2UZIR

Crystal structure of hras(g12v) - anti-ras fv complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumour Prevention by a Single Antibody Domain Targeting the Interaction of Signal Transduction Proteins with Ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uziR00
1DAEA 1LB1B 4TLBA 3EAQA 2WJIA 1XTJA 3CLVA 4LJ7A 2GF9A 4WW0A 3OIYA 5HE8A 3EPJA 3WRYC 1IY2A 3CRVA 3OAAA 5C4GB 5FI1B 1H8ED 2ZRFA 1ANKA 4P0TA 3VR1A 4BFUA 1JQLB 4DCVA 1DARA 2HCBA 1CP2A 2XTZA 4OQNA 3T1VA 5G3YA 4NYIR 1UKZA 3SN6A 4BLPA 5L3SA 5A5GA 3EPHA 3FHCB 3Q3JB 1G18A 3CNLA 4DKXA 2D06A 3CR8A 2WSSD 4HZIA 1XTQA 2A5FA 2XEXA 4K81B 4MKHA 1JR3E 1E1RD 4DLXA 2WVJA 4QGGA 2QU8A 4KODA 2GK6A 4DXAA 3BGWA 3K70D 4Q66C 1LS1A 4AYWA 2W83A 1RVDA 2VSFA 4LY6A 5IDVA 4EDHA 1T0HB 1N25A 2EFDB 1QF9A 1KI2A 4MGKR 4OKSA 2PL3A 3U3RA 1Z6GA 4PFSA 2D4HA 2GEDA 1OW3B 3EWSA 1AN0A 4RSGA 1TEVA 2QP4A 4JT2A 3KJHA 1QVRA 4MKGA 1DTSA 3EZ9A 3SR0A 1SXJD 1JNYA 2O8CA 2XGJA 1P75A 1Z6XA 4QBHA 4N1AA 4LZZA 5L3RA 2ZS7A 3THXA 3EC1A 1ZUIA 4WOPA 4F4CA 2C9CA 4BFVA 3R20A 3QXSA 4BZXA 1R0XA 3QXXA 4TYNA 2IYSA 2FF7A 5AUNB 4O2LA 2ODNA 1Q0UA 1KK1A 3K1JA 4J0QA 3CKLA 5FOWA 4UNRA 1VIYA 3TMKA 2ZRKA 4R98A 1F2UB 1T3LA 4YC7A 4W9MC 4LWZA 3ADBA 1SQ5A 2VHJA 2CVFA 2A5GA 4PHGA 4NCNA 1KI1A 1VG8A 1GFIA 3GLIE 2P2LA 2O8DB 4DCSA 4RD2A 2QENA 2LKDA 4JIMA 2W6JA 3VQTA 3NC1C 2VL7A 3QY0A 1T91A 2CHQA 1CRPA 4PAMA 3D8BA 4YDHB 2QPOA 3CNNA 1OLOA 3DMDA 2IF2A 3FWYA 2VP2A 2XOKD 4B35A 3QF4A 4C2TA 3T1OA 5GJVC 4NYJR 4UNSA 3OEED 2OCYC 4QRHA 3IGFA 4V02A 3ZGXA 4HUQB 2BM0A 3T15A 1QHGA 1IXRC 1W36D 1KDRA 3ZYCA 3AVUA 2GNOA 5CYPA 1U9IA 3C41J 3A1WA 1P2TA 1DAHA 1XEWY 2JDIA 1HT1E 1NBMD 1E99A 2PMKA 3L2OB 1NG1A 3SC3A 1YR7A 4NPHA 3RANA 4B75A 3TKLA 3P4XA 4BZPA 4QKQA 5FL7D 1Z0JA 5AWFC 1MABB 4M1OA 3R9IA 3VR2A 3U2QA 1AQUA 4TL7A 3SU8A 2HYDA 1UKVY 5IRCD 2JLWA 1JI0A 3M4YA 5CK4A 1WRBA 1AKEA 3MMPA 2WWYA 4DEXA 1E4VA 4RD1A 2J87A 3DM9B 1J8MF 2JA1A 1Z5ZA 3RSLA 3SEAA 4BASA 2ZUBA 1FX0B 1XBTA 4KBFA 4BEJA 3KQHA 3X1WA 3PJRA 2OAP1 2ZIAA 1KSGA 1MR3F 3RRMA 1H65A 2EFHB 4IOKA 3WMFA 3U7GA 2FU5C 4TQAA 4BUJA 2HT1A 3X1XA 2P5TB 3CO5A 4QGHA 2FEOA 3DHWC 4JLMA 1IY1A 1RIFA 3B78A 4LJ4A 4RD0A 5KDOA 1UEIA 2VEDA 1OXXK 4TLDA 2HJGA 5FPSA 1N6RA 2H7VA 1RRPA 1T8UA 5FPYA 2J59A 2IUUA 1G20E 4M1WA 4KI0A 3ICQB 1FUUA 1SVLA 4TSFD 3KQKA 2F6RA 4NYMQ 5IHPA 1G5RA 2V9PA 4Q18A 1G21E 2GZHA 2DFTA 2ZJBA 4U00A 5JWHA 2VLIA 1BOFA 2ZSBA 3IPYA 3OEEA 2HDNB 2FOLA 3UATA 4JVSB 2GJ8A 4A9AA 4WBSA 5DO9A 3VU9A 2YWFA 1K5DA 3LX5A 1WB9A 1KHTA 1EFHA 2VSOA 3HJNA 4F91B 5CITA 1OHHD 2GHIA 3P1JA 1YE8A 2A9KA 1GIAA 5AK0A 4F38A 5HZHA 5HTKA 4Q9KA 2PX0A 2JIZA 2Q3MA 4QGAA 3U61B 1AJEA 3AVVA 3LV8A 1R8QA 621PA 4DEYA 3P27A 2V55B 4PC7A 1PV4A 3NC0C 3QKSB 4CIDA 2FSIA 2F1RA 2F43B 2WWGA 3FGNA 2YC4C 2O8FA 1E94E 2ZJOA 3NBYC 3LXXA 4OBEA 2CK3A 3CH4B 2NIPA 2GILA 3X1DA 2AK3A 3QPUA 4MH0R 5FR1A 4Z54A 3UWKA 5B58C 3RDPA 1TF2A 3RS5A 5EUQB 1ZC4A 3DOEA 2J0QA 4KFTA 1CJUC 4GDFA 3QEJA 5KUTA 2ZVPX 1GG2A 1R5NA 3T1QA 3GD7A 2FFBA 3ZVLA 4BFZA 2Z4SA 4ZCIA 4JBXA 1A82A 3V9PA 2IUTA 2ZXUA 4EFMA 2R65A 1JEEA 2ZI3A 3GFTA 1HEIA 4KBGA 4TL8A 1S8FA 3W90A 1N3BA 2OESA 1XD2A 2QL6A 2XJ9A 2QTVB 4G5QA 4P31A 3D31A 3LDAA 1DAFA 4XSGA 3Q85A 2CCKA 4ASUA 4TZ0A 1ZUHA 4QM6A 1II8B 3THYA 3SI7A 3FHTA 2JLQA 3KB1A 2AN9A 4OK5A 2NG1A 2WJGA 1VIAA 5BYJA 4RD3A 3LAWA 3M0EA 421PA 2W00A 2E87A 1XEXA 4A6XA 2P6NA 3HWSA 5EXSA 3VMFA 3HR7A 5JEEA 1TU4A 1NVXQ 3SZRA 3BFKA 3GLFB 3AM1A 3TAHA 1HE8B 2XB2A 1AGPA 4XD7A 3BH7A 3EASA 1N5IA 4YXWA 5DI9A 2PCLA 2XB4A 4IW3B 2OG2A 4ZIRB 1DAGA 2WZQA 1OJLA 1A2KC 1GNPA 1E2QA 2G3YA 3IIKA 4NCKA 3GLIB 2O8EB 4FCWA 3U4QB 3HPQA 2O0HA 2ZJ2A 3LY5A 