2UZIR

Crystal structure of hras(g12v) - anti-ras fv complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumour Prevention by a Single Antibody Domain Targeting the Interaction of Signal Transduction Proteins with Ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uziR00
4M9ZA 2FDCA 2MSDB 1NG9A 5JBQA 1BMFD 4IDHA 2ZR7A 2H5EA 1GKUB 3KUCA 3ETLA 1YJ5A 1VG0B 2YOHA 3EIQA 4ZDWA 3K9HA 2ZE6A 1M6NA 4P0TA 5AUNB 4A0FA 3DPUA 3TBKA 1TUIA 4XWKA 1XXHE 2DWOA 4TLDA 1ZC3A 2E9SA 3CNOA 3CWQA 1S2MA 4ACBA 1GM5A 3HWSA 3RNLA 2P2LA 4MH0R 5DYGA 3CM0A 4I1UA 3WRXC 721PA 3FE2A 3EC1A 1NP6A 3L43A 2JLUA 1E2EA 4IW3B 2AK3A 3BC1A 4FCVA 3R9IA 3OIWA 3LY5A 2HLDD 1XMVA 2G0TA 5IHPA 2Q3FA 3SQWA 1YRBA 2V54A 3TW4A 4DDUA 1W47A 4LV6A 3SN6A 4G01B 3CW2A 3CR7A 1VTKA 4ON9A 4HUTA 1XCPA 1RFLA 2PBRA 3SJCA 4R2IA 2H17A 4H1VA 1X1SA 3AKYA 3TR0A 3U2QA 3GLIE 4QBFA 4EKDA 2PCLA 4HB2A 1JEDA 1A4RA 2QNRA 1A2KC 1KIMA 1E9EA 3TMKA 1XMJA 4BLTA 4TYPA 3B9PA 1XJCA 3K09C 2AWNA 2HXYA 5AK0A 1COWD 2ZSBA 3IBGA 2GJSA 1JAHA 3UATA 4PZZA 4C2TA 1QHXA 3E2IA 5EZ6B 3T15A 3U60B 1YRAA 1F3OA 4PZLA 4DC9A 3MWKA 2FPLA 2ZYTX 4JLMA 4KYUA 3HR8A 2MMCA 2V1XA 5FPSA 3SJBA 2HYDA 2OAQ1 3PITA 3X1WA 2Y8EA 2P5SA 3UIEA 2G0NA 1Q44A 1RVDA 1F48A 4NH0A 4LBVA 2B8TA 2CK3D 3FDIA 5LPNA 1KO1A 4QM7A 2X19A 3TE6A 1WE2A 2IEYA 2JLYA 2ZJ8A 1QDEA 5IT5A 2IS2A 4FD2A 4Q7JB 3SJZA 3ASZA 1UM8A 4Q21A 1ZD9A 4HATA 5DGXA 3ZZTA 2IS6A 3SYLA 2OFXA 2NMVA 3LX5A 2BJVA 1IN4A 2H16A 4KVAA 1DARA 4UXHA 3CRRA 1KI3A 2YVUA 4AIIA 1E9DA 5FBLB 1E1QA 3THXA 1U2RA 2QAGC 4LJ7A 3L0SA 3NBYC 1P72A 4NCKA 3I8XA 1W2HA 1KAOA 5TMPA 4GZLA 3L8YA 2CDNA 1MABA 2J46A 3N70A 1J7KA 1E2FA 3H84A 4MGKR 1R5NA 3W3ZB 3SS8A 3O8DA 5CB6A 3NHAA 4XVRA 1PJRA 4KYIB 4DWJA 2GKSA 1MV5A 4NHOA 1XEWX 3BB4A 3P1JA 1KKMA 2JDIA 2WMOB 3T5GA 4ZIRB 3LW7A 1FZQA 4MYUA 4MYHA 1HTWA 1GTVA 2G88A 2R6DA 3VNVA 4ZKEA 1LS6A 1II9A 4DT1B 1XBTA 3PEVA 5KOYA 3QI2A 4QJ4A 1VCIA 4MKFA 4Q19A 3EPJA 2SHKA 3BD9A 3WNCA 1Z63A 2WJGA 5KNCA 1OHHA 4JYCA 4CYMA 3BAFA 3D31A 3CH5A 4TL6A 3AVXA 3E70C 3WXMA 5J47A 3DL0A 2OBMA 2FGJA 2O8FA 1XXHA 2QAGB 1XMSA 1VG1A 2AFIE 2NO1A 4K8OA 5CIWA 5FPTA 3PG5A 3D8BA 3VHXA 4URXR 1D8TA 3ADDA 5FOVA 3K0AA 1E96A 1HA3A 3SHFA 2HT6A 3NC1C 4G5SA 1OXUA 1JALA 1VMAA 4WA7A 1GWNA 1Q20A 3NHBA 1M2OB 5FOXA 3V4RA 2QP4A 2O5VA 4TYNA 5AJVB 2Z6VA 2NO6A 1G291 2IT1A 4BLSA 3BOSA 3N2EA 3WHKA 1KYIA 4PC2A 2PMDA 2I4IA 1KK3A 3LDAA 1G41A 5KPDA 2PX0A 3GLFB 2VP6A 4DIDA 4Q4JB 4XVUA 1T0JB 4O0MA 2B7CA 2XTMA 3DZDA 4A0RA 2ODEA 3CONA 4XH9B 2EU8A 5EUQB 3GFOA 3AVTA 4FW9A 4Z8YA 3W9YA 2QG6A 2MMGA 2D7CA 4PFSA 1JXMA 2QPTA 1W0JD 2ZR0A 4QRHA 4DIEA 1K8RA 5B64A 1JJVA 1KY2A 1DS6A 3MJHA 4V0NA 3OFND 2W58A 4BRUA 3U3RA 2BM1A 1DAHA 1E2GA 2ZRGA 1NF3A 1JBKA 2FV8A 3KUDA 4V02A 3ZVMA 1D6JA 4LK2A 2FEOA 2XB2A 2HV8A 2RGCA 4MRRA 4M1OA 4GDFA 2G9NA 4JBYA 3LO5A 3P26A 1IN8A 3I4LA 2XOKD 5HZHA 1MT0A 1WRBA 4RFVA 3THWB 2WSSA 5JCZA 2HLDA 1ODFA 4YDHB 3SBEA 4E22A 3K70C 1AS3A 3H2YA 4FIDA 2AR7A 4JLPA 4XSHA 1N3BA 1YZTA 4ESVA 1O87A 3K0FB 4C0AC 3NBZC 2FSIA 2WKPA 4Q02A 3S1AB 1OT3A 2DPXA 2OE2A 3NDBB 1XPOA 1OIWA 2XXAB 4GP6A 3H4MA 2VP4A 1KMHA 3KKNA 1Z08A 1RRFA 3RLFA 3CH4B 4Q1EA 4BFWA 4D26A 2REBA 4C4PA 4D81A 5EJEA 2ZRBA 3UMFA 1HURA 3AUYA 1B0UA 2BWJA 1XPUA 3KKOA 2PMKA 1JR3D 4JLJA 4JKIA 4DB4A 2BCJQ 1E4VA 2F9MA 1E1RD 2X1VA 3IGFA 2JLWA 1DOAA 5K8IA 1Y63A 3MG9A 4F4IA 2FZ4A 3I1FA 1Z6TA 3G0HA 4I1SA 5DI9A 3VKGA 1TF5A 4L15A 5CIQA 3CF6R 3EIEA 4C7OA 3ZJYA 1YVDA 1KSFX 2XJ9A 1HT1E 3WNBA 4Z54A 1W36D 4AURA 1P61B 4A8JB 3FWYA 1SZPA 1NVUQ 2QPAA 4PPQA 5D3QA 1YHNA 3A4LA 1AS0A 2GZHA 1IXRC 3MLEA 2VLIA 5CLQA 3THXB 1KI7A 1G19A 4HDOB 1NIJA 4ARZA 2ZVQX 2ZVPX 3MRSA 1CRPA 2ZAMA 3NC0C 3O8BA 2OSBA 4XOIA 1OIXA 3ZZUA 3CNLA 3VHLB 3ZQJA 3PXGA 3SR0A 1L8QA 5FR2A 4B6EA 3ZQ6A 2Q9AA 2VTKA 3VNUA 4PXAA 4US2R 4LWZA 1CU1A 1OYWA 5EQTA 1HE8B 4K46A 5JJIA 1KK1A 2O8CB 1KI9A 5FUXA 1TQ2A 1CJMA 3SZRA 4DSOA 2GCOB 3LFUA 4DLZA 2O8EA 3LX8A 5E3HA 2BKEA 2JJ8A 1N0WA 2PLRA 2R2AA 2ZSEA 3GCGA 3BFVA 4NE2A 5KNBA 4CEIA 2J87A 4ERNA 3LW8A 5FBQB 2I3BA 2JDID 3KQUA 2XEXA 1CJVC 1P73A 3Q7QA 3MWLA 1OE0A 4RSGA 1G6HA 2J9RA 4OKSA 3TJZA 3QOFA 3ZH9B 5B57C 4ZCIA 1C9KA 3PUWA 1UKEA 3GLFE 4CEJB 1SHZA 3L2OB 1KO8A 3A8TA 4HLUC 1EGAA 1G8HA 3SI7A 5A5GA 2J0VA 1OXXK 3LBNA 4JZKA 4B3GA 2BMFA 4URYR 4JSYA 5DISB 2FMXA 4NP6A 1YKSA 4LPSA 2ZAOA 4P31A 4M0LA 2ATVA 2V7QD 2GJAA 2ZRFA 5JLJA 3A1VA 3CRMA 2FFBA 4M9XA 5FI1B 2ZM5A 221PA 2ZSFA 4EQ6B 2MSEB 4B44A 3IHLA 1BH2A 1E98A 1NKSA 2KWIA 1VCMA 3A4NA 3OAAA 5G3YA 5KSZA 2IF2A 3OESA 3FMIA 2BDTA 2W00A 1WBBA 1DTSA 4EPYA 2GXAA 1ANKA 2YC2C 3FKSA 3IQWA 3TR5A 4EPWA 5KHOC 1UBGA 1IHUA 2I1QA 5L3QA 2JAQA 4IOJA 1U94A 2W6JD 4N0EA 1R7RA 2EFCB 3JZMA 4XIGS 3RANA 1WDTA 4EJSB 1QHNA 2BEJA 4JBWA 4Q1CA 2B92A 2W2VA 3BH0A 4BFXA 3FMFA 3T1QA 3QBTA 1EK0A 1Z83A 4Q4HB 4Z8XA 2FFAA 4IVRA 3TUIC 4B3XA 2GK6A 1U8YA 2WWGA 5HTKA 2WJJA 2KE5A 5CJPA 3FMPB 4LJ6A 3IO5A 4Q4JA 4BWYA 4NYIR 3RS2A 2BHRA 2RGAA 2P65A 2ZITA 4PC3A 1UAAA 3QXCA 1JXOA 2AXNA 2NZJA 3A1TA 2ZQ5A 3V00A 2D62A 4HLUA 5BN4A 3TLXA 1NJFA 3C14C 4JBXA 3UMRA 2GJ8A 2Q0HA 1GG2A 3CZPA 4AG6A 2NPFA 1UEIA 