSOA 1C9EA 5KHOC 3J81A 1O6BA 4F56A 3LD9A 4FDTA 2ZTSA 2ZIZA 1KEUA 2GVZC 2HLDA 2X5JO 4M6WB 1YZQA 3RFVA 2J30A 1Z8NA 1NQVA 3RRNA 2PG3A 2YJGA 3TR6A 5FPQA 1UJ6A 2JFBA 4M36A 1UMKA 2FR0A 1JAXA 1JEEA 1K89A 2EJWA 4MUBA 4HVAA 1MJHA 3DOIA 3EFOB 2OZLB 3LF2A 4JBHA 3ITDA 4TMYA 4XOIA 5LA6F 4YRKA 1ADYA 1H85A 5ADHA 3FWYA 4WUTA 3THXA 2HYIC 4OK3A 5ALLA 2ZZMA 5F5NA 4WXYB 1Y9JA 2XZDA 5JS7A 4POOA 1SXIA 5E8JA