2GKSA 2ZE5A 2YHSA 5J5CA 4BFXA 4DLZA 2BIFA 4DSOA 5FBVB 4QG7A 3LBIA 4JS0A 1ZCAA 2CE7A 5FI0B 1D2EA 2Z5FA 3RVBA 2ZRAA 4Q02A 1OE0A 2A7QA 2NQ2C 4B71A 3KZ1E 3TW4A 1NIPA 1E2HA 3TNFA 1CR1A 2QPTA 4POAA 2G83A 1E69A 3NH6A 3QG5A 4DLTA 4ZO4A 1HE1C 3IIJA 2ANCA 5DSZA 3SJBA 2J7PD 4ON9A 1W49A 2G1JA 4JT4A 4QBFA 4QJ5A 2OCBA 2IHBA 4HSEA 2GAOA 3B9PA 4UJ3A 3ZZTA 1G3IA 3TLXA 1Q1ZA 4I1SA 4PX9A 1M8PA 4K46A 4RFSB 1NIJA 4PHFA 4PPNA 4DSTA 1E32A 1JECA 4D0NA 5KPJA 3W9YA 3A36A 3B5JA 5EE0A 3CPHA 1YR6A 1ZIOA 3GJXC 2YINC 5GVSA 3KDSE 1GILA 3C5CA 1SVWA 2GA8A 3SYKA 2BEKA 1W5TA 1U0JA 2D74A 5JRZA 2XSZA 2RH5A 4CEIA 1I4LD 1W2HA 1KZGB 1RJ9B 3ADKA 3LVQE 3PV0A 2Z83A 4GMDA 3LBHA 3WP1B 5C46F 1CJKC 3EA5A 5CLLA 1Z6TA 3KUDA 2RGGA 1KI4A 3U3MA 2ODWA 4TMVA 1PLLA 2EWWA 1MV5A 2ZYTX 5E7JA 4B33A 1XTKA 4XVRA 5IK2A 1AGRA 1HQYE 4GRAA 2YNMA 1WXQA 2FPKA 1AZSC 3B85A 2ZAOA 5JEDA 3OHMA 1WF3A 1J90A 1GAJA 3AF3A 2Z6VA 3RWMB 4BGDA 4LBZA 1DAKA 5JHGB 1MO6A 3RHFA 1G3UA 4MGYR 1YRAA 3BB3A 4DCTA 1E79A 3THWB 1G19A 5GJCA 2I4IA 1T5LA 1N0VC 5IT5A 2FPLA 2YOHA 5JCPA 3BB1A 4ZDKA 2P5SA 5AJYA 4P4TA 2AHOA 4Z8XA 4QHYA 4TYYA 3SHFA 3TR0A 3FDIA 3O8CA 1Z83A 4UNNA 3PUXA 3DZDA 5JI3E 3PR1A 3N70A 4TTQA 1NKSA 5CIQA 1RYHA 1BIFA 2ZE6A 4F4JA 3GEEA 3QXJA 3AVOA 3SFVA 3H2YA 3NKVA 5DH9A 3GLIA 1PUIA 3V00A 1Q21A 1E2KA 1R8SA 1ZD1A 3I61A 4IVRA 4PC3A 3H0KA 3MJRA 1GRQA 2A30A 1ZM3A 2FSGA 5FR2A 4TMWA 1UADA 1KI7A 3RRNA 2F1IA 1NN1A 2GVZC 2DFKB 4KLZA 3K0SA 5FBWB 3L0OA 5SZIA 3MD0A 2ZJAA 3A1VA 4B3DA 4G1UC 2ORIA 5BQ5A 4JLOA 4N0DA 4Q47A 5JCZA 1RRCA 1II8A 4BWYA 1WP9A 4FMDF 1E9SA 1UBFA 3BWDD 2H1LA 4G5OA 4OL0A 5K8UA 1COWA 4D82A 1NMXA 2J41A 4PO1A 1IQPA 1UKEA 4JJKA 1W47A 2G0TA 4ZDWA 4CZ2A 4A2WA 1IONA 3ZH9B 1GNRA 1HH4A 1VHTA 2IYZA 3GCGA 4RFVA 4UNPA 3KFXA 1N2CE 5TB5A 2QROA 5CDFE 4OI4A 4ACBA 2ZJ8A 4JL8A 4WIAA 3LLMA 1W0JD 2AKYA 1E79D 4URXR 2MSEB 3LBNA 3KKMA 3BH0A 4IRUB 4Q4AA 4KHZA 1G4UR 1JJVA 2A2ZA 3K9GA 2XTNA 2FN4A 4DLUA 4Q7KA 2JAQA 2ZI7A 3TK1A 3K0AB 1RJ9A 1OKKD 3LVRE 5EE5B 3GLHE 3ONWA 5GVRA 4ABYA 4A82A 1E9FA 4AURA 4URVR 4XWKA 2J7KA 3VNUA 2W6IA 3MJHA 1TL7C 4NHOA 2IUSA 4D6PA 3GLGA 4OQMA 1XMIA 2WWWA 4K8OA 4M9ZA 3B1WA 4B76A 5EZ6B 2EWVA 3KJGA 2CNWD 3A58B 4MITA 1NY5A 4CEJB 3ZIAA 4LX0A 1XXHB 2J9RA 5J47A 4KU4A 3G0HA 4JLKA 1E0JA 4Q1DA 4D0GA 1E2IA 3NHAA 1G9XA 2IC5A 3QJYA 4HUTA 3SJZA 1EWRA 1OFHA 3TSZA 3VNVA 5FTLA 2ZUDA 1N0WA 2JEOA 1G6OA 3DEFA 3DPUA 4L8GA 2W2XA 1W0KD 1T3SA 4LBWA 4TMTA 1R7RA 3EIHA 1YU9A 3LRPA 1F2TB 3KKOA 3OEHD 1ODFA 4XVUA 5H8WA 4A1FA 1C1YA 4LJ6A 1OH8A 1E9DA 3W6OA 1A7JA 2OHFA 3UMRA 1GITA 2J7PA 2WKQA 4BRWA 1G3QA 1W36C 1P2VA 5E4FA 5HR5A 3FKQA 3Q5DA 2EFCB 1XTRA 1FL9A 3B1YA 5KDDA 2JLUA 2GJSA 4PR0A 2FX3A 3FMFA 4KSCA 1A2BA 1JQJC 2JLXA 1NJGA 3WP0A 1KJYA 5BXQC 2ZVQX 3P20A 3VHXA 4AWXA 1EFCA 1P62B 1GKYA 1ZM2A 1WMSA 3T06B 3OZXA 1KO1A 4R2IA 3WYFA 4GP6A 4LBVA 4DC9A 2ONKA 2YWEA 1SKYB 2BWJA 1S1MA 1ZUNB 3LD9A 3NDPA 2QM7A 4HEJA 3CRW1 3AV0B 1EFRA 5FUYA 1J8YF 3ZDQA 4M21A 4DDVA 1HV8A 1KIMA 1PJRA 3QENA 5KSOA 2IYRA 1YR9A 3PQCA 1VCMA 4Q9IA 1S96A 1GWNA 1NN5A 1M2OB 1XU4A 3E1SA 1JR6A 2QY9A 1GZSA 4PSVA 4PPGA 1SZPA 3RLFA 2O52A 5JSZA 1OXUA 2GBLC 1W5SA 4GI7A 5AJWA 3PCRB 2GXSA 4XTRA 1YZGA 1ZU4A 4NZYA 3EZ6A 6Q21A 4TQ9A 1XPOA 5D3MA 3VR5A 3U6KA 2F3TA 2QRNA 4XWAA 3TW8B 3W6NA 5C4MA 3B7GA 3HYRA 2ORWA 4MA4A 4TLEA 2B92A 3GEIA 5H68A 4FCTA 4TZ6A 3DKPA 4FN5A 4B6EA 1EWQA 3D7MA 2VH5R 1ESNA 4WXRA 2WJJA 1XJCA 2HV8A 1FQJA 5JSZB 4ARZB 2O8DA 1RW4A 4CVNA 3ND9A 1NNEA 4US0R 4XJXA 1F2UA 1KNQA 2E1RA 2CLCX 2VTKA 4CF7A 1IAQA 4QBGB 5A4JA 1ZNXA 3CRMA 2C98A 3AKYA 1ELOA 4MRPA 1X3SA 1CR4A 5KHOC 1Z07A 1AQYA 2OFWA 2CHVA 2ZETA 1KSFX 2GXQA 4MRSA 2B8TA 