5A0FA 4PO8A 2PL3A 2Q6TA 3ZZ0A 2O8EB 4FMDB 2C04A 1GSIA 3EZ7A 3Q3JB 5AJZA 2VF8A 1COWA 2GESA 4XJXA 1O3YA 2GTPA 3AV0B 3R7WB 4W5WA 2OBNA 4FMDF 4MITA 4Q1FA 1KNXA 3DEFA 4LC0A 4URUR 2ZS8A 2EYUA 3C16C 3RWMB 4KSCA 3HU3A 2F1RA 5TARA 4Q9JA 1JQLB 3T1OA 3RC8A 4GL2A 1XTQA 2CVHA 4A8JC 3WRYC 4H9GA 2QL6A 4OHXA 4PHFA 1R0WA 3B1WA 3DKPA 3B1VA 4OJKA 2QORA 3WBJA 2JLRA 5GJVC 1E2MA 1KJYA 3D6TB 4B35A 1DADA 4LBYA 1N5LA 3KB2A 4DB2A 3EAQA 1ZNYA 4PAOA 4RFSB 2O52A 4U02A 1W0KA 3VR1A 1G8GA 1MABB 5C46F 2XZOA 3C5CA 3QKSA 4Q4LA 2OLKA 1M7GA 2EWWA 3GLFA 1PZNA 3NBXX 1E2QA 1VCOA 5JWHA 5DH9A 2QM8A 4IKEA 4IOLA 1JR6A 4Q4AB 2N42A 4TLBA 3IIJA 5AR1A 5J4VA 3GLHA 2GILA 5H68A 2WSMA 1QHSA 1VHLA 2VHUA 3K8YA 2PCJA 4UJ5A 2J41A 3KXIA 3AVUA 3KB1A 1E9FA 4ARZB 1QVAA 1XD8A 1LS1A 3G82C 4AC9A 2J7KA 1XX6A 2ZYWX 3BJIC 1TPZA 3PFIA 4KFUA 4YMSA 3K1JA 5FBRB 2JGNA 2ZREA 4ILEA 3GFPA 1J8YF 1HE1C 4C0KA 2OUKA 2ZJ5A 2WIBA 4TZ0A 4N0DA 5B2ZA 4JLAA 5FR1A 1QHGA 1G17A 1Z07A 3PEUA 4HAYA 2FH5B 1CJUC 2WM9B 4PTLA 4U00A 3AUXA 1JQJC 5TY0A 1SHKA 2GVZC 2Z43A 4QHYA 5KDLA 4OI1A 3EWAA 4DDWA 2BVNA 2QMHA 3ZVRA 4NONA 2QTHA 2QM7A 4JMPA 3U3KA 5FTMA 4D4MA 3IIKA 3LH5A 1PVOA 3FFBA 5CLLA 3U3OA 5JS8A 3UPUA 1WBDA 4JL8A 4R2HA 2WIAA 4CIDA 3T1VA 1RC8A 1N6IA 1HQCA 2JLSA 4LRWA 3RVBA 5BN5A 2A3RA 3K70D 4EPTA 3LXXA 5JS7A 3CIOA 2VBCA 4OQLA 4XD7D 3RABA 3U7FB 1IY1A 5DHAA 3PIRA 2IS4A 5EE0A 3M4YA 1K6MA 2R62A 2PZFA 1T3SA 1TQ4A 2PT7A 4TYWA 4KFRA 4PPFA 5E7JA 1RZ3A 3IBYA 4KV9A 3ND9A 2OILA 1LFDB 5L3RA 3GP8A 3W90A 4ZDIA 2JLQA 2GAAA 2J1LA 3CO5A 4JLDA 3AVYA 3MUFA 4GSYA 4JLOA 4NPHA 1R0ZA 3HDTA 3K9NA 5LB2A 2WWIA 2FSFA 3D7MA 4DJTA 1N6OA 1NLFA 1W4BA 2ZJOA 4LJ9A 5EE1A 4IRUB 4QOSA 3EIHA 5IDVA 1X8LA 2RMKA 5TVKA 3U4QA 3WMEA 3X1ZA 2ZU6A 5F98A 5A4JA 1MO6A 4PX9A 4TTRA 1DG1G 3ZGXA 3QJYA 2R9VA 3SE0A 2QRZA 1R6BX 2V7QA 3DM9B 4YMTA 2BC9A 4KHZA 3UK6A 1AGRA 4F4JA 4OK6A 3RS4A 1HYQA 5B30A 4TLAA 2GJ9A 4BLOA 2QPOA 1OFIA 1QHHA 4OJQA 4PQFA 4CEJA 2AKYA 4DZZA 4JVNA 3KFXA 3C7KA 2EFDB 2IWRA 1OFTA 1QZXA 3B60A 4TT3A 2IYXA 4CEHB 1D2MA 3TVDA 1KZ7B 3VX3A 4NCIA 1N5KA 3LV8A 3CZQA 1LW7A 2A30A 4NYJR 1BMFA 3RC3A 3IQXA 1MO5A 4HAZA 4HB4A 4B3FX 4Q66C 1SXJD 3EA5A 5BWMA 4A2QA 3IEVA 2ZRNA 2IYVA 5K8LA 1II0A 2PT5A 3C41J 2AXPA 1GRNA 1KKLA 3OIYA 3RSLA 1JR3A 5G3ZA 1BKDR 4D4JA 2O8FB 1DPFA 1MH1A 1X86B 2RGGA 1G4UR 3NH6A 1KJWA 2QGNA 2YWGA 4DHEA 2F55A 2YINC 1U8ZA 4MGZR 3X1XA 2W83A 3THWA 3LQQA 4RD1A 2WAXA 1VDZA 2XTNA 4ZDJA 1MRNA 1SVOA 1RRGA 4B48A 2ZYUX 3OHMA 3REGA 2NO0A 2QT0A 2TMKA 1P9NA 1DG3A 2B21A 3AB3A 1KO5A 1P2VA 5AJWA 5IK2D 2J5XA 1LNZA 3KL4A 1W44A 1A1VA 4JLNA 1NN3A 1ZD8A 3K9LA 4E03A 1W4CA 1YE8A 3JVVA 5SZKB 1OB5A 1ZM4A 2EW1A 2GEUA 1DAKA 2P6RA 2J7PA 2QAGA 3FHOA 4G5RA 1P4SA 2C9CA 2WVJA 1V5WA 2W2XA 2CCKA 4G5OA 1U9IC 1ZCAA 2OG2A 3FHTA 5CK5A 2GWHA 3QIAA 3SBDA 2GETA 3PUZA 3B7GA 2WOJA 2VP5A 3CBQA 3MSXA 4P32A 5FFMA 2WWYA 1G18A 3ZLJA 1KI6B 5JHHB 1G3MA 1NSTA 4V0ME 4BEBA 3WY9A 2ODBA 1XMIA 4HLDA 1ZMXA 4BRWA 1QHHB 3AP3A 2DWPA 2P6NA 2QSYA 4A8JA 3AGPA 4L16A 2Q3HA 3N2IA 4ZCLA 1T4GA 1VECA 5EUMA 4CRWB 4DDVA 5FBWB 4TMKA 4DBLC 3OEED 3CWZA 1W1WA 2LCFA 3SFVA 4M53A 1FP6A 3I5XA 1FFHA 1XXHB 4G1UC 2WPDD 3DVLA 5BN3A 2FF7A 1G8PA 1T3LA 1SXJC 2KB0A 2OZEA 2YWEA 4LX0A 3T34A 4HDQB 2VF7A 3K09A 1E2PA 2CNWA 2NGRA 4M1WA 4AG5A 3R9WA 3KJGA 1M7HA 1VKJA 2REXB 4NL4H 3VR6A 1LVGA 3R20A 2RGNA 3GLIA 3AGQA 2IHYA 1DE0A 1DEKA 1E1RA 1HY3A 1NY5A 3HPRA 4PO1A 5E7MA 5FUWA 3EX7C 4CEHA 1Z8FA 2CCGA 3QE0A 1AJEA 4KLZA 1EFRD 3QPUA 3EPKA 3OAAD 1EFHA 4D0GA 2QROA 3PEWA 5JCPA 2QEQA 2C8VA 4QM6A 2ZJBA 3V4FA 1N25A 1OLOA 2V8OA 2CEAA 2VHTA 4BFVA 4LHYA 3VU9B 2VQSA 1G8FA 2Z4SA 4TQUS 3GLGA 2QP9X 3VX4A 1RPZA 3BH7A 4N3NA 1NMXA 3P27A 2JJ1D 4UQOA 3PJRA 1NRJB 2W6ID 3FYHA 4UNNA 5HE8A 2ECKA 2HCJB 4QG7A 2RCNA 3IHWA 4IDOA 4V0KA 4B2LA 1OFUX 2PX3A 4YMWA 2C03A 3LBHA 1Z28A 1LTQA 3GJ8A 1TEVA 3I61A 3OEHD 2QZ4A 2XJ4A 1N6PA 3TKLA 1NMYA 4TQAA 2FZLA 1NKTA 1Z0FA 2V4ZA 3DZ8A 4N1AA 2RB4A 1ZNXA 1CXZA 3MWYW 1GL9B 3BS4A 1RRCA 2ZRKA 1E9AA 2XITA 3ZS8A 4LY6A 4HUQB 1DVRA 2HJGA 4M1YA 2OAP1 5JFGA 4C3ZA 5L3VA 2ATXA 2H18A 1R10A 2RAPA 1PUJA 2ZI9A 5TB5A 5KTYA 4YDSA 4IEIA 3GQBA 1D9XA 2JASA 5HR5A 3LLMA 1XJ0A 5EP4A 2OESA 2QSZA 3NIBA 4DCSA 2IWHA 2I1VB 1KI4A 3TQCA 1YZNA 1F6BA 1ZIOA 2QTFA 4AWXA 4MRNA 5JSZA 4G3XA 2V6JA 1BOFA 5TV2A 4F91B 5H1YA 4MUAA 3UG7A 1G7RA 2GVDC 1DAFA 1EFTA 2G1KA 3VQTA 4QJ3A 1Z06A 1ZINA 1E69A 4M1KA 4Q1AA 2IUSA 1ZU5A 5ANRB 2R8RA 3DM5A 4F93B 4B75A 3SYKA 1AKYA 4TSFA 1KI1A 4R7ZA 1T91A 2PH1A 2WJVA 3QNUA 3NBFA 5DO9A 3M0EA 4Q9IA 2QT1A 4FXPA 4KVGA 1DO0A 1T0HB 2KSQA 3ZDQA 3IDQA 2GEVA 3IUYA 2F43A 2GZAA 3K0CA 1R0XA 4FWIB 4KODA 3B1XA 3GJ7A 3C5HA 2D7DA 2HDNB 2CBZA 1D2EA 4EPXA 4QKQA 1KI8A 1BYIA 1H8HD 4ZIRA 2VSOA 2GDJA 1A5TA 2ZR9A 4FMCF 3DMNA 2Z0MA 3ZD7A 4RZ2A 3NKVA 1H8EA 2IYUA 2XB4A 3C8UA 1NJGA 4MQBA 1WB9A 5DN6A 2CMKA 1Q1QA 2VP9A 1RE0A 3KKPA 3J81k 1YZLA 2BM0A 3NWJA 4KFTA 1NBMA 4B34A 4D0LB 4LGMA 2BJWA 1UBCA 2ZI5A 1ZD1A 4DDTA 5H70A 3U4QB 3EA0A 1BIFA 2JJ2A 3HPQA 4DSUA 3U3MA 3L82B 2H1LA 2GCNA 5CDFE 3KQKA 1UPTA 1L4YA 1Z0IA 4PPNA 3GJ0A 2BIFA 3I5YA 5G53C 4Q1DA 1AIPA 2NOAA 2X8AA 