1V5WA 2IWRA 2HJVA 5DIFA 4BLRA 2UVQA 4URYR 1BYUA 4ILEA 5HCNA 4MRVA 1SGWA 4KYUA 1V43A 1UPTA 2B21A 2PEZA 1XNJA 3GFOA 4MQBA 1TNDA 2VSXA 3VKHA 1US8B 2EW1A 2NTYC 4M9QA 1TTTA 1KAOA 1W2GA 1W4AA 3U4QA 3AEZA 2HEIA 3NH9A 4PZYA 4C30A 4IKEA 5DNYB 2IA5A 3KL4A 5JWOA 1Z63A 4TTRA 4B3FX 3SDZA 4V0LA 2QMUA 4EQ6B 1XXHE 4D4KA 4X8HA 2V3CC 2XJ4A 4EPXA 4A8JC 3W34A 4Q4HA 3TVDA 2WHXA 5F98A 3REGA 4UQOA 2AK2A 2EYUA 4NE2A 2IWHA 3RS2A 1IXZA 3RAPR 1F6BA 5IK2D 1QBKC 3VKGA 5JMTA 3A1SA 5CB6A 2JLYA 1KYIA 3M6AA 1XX6A 3U44B 2PX3A 2IT1A 1U0HC 2QSZA 3P4YA 3TVTA 1QHXA 1M1YE 1R4AA 4R9UC 2WIBA 3SS8A 1LVGA 3CW2A 1G8HA 1PLKA 2WTUA 5B2ZA 3PVSA 4PAOA 1QDEA 1QHHA 4MUBA 3TUJC 4D2IA 2R6FA 2O8BB 3U6BA 2LWIA 1W46A 3RS0A 1E9CA 2WKPA 1P9WA 1E2DA 3E5HA 3KXKA 1IJEA 4KJZA 4DLYA 5EXPA 1MABA 2FGKA 1XEWX 2R8RA 3I62A 1ZC3A 3RABA 2ZJYA 3PUYA 4Q4JB 4C0QC 1KJWA 3IEUA 4Q9HA 3FE2A 4DUGA 1XPRA 1OIWA 1U0LA 4R71A 4Q1CA 4BLSA 2WJVA 4ESVA 3F3YA 3ZS9A 3UWOA 3OIUA 2ZAMA 4LHXA 2FSHA 2X1VA 1SKYE 4M1SA 2R62A 4OI2A 4JYBA 4F92B 2QAGA 5FL7A 2O0JA 2J0UB 2YWHA 4NTZA 4F4IA 1OF1A 1QVAA 2NO0A 1KMQA 2JJ8A 4A2QA 3BC1A 5G3ZA 2VP9A 1G8GA 2FFAA 4JJZA 1AM4D 4XD7D 5JI2E 2MSDB 2IHYA 4NKRA 3ZS8A 3A4MA 3TQCA 4YLGA 5JZVA 5JECA 2CEAA 4WZAE 5C1BA 4S35A 1KOFA 2C78A 4KAXA 2WKRA 2EFEB 5K8TA 3RNLA 2JGNA 2FFHA 1FNMA 4RD6A 4MDFA 1SVMA 4PQFA 5EP3A 3VR3A 3GPLA 4YXWD 3NBXX 2EFGA 2DY1A 1ZINA 2XTMA 1G17A 1DELA 1AA9A 5CM9C 4TMXA 1X8JA 1UM8A 3F5FA 3IHLA 3CB4A 1R6BX 4LC1A 2DFLA 2XXAB 4FINA 1LV7A 3L8ZA 2JJ2D 4Q1AA 4JMPA 3O8DA 1PLJA 2PJZA 3V4RA 1U90A 2CL0X 2NO6A 2VHCA 3AH8A 2GZDA 2BKUA 3JVVA 3QNUA 5HZKA 4BFWA 2JLRA 5FUVA 4BEBA 1YKSA 1J99A 2QAJA 4UJ5A 4B44A 3LQQA 4Y0VA 3GP8A 3BB4A 1DE0A 1OSNA 3VR6A 4XTCS 1CS4C 4DDTA 1NVWQ 1KI6B 1Q12A 2FJUA 1FX0A 4TL6A 3AF1A 2OM2A 3EARA 3A8TA 3U7HB 1XDBA 1ZP6A 3X1ZA 1DS6A 4YONB 3VTKA 3AQ4A 2GCNA 2RGEA 4PPFA 1EGAA 4BRUA 2GF0A 1FQKA 4LHVA 1QHYA 2ASEA 3WBKA 2C8VA 2CK3D 2WSSA 3IBGA 3HU2A 1E2LA 1KTVA 3WNBA 1DEKA 2AKAB 3MWKA 1A5TA 5FTKA 3QXHA 4Q00A 2ZSEA 1VYTA 1YZQA 1OYWA 4LPSA 3LFUA 4Q1BA 2ZREA 4US1R 5KYKA 3G82C 1G4AE 2WJHA 1ZJ6A 2V1XA 2ZEJA 3CPEA 3ECCA 5B30A 4ESHA 1OB2A 2OXCA 4FW9A 1H8EA 2DPXA 5DE3A 3UMFA 2YC2C 3D6TB 4OI0A 2BV3A 1GOTA 4FWTA 4TSFA 4EPVA 1DAMA 5JFGA 3CRQA 1B0UA 3EW9A 3IPXA 1TX4B 3CNOA 2IS2A 1N6IA 2G77B 3W3ZB 3C15C 1CBUA 1P73A 3F8TA 3KXLA 3PUWA 5JS8A 4OQXA 1TUEA 5EP4A 4GOKA 3AVYA 3V4FA 5JWRA 1VKJA 3N2IA 4CEHA 3AF2A 4LJYA 3MWLA 1JPJA 2G88A 1SXJE 4HLUA 2B6HA 4PXAA 5LDDC 4PC2A 1JJ7A 3R7WB 3SBDA 3UG7A 2YKGA 5CLQA 1N5JA 1U98A 4B74A 2REXB 1QRAA 1G7TA 1QHHB 1U2RA 2R6CA 2ZRNA 3MWYW 2J3EA 3MLEA 4LV6A 4I1OA 1G7RA 2ZE8A 2GXUA 1IN5A 4ZKEA 4U7DA 4Q19A 3T5DA 4DHEA 4NCIA 4DIEA 4IDHA 3EZ7A 3UIEA 4MKFA 2QE7D 1Q44A 5FTJA 1NY6A 5BN4A 4CT4B 1E4YA 1NSFA 4C3ZA 1XZPA 1CU1A 2PCJA 2QE7A 4JLBA 5CYOA 2YJTD 4NBSA 1XPUA 1PVOA 5G41A 1J70A 2ORVA 4UNQA 3NIBA 1KK0A 2C2HA 2NPFA 2EQBA 1HQCA 1T4GA 1P7CA 5SZKB 1RPZA 4DSNA 4TL9A 4QM7A 2ZSFA 1MO4A 2ZR0A 5JBQA 2RHDA 4US2R 5H70A 4Q9JA 3JZAA 4NP6A 4Q03A 3T34A 2EU8A 1UF9A 2H57A 3AF0A 1E2JA 4RZXA 2ZUCA 2BCJQ 4LV8B 4MYUA 3GLGE 5JJLA 3JZMA 3VKWA 5J4YA 2JJ1D 4DRZA 2ZRLA 1VYUA 5UKDA 2IS4A 2WWHA 3GLFA 4AYXA 4ZI2A 4M2LA 3B9QA 1XMJA 3U5ZB 3RC8A 5TDHA 4JLPA 4B48A 3QVVA 3C4JA 3GLFE 4JKYA 3ZD7A 1YVDA 1T6NA 4O2RA 3PXGA 3QPVA 3TH5A 4B34A 4B73A 4Q01A 3RYTC 1CULC 2BOVA 1T5IA 4IOLA 2VHUA 1N6HA 3A1TA 2QSYA 1TQDA 4KCGA 3CWZA 3OFND 3QUSA 2X77A 3BAFA 1KDPA 2IW3A 4RZ2A 2B8WA 1FFHA 1GM5A 4FCVA 5EP1A 2XOKA 1Z06A 2AL7A 5G53C 1G3RA 1C4OA 1QG2A 2F7SA 2NO1A 4GMXA 5FPTA 3K70C 2AFIE 4A36A 2QP3A 2Q21A 1R5BA 5LD2C 4IFBA 4GOXA 3E2IA 3U7FB 2BBWA 5FTMA 2IYUA 4V0OA 1GUAA 4HB3A 2V54A 5DI3A 2ZE7A 4OJKA 5KSZA 3K53A 3QE0A 3VHLB 1UDWA 4JSYA 3I92A 3IILA 2QPAA 2PBRA 5FUXA 2OCPA 4JYCA 5E7IA 5HE9A 5J4KA 4LBYA 2O8FB 3T5GA 5D3QA 5SZJA 4P4SA 2F43A 2VYFA 5TARA 2WICA 4M4SA 1DOAA 3WNCA 1SXJA 4F93B 2GBLA 1Z6YA 3ETLA 1E6CA 1Q20A 4IOJA 1G64A 5CJPA 3P26A 2PZFA 5E7MA 3UXMA 2ZRIA 3PEYA 4MYHA 1LF5A 1Q3TA 2DFNA 1CRQA 4DT1A 3H4MA 1KK2A 4QJ3A 2PJRA 3RRYA 4BFTA 2I1QA 1S1CA 1KI6A 1XCPA 4TN1A 2CL6X 5L3QB 3THXB 5J40A 5HKKD 2Q9AA 2KSQA 1AIPA 1S3GA 1XJ0A 1JPNA 1FMLA 3VU9B 1VDZA 4AC9A 721PA 1M34E 3CR7A 5AJXA 5KNBA 2AR7A 2C5LA 2OAQ1 1P4SA 3B13B 2MMGA 3N5CA 4X8LA 2GEVA 1E9BA 2ODEA 3QSYA 1AS2A 4W5HA 2KE5A 1EFRD 2XNSA 4FMBB 2PMDA 4YMWA 3UK6A 2GJAA 1ZNYA 4KITB 4M9XA 5SZHB 3DVLA 3UMSA 4E07A 3WY9A 2NPIA 1UKYA 2OE2A 4EPYA 3OIVA 4Z51A 1KDOA 1FW6A 4JLDA 3IO3A 1BO6A 4PC6A 4DBLC 2WV9A 5K8IA 4O3MA 1CIPA 2H18A 2VP5A 5EZ5A 3VR4A 5L3SB 2RGDA 1FP6A 4DLRA 3OIWA 4TYWA 5JLJA 2B7BA 4LDJA 2QMEA 2B7CA 4HAWA 1YZNA 5FOSA 2WIAA 2BJWA 3F0TA 2ZI4A 1IN8A 4MKIA 4IFEA 3K0FB 3IUYA 2VP4A 3IHWA 4C2UA 3SYLA 5H1YA 3SJCA 3OE7D 2OFOA 1FMJA 2BMDA 1K8RA 1TF7A 2ZYUX 1OT3A 1M7BA 3HR8A 1XWIA 4L9WA 4C0JA 3PEWA 2ECKA 4D81A 4ITRC 2IEZA 4PO9A 4CEJA 3BRWD 2IS1A 2GTPA 2QAGC 4BZQA 4OQFA 3PG5A 1II0A 1SXJB 3C5HA 2F55A 4C7OA 2QT0A 4TYPA 5J4LA 4GT1A 2L0XA 4DVGA 4URUR 1B23P 1BH2A 2BMJA 4GOJA 3GLGB 3Q5EA 2D62A 2F1HA 2W58A 4U5XA 2QORA 2JCSA 1S3SA 4IDOA 2ZI6A 3LWNA 2WAYA 1TEXA 4D26A 121PA 4LC0A 3WMEA 2VPPA 3LW7A 1N6LA 1IN7A 2X2FA 3FPAA 4JLAA 4JLJA 1HTWA 3CBQA 2A5DA 2ZI5A 4KYIB 3RWOA 2OBLA 3FFAA 4DB2A 3NHBA 3A4NA 3FOZA 4AKEA 3AKCA 3KTAB 2ZRCA 1GL6A 1I4TD 3I4LA 1EX6A 2W6ID 1SVSA 3B2EA 2AXPA 4QXAA 1ZM4A 4BQSA 4C0KA 3QPWA 1S0UA 3RSOA 1NVVQ 1U8YA 4DZZA 2IS6A 4GBMA 3ADCA 3QKUA 1XTIA 1GTVA 5F3WB 2VIIA 1RRGA 2ATVA 3K09C 3NWJA 1CLUA 2GAAA 1KI9A 2GCOB 2PT5A 3A4LA 1SULA 3CIOA 3I32A 1QZXA 1T8TA 3WRXC 1G5PA 4HZUB 3L0SA 1E0KA 3NEJA 1U94A 2C04A 1UBEA 1CR0A 1W0JA 2PT7A 2G1KA 1WBBA 1BMFD 1ESMA 4A8JA 2OBNA 2AFHE 3QBTA 5C2JB 1W48A 821PA 5DHAA 1ZAKA 2RHMA 2GXAA 3M1IA 3KKPA 4HB4A 4IEIA 1OH5A 3U7EB 1NL3A 5EE9A 3GLHB 2WM9B 3A37A 3D3QA 1TMKA 2ZM5A 4TMZA 2IF0A 1UBCA 1GKIA 1ZBDA 1W44A 5TXGA 1EG7A 2R2AA 4HYYA 2ZS9A 1COWD 2QGZA 3GJ8A 1ZM9A 5DYIA 4FXPA 5F2EA 3FB4A 3QBVA 4HB2A 3GQBA 4H1VA 4L15A 4MYCA 4V0MA 1LY1A 5KO2A 1E2NA 4R7ZA 1DBSA 3KFVA 2A78A 3LLUA 1UAAA 4EFLA 2QZ4A 3NXSA 2QNRA 1VMAA 1UEJA 1Z3IX 4H9GA 2KI5A 2ZRHA 3K8YA 2QRZA 4M9SA 3UANA 3VX4A 2DR3A 4V0NA 1E2GA 5M04A 1SHKA 4GZMA 4EUNA 5BWMA 1Q3HA 1C9KA 3RS7A 2YWGA 1X86B 1WBDA 3T1TA 2OCAA 1TQ6A 1XF9A 1Z29A 4BE7B 4URZR 1JBKA 3B60A 1OH7A 4XH9B 2ZSDA 2JATA 3QVUA 2BEJA 2OILA 3K0CC 2DWOA 2OSBA 3CM0A 4XIGS 1NMZA 4LJAA 1Y63A 5FBQB 1TQ4A 3R7WA 2FA9A 4PPQA 1Q57A 1SVIA 3NVAA 1NN3A 5JJKA 2XZLA 4LHWA 5DN6A 2QP9X 1G8FA 1U81A 1ZRHA 1DO2A 1VYVA 3BXZA 3K9HA 4I1VA 1GL9B 3IQWA 1F5NA 5D3MB 1LF0A 5E95A 4NL4H 3MWJA 4IOMA 3KTAA 3MCAA 3IQXA 3MGCA 4G5RA 1IM2A 2ZRDA 5BYKA 2VO1A 2YZ2A 3W8NA 1S9HA 2KB0A 4LYJA 4LHZA 4UKDA 2JLVA 4WVFA 3U3OA 1KZ7B 4Q9LA 4A15A 2EVWX 5E3HA 3AVWA 4DWJA 1E98A 4LK2A 3W5IA 3OF5A 4B2LA 1AZTA 1NMYA 1ZW6A 1F3OA 2GK7A 1CXZA 1VCOA 3AGQA 1XP8A 3K0CA 4EKDA 4RZ3A 4RJLA 1YZLA 2HYIC 3DOFA 1W36B 5DGXA 2AX4A 3AP2A 5J4HA 2V6IA 3JVUA 1ZU5A 2QTFA 4DJTA 1ZIPA 3K0FA 2BBOA 3L0PA 1MOZA 1KMHA 4D4JA 3PENA 4IXNA 1KKMA 3I3SR 3K70B 3GJ4A 3AVTA 3GJ3A 1AK2A 5TY0A 1N6PA 2REOA 5HPYB 3HU3A 2QM8A 2R9VA 3QI2A 4RVCA 4B43A 5ELXA 3U44A 2D7CA 1YRBA 3OEHA 1XD8A 1K6MA 2FFQA 4GSYA 4B3GA 4Q21A 2HUPA 5L8VA 5JJIA 2XSZD 3RRZA 2Q3FA 4EJSA 2BBTA 2EYQA 1I2MA 4OYHA 4YMUA 4QHTA 1XZQA 2UKDA 2VHTA 3ZLJA 4ZDIA 2ZR7A 4G5GA 3C14C 4QHSA 4EJSB 1AS3A 1XFAA 