2GA8A 5FPHA 5DHFA 3Q5EA 3ECCA 5SZJA 2C9OA 4CF7A 1OH8A 4CEIB 4PC6A 3TH5A 2FSHA 3LVQE 8OHMA 2WICA 1J8MF 1Z0KA 2ZI4A 3WYAA 1GITA 2IUTA 1CR4A 4IEEA 5EXSA 821PA 2ZEJA 4M1TA 3CX7A 5K8UA 5KUTA 1D2NA 1OB2A 2UZIR 5HE9A 2QN6A 4YXWA 4TMXA 3IEUA 2OXCA 4PHGA 5DI3B 4BLQA 1SVLA 4TL7A 3F0TA 5GVSA 1XRJA 2GNOA 1GDDA 2ZANA 3HP1A 3LAWA 3BH6A 2OFOA 1KMQA 1S8FA 2XAUA 3LXRA 1XNJA 1UBEA 4V0LA 5FTKA 2CVFA 3MFYA 3LBIA 3SEAA 1D5CA 1XU4A 2DFNA 3ADKA 1S3SA 3L0PA 3B78A 4HDCA 4EQ6A 1EX7A 3O8CA 2IX3A 3TSWA 1GL7A 2AWOA 1U0HC 1XEXA 1GRQA 2X2FA 4M4SA 4QBHA 1ZIPA 3PUVA 4F38A 1T8TA 4QBGB 1RKBA 1QG4A 3KFVA 2BBOA 2HEIA 2CK3A 4LYHA 4BFTA 1W4AA 2GF9A 4KXFB 3O47A 1F2UB 1XDBA 2ZSDA 4OQFA 1HQYE 4MGIR 1UKVY 3CF2A 3CRVA 1XFAA 2OO7A 2WKRA 4IOMA 2Z83A 2QE7A 3LRPA 2BEKA 2F1IA 1VIYA 2NQ2C 2OXRA 1IJFA 3U7HB 2CNWD 2XNSA 4NMMA 1FW6A 1UDWA 2F6RA 4D6PA 5KDOA 1YQTA 1GNRA 3AF0A 1RJ9B 4Q5IA 2NO9A 3C4JA 4RJLA 4Q4AA 4B73A 2DFTA 3SDZA 1J70A 2OEPA 3HYRA 4Y0VA 5J40A 1VG9B 1MRSA 2A5DA 1E32A 3NDPA 1T5IA 1RRPA 4RD2A 4BGDA 3IKJA 5FTNA 2ORIA 4PAMA 4DUGD 2CHGA 3QF4A 4US0R 1ZM7A 1LB1B 1UDXA 4JLVA 4OHYA 2NZ8A 1S9DA 3Q5DA 1FUUA 1T9HA 3ZVNA 1E2KA 1SVWA 2HF8A 4DUGA 3WYGA 3BERA 3U44B 4G5QA 4POAA 4TMTA 2VO1A 5H8WA 1G3UA 3AF1A 1M74A 3WBKA 4EPVA 3BK7A 4XVQA 4GRAA 4D2IA 4U7DA 4DLTA 3IILA 1K5DA 3U7EB 4IHQA 3THYA 1E2IA 4RVCA 3U6BA 5GADl 1TMKA 2O0JA 6Q21A 4H1UA 2C78A 1KZGB 1KMHB 3RS0A 2H57A 2A2ZA 4LJAA 2ZS7A 1EXMA 4JVSB 1CIPA 4IJMA 2XX3A 5AUOB 1IQPA 2ZIAA 1Z0JA 4TMVA 4B32A 1S9HA 3VKWA 1WP9A 4QNMA 1CP2A 2WJYA 2QY9A 1RW4A 4C30A 3BB1A 3P20A 3BBPA 2WJHA 2WSSD 4HZUB 4M8NE 3B13B 4G0NA 1W5SA 1MOZA 3SJAA 1AKEA 2QMEA 2YKGA 5FI0B 4JSTA 3TAUA 3KX2A 1OIVA 5JI2E 2WTUA 2X2EA 1X8KA 3RS7A 1UF9A 1XEFA 3QKRA 2EVWX 2WMNB 4EJSC 3GLGB 1DBSA 1HEIA 4PZYA 1IXSB 4LDJA 4JVLA 4TL9A 2ORWA 2XSZA 2O8BB 1G4AE 4OHWA 3I62A 1IM2A 1CULC 1FNNA 4UXJA 1IN7A 1Z6YA 3AEZA 2EFEB 2WWHA 4LJ4A 5FL3A 4ABYA 1NY6A 4X8OA 3SC3A 1FPMA 4KLNA 2UKDA 3UKDA 1E9SA 1QHIA 1NN5A 2ONKA 3L0OA 4DT1A 4BFUA 3TW8B 2BBTA 4FINA 2ZS9A 3OE7D 4DLSA 4V0OA 3GJ6A 1QRAA 1W0KD 2AX4A 4W7SA 4Z51A 3U44A 2HCBA 1Q12A 2VEDA 4HZIA 4GNKA 1WCV1 1Q1BA 1YU9A 3FMOB 2O8BA 1JJ7A 2OT3B 2VIIA 3FKQA 4IXMA 4LBZA 3ZIAA 1XTIA 3MMPA 2O8DA 5HKKA 3QY0A 4IDNA 1SKYE 1CKEA 3B2EA 1GOTA 4US1R 1ZNZA 1G1MA 4PR0A 2XZLA 1CF4A 5CJ2A 4WXRA 2RGBA 2IK8A 1NN1A 4PQRA 4RFSA 4L9SA 2FNAA 1UKZA 4YXWD 3K53A 2AFHE 4GFDA 4DLYA 2PEYA 3JVUA 4WIAA 1JR3E 4PANA 4URZR 2ANCA 2VSFA 1OH7A 4P4UA 1E4YA 1UBFA 1ZRHA 2CJWA 1E99A 1N6KA 1JNYA 3V9PA 3OIUA 1DO2A 3CF0A 1TUEA 2RH5A 1BS1A 1P9WA 2QAJA 3PEYA 3GLHB 3T5DA 1S0UA 2A78A 2IYWA 4MUBA 3SNHA 2Q9CA 3FKSD 4LHWA 3W3AA 5F3WB 4IOKA 2FA9A 2IYSA 3EXAA 3KJIA 3S1AA 3VTKA 5JWOA 5JJKA 3EC2A 3LQRA 1CJTC 4NBSA 1SXJB 4MKIA 2RGXA 3REFA 5CM8B 2HYIC 1MO3A 2B8WA 4DCTA 1IBRA 3EG5A 2DY1A 2P0EA 2F1JA 3ONWA 1JAIA 5DE3A 3AVWA 4OI2A 3CRW1 1NVXQ 1W0JA 2OBLA 1OKKA 4XWOA 2W6IA 1E2NA 4JYBA 4BASA 2BBWA 1NL3A 3W6OA 4EUNA 4GP7A 5CB8A 3Q85A 2JIZD 5JSZB 1GAJA 1YZKA 4IFBA 2RHDA 4O2RA 1L2TA 3SHWA 4B33A 5JRZA 4U5XA 4NYIQ 1S1CA 4G5GA 1PLJA 1T8UA 3VR5A 3X1DA 2JIZA 1GFIA 1YR6A 1A7JA 3AVOA 1XTKA 3NEJA 1G7TA 5DSZA 2J45A 1YZQA 2YYZA 3WP1B 4C0JA 4BE7B 2QU8A 1P75A 1CS4C 2ZRIA 2CL7X 2IL1A 1G5TA 3KJEA 1UADA 3X1YA 5EZ5A 1Z47A 1KY3A 2HXSA 3B5JA 1XEXB 1VYTA 5EE9A 4KBFA 1EG7A 4YMUA 5C4MA 4TZ6A 1N5JA 2ERXA 3GJ4A 3F8TA 4LV8B 2WV9A 2X77A 3RS3A 5DIFA 3QEOA 3H0KA 2ZROA 5FL7A 5JHGB 4DLWA 4TTQA 4DLUA 4OK3A 5KU1A 3SYNA 2A7QA 4Q1BA 4MKHA 3BFKA 3A1WA 4A9AA 4DCNA 3I73A 1V43A 1XWIA 5TXGA 4RKEA 5FL7D 2AD5A 5DI3A 1E3MA 3AVPA 4KFSA 2DFKB 1J90A 2YV5A 3EASA 2E1RA 1I4DD 1ZVQA 3O8RA 1AGPA 2A9KA 1JI0A 1P62B 4D4LA 3GEIA 4CZ2A 3U61B 3GJXC 3OF5A 2FSGA 2R6GA 4ZPXA 2W0MA 1FQKA 5EE5B 5AUPB 1U0LA 4ZI3A 2G6BA 4PAQA 4BEJA 4GOJA 4Q9HA 5HZKA 1ZUNB 3CPEA 1T6NA 1G20E 3EZ2A 1AZSC 1GRRA 4MRSA 4TL8A 5LDDC 4EFNA 3AF4A 4BZPA 4GPTA 3RWOA 4KO8A 4HAUA 4W5JA 2DBYA 1R5OA 1M7BA 4UKDA 2RHMA 1XCGB 1I2DA 3GLHE 3SQXA 4X8HA 1Q1ZA 3VMFA 1N6NA 1GIAA 1SVIA 2EWVA 4II7A 3EPLA 1KDOA 1U0JA 2VL7A 1P7CA 2JEOA 4LJ8A 3HR7A 4HB3A 2VPPA 1GILA 2BCGY 4LC1A 1ZM9A 1VYVA 3WP0A 5IF9A 3OE7A 5J4YA 3A37A 1G21E 3T61A 1OYYA 1ESMA 4LYFA 2F1HA 1U8AA 2IA5A 3FTQA 3R9XA 1OF1A 4A4DA 4GBMA 1R4AA 5AWFC 4EIWA 2VH5R 3MD0A 5EXPA 1E0SA 2P6UA 3W34A 5ELXA 1ELOA 2QGZA 2IC5A 2Z4RA 4NYMR 5HKKD 3PUXA 2FJUA 4QGHA 4RZXA 2J7PD 4WBSA 2R44A 3UANA 2JLVA 4MA4A 2AHOA 3K0EA 5JMTA 4R98A 2F7SA 2VP2A 4RZUA 4YQFA 1R0YA 1ZUIA 3BB3A 1EESA 5KYKA 3NTUA 4TMZA 1F2UA 5AUQA 3CR8A 2J0UB 2YC4C 1AM4D 1E0AA 1TEXA 3D3QA 4DCVA 1MKYA 3QUSA 4FI3C 4UXIA 3GEEA 5FUYA 3QXSA 2VYFA 3LA6A 1G64A 1E0KA 1ZAKA 1IJEA 2DR3A 1KK0A 1KJZA 1W36B 5HPYB 2KJQA 4TYYA 4GI7A 4HLCA 5FTLA 3LD9A 3CNNA 3T35A 4IDQA 3L0IB 2FN4A 1Q0UA 5E95A 4B3DA 2CL6X 2DCUA 2NG1A 1G7CA 3THOA 4TTPA 4TYQA 5JEDA 1DAIA 4OQMA 5LD2B 1VHTA 2CJWB 1ZJ6A 3I32A 1E9CA 3ZIAD 4K81B 2J0UA 4BUJA 1R5BA 1II8A 1ZP6A 4JLBA 5SZIA 1FX0A 1G6OA 1OSNA 2CLCX 4PHTA 2GXQA 1CBUA 2NPIA 1GKIA 4OQXA 4TLEA 1K5GA 2G1JA 4OYHA 2XGJA 1OXTA 3A4MA 3QKRB 1ZW6A 3MGCA 3KKMA 3B9QA 4GT1A 1P2TA 2A5GA 2AK2A 1E1QD 1YZUA 4P3YA 3K70B 1P2UA 4WAUA 4Q47A 4Z1MA 2J3EA 2DHRA 2DWQA 2CLDX 2IHBA 2L0XA 3QKUA 4MYTA 4QGGA 4TT3D 1U9IA 4Q7LA 1X1RA 2W0SA 1LF5A 4IDPA 2FFHA 3U6KA 2CXXA 3BXZA 2GBLA 4LSGA 4S35A 1TU3A 2JATA 1OXSC 3EW9A 4ZV4A 1M1YE 3KKQA 1C1YA 2OCPA 3ADCA 2FPMA 1EWRA 3LVRE 4MRVA 2QE7D 1U90A 2IYRA 4C0SA 4C7OB 3SU8A 2KBEA 4LZZA 2WPDA 1Y3AA 4X8MA 3GFTA 3KXKA 3PUYA 4LUCA 5GJWC 3QQ5A 4EPRA 4ZDKA 4LCBA 1SKQA 5BW8A 1XTSA 4DSNA 2C98A 2DFLA 4WVFA 3TGPA 3M1IA 1GKYA 2IYTA 1JPJA 5J4LA 4M2LA 2PJRA 3A58B 3LNCA 1XP8A 4JL5A 5C2JB 1P2SA 1ZC4A 4Q01A 5K8TA 1AQYA 2FGKA 3CUEF 1M34E 2H7VA 2IEZA 4XD7A 3WMFA 2ZE7A 1AZTA 1G3RA 1FNMA 3AQ4A 2IXGA 2QA5A 4JVMA 2V1UA 1XZQA 1JPNA 3QVVA 5FUVA 1D9ZA 2ZUCA 2IUUA 3R7WA 5JI3E 5IK2A 1N6LA 4NZYA 3K0AB 5D3MA 4X8LA 1ZCBA 3VR3A 3ICQB 1F5NA 3QKSB 3TVTA 2R65A 1XPRA 5M04A 1S3GA 3NVAA 3CRQA 1E9RA 3GJ5A 4WZBE 2D3WA 3PR1A 3IPYA 1GVNB 4PSKA 4HB0A 2V6IA 4B2PA 1E79A 1QF9A 2D2EA 3AP2A 3QF7A 2WZQA 1TX4B 4QL3A 1JB1A 1Z0DA 4D4KA 3AM1A 4J0QA 4AI6A 2XTZA 2ZRAA 3CPHA 2QMOA 1E2LA 4LOAA 3B8HA 1OPXA 1XEWY 1GUAA 1EFCA 1IXZA 1S1MA 4I99A 4AKIA 2BKUA 3TK1A 5JRJA 2FFQA 4RCZA 2ZRPA 4FMBB 1II8B 5FTJA 2QBYB 3FHCB 2ANBA 3CB4A 3U3JA 3VR4A 4KAXA 4LHXA 5JZVA 4QGFA 1VCNA 3QVUA 3RRNA 1KI2A 4A2WA 4DVGA 4NCHA 5FPYA 4NCNA 2ZRMA 5KSOA 5E7IA 4EAQA 1MR3F 1KAGA 2NIPA 3AF3A 3W6PA 4A0GA 4E07A 1SKYB 2F43B 3F5FA 2CHVA 3TSZA 1NBMD 4JKYA 4JT4A 3BORA 4UNRA 4URVR 5FOSA 1FMJA 4LBWA 1N0VC 4AYTA 4ESHA 3ND8A 3KZ1E 2IS1A 1T3HA 2EFHB 4ASUA 4PC1A 2WAYA 2OM2A 2ZJYA 2ZRLA 4Q7KA 4MDFA 4HAXA 4Q4HA 5KDDA 3T1TA 1YR9A 1HUQA 1OJLA 2ZRDA 4PQYA 2XZPA 2LKCA 3PVSA 1OW3B 5LB4A 1ESNA 3TUZC 3QG5A 2QTVB 2REOA 2Q21A 5EP3A 2QQ0A 2H92A 2C9YA 3RHFA 2CHQA 4HAVA 3TNFA 4LJ5A 1E6CA 3WYFA 4L8GA 5DYIA 4YC7A 3M6AA 1FUKA 4BPBA 2IBMA 5DNYB 4B47A 2GK7A 3B85A 3ASYA 1AK2A 5JEEA 4F92B 4MKGA 1NLZA 2O8DB 1G7SA 1KHTA 4HSEA 1W4RA 4QHSA 4W9MC 4OHZA 1OH5A 2OCYC 5DLQC 3B6EA 1RYFA 1TU4A 4M9QA 2AN9A 4NYJQ 5L8VA 3QXJA 3MCAA 3A1UA 4HEJA 3E5HA 5EP1A 1QBKC 1KDRA 2ODNA 5KNDA 3W8NA 3AKCA 1Z6XA 2EYQA 1VPLA 2ZTSA 3GLIB 2VHQA 5JJLA 4GMDA 4MGYR 1DAGA 3CX8A 2OFWA 4GZMA 5G40A 4Q00A 4FN5A 1XCMA 1TQ6A 4I1VA 3UMSA 1F2TA 4YMVA 1Q3TA 3T06B 1BYUA 3U5ZB 1Q57A 5CITA 3VU9A 1H65A 4E5UA 4A36A 1RIFA 2GCOA 1N0UA 2YWHA 4M1SA 5TDHA 3QSYA 4O3MA 4YLGA 1R8QA 4UNQA 4AYXA 3CPJB 1KOFA 3E1SA 4WZAE 5FOTA 2PZEA 2BMDA 3WHLA 2VRWA 3OEHA 5JECA 4KJZA 1FL9A 4B2IA 2CE7A 2IW3A 3QPWA 3TUJC 1KDPA 1PV4A 1IONA 1B23P 4P4SB 2YHSA 4TSFD 1ZNWA 4Z1MD 1YR7A 1E2JA 2IYLD 5AJYA 1W46A 3F3YA 2OHFA 3OIVA 2CL0X 3IPXA 1F2TB 4R71A 4HZUA 1EFRA 2FG5A 2DB3A 1TL7C 4Q7MB 1W49A 2QI9C 1NVVR 2OV2A 3N5CA 4RD6A 2ONJA 5HCIA 5B58C 2C77A 4A92A 3KTAA 3SOPA 5SZHB 1ONBA 4HYYA 1ETUA 3B82A 1ZM2A 3KQNA 5L3SA 2J0QA 4KITB 1XTJA 1Z29A 1VG8A 4DXAA 1RYHA 4QHTA 3UWKA 4ITRC 3G5UA 1P6XA 4B76A 4A6XA 4A0HA 3QF4B 4IVPA 1N6HA 1Q22A 4S2EA 3ZVLA 4NTZA 1QHYA 5HCNA 1Q21A 2LWIA 1TQDA 1AQUA 2QMUA 2HJVA 2PZGA 3QXXA 2ZXUA 2JA1A 1PUIA 1I4LD 3LWNA 1X3SA 1WXQA 5FH9A 1SVKA 4IVQA 5J4HA 1E79D 2VP0A 2KI5A 1VIAA 2C5LA 1HV8A 2OLJA 2VHJA 1BO6A 2QRNA 1KO4A 1NI3A 2AKAB 4RKFA 1WA5A 4BZQA 4A15A 4C2UA 3MAAC 1Z22A 4ZI2A 4MDEA 4URWR 2IYZA 4PHHA 5G41A 3HYTA 4AYWA 1AA9A 1UJ2A 1UKYA 4OI4A 4FCTA 4OI0A 3B1YA 4TLCA 1N2CE 1CLUA 2PJZA 4TWZA 3W8RA 1J99A 3FVQA 2B7BA 2JLZA 2E87A 4JS0A 2ZRCA 4P33A 2ZUDA 1MO4A 521PA 1W5TA 4CT5A 5DN6D 5P21A 3ZYCA 3FPAA 2W6JA 3NG1A 1EFUA 1I4TD 1Z2AA 1LY1A 1M8PA 3MWJA 2QUZA 4HLQB 4E09A 2FU5C 3AH8A 4KI0A 1R2QA 1S96A 4D82A 1DAEA 2UZ3A 2ZI3A 3DDCA 4P4SA 4A6PA 3LLUA 4UJ3A 2WWXA 4HI0E 421PA 2G77B 4L5BA 2RGEA 2RGNC 4DLRA 1GNQA 1TF7A 121PA 4WW0A 2A5JA 3X2SA 2EQBA 2A5YB 4Q9KA 4EFLA 3MJRA 3GPLA 3L8ZA 4RCYA 1W48A 2ORVA 4L9WA 3FOZA 5L3SB 1P60A 1L7VC 1QVRA 2YNMA 3Q8XB 2W2TA 2JCSA 3RDPA 2FOLA 5AJXA 3KDSE 5EXXA 3RSOA 3K0SA 1ZBDA 2C96A 4JIMA 3FB4A 3CX6A 3EZFA 4M21A 2GRJA 3IO3A 3TAHA 3BFXA 4AK9A 1NVVQ 4V03A 4GOXA 2ZETA 5KSPA 2ZSAA 1NIPA 3HU2A 3EZ6A 2FWRA 1TTTA 3B1ZA 4HUQA 4PSVA 3WMGA 1KNQA 4DLXA 2EFGA 1C4OA 1FOEB 3I8SA 1P3JA 1E9BA 1NLYA 4WOPA 4ZCMA 3QPVA 4O25A 1Z3IX 2GXUA 5EP2A 1US8A 2ZE8A 4DEYA 4QJ5A 1E2DA 1Q3HA 1SULA 1YR8A 5FBVB 2AD1A 2BMJA 2WBLC 1GNPA 1G9XA 3QENA 2Z5FA 2QENA 4EJSA 2F3RA 3UXMA 3UWOA 4B6FA 2F9LA 3DOFA 2BBSA 2XNDA 1XJQA 3KQLA 4MYCA 3EWSA 1KO7A 1IOZA 1P5ZB 3A36A 2IXFA 2HF9A 1E2HA 3OEEA 4Q9LA 3RRMA 2IF0A 1CEEA 2YWFA 2ASEA 2OCBA 4XSGA 2KBFA 5F2EA 2N1BA 5F9HA 1FP7A 2ZE5A 1IN6A 3H1TA 3VR2A 1FMLA 2ZU0C 1DAMA 3TQFA 5D3MB 1QG2A 3GJ3A 1TADA 2WJIA 1OHHD 3K0FA 3Q7PA 2P3SA 4DSTA 1FTSA 1OKKD 1ZM3A 3AVVA 1X8JA 4LYJA 1KSGA 3QBVA 1Z5ZA 4M22A 4B74A 2WWWA 4RZ3A 3OZXA 4QFMA 2O0KA 4A2PA 1NSFA 1CR0A 2V55B 4QGAA 1A82A 4CT4B 4AY2A 1G5RA 4OQNA 3FGNA 4AKHA 4BECA 3DHWC 4B3BA 1GZSA 4ACAA 1KDTA 5C4GB 4DCUA 1OH6A 1CRQA 2DYKA 3H86A 3I3SR 1SVSA 2K5UA 2C99A 1KI6A 5GVRA 3WNDA 4TN1A 3CKLA 4C0HA 4DRZA 3JZAA 4ZO4A 1G16A 1XZPA 3EARA 5CM9C 3ICEA 1FTNA 4PC7A 1H8HA 4NKRA 5UKDA 4R9UC 1P9RA 2ZYVX 4M1MA 1XB2A 2CLSA 4FCWA 3W6NA 4CGZA 5KSYA 4OK5A 1XD9A 1TF2A 3PENA 621PA 4AKGA 3I92A 1AN0A 1NMZA 5CK4A 2GEDA 2BV3A 1I2MA 1NG1A 1U98A 1JECA 4PPGA 2WOOA 