1FZQA 1TF5A 4AK9A 1GKUB 1R2QA 1NVUQ 3NBZC 1VPLA 3HYTA 4NH0A 4ZPXA 5GADl 2QQ0A 2C96A 1Q1BA 4HI0E 3NBFA 5TVKA 3ZIAD 1HT2E 1NLFA 2P67A 2CBZA 2RAPA 3WNDA 3T61A 4DLSA 2F9MA 4TQUS 4A4DA 1X8KA 2Q0HA 3PUVA 4O0MA 3PEUA 3R9WA 1KSHA 521PA 1SVOA 1ZMXA 2HT6A 5EXTA 1OIVA 4KFSA 4I99A 3MSXA 1RZ3A 1N6NA 3FKSD 4NYIQ 4OQLA 4ACAA 2ZRJA 2P65A 1DPFA 1E9EA 4V0ME 1NSTA 1OKKA 3PIRA 1JEDA 3DMNA 4IXMA 4HZUA 4IEEA 2MMCA 1S2MA 3P32A 4DIDA 4HDOB 1ZYUA 1Y3AA 3SE0A 4PZLA 1KDTA 2IYQA 2OUKA 1CJVC 4WA7A 1W7AA 1X8LA 2IEYA 1MT0A 2RGBA 4I81A 3U3KA 1Z0DA 1KGDA 1UFQA 2FZ4A 4JKIA 2ZYWX 3KQUA 2YV5A 4FD2A 2J45A 1XMVA 1LTQA 2AWNA 1NRJB 4L16A 4LV5B 4MGIR 4NYJQ 5HCIA 4MYTA 4DB4A 4PO8A 4HLUC 3ADDA 3FMPB 4RD4A 1DAIA 1JB1A 2NO9A 1MO5A 4EPWA 2J0UA 2RGXA 3WYAA 5DHFA 2PLRA 4HUQA 4P32A 2JJ1A 2F9LA 4FWIB 1U8ZA 4QOSA 1D2MA 4DCNA 1E0AA 3VFDA 3K9NA 1KK3A 1SHZA 4HLQB 3CF2A 2C03A 2WMOB 1O87A 1ETUA 3KKQA 3WXMA 3GFPA 3GEHA 5HKKA 2QMHA 2D7DA 2VA8A 2ZR9A 3AVXA 4AG6A 2NO7A 1L2TA 4MDEA 1P61B 4GFDA 1ONBA 5FOTA 3C16C 4KFRA 4Q4JA 2G9NA 2N1BA 4DLWA 2IXEA 4LYFA 5KPDA 4V0KA 3CONA 4TT3A 4B2PA 4A0HA 2P0EA 4EJSC 3CX6A 2C9OA 2H16A 4TMKA 2CLDX 2H5EA 3NDBB 1E2FA 3K0EA 2ONJA 2TMKA 5LB4A 4M1KA 2GJKA 3SQXA 2XZOA 4JVMA 4KLNA 4B3CA 1JR3A 4KFUA 5EQTA 4DCUA 1XTSA 1CF4A 5AJVB 4Q1EA 1A4RA 2XNDD 1FTSA 4OK6A 4QJ4A 4ZCMA 3W3AA 2V7QD 3LW8A 5FUWA 2CLSA 4NDZA 1ZD9A 1W4CA 4Q4LA 2ZTSA 1OHHA 1TU3A 2UZIR 3DL0A 2JLZA 2OFXA 4I4LA 2RMKA 3TUIC 4OHYA 1G6HA 4QC2A 1R5OA 1AS0A 2NGRA 1CR2A 2NZJA 3OFNA 3QXCA 4LOAA 3T35A 5DISB 4AYTA 2J5XA 3TE6A 2WWXA 4O25A 2NMVA 2BCGY 3EXAA 2RGAA 2ZROA 4DDUA 1OIXA 1Z8FA 3BFXA 3CZPA 2BHRA 3HPRA 3TIFA 1NLYA 2VHQA 1F48A 2ZQ5A 1WCV1 5CIWA 1KI3A 2GCOA 1FOEB 5FTNA 1E1QD 4IJMA 1IY0A 4AKIA 2J0SA 2IL1A 3CZQA 3BJIC 4BECA 4R2HA 3RS3A 2QUZA 2V7QA 4A0RA 5KNCA 3I5YA 1P2UA 2CDNA 3AGPA 1HA3A 3B1VA 4CEHB 1VG9B 1FP7A 3MFYA 4MUAA 3THYB 1W4BA 4GZLA 3WHLA 2REBA 4LUCA 1J2JA 4Q7LA 3QQ5A 1JR3D 2J46A 2QTHA 2DHRA 3ZVMA 2C77A 2P3SA 2ZRGA 5CJ2A 3UPUA 2V4ZA 4FIDA 4JSTA 1VTKA 3KJEA 2ZANA 3O8BA 1OFIA 2RCNA 1JXMA 2Y8EA 5J4VA 1MKYA 4M1YA 3O47A 2QN6A 1SVKA 1RFLA 1R10A 2BM1A 2NZ8A 4GP7A 1OV4A 2GWHA 3QKRB 4QGFA 1W4RA 1QG4A 2IYTA 1R0ZA 2P6RA 1EESA 1YZTA 2CL7X 4CDGA 1JAIA 2AD5A 3AP1A 1VG1A 2A5YB 3EIEA 4C7OB 5BN5A 4NONA 1TQ2A 2IYLD 4JVLA 4OI1A 2ZU0C 1DADA 2X8AA 1G5TA 4JLVA 1RKBA 4LSGA 3W5JA 5AUOB 4G3XA 4C0AC 5ANRB 2ZS8A 4B47A 4Y0AA 4URWR 1EFTA 1KY3A 3L0IB 1RE0A 1P3JA 1UDXA 2FMXA 2WWIA 4C0LA 5GJBA 5KOYA 2KWIA 5AUQA 2HLDA 4BFSA 1U9IC 2OBMA 1N5LA 2D3WA 1G1MA 4C4PA 4Z1MD 2FGJA 3PUZA 4M8NE 4RKFA 3IIMA 4TWZA 1CJMA 2AXNA 1NBMA 1MO3A 3UKDA 3IKJA 3EA0A 2GESA 3ZJYA 4TLAA 2QBYA 2JDID 3I5XA 5FBLB 1GDDA 1RRFA 2NOAA 2HLDD 2ZITA 4L4UA 2JLSA 2X2EA 3CF6R 4Q4HB 4YMSA 4Z1MA 4A92A 3DDCA 3IEVA 5EE3A 5JS7A 4RKEA 3EX7C 2W6JD 2H92A 1CKEA 4QNMA 4NU0A 3BERA 2GCPA 1LS6A 2FZLA 4RY2A 4GPTA 1SKQA 4M1MA 2O8EA 1S9DA 2GJ9A 1RYFA 3DO6A 2DYKA 3SYNA 3K09A 2BMEA 3FKSA 1VHLA 2J1LA 4HAYA 1US8A 5FH9A 2ZI9A 3LX8A 2PZEA 3ASYA 2WOOA 2CJWA 3KUCA 1Q1EA 4ZI3A 3FMOB 4ASUD 4QBIA 3E70C 3W6PA 2HXSA 4L5BA 1ZM7A 4E03A 4AD8A 1QHIA 1U99A 2QBYB 4OHVA 2YOGA 4DLVA 4AKGA 5KU1A 2OXRA 3Q7QA 5CM8B 1LW7A 1TAGA 2OZEA 3FMIA 3I73A 4AG5A 2VF8A 3I1FA 4PC1A 2A5JA 1HY3A 4P33A 1YZKA 4BLQA 3Q7PA 4LYAA 4M53A 5B57C 4PHHA 1AKYA 1HYQA 3FTQA 1GL7A 2VRWA 3AKEA 5CDFA 1KJZA 1OH6A 4CW7A 1VCNA 3TAUA 2F1JA 3BS4A 5GJWC 4LHYA 3ICEA 4Q48A 2VP0A 3SQWA 1KMHB 3SBEA 3RC3A 1Z6AA 4HAVA 1WQ1R 1E1RA 2R6AA 4NMMA 4D0LB 3AUXA 1NG9A 1OXVA 1P5ZB 3IO5A 3ZD6A 1MH1A 1U8AA 3A1UA 1E2MA 2O0KA 3ND8A 2ZJZA 2FG5A 2JJ2A 1I4DD 4HDQB 5AJZA 1CJTC 5EJEA 1KY2A 3WYGA 4MRNA 3ZZ0A 1LFDB 1P2SA 2C95A 