4KU4A 4PSAA 2GHIA 2J0SA 1SGWA 4IXNA 5LBIA 1NNEA 3A6PC 3BE4A 3EZ9A 1SQ5A 1DELA 1G8YA 1E0JA 3AP1A 4NDZA 3SFZA 3I72A 4F7WA 2C2HA 1KGDA 4LJYA 1CR2A 4ZKDA 4OBEA 2BOVA 2GAOA 1N6RA 2GCPA 2FEMA 3RS5A 4B71A 5C1BA 4I4LA 1AS2A 1EX6A 1NN0A 1SXJE 3W5JA 1TNDA 1OXVA 2WKQA 4BQSA 4BFYA 1T5LA 5C18A 1W2GA 2WWFA 3ZS9A 2MSCB 4I1OA 4BZXA 3DOEA 1U99A 3PV0A 1IY2A 3TIFA 1FQJA 3RYTC 3U7GA 1OFHA 1KTVA 2D2FA 3A1SA 4CW7A 2ZRHA 2WHXA 1W36C 4EFMA 4D25A 2JJ1A 4BLRA 3EPHA 3FFAA 3KTAB 2ZJAA 2FPKA 2VSXA 2YOGA 4D0NA 3IIMA 5BYKA 3P32A 1E94E 4HAWA 4Q48A 2R6CA 4KSBA 4Q03A 3TRFA 1WF3A 4LYAA 5KO2A 4GOKA 4JLKA 3C15C 2IYYA 2ZI7A 1JEEA 1CJKC 1N5IA 1XD2B 2C95A 1ZUHA 2XOKA 1CTQA 2YZ2A 5FOWA 3CLVA 4MRPA 2QBYA 3P4YA 4GMXA 4TQ9A 3VKHA 3HU1A 3KJHA 3BIFA 2GXSA 2ZPTX 5GJCA 5IRCD 3OFNA 3TSOA 2N46A 2PLFA 4FMCB 4JT2A 4XTRA 3W5IA 4LI0A 3VFDA 1J2JA 3QXHA 1U81A 2HUPA 2R6FA 3AVQA 1GL6A 4KCGA 2IYQA 1IY0A 4D80A 2D06A 1H8ED 1RJ9A 3RAPR 3DKVA 1XD2A 5EE3A 4BLPA 3Q9LA 4L4UA 4A82A 1WQ1R 5BQ5A 2H8KA 2OCAA 2ZRJA 3K0CC 1F60A 4JJKA 4UNSA 1LF0A 1OV4A 1US8B 2ERYA 2F3TA 2IXEA 5CYPA 2JJ2D 5CYOA 1KSHA 4AD8A 4C9BA 3GLGE 1XF9A 2GBLC 2V3CC 3GD7A 3T12A 1X6VA 4V0MA 4RD0A 3BGWA 3NEYA 5JWRA 2UVQA 2D4HA 1FX0B 4LV5B 2FX3A 4RD4A 5GJBA 1A2BA 2P5TB 4UNPA 1HH4A 4LHZA 4W5HA 2D74A 2QP3A 4F4CA 4LHVA 3AKDA 2RKOA 3ADBA 4JJZA 1ZU4A 1NBME 3AF2A 5KPJA 5FOUA 5L3QB 3Q72A 1GP2A 3BRWD 1UFQA 1CR1A 4TMWA 5E4FA 5CDFA 4B3CA 1Z2CA 3VAAA 4PO9A 3GEHA 2LKDA 4DEXA 1IAQA 4Q18A 4OHVA 5J5CA 4O2LA 3K9GA 4LPKA 4P4TA 4Y0AA 2P67A 1YZGA 4QBIA 3QEJA 4ASUD 4NCJA 1Q1EA 5BXQC 1UEJA 3KXLA 1PLLA 4IFEA 2VA8A 2Q9BA 2VHCA 3RRYA 2JLXA 4NU0A 3PCRB 2A5FA 2ZUBA 3HJNA 1NVWQ 1L4UA 2R6AA 1G3QA 2GZDA 5EXTA 1SVMA 4C0LA 2BMEA 5FPKA 4YONB 2XNDD 4QNRA 4XTCS 3THYB 3UG6A 4WZ6A 4QC2A 3DO6A 1PLKA 3KQHA 3BWDD 1W7AA 1VYUA 2B6HA 3QKTA 4BFZA 3RRZA 5F9FA 4FWTA 5LD2C 1WMSA 4C0QC 4CVNA 2O0HA 2HT1A 2CCJA 1ZYUA 1KK2A 2AL7A 2QQEA 4BFSA 4DLVA 1XTRA 2ZI6A 1HT2E 4I81A 2Q3MA 2CE2X 4JL6A 1SXJA 4XWAA 1G3IA 3NH9A 4A1FA 4DKXA 2O8CA 2J59A 4CDGA 1IN5A 2XSZD 1Z0AA 2ODWA 2GJKA 3AKEA 2FE4A 1TAGA 2YOFA 3DMDA 2ZJZA 2NO7A 1LV7A 2NTYC 4M9SA 1R8SA 1EWQA 4RD3A 4NYMQ 4QXAA 2G3YA 4C0BA 1KSJA 2ZJ2A 2RGDA 3QG1A 3P4XA 3PQCA 2PEZA 2GF0A 4KBGA 3R8FA 4WXPA 3ZD6A 1Z6GA 1G5PA 2YJTD 5BYJA 1S4QA 3GMTA 4AKEA 4RY2A 2XXAA 2V9PA 4OL0A 3NXSA 4B43A 1Z6AA 4EDHA 5J4KA 3R8CA 2G83A
chains in the Genus database with same CATH superfamily
3P0RA 2QN7A 1KPIA 1QYIA 1BMFD 3SIWA 2ZR7A 1ZCZA 3GEGA 1E0DA 3KUCA 3MUEA 5FNVB 4EARA 4DV0B 4BV8A 1N5MA 3K9HA 1H4TA 4OMFG 3B12A 3NPMA 2I1LA 3GPIA 3HRHA 3TQQA 3VU0A 1JVBA 1XXHE 1KEKA 5A9TA 1VRCA 4EI2A 9LDBA 3QEMA 3VI3B 3VPAA 2PDAA 3JQRA 1VFNA 2P2LA 4KQIA 2PYIA 1LK0A 5DYGA 5CLJA 4Q3DA 1T8YA 1NSYA 1RYZA 2BFBB 721PA 3O7MA 1UWVA 3JQBA 5CLHA 3CT6A 5IDWA 4F6RA 3IVXA 1SQ0A 4C7BA 1RI2A 2BSQA 5E3IA 2HLDD 4H17A 5IJ0A 2HU8A 4R3NA 2Y1GA 1YRBA 9MHTA 1PYOA 3QTTA 4JKOA 4QBTA 4ZOCA 4YPVA 3P9RA 4FGKA 2QGFA 3AFHA 2OMKA 1O2DA 3KD3A 2J85A 4NC9A 5D51S 3CR7A 1UAGA 4U5QA 3IDAA 1VTKA 5D3KA 5EIBC 4GMHA 1L9XA 3GY0A 5DTRA 3ZLUA 3V7YA 3QU9A 1QX3A 4EELA 4HUTA 4NV0A 2AE2A 5GIPE 2KW5A 1F4PA 2J9FB 2Q2OA 4WKNA 3WV4A 4AJIA 5IZCC 1X1SA 3AKYA 3TGPA 3U2QA 1E61A 3RRFA 4EKDA 4RF2A 5FV4A 4PG4A 3INNA 3ML1A 5FT9A 1W1UA 3HKDB 1A2KC 1E9EA 2HF7A 3NM4A 5L4LA 2B35A 1TB4A 4F2GA 2X7HA 1GO2A 3B9PA 3KVNA 4KOEC 3K09C 5C1PA 5AK0A 3TRJA 2HB6A 4EJ6A 1CY1A 2ZSBA 4J0JA 1QV7A 4X6UA 3UATA 2WJ3A 1F14A 3D6UA 2I9KA 3OMLA 1EBFA 4G1FA 1V4VA 3VPSA 4RK0A 1F3OA 2QD4A 1FYWA 3P2YA 1UZUA 4MUMA 3WYBA 1SOWA 1XMXA 4YV0A 3HP7A 3K5IA 3OKAA 1JP7A 2ZYTX 3IDSA 5IKEA 5IJWA 1WDMA 4NBWA 1U1FA 1E7RA 3HR8A 5KKAA 3U80A 5I7AA 3VC2A 4HVTA 3SJBA 5JAPA 1C4XA 2OAQ1 4K6KA 5CYGA 3GJZA 4W9RA 3X1WA 2O5EA 2XCSB 2G0NA 4JQCA 1I7DA 2PK3A 4R2WA 1F48A 2VPIA 1TM3E 3L4EA 1E5LA 3HYSA 2VAVA 3GOHA 4DMCA 3A9WA 4OL9A 4WXEA 3GH3A 4H60A 2XYPA 3TE6A 2Z57A 2IEYA 4F8YA 3VZCA 1NQAO 4X93A 3CW9A 2JD0A 3KZKA 3AEXA 3E8SA 4X41A 1K8ZB 2PMFA 4Q7JB 3UY4A 3QMWA 5TQ0A 3ASZA 1PR6A 2B99A 4Z4HA 1XK7A 5T67A 2FPWA 1GGNA 3GLQA 5DYYA 3SYLA 4CR8A 2L82A 5C7LO 2GHTA 4JXKA 4D9EA 3IJRA 5BSFA 5AW6A 1A76A 1IN4A 1TM7E 1YQGA 1C80A 4AMGA 4KVAA 2QVCA 2EF0A 4UXHA 5F23A 4W5TA 3CRRA 4DREA 1KI3A 3I5UA 4R01A 4YT4A 5FBLB 2VKQA 2QAGC 3N0VA 4LJ7A 3L0SA 1I10A 3T0GA 4D02A 3DEIA 4OUDB 3I8XA 3ZK9A 2VXYA 1KAOA 2BHNA 3UOWA 4HDMA 1YGYA 3FWZA 3N70A 1RLOA 1TT7A 2Y9PB 4MGKR 5HG0A 3RE1A 4BWVA 1R5NA 4WY2A 1KZ6A 3SS8A 2O19A 4J76A 1NQWA 3VJLA 4YTEA 2JANA 1N2CB 1XEWX 3BB4A 3P1JA 1NVTA 4TVOA 1C3VA 5SY9A 3S2FA 4FZRA 2WUGA 3RSQA 3T5GA 4ND4A 1V37A 1K75A 1YK0A 2ZWVA 5CNMA 5CP8A 3COZA 5B3AA 3LZCA 3T38A 4BVLA 1CNMA 4QD3A 2N1MA 1GTVA 1YFZA 3E1KA 4G1CA 4RS4A 1II9A 2V0CA 3PEVA 1T1JA 4J16C 2CYCA 3DB1A 4QJ4A 1SZDA 4LWQA 3AY7A 3W0LB 4Q19A 1Z63A 3WNVA 3H9EO 3L1JA 1XK6A 2ZP1A 3T3MB 1I2CA 3HKBA 3DL0A 1DZ3A 3LOQA 2A58A 2ICAA 3BA6A 1JH8A 2OBMA 1U3UA 1XXHA 2QAGB 4F3KA 5BR4A 2XE7A 2AFIE 2ZBEA 3GG2A 4M0DA 5CIWA 1T34A 1XZCA 3PG5A 1EM8A 1B42A 1MHPA 1RR6A 3T7AA 1XQWA 3OX2A 1WTCA 1K5PA 4EW1A 1TPYA 4JJ8A 1E96A 3OOJA 5JQGA 2MR6A 4JEHA 4S2UA 