2RGCA 4H1UA 2HXYA 1CEEA 3L43A 2KJQA 2OV2A 2JIZD 2QAGB 2ZRMA 4KXFB 5JRJA 2IXGA 1G291 3KXIA 3LXRA 1GRRA 1E1QA 3KQNA 1NJFA 1Z28A 4W7SA 2PZGA 4CEIB 1XCMA 2I1VB 5IF9A 4HLCA 3GJ5A 3LO5A 4RZUA 1S4QA 4LJ8A 3FFBA 3GJ7A 3B8HA 5DYGA 4E5UA 4IDPA 4V03A 2CMKA 4AY2A 2OO7A 2W2VA 4N0EA 4W5JA 2X19A 2XNDA 4D80A 1OXSC 1OFUX 2QT1A 2K5UA 2OLKA 4JLNA 2IXFA 4TYQA 1K5GA 2O8BA 4WXPA 3CPJB 1QHSA 3N2EA 4ZKDA 4EPRA 1BS1A 2ERYA 4B3XA 1N0UA 1IJFA 3H1TA 4Z8YA 4A0GA 4D4MA 4A6PA 1IHUA 1OYYA 4Q5IA 3B82A 3AVPA 2VF7A 3DKVA 3AUYA 2WPDA 2Z4RA 4HLDA 1E9RA 2BBSA 4G5SA 2WMNB 4C9BA 4EIWA 5JHHB 3EIQA 3TUZC 1G8PA 2HCJB 4BFYA 2W0MA 1NP6A 2CJWB 3PFIA 4DUGD 5A0FA 1LNZA 2Q6TA 1XB2A 1OB5A 3WHKA 1BYIA 3NG1A 3O8RA 4PSKA 2BC9A 4TT3D 2HF8A 5KSYA 1KO7A 1XD9A 2A3RA 2XXAA 3KQLA 2BMFA 4IDQA 1FNNA 4ZIRA 3R9XA 3FVQA 4IVPA 2GEUA 1YHNA 3EWAA 4HAUA 1TADA 5LD2B 1M6NA 1ZCBA 2QG6A 4CRWB 3GLHA 2Q3HA 1Z08A 1KKLA 1OFTA 5FL3A 1JXOA 1GSIA 1R0WA 2Z43A 4DT1B 1ZVQA 3B1XA 3U60B 3TR5A 1QHNA 2C99A 3SFZA 4C0SA 1EX7A 2PH1A 3H86A 3KB2A 3HP1A 4E22A 1Z2CA 5FPKA 5EXXA 4ARZA 1Q22A 3C7KA 4ZDJA 3WBJA 4NCHA 2FE4A 4IHQA 2RB4A 3S1AA 1KAGA 3AKDA 3H84A 4FMDB 5KSPA 2VQSA 3BFVA 2DBYA 1L4YA 4HB0A 5CK5A 4AI6A 1L7VC 1YR8A 5DI3B 4TTPA 2FSFA 3MUFA 1EXMA 1MRSA 1N6OA 3I8XA 2VBCA 1BKDR 3CWQA 4M1TA 3TGPA 2R6DA 3SNHA 2G6BA 3BIFA 2DWQA 1W1WA 3GMTA 3DZ8A 1UJ2A 3TBKA 1IN4A 4X8OA 4XVQA 3CF0A 4PZZA 4JBWA 1PZNA 3UG6A 2V1UA 3GJ0A 5TV2A 4C0HA 2IYVA 3S1AB 2Q9BA 3U3JA 1XRJA 5LBIA 1XCGB 3BD9A 3VX3A 3QKSA 2ANBA 4CGZA 5FBRB 2PLFA 2XX3A 5C18A 1G8YA 4BLOA 4D4LA 1N6KA 1VECA 1Z22A 3BOSA 4PANA 1G16A 2W0SA 3W8RA 3ZQ6A 1ZNZA 1VG0B 2GETA 2LCFA 4E09A 2WBLC 3EG5A 2AWOA 1KSJA 4QNRA 2LKCA 4M22A 3FHOA 3LQRA 3QKTA 4G0NA 2ZU6A 4NCJA 4DSUA 2WJYA 1P72A 3BORA 1D2NA 3CX8A 2O8CB 4EFNA 4B6FA 4HAZA 1IN6A 1FTNA 1KO5A 2ZRBA 3I72A 3AVQA 4KVGA 4XOIA 3MG9A 1Z0KA 4QFMA 5FPHA 4B32A 2CNWA 3Q72A 3CUEF 2PEYA 2D2EA 3REFA 4RCYA 3EZFA 1X6VA 5DLQC 2YOFA 1L8QA 1WA5A 2OT3B 3TRFA 1GP2A 3SOPA 4MRRA 3CRRA 4GNKA 3KJIA 4U02A 2IBMA 4MGZR 5EUMA 3TSOA 4CT5A 1YQTA 4B3BA 2R6GA 1J7KA 1N5KA 2F3RA 2WOJA 3GJ6A 2CXXA 3OAAD 1H8HA 3OESA 1WE2A 4YDSA 4AKHA 1EFUA 4HATA 1CTQA 2Z0MA 3THOA 4A8JB 5F9FA 3NEYA 1KO4A 1F2TA 4EAQA 4LYHA 8OHMA 4LI0A 1IXSB 4M0LA 1FUKA 2OLJA 4OK3A 3TJZA 4G01B 1E96A 2KBFA 4AIIA 1NN0A 1XEXB 3R8FA 1XXHA 4PSAA 2I3BA 5FFMA 3ASZA 3AB3A 1IOZA 5L3QA 1D6JA 3QOFA 1TPZA 4OJQA 2HF9A 5LB2A 2GRJA 1GVNB 3SHWA 3BE4A 1Q1QA 3L8YA 2BJVA 1P60A 5AR1A 4FMCF 2UZ3A 3WMGA 4A0FA 1H8HD 4FI3C 1T3HA 4RCZA 2CCGA 3KKNA 2J0VA 1XD2B 4F7WA 2BKEA 4EPTA 1Z0IA 2YVUA 1WDTA 3NTUA 3MAAC 4L9SA 5DN6D 4P4SB 5F9HA 1JALA 3X2SA 1GRNA 1M7GA 2IX3A 2CCJA 2CVHA 2QEQA 5P21A 4Q1FA 4PHTA 3AF4A 5BW8A 4I1UA 1X1SA 1D8TA 1T9HA 4Q4AB 5CB8A 1X1RA 2FPMA 1E3MA 4X8MA 4LGMA 5KDLA 1I2DA 1W0KA 4ZCLA 3QIAA 1JAHA 3K0AA 4OHZA 3BBPA 1XMSA 3LNCA 3EPKA 1VCIA 2IYXA 1Z0FA 1NVVR 2Q9CA 3EC2A 2FEMA 4P4UA 1DO0A 3CH5A 3I8SA 3L82B 4DDWA 1T0JB 2ODBA 2RKOA 1D9ZA 4JL6A 3T12A 4JZKA 2R44A 2IYYA 1XEFA 3HU1A 1L4UA 4II7A 3A6PC 2H8KA 1O3YA 2N46A 4YMVA 1GNQA 2QQEA 4KV9A 2QI9C 5FOVA 1PUJA 2W2TA 3EPLA 3SJAA 2WWFA 3LH5A 4LRWA 5K8LA 1Z0AA 4QL3A 5KNDA 4KVAA 4OHXA 4HDCA 4XSHA 1Z47A 4GL2A 2JASA 2IK8A 2FWRA 1Z2AA 2ZSAA 4PQYA 3VAAA 4C0BA 2GZAA 1G3MA 3IDQA 3ZQJA 1E2EA 2E9SA 2CHGA 2FNAA 3EZ2A 3LA6A 2YYZA 4OHWA 1NLZA 3K9LA 3IBYA 4YQFA 2V8OA 2FH5B 4EQ6A 4Q7MB 2DB3A 1NBME 1YJ5A 2GVDC 1P6XA 5L3VA 1G7CA 4UXHA 4IDNA 4LJ5A 5KTYA 1BMFA 5FOUA 2RGNC 3J81k 4LPKA 1RC8A 2BDTA 2QA5A 4UXJA 5EP2A 2BVNA 1II9A 1KO8A 2O5VA 4ZV4A 1HURA 4JL5A 1EK0A 3TSWA 2G0NA 5BN3A 4WAUA 1KNXA 2XAUA 5AUPB 1D9XA 4YMTA 5LPNA 221PA 3B1ZA 3PITA 4KO8A 2RGNA 