2PQMA 2AVNA 1OLXB 1H3NA 4OTZA 3T9EA 3VR5D 1OVGA 4PYLA 3CF4G 1OXUA 4MWZA 3U0VA 5BNFA 2OM6A 4W8OA 3FWKA 3V4RA 1Q0TA 2ACVA 2QP4A 3L0DA 4G8BA 1RJFA 1Z18A 1KF0A 4WSOA 1AHNA 2IT1A 4FNGA 5IT4A 3CKYA 5IABA 1C8KA 3NRCA 4FC6A 4PLFA 5DNAA 1A9OA 5C51B 1B74A 1KK3A 3WLTA 4ZHQA 4UUNA 5FWDA 1DLIA 2PX0A 4F5ZA 3D3WB 3RJ9A 2L19A 1TE2A 4F72A 1EFKA 4O0MA 2GRAA 2YJ5A 1L5HB 4H6PA 4TUYF 3ROTA 3QGMA 2ODEA 1ZD2P 2PM8A 1WJGA 3OWXA 3VNAA 5JNSA 1WSWA 2EU8A 3FDZA 3GFOA 4UAVA 5EUQB 1JX6A 2ZB3A 4FW9A 3G8YA 5FUMA 2R66A 4OU4A 4D9GA 3BXEA 2QG6A 5A3VA 2NUAB 1ACLA 2DOKA 1YR2A 2QPTA 2YXPX 3CTMA 4MWTA 2OYCA 1GCUA 1JJVA 2ZCUA 4PSCA 1KY2A 5GV7A 1DS6A 5A2QA 5KTTA 4FSHA 1MJFA 3FPGA 4QFDA 2JFNA 1UXKA 2JIBA 5HUJA 1V9SA 3UA4A 1E2GA 2P4SA 3S6JA 3ZVMA 1REQA 1I7NA 2Y77A 3GBSA 2XB2A 4EG0A 1YCGA 4MRRA 4ZO7A 4JBYA 1W5AA 4LXGA 3P26A 1F1JA 3EIOA 3S99A 5IPFA 2XOKD 3JATB 5HZHA 5KTRA 1FIUA 2BGMA 4O4IF 3K70C 4E22A 4TXMA 4NFSA 1NW5A 1T8WA 3CUKA 3H2YA 3HSKA 3OFJA 4FIDA 4XSHA 3SLKA 1LQ2A 3UB2A 4Z4CA 3EVGA 1O87A 3DE0X 3QTBA 4YQZA 4HWPA 5HRAA 3PX7A 1H66A 2LDXA 2JGKA 4C0AC 3RU2A 4BJHB 2JC3A 2RK6A 1ESDA 2HMWA 1NE7A 2OE2A 3KPYA 4Q4DA 1TK3A 1XIVA 4F45A 4ALLA 3H4MA 4K6GA 2IOHA 3CH4B 3HY4A 4ZYLA 4QEZA 1DC3A 4IKPA 2NVUA 3VO9A 5I4CA 2ZRBA 3FJ1A 4TV8A 5C7YA 1RXWA 4HP8A 2PMKA 2WEKA 1JR3D 1WKVA 2TMDA 4ND2A 2C84A 1LRLA 4DSZA 1E4VA 1UWLA 2X1VA 2AQKA 1Y63A 3MG9A 4F4IA 2FZ4A 1JA1A 2JHGA 3G2IA 5HILA 1LC3A 1IH8A 2FKAA 1Y7PA 3I6BA 1TF5A 3MCWA 3BDAA 3AWDA 2ISCA 4L15A 1PYGA 3ZJYA 2J67A 1YVDA 3QKIA 2IW1A 3FNIA 1WP4A 2XJ9A 3O94A 4WERA 1HT1E 4Z54A 3FZYA 5JAHA 1EZZA 1Q0SA 4FE7A 4PGGA 4PPQA 4Q9NA 1YHNA 3A4LA 1AS0A 5CLQA 2VLIA 1H05A 3IT1A 2ONZA 2ZTHA 1JS1X 3AHEA 2NTJA 3JQGB 4HDOB 3UHFA 2ZVQX 4UM5A 3QA3E 3O8BA 3ORYA 2I99A 3QA9A 1N32B 1GJRA 4O4HA 1C0IA 3ZZUA 1YIAA 3ZD8A 3CNLA 4A0QA 5K6RA 1VRVA 4GP9A 1WDWB 3SR0A 1O9HA 4JOQA 4QAQA 1NHGA 3EQ2A 3IE2A 5JSHA 3DL4A 2VPYA 4JMLA 2P11A 3NHJA 3T1HB 2A8YA 3RBZA 1LNSA 4PXAA 1WCIA 1L1QA 4TOIA 4US2R 4N7MA 1CU1A 1L4LA 4RVDA 3DAGA 5ES3A 3MT7A 1E89A 1OI4A 2P35A 5DASA 3HK2A 2O8CB 1O6FA 5FUXA 3E3LA 3E22A 1P18A 3HYLA 1D0VA 4YN3A 3KQOA 2PMWB 3R0JA 1TLLA 1NC3A 4QT0A 3FTCA 1OROA 4DSOA 3K5PA 3Q2IA 1QQTA 1QJCA 5EIBD 3IIEA 2W93A 1K08A 4I6GA 2H54A 1I3KA 2JJ8A 3GCGA 3IJ5A 4EG4A 5AHKA 3IDFA 1F6WA 3V1MA 3KYCB 4HO1X 2OV8A 1TYBE 1I2ZA 1PL6A 1RQRA 2J9RA 2PUHA 4X1KB 1H2EA 4RIIA 1N8SA 3L07A 3QOFA 2D2XA 1C2YA 4D92A 5A62A 1UKEA 3ACDA 1IL0A 1ZK4A 1SHZA 4YRDA 5HUHA 5I51A 2YRXA 3A8TA 4JJFA 2J33A 3O31A 3AR6A 1G8HA 3ZTWA 4DBZA 3L9XA 5CU7A 2EW8A 3L40A 3LBNA 2WD7B 4URYR 2NT3A 4JSYA 1I30A 2XZTA 4X6YA 4DAEA 3ZWKA 1SC6A 1DEAA 1U8EA 1T4MA 5A05A 3A6EA 3BSYA 3VZSA 4OQ4A 3R7FA 2MINB 2BTEA 1XDGA 2EWMA 1J2TA 1QGDA 221PA 2VA9A 3BL5A 5GOZA 3TZKA 1BH2A 2XADA 5G3YA 2CHUA 3RYHB 5KSZA 3OESA 5U4QA 3TLZA 3FMIA 1OA0A 2W00A 4N9QA 1DTSA 5IP5A 4DMGA 3R6WA 4EPYA 4YT2A 2GXAA 2N75A 2SCUA 3NONA 3IQIX 4JFRA 1UBGA 3IUQA 1PT8A 4Q3KA 3T6KA 3WGGA 4HX9A 2IXBA 1V11A 3R77A 5HUQA 4IOJA 4EW3A 4D74A 1N2CA 1SB8A 2G36A 2VF5X 4TVKA 1R7RA 3JZMA 5BRAA 3SSMA 8GPBA 3R5JA 1A7UA 1M54A 5DNVA 2HWXA 1QK3A 3MIIA 3BH0A 2PTHA 1F3LA 2C2WA 4WH0A 5JSFA 1T1GA 3FMFA 4MQMA 3VBEA 4B3XA 2FFAA 2UU9B 1YRHA 2P2CA 4XJVA 5BOVA 1LPMA 4WUTA 1AUPA 4LOLA 4Q4JA 3FZNA 3AM4A 3UUWA 2JJMA 2HIGA 1Z34A 1EVLA 4G97A 2P65A 2ZITA 4PC3A 2AN1A 3QXCA 2AXNA 3KDPA 1DEOA 4FS8A 4B40A 4Y30A 4EENA 4PYMA 2B3DA 1OBOA 4EL0A 1U6KA 1JLLB 4P53A 4XGQA 4UEOA 4E4RA 2HWWA 2OQRA 4HGYA 2GJ8A 2HFKA 2XCOA 1N3IA 3QEKA 3NTRA 4BUZA 3HU5A 5A0FA 3A6LA 3MBIA 3ZZ0A 4BO5A 3OZEA 4BQIA 2B4QA 3IS3A 4BEWA 4QPDA 4C6TA 3HV2A 3JQAD 2VF8A 1ZOOA 3IUBA 2AB0A 3E9ZA 1JA9A 4K87A 4AICA 3ZU3A 2KLHA 4U9HS 1YWGO 4F9TA 1W35A 3PE6A 4HADA 4A8PA 3SS7X 4FMDF 1Z5PA 5EFZA 4LC0A 4UU7A 4WI1A 2EYUA 4NOLA 1ZHHA 4MGEA 3RWMB 4WKPA 4N4AA 4X7RA 5AM5A 1JR4A 1JQLB 5HDQA 1V26A 4Y6PA 3IB3A 1TCCA 3WRYC 3I9MA 4B0PA 3EVCA 4OHXA 4F11A 3STVA 4DJAA 3NOOA 3RF6A 2OFFA 2JFGA 4X63A 4B8ZA 1E2MA 2DJIA 2VZ8A 1E5XA 3WLLA 3TEFA 3FI9A 3U7QA 3SEQA 4MINA 1TGVA 5KNLA 1DADA 1ADCA 1DIAA 1IB6A 1O96A 3DDNA 3KAPA 4LBYA 3GAZA 3DE3X 4R40A 2QRLA 4TT8A 4ENWA 1R4MA 4PAOA 4X97A 4WBNF 4RFSB 1XJ5A 4U02A 1MJHA 2O07A 4LZNA 5FTWA 1UBJS 3W3AD 3ZU2A 4CQJA 1CUBA 3QOYA 4EMUA 1E7WA 5C46F 2XZOA 5IBCA 1CR6A 3RUEA 2EWWA 3BK1A 2OMEA 1PZNA 3CIFA 1SZCA 3PHJA 3AILA 3ZHCA 1VE3A 2VDVE 2OPBA 4CM4A 5DH9A 2A35A 4ETNA 4YHHB 3Q7TA 1YDHA 4E0BA 4Q4AB 4HD8A 4CKXA 1RLIA 3IIJA 5AR1A 3F2IA 3WLEA 4BNNA 2E2WA 3KWLA 5ESWA 3A4VA 1PQUA 5H68A 4EG1A 1E2BA 4C14A 1VHLA 1WHSA 2PZBA 1GZHB 4EBBA 2VHUA 2D1QA 4YO7A 5GONA 2O3TA 2PCJA 3RUAA 3KXIA 3A06A 1VLQA 4HCJA 4ARZB 1QVAA 2VRBA 2Q62A 2JK1A 1DRUA 1LS1A 1WZUA 2J7KA 3GRZA 4Y6SA 1L5LA 3IBCA 5IKMA 2PXHA 1TPZA 2GM5A 3K1JA 1UK7A 1XSEA 3D0QA 3GW8A 4D6XA 1POWA 1XF1A 2ZREA 1YI0A 4R9VA 4N48A 4ILEA 3KB8A 2AG1A 4N12A 4WK2B 4YQEA 4H08A 1V45E 3BL6A 1SCDA 1X77A 1Z4OA 2HSWA 1QTQA 1Z07A 3PEUA 1NJ1A 1CJUC 1P29A 1YS2X 1Z2EA 5DHRA 3JAMA 1D03A 1P4GA 3AUXA 2RI0A 2GVZC 1RAAA 2XOEA 5KDLA 4HTFA 4OI1A 2G04A 4K9SA 5CT6A 4DDWA 3OQMA 4RIHA 2PSHA 4AZTA 3IKTA 1FMCA 4J90A 2AJTA 3U3KA 2BGJA 3LH5A 3U5TA 2OXEA 2OCKA 2Q1UA 3EYWA 2VK8A 3M1YA 4V3BA 5CLLA 3U3OA 3ZTTA 2XDWA 3UPUA 3PNOA 2OCDA 4CXMA 3CEMA 3C1AA 4Z3DA 4IPTA 2VPZA 2WIAA 4R2HA 4JYZA 3LTEA 4CIDA 3WKCA 2B34A 1YQEA 3KEGA 1N6IA 4LRWA 1OI2A 2OC9A 3K70D 4M9CA 3RC1A 4EEXA 5E2BA 2OKGA 4MP6A 1WR8A 4UFPA 4YJGB 3CIOA 3E35A 4E7OA 2QRHA 1D8AA 1IY1A 3LUDA 3VR6D 1FFGA 1AHIA 3CN9A 3T5BA 5BV1A 1EQUA 1WPXA 4LWPA 1QP4A 4JJ4A 5TPZA 3M4YA 2R62A 2PZFA 1T3SA 3BVPA 3ED1A 3EQ9A 3WGJA 3TW0A 4TYWA 3RVNA 2IZ1A 4PPFA 4IEFB 1JIUA 3IBYA 3LYUA 4P7BA 5CGQB 1L7BA 1PR0A 2WD9A 2P2YA 3ND9A 1J56A 3O2JA 1Y82A 1PZHA 3BN3A 3GP8A 4ZDIA 4QEDA 1NX9A 3CO5A 2J1LA 3SZOA 3WGTA 3MUFA 2QN2A 4GSYA 4WINA 1Y6ZA 5IM5A 4NPHA 4JOSA 5JZSA 2WWIA 3CW8X 4IMJB 4WD3A 4MW2A 5HMMA 1N6OA 1ZK2A 2YWBA 3FYDA 4RF4A 4Y1EA 1ABBA 2O1SA 4X3CA 4ZZIA 4BQRA 3EIHA 4JP1A 4FOLA 1IG3A 3EBOA 1QYWA 1X8LA 4YP7A 4UBLA 5JOQA 5K8JB 3AHHA 4RX1A 4RJJA 4R51A 2ZU6A 3DLHA 2VEOA 5FPQA 4XR4A 4EYEA 3NVKI 1STOA 4CHTA 4EHAA 3L7CA 4DIKA 5LM3A 3ASUA 2WMYA 4X1IA 3NASA 1EVJA 4YMTA 1ZCFA 1G5IA 4YGYA 1AGRA 2A88A 1KL7A 4ER0A 1ECFA 1YOVB 4QXRA 3RS4A 5B30A 1LPPA 2Q2QA 3KHKA 2YMMA 4OJQA 4MW1A 4IQ0A 5FBZA 5THXA 3WFZA 4DZZA 4JVNA 2A0KA 3A11A 1FLNA 1WXDA 2AFIA 3L93A 1OFTA 4N49A 3WGNA 1P31A 3O3CA 1Q92A 4P86A 4CEHB 1QVZA 3AM3A 5T4FA 3TVDA 1IUOA 1IE3A 2P8SA 2WJPA 4QLBA 3CVXA 2B7LA 1FFYA 1U02A 4W8GA 4FE4A 1N5KA 1IMOA 5DKFA 3CZQA 4LRQA 4QXOA 2A30A 5EFOA 2BH2A 1QF7A 3CJTA 2CXRA 3MCUA 3UJ3X 2XT6A 4PR3A 4HB4A 3WKDA 1YUBA 4ZI7F 1UK6A 2X7XA 4WY8A 5J58A 4A6DA 1DDIA 1WV0A 1SXJD 4PLHA 3PXEA 3EA5A 1A9RA 5BWMA 3DFFA 1I9GA 3KQTA 1IVSA 4MRMB 1X19A 2IX9A 1GRNA 1RJDA 1IATA 2KHZA 3NX4A 4A03A 1EP2B 3RSLA 1LLFA 1V9CA 2QIOA 1CUCA 3O8QA 5KC8A 4QU0A 1R0LA 1MH1A 3QFHA 2RGGA 2EARA 4S05A 3O4IA 4RE5A 1WG8A 5EJFA 3THWA 3GT3A 3MS4A 1J8VA 1Z7BA 3NCHA 1VDZA 3LX4A 4G0ZA 1OC4A 4LF5B 2ZUFA 2C2ZA 5JDIA 1RRGA 3BPSA 3MM4A 2TS1A 4OEHA 2FPUA 4N39A 3SOZA 5REQB 1RQ2A 3REGA 1P9NA 4MR8B 5MDHA 3DEYX 1GSAA 1LLCA 2ZYGA 4HLNA 3KT8A 1P2VA 4K86A 4X3OA 5CMLA 5DXAA 1GTSA 2WUVA 3PQ7A 3KL4A 1W44A 1QE0A 5BV8A 1PNQA 4W1QA 3HC7A 4K8RB 4V1CA 1NN3A 4RW0A 4G2TA 1W4CA 1YE8A 1VE5A 3NNSA 2C97A 2CF6A 1ZM4A 3VZPA 1OB5A 3NT4A 3CRNA 1DINA 3OOEA 2G25A 4CG2A 1PV1A 3BIOA 4TQGA 4OB8A 3WYNA 4G5RA 4G0OA 4Y2JA 5H4GA 1XNHA 1DIRA 1K63A 1FFCA 1C0EA 1G20A 1A8UA 1V5WA 2W2XA 2WVJA 2XUDA 4BVGA 4YCSA 4UHBA 1U9IC 1WW3A 3FHTA 3PNPA 1YL6A 3ZQKA 1YS6A 2FQWA 4WLOA 1NW3A 3B5IA 3SBDA 1T10A 5ARCA 1BJKA 1VJ0A 2VP5A 1YFLA 3MSXA 1VHDA 1ZJZA 5FCDA 2WWYA 3VI4B 1QFJA 5DV9A 2ZWMA 1KI6B 4I50A 4P98A 4DV6B 5AO9A 4CMIB 1GU1A 2C82A 3MOSA 2JGEA 1I4WA 4FDTA 2Z9CA 3IR5A 4L9RA 4BN5A 4EG8A 1ZMXA 1P0MA 2OAEA 2DWPA 2P6NA 4YI3A 1BS9A 3AGPA 3KZCA 1JHZA 1OAAA 1FSZA 3ODPA 1UEXC 1GYQA 3E23A 1V0JA 4GICA 5EUMA 1F12A 4XVHA 4CRWB 3NW9A 5FBWB 1I2AA 1XHLA 4DTCA 4DDVA 1J0AA 3SIRA 2I7DA 2PUWA 2LCFA 2G9VA 3LPMA 3M4ZA 4YUVA 4M53A 1CY4A 1J9ZA 1J0BA 1FP6A 1O5OA 2H1SA 3DVAB 3ND6A 1PCXA 1PT5A 3OJWA 4HDNB 3ZGYA 2AHRA 5LCXA 4L5YA 3CVJA 4R4JA 2Y6UA 4ITVA 1XWWA 5BN3A 2A7XA 4CF6A 4F4HA 1T3LA 5DBIA 2KB0A 3ZC3A 2FJ0A 2YWEA 4LX0A 3TG8A 4U2BA 4XLZA 3T34A 4MUKA 2VF7A 1E2PA 2CNWA 2GWRA 1XMPA 1G55A 4ZAVA 1M7HA 2QE6A 4R1PA 5FF9A 3VR6A 3RC2A 2QYSA 3R20A 1QLJA 2RGNA 3S8MA 3AGQA 1DE0A 1NY5A 2V6FA 1CLEA 3N86A 3RRBA 4BO0A 1FF9A 2CCGA 4KLZA 1FRVA 3U7JA 3NHPA 1XG5A 3QPUA 4EYSA 4D41A 3EPKA 3OAAD 2O4UX 1ZFNA 3FCXA 2VNIA 2UV8A 1V1RB 3TQTA 1CS0A 2F64A 2E82A 3CV3A 1QH8B 4FP9A 3NGXA 4G2NA 4QM6A 4IUCS 1GA4A 1N25A 1OLOA 4UDNA 2V8OA 1C7ZA 1IIBA 4ID3A 3RRXA 2CNKA 4FJ1A 5BN5B 1AQNA 5BXYA 1G8FA 1CDZA 3EUWA 3LU1A 1ZUD1 2GTHA 1QG0A 1U2EA 3CCFA 4WNAA 2AJCA 1YS9A 1NRJB 2W6ID 4FYPA 5HBGA 1H42A 3W7AA 5IDXA 2ECKA 2HCJB 4QG7A 3HMQA 1J6UA 1JEAA 4ZZ0A 3WGHA 3LBHA 4WZAA 1RHMA 1FP2A 1LTQA 3AUAA 3C3DA 2JLAA 4WL0A 1G5FA 3I61A 5KTMA 5ITZB 2YBDA 1SIBE 2ZIWB 1MX1A 2QZ4A 3FGZA 1NMYA 1KEEB 1QAMA 3KXPA 1N2JA 1ZO8A 1EVQA 3AEQB 3O84A 3K9QO 2IHVA 4RXTA 4REMA 4Z0HO 1F2DA 1Z0FA 4D8TA 1RXVA 4AP6A 1QLWA 1CE8A 3K6RA 2EHDA 2RB4A 4FFVA 1CXZA 1GL9B 2BFCA 3DW1X 4N5HX 5J59A 4QDUA 3WFIA 4W5OA 4P3NA 4YMHA 5G0UA 1HLDA 3ZS8A 4LY6A 4L6IA 3SP1A 1DVRA 1SHTX 5LQAA 4P93A 3IVCA 2RAPA 3DLCA 5TB5A 4CKCB 5I3CA 2W8ZA 4RTMA 2EX4A 1JA0A 1B16A 3U7QB 3SQDA 4G86A 3FUWA 1AKVA 2OESA 2QSZA 3RF7A 3Q41A 4P4LA 1DLJA 1SUEA 2IWHA 4ZT2A 2VRCD 1M10A 1U8TA 1ZIOA 1KEEA 3CEHA 3GRCA 2V7GA 2ZR8A 4I14A 3TM4A 1PRYA 1VZ2A 2CWDA 3B1JA 1BOFA 3OZAA 4G4SP 4M1OA 3YASA 4DY6A 1OLXA 1DWPA 4WXMA 2PSEA 2I29A 1L5MA 4ZMBA 3A1FA 3H5RA 1JDSA 4L4ZA 3A1DA 1S01A 4R8LA 1FJXA 2WSIA 4DLBA 2CV1A 3VR2D 4E5MA 1PT6A 3CMMA 3BWMA 3VJKA 1L4BA 4QJ3A 5IX8A 4EGJA 1UMCA 4BO9A 2VNAA 2IUSA 4KRXA 1THGA 5EZQA 2R8RA 3C3BA 5AVJA 2FSVC 3M5PA 4B75A 1C1DB 1LW6E 3DXZA 1U11A 2DLNA 1T91A 3FYSA 2Z09A 1WSDA 3ZWOA 3PEEA 3O91A 1E77A 4HHEA 4FXPA 4KVGA 4OGWA 3EFOB 4ZQIA 1UP7A 3V7UA 1OU4A 2GEVA 5A5EA 2O2EA 1N77A 4FWIB 2UUBB 4KODA 5B5SA 1RMYA 1GPKA 3W2IA 2Q3EA 2QRVB 1O6CA 1UBLS 1BE8A 1BYIA 1KI8A 1VIMA 1YE3A 2MIIA 4RAOA 3R0ZA 2VSOA 4QWWA 5DK6A 1NGSA 1FY2A 1PR4A 2B4KA 2GDJA 2W4IA 2ZYSA 4CLDA 4DNXA 5CBKA 