4PAQA 4TLCA 3KX2A 2P6UA 1A1VA 4P3YA 2DCUA 1OPXA 3FYHA 4CYMA 2ERXA 2MSCB 1NI3A 1P9NA 2IYWA 2OEPA 2AD1A 3RS4A 2ZPTX 3TQFA 1M7HA 1XJQA 2WAXA 2ZRPA 3Q8XB 4UXIA 4D25A 2C9YA 4PTLA 4KSBA 4BPBA 2N42A 4W5WA 3THWA 3AP3A 4A2PA 2ATXA 2CE2X 2FDCA 2ZJ5A 1DVRA 4XWOA 3HDTA 5B64A 3BK7A 1E2PA 2V6JA 1D5CA 4PQRA 1HUQA 1TUIA 1R0YA 2KBEA 2WPDD 2ZYVX 3CX7A 1P9RA 3MRSA 1KI8A 1MRNA 3Q9LA 3PEVA 1DG1G 1G7SA 3X1YA 2GDJA 4N3NA 3G5UA 1F60A 2WSMA 2D2FA 2XITA 3QKRA 4FMCB 4IVQA 1NF3A 1E9AA 2QMOA 2H17A 4B2IA 5G40A 3QG1A 3C8UA 3ZZUA 4NYMR 5TMPA 2FV8A 4WZ6A 1E0SA 3OE7A 5EE1A 4JBYA 1UBGA 3BH6A 4Q7JB 3B6EA 2DWPA 2VP6A 3QEOA 1IBRA 4HAXA 1G41A 1OXTA 2XZPA 1ZNWA 4LJ9A 1FPMA 5FOXA 3R8CA 3QF7A 4WZBE 4S2EA 1SXJC 3ZVRA 1DG3A 4BLTA 2SHKA 3ZVNA 4RFSA 1YZUA 1ZD8A 1NKTA 4ERNA 1M74A 4LCBA 3QF4B 3DM5A 2QGNA 4JVNA
chains in the Genus database with same CATH superfamily
2XYPA 1L4KA 3EAQA 4ZMBA 2WJIA 1XTJA 1J0EA 1PJCA 3CLVA 2PVSA 3OIYA 4S1TA 4WW0A 1XLWA 3N7AA 4WVLA 3CRVA 4DV1B 1UKCA 2B1JA 2ZRFA 3E9RA 4XGIA 5SICE 1JIIA 2AN4A 3QITA 1N2IA 3NHRA 4JH0A 1JQLB 1YO6A 3CZMA 2B4TO 3FYCA 4MSUA 2FOXA 3TIVA 2Z1MA 3T1VA 2EJVA 2FETA 3ZU4A 1WP4A 3WGIA 4DV5B 3SN6A 4BLPA 3ZX5A 2JARA 1DSSG 1NOJA 1ZBQA 2NTJA 3FHCB 4IGAA 3RU2A 4CWAA 4GPD1 5K6RA 5GGYA 2P6MA 3CR8A 2WSSD 1WCWA 1NVKA 2A5FA 2V5AA 4YWJA 1JR3E 1E1RD 1E18A 4DR4B 4XCVA 2WVJA 3SJ7A 3GCXA 4KODA 1CFZA 1SUAA 3QV1A 2Z58A 5JISA 4JROA 3SS9X 1B74A 3UB3A 3BHNA 4OB7A 3ZDFA 1RVDA 2VSFA 3DFIA 5TMDA 1L1EA 5IDVA 2C88A 2QRMA 2NXWA 2QLFA 1KORA 1N25A 3AOEA 4K7JA 1IZ7A 3IIIA 1A88A 1Z6GA 5E3IA 2WVHA 3GC6A 2Q8PA 1I1OA 3EWSA 3TL2A 1I7QB 3V7FA 4R16A 5K3DA 4A0SA 2VAXA 3ZPXA 1CUGA 1U1GA 3OFSA 1U2DA 1QO9A 2IH4A 3B3JA 3EZ9A 4DJDC 4XB1A 1JNYA 2OUIA 1CJBA 5G0SA 2O8CA 3ROKA 2XGJA 1P75A 1Z6XA 1PFQA 3BIXA 4EUKA 3Q3GE 4QFCA 2ZS7A 3TKYA 3AHCA 4RTJA 3MA0A 3EC1A 3FNRA 4ZRDA 1ZUIA 4BFVA 4DLLA 3CJTA 2OBFA 3GUCA 3QXXA 3U81A 2IYOA 4LF8B 3ORYA 4DLXA 3AINA 4N03A 2F48A 1IVYA 3K1JA 3LGAA 3C98A 3CKLA 4J0QA 1UXJA 4AL4A 4YC7A 2PA0A 2VHJA 4JJ4A 3U7RA 3C3EA 4C1NA 1TYZA 1KI1A 3N0VA 1GFIA 1X7DA 4IS3A 4NCNA 4D9NA 1CZRA 4V0SA 4QYSA 3HXOA 3BMQA 2WFAA 1Y7HA 3VQTA 2PX5A 2G04A 1MMFB 2QVZX 2VL7A 3NC1C 4U7WA 2Y3IA 3ZWPA 3ITDA 3M83A 4PAMA 3W2GA 4EW1A 2QPOA 4BNDA 5TX7A 1OLOA 2OV8A 4P3XA 3OZDA 4ND6A 3AG5A 2PWBA 5TSDA 4X7MA 1ULSA 2A4MA 1JDBC 1DCKA 1ZGBA 3T1OA 1PF7E 1CF2O 3WJAA 1OQAA 3FSGD 2OVFA 4MVXA 1FY2A 1UMCB 3KEGA 3P2KA 1LW6E 1VIMA 1FYEA 1CEEA 5BQ3A 1ZHHA 4ND8B 4MIEA 4X3PA 1KDRA 2O2DA 1K6IA 3H9QA 3AVUA 1OBFO 4PGMA 4WEQA 5K3BA 4TMYA 4MVJD 4WXEA 1P2TA 1DAHA 2WSLA 3DUFB 2XHEA 4W99A 4M87A 1KEEA 2JDIA 4MVJP 2ZBVA 2BGGA 3L0DA 4KQ6A 4LQLA 5CR9A 1M0TA 3I2JA 5JSYA 2PMKA 1QANA 1NG1A 4BKQA 3LNTA 1E59A 4NPHA 4LY0A 3TECE 1NASA 3R0JA 4BZPA 1GSHA 1QORA 2BH9A 3E9EA 2PQMA 2NVOA 4ENSA 3W5HA 1J23A 3IQIX 3LC0A 4M1OA 4OSOA 4E1AA 4EFKA 4WKBA 4YROA 1N7JA 3U4GA 1ID8A 1UKVY 2YVKA 1RM0A 3IVMA 4FYWA 4KQGA 2RC6A 3RIYA 1AKEA 3G7UA 3QMVA 4PIMA 1UPBA 2GPNA 5HIKA 1Z25A 3JALA 3MINA 4RD1A 3QW2A 5FWNA 3D6NB 3ROZA 1SBNE 2XDWA 2I8LA 2GRAA 1FX0B 2ZUBA 3FI0A 3H83A 4Y3UA 1VJGA 1E58A 4BEJA 2IU4A 4L74A 3B48A 5FPPA 3UAGA 1KSGA 3PJRA 1V1MA 1L7PA 1H65A 3BTSA 4QYWA 1MW9X 5DX8A 2E5LB 1QQ6A 3TL3A 1IJKA 4CNBA 4ZYZA 2WIKA 2FU5C 5EJIA 1TZJA 2HT1A 3X1XA 1UWVA 3WQHA 4BB6A 1IY1A 5F4BA 1L3CA 1V7CA 2KMLA 2VNKA 4MW9A 2I2DA 2V4UA 1Y3HA 4E1BA 2IEDA 2HPHA 1ZSNA 2HJGA 2H7VA 4RORA 4BNXA 1PYDA 3L7NA 4ZEOA 1TJ3A 1TYBE 4M6WB 3MTEA 4OQDA 3PVZA 2D5IA 4P3NA 4QAQA 4QTTB 2UZ4A 3HWWA 3FNQA 4LW8A 1HKUA 1JU4A 1KZ6A 1FUUA 2I22A 3WLPA 1KL7A 3SF8B 5KQLA 4TSFD 5KWJA 2H63A 3EAFA 3EMBA 2DQSA 4XGNA 3UGQA 3ZU5A 4D9CA 2GZHA 