2CV0A 4F2PA 2QSJA 2ZR9A 2YN2A 3P94A 4FMCF 2OORC 3H9GA 3R75A 4F6LA 3GL9A 1VLJA 2HADA 3NKVA 2IYUA 3K3PA 1OC2A 1NJGA 2JIRA 2Q8QA 2WFZA 4XUEA 5AW5A 5DN6A 3ADPA 1A5SB 4QGSA 1JSLA 3AX6A 1QG6A 2PKWA 3ZCRA 1FP4B 1W19A 2P9GA 3NTOA 2HHAA 5TS2A 1UMCB 3I6MA 3U4QB 2GPWA 2WUWE 3EA0A 3PD7A 1BIFA 2IRWA 4WT7A 5ALQA 3RVMA 5HWSA 5KX5F 4WGFA 3CLUD 3KE9A 4TN5A 3JYQA 5CDFE 2Q50A 2UVDA 3AT1A 2CZQA 2VNHA 1ZL0A 3ILYA 4QYTA 5B2EA 1Z0IA 3GCWA 1BCSB 4PPNA 4DMLA 2BIFA 1JSZA 1V96A 3GLUA 3QMVA 5D5HA 1MCZA 4CCSA 5G53C 1AIPA 1E18A 2NOAA 2GA8A 3NHSA 5FPHA 4ER3A 3ECCA 5SZJA 4RACA 3QVJA 4CEIB 3KR1A 1WF6A 4O4HF 2W4MA 3PNQA 4PC6A 4RKRA 1DIHA 3E15A 4X66B 1Z35A 3KHTA 8OHMA 2PRSA 1PJCA 3FPBA 4ZPJA 1J8MF 2A1UB 4NE9A 5EC8A 3TECE 4DMKA 4CMBA 1XTBA 2DBRA 1JSRA 2IUTA 3I37X 4KZPA 4R6WA 4F1WA 1ZI8A 3I28A 5THKA 1D1PA 4K26A 3RHZA 3WBBA 3DT8A 2YS7A 3CX7A 1TIKA 4Y9UA 2X0FA 3VTAA 1D2NA 4DARA 1OB2A 4TTAA 1KR5A 3A3OA 1SQFA 2UZIR 3L7BA 4MNTA 3EEOA 4LNAA 4YXWA 4TMXA 2XUFA 3KK0A 3PP8A 4UATA 2VJMB 1AK9A 4HVCA 2QY6A 4TL7A 5NLLA 2DHQA 2FMFA 4W63A 1EWTA 2GZRA 4LFBB 3HP1A 4WFJA 2CNOA 3EFBA 4I19A 1KMQA 3I1YA 3G5MA 3L41A 4QFBA 5M7EA 3CZAA 3MFYA 3C1UA 3N2KB 4NOKA 2X0EA 5KREA 2DFNA 4D9MA 1S3SA 4B4VA 3B78A 1CVLA 3N2LA 1WW8A 2NYRA 2J3DA 1U7PA 3WGZA 2A0FA 4WACA 3B6JA 1GL7A 1CWUA 3AOEC 3EIUA 1YQXA 3NQ41 3TSWA 4CHGA 1VE1A 2NU6B 4XB6B 3JWHA 4MICA 4IDGA 4DZTA 1XGKA 2WY2D 3A0UA 1ZIPA 2FX2A 2P3QA 4UUPA 2FHSA 3KJNA 1A8IA 1T8TA 3KFVA 4N5LA 2BBOA 1ONOA 4JD5A 4EECA 1DUSA 5TMEA 2FCAA 2GF9A 4KXFB 3O47A 5DHUA 4HDRB 4OQFA 5BT8A 1HQYE 2XCLA 4MGIR 1TKAA 1W6RA 2ONYA 1ZSNA 2WKRA 4HDKB 3UJ9A 1M6EX 1VHWA 1XZHA 2BEWB 4CUZA 1DXYA 2OXRA 4KXLA 1IJFA 2XNSA 4NMMA 1UDWA 2XHEA 1PT9A 3FNQA 4NMHA 1BVYF 3M5CA 2Z30A 1GNRA 2D5AA 3C4JA 1T4CA 2JHFA 3UQYS 2P7HA 1PQYA 2DFTA 2DR0A 4MKXA 2HREA 1OVMA 2B8JA 5EI5A 3RVKA 4KR6A 2OO5A 4C1NA 1VG9B 5FKJA 4ZJPA 1AKUA 1DWOA 4B3JA 2WQ6A 4WCDA 1KZ9A 1RRPA 1CQIA 2D0PB 1ZJJA 5FNVA 7AT1A 1XZKA 1RU3A 4GX0A 2PS9A 1WPRA 4N54A 4PAMA 2OCGA 2CHGA 4U8GA 1ZM7A 1LB1B 3U31A 1UDXA 3O9MA 1I94B 1A4UA 4LF6B 3DKIA 5KJ6A 4JN6B 1PWHA 5IULC 4YT8A 3ZVNA 1LSSA 3ZV5A 3KC2A 4M8LA 2ID7A 2VH2A 1CDOA 1QIKA 2AC2A 3BJZA 2RGYA 4TMTA 1ZUWA 1O95A 4M9UA 5H8WA 4CLXA 3AF1A 1KYXA 4D2IA 3FKJA 3H1BA 4GRAA 3ZE7A 1FVHA 1NC1A 1QWOA 3IILA 4KO4S 4HXEB 1CUDA 1K5DA 1SAYA 3G8BA 3U40A 4IHQA 3THYA 2WIJA 3ZY6A 3Q8KA 4ZOLA 3U6BA 2C7RA 1RVV1 1MNAA 1OLUB 2A84A 3PQEA 4KQ6A 4E32A 5LU8A 3KOZA 4H1UA 3GD5A 1KZGB 4GIBA 5ESRA 4LJAA 3PHHA 3R5TA 4LZOA 5DNCA 4JVSB 1CIPA 5L3ZA 4CQMB 4WLNA 3S2IA 4IJMA 3TTWA 1DSSG 2G71A 3BZBA 3WMXA 4BNWA 5AQ1A 1GQ2A 3GAMA 1QU3A 3AOEA 1R00A 1EE2A 4B32A 1QHEA 3L6CA 2COUA 3IAEA 4QNMA 3PF9A 4K2AA 1UOOA 2PX5A 2QY9A 2R87A 3BB1A 3BMXA 1PEAA 2IHJA 3I01M 4OXIA 3VXKA 4JJIA 3I05A 1LUAA 1WZEA 4G0NA 1W5SA 4AO8A 1O0BA 4HWSA 3KUXA 2B20A 1CP3A 1VL6A 2XECA 4J29A 3H3JA 3LUCA 1U3GA 2YNMC 5EIOA 1M2KA 3LC2O 1E3SA 4JSTA 3TAUA 5CVUA 2IDJA 2R4TA 2YJ4A 3NXKA 1MC1A 4TVSA 4R1SA 2X2EA 2XNHA 3DE7X 5JI2E 3WVNA 1JQAA 2WM3A 3FBTA 1E3WB 1PFKA 2ZTLA 3K9CA 4ZO6A 3QKRA 4Y1RB 3TE7A 4PPYA 3GLGB 5I7VA 5CBPB 2I4MA 3Q0EA 5LXTF 3CZMA 2ORWA 3ZXUB 4JI4B 3M9WA 4KB5A 1G4AE 2PFKA 3JQ7A 3ZUPA 1V25A 1A27A 4UXJA 1EVYA 1FNNA 5AW1A 1Z6YA 3TS1A 2EKBA 4Y18A 3VR4D 3ZWBA 5LJIA 3WAGA 4ABYA 2QUHA 2WJZB 5KNDD 1NY6A 5EUBA 3IUPA 1JHOA 2G28A 2FZWA 1BHSA 2UKDA 3P0IA 2YXDA 2AN3A 2DJ5A 2JGFA 2NADA 4MS4B 1I5EA 3UKDA 1BDIA 3L0OA 4G0MA 2I2WA 3ITKA 2QX8A 2X5XA 3TW8B 1SUDA 4EY5A 1M2VA 1TEZA 1KORA 1YCFA 5FLKA 3ZDDA 2ZTMA 3GJ6A 1QRAA 2X40A 3BWEA 4TV9A 3T9BA 1T24A 5AHXA 2AX4A 4W7SA 3OT5A 4MPPA 1Q12A 2BFFB 1GVHA 2CFIA 2NSLA 1XDWA 4HZIA 4K05A 2QTVA 4UCFA 5D8DA 4Z0PA 2K6GA 1R1DA 4DDKA 1JJ7A 1XXLA 3RH0A 2OT3B 3DEAA 4KIJA 3ZIAA 2XQGA 4LRTB 2O8DA 1QV9A 3DTVA 3IQEA 2WSYB 3QY0A 3RARA 4IDNA 5HKKA 4N6NA 1QK5A 3G13A 4WCFA 4Z6KA 4W8HA 4EI7A 3F3SA 3ZDRA 1IQ0A 4C4TA 5I48A 1FZTA 1QVWA 3C8MA 2F3SA 2XZLA 2WT9A 4K2HA 3W5AA 1CF4A 2RGBA 2BR3A 2IK8A 2O2SA 4RFSA 4UVDA 2AYXA 1TCAA 4H1TA 5F64A 3MIZA 4DLYA 5K45A 1JR3E 4URZR 2VSFA 3L1KA 1OH7A 3CC8A 1T9KA 4PU0A 1UBFA 4RA6B 3ABZA 3A10A 4EMTA 3TB6A 3BHIA 1N5OX 4FYYA 3V9PA 1PFYA 1UDAA 2XMPA 1LV8A 3PC8C 2NUTA 4OHFA 1P9WA 1NKVA 3BREA 2O3JA 1LI7A 2FUNB 4MDHA 3VTZA 3WLHA 3BIJA 2OBXA 3V8EA 4DR6B 3L06A 2BGTA 1QUEA 2ZB8A 3H65A 3WTCA 3FKSD 5CW2A 3O74A 1SMKA 3W3AA 1ZXXA 5ERXA 5FO1A 4IOKA 2FA9A 2IYSA 3S1AA 4AXXA 3L4JA 1OV6A 3NAQA 4HVLA 2M32A 1SRQA 2G06A 1VXRA 4XSVA 1MO3A 4DCTA 2EERA 1IBRA 1MENA 3EG5A 4GHWA 1X7GA 3KYBA 2Z5VA 3MQFA 1EJ0A 2DY1A 3HR4A 4G1VA 1ID1A 3UGKA 1Y9EA 1O96B 3BUSA 3CG0A 4GSLA 1J06A 1Q0RA 3CRW1 4PG6A 1VBMA 3FCCA 1OKKA 1JHRA 1A72A 2PY6A 3MJVA 2X8JA 5JJCA 4KG7A 2JHPA 3LZ6A 4GP7A 2QL7A 4MVJG 5CB8A 3VAYA 2JIZD 2Q9UA 3DT6A 3UV7A 1UZAA 1T4DA 1ULZA 5DXFA 3EGXA 1M0TA 1SUWA 4NZZA 4CM3A 4IFBA 4O2RA 2NTNA 1L2TA 4HTFB 4B33A 4EL5A 2ODAA 2D5LA 3KVYA 2D5BA 4KQGA 4RXMA 3DE6X 4UDXX 1C7IA 1BKSB 3IP7A 1LBSA 1J49A 4G5GA 3SYMA 3VR5A 3WC4A 3NM6B 3DL7A 3H9CA 3BILA 3N6RA 3GHYA 1ENOA 3NEJA 4M0FA 2OHJA 4LEIA 3JZIA 3LGXA 3FNFA 1YZQA 2GN9A 3K96A 2BR5A 4MWDA 2C7OA 1CS4C