3PGA1 2DFTA 2ZJBA 5F2OA 2VLIA 3UAXA 5KKAA 1BOFA 3FCEA 4FDLA 1IJBA 1E7WA 5HF9A 5BUSA 4ZT2A 3GLSA 1AMUA 3FHLA 3FPLA 1N7HA 3D5QA 2GJ8A 3H5WA 1FP4A 4I46A 4WBSA 1K5DA 1QWOA 3DBRB 3LX5A 3M1AA 4MRMB 5EGNA 2N1MA 1RM5A 1PNOA 1P18A 5JCOC 4WPGA 1XRLA 3P1JA 4WACA 3U9TA 1BW9A 1JGTA 4B6SA 3TZ6A 2A9KA 2ZAIA 3V8EA 1HG0A 4LXQA 5ELLA 1GIAA 4KQJA 1E7MA 1OV6A 1KEZA 5HTKA 1JR4A 2FHPA 4E5KA 1E6KA 2C20A 2HAEA 4UQLA 1O94A 3WSTA 3VO2A 1AJEA 1MA0A 1R4MA 2AFRA 3LT0A 4AY4A 2KPOA 1R8QA 3IPAA 4YJHA 3WGHA 5E2BA 3P27A 1NBEA 2BF4A 3K9QO 2K87A 3QPBA 4BNZA 4DABA 4DEYA 1MD9A 3BF8A 3NC0C 4CIDA 3G2OA 3QLTA 2G9QA 2F1RA 4JITA 3VPGA 5DRYA 3LQ4A 4O08A 2O8FA 1E94E 3EULA 1OZAA 3LXXA 2Y9MB 2G70A 2NIPA 2GILA 2AK3A 2WC1A 1YCHA 2X6TA 3HUDA 3DMTC 1AUOA 1A98A 4JYAB 1LRKA 2Q07A 3UEOA 1TF2A 1PNQA 1W19A 3NM6B 2GPBA 4O4HB 3HKDA 1YS1X 1O97C 4KJXA 3DOEA 1S2NA 3GGPA 4KFTA 3QEJA 3WKDA 3JCZA 1GG2A 1T4CB 1WVMA 3IUPA 4HEA1 4ZHQB 3TNJA 2FFBA 1RI4A 2J9ZB 4JBXA 5ECWA 2WFLA 1A82A 1EVEA 3FFXA 4QPCA 5IJAA 3VHQA 1Y1QA 4BPRA 2R65A 3DTNA 4GZ3A 4ZREA 4CKZA 1A9XA 2UZ0A 5BSFA 1EQUA 1A04A 4KPEC 1Y5LA 3D0RA 3GX1A 1QDUA 4RHXA 2ZUFA 5IJ9B 3GGDA 5G1NA 1N2EA 1VYHA 3WGOA 3FHTA 3WLTA 2WRZA 2O6LA 3CC8A 4LE0A 3KAQA 4BJ5A 3MJDA 4QQNA 4HQFA 5BYJA 4RD3A 2FF5A 2XKBA 2YN4A 2ZB3A 4YN3A 1WU7A 421PA 2W00A 5B3JA 5KKNB 4A6XA 1V45E 1BQEA 3HWSA 1QIGA 3HR7A 3PDIB 1FS6A 4FNOA 5DK4A 1UPUA 1LZKA 4MV7A 1NVXQ 1I9CA 3GLFB 2CSXA 2AOTB 2YV1A 4EG8A 2WMYA 4HTFB 1AGPA 1CDOA 4LEIA 3BH7A 3VC2A 1IYZA 2E0IA 3VTFA 5DI9A 1R9GA 4ZIRB 2G3YA 1GNPA 1SCUB 2O2ZA 3IIKA 3A11A 1YKGA 4FB4A 2O0HA 2BHTA 2WUGA 4LE2A 4D9KA 3KSBC 2GKSA 3HHEA 4R0VA 5JNVA 2H5IA 2YHSA 1MQ8B 1YGYA 3OQNA 4BFXA 2PE5A 1R0LA 5A71A 2N0SA 4WJZA 1C7EA 1OPRA 2CE7A 2GR9A 2K2QB 3NGMA 2E6UX 4ZJZA 5A4KA 3EXHB 2ZRAA 3KR1A 1JI3A 1JHVA 1SCIA 1E1NA 2NQ2C 2ZJFA 1Z4NA 2VF4X 2NU9A 1NIPA 3KZ1E 3ENNA 3R3UA 4RQUA 4X60A 2NYUA 2D2VA 1P1FA 4JYPA 1G21A 3TNFA 2L2QA 1CR1A 1XZKA 2QPTA 2UVPB 1PL6A 1E69A 1PD1A 4RDCA 3SGLA 5KOHA 2ANCA 5DSZA 1J39A 3ZWVA 2XVMA 2Z57A 1C1XA 2YIDA 4R1UA 4HFMA 1CD5A 1K63A 3AFNA 5E0KB 2OV3A 3QVGA 4HSEA 5REQB 1EFLA 9ATCA 3L7LA 1J1IA 2OD2A 3E8MA 3EUWA 4UPEA 3UICA 1G3IA 1TPYA 3C2QA 3L1IA 2C5HA 4WHMA 2AB0A 1FMTA 2JIMA 2XODA 1WD5A 4RFSB 3ZWBA 1E32A 1IOLA 1WHTB 3NJ8A 5LXTA 1GTL1 3A36A 3ELUA 1X42A 2D3TA 3DO5A 2AI1A 1KYQA 2EKBA 3B5JA 1HSZA 3IPRA 4I14A 4C2AA 2Z9CA 3GJXC 3C5CA 1GZVA 3WQQA 2GA8A 2XGOA 3NTRA 1B6SA 1W5TA 3AYXB 3PYMA 1YQQA 2D74A 5A4MS 5JRZA 3THWB 4JY7A 1QP0A 1TMGE 4EDFA 1OX5A 1QK3A 1RJ9B 5IDYA 1L5HB 5JCOA 2WT9A 2YXLA 4O1HA 2BRUA 5DULA 3D0KA 4J1TA 2RONA 1U5BB 1VSVA 4I8IA 4RLSA 3LE8A 2HDWA 3REOA 5DGTA 1M2FA 2D0IA 4K05A 1JSLA 3HY3A 2CJXA 3GFGA 3TTVA 5E7JA 4B33A 3E9QA 1AGRA 4MS4A 3OZSA 3E0QA 4GRAA 3KD2A 5A03A 3QFSA 4B4DA 2ZAOA 4IIVA 1YJQA 3GMIA 7REQB 1BWSA 2BFCA 1J90A 1QFYA 1V3UA 5F3RA 1WETA 2PGXA 2Z6VA 3MC1A 3NM5A 2QUBA 4CIAA 2DPHA 5A1TA 3R4VA 1YQGA 1EA5A 4FDAA 2EJTA 4D02A 1MO6A 2FQWA 1OVGA 5KMGA 1EUDB 1G3UA 1YS6A 1YRAA 4MGYR 4UPVA 1H66A 3BB3A 2ZBDA 4BFCA 2PUAA 2GM3A 4MS1A 4X1IB 5GJCA 5A5EA 4HR7A 3WYCA 2RDMA 1EM8B 1A1SA 5AJYA 2W43A 1KMIY 2AHOA 3FVVA 4P4TA 4Z8XA 4BKMA 3SHFA 5BUZA 4LF4B 3FDIA 3WGNA 2XYQA 4FC6A 4UDNA 3TG2A 1NVBA 4BP9A 2QJTA 3WV5A 4LRUA 6REQA 3PUXA 9ABPA 4Y6GB 2AJ8A 1O0CA 2WF9A 2ZGVA 3N70A 4TTQA 5CIQA 3A6EA 1RYHA 4CT0A 2ZE6A 3OF3A 3QVJA 4Y1GA 3DMHA 3R6LA 2P4SA 3A9RA 3HDHA 5ENDA 1U1DA 2FZ5A 2ZB4A 4ZN6A 1PT9A 1H2RS 1XVUA 4HEQA 1PUIA 4CR8A 3NYWA 4HMPA 1R8SA 4IJ5A 1JKXA 5BN3B 5IFKA 3I61A 2X8BA 1DDIA 4F71A 4PC3A 3OPVA 1GRQA 1Y5IA 2JGEA 2Q5JA 2YICA 3BQMB 3ILXA 1AD2A 2V7PA 4KVFA 4O4JF 4PVDA 1ZM3A 4EITA 1FDIA 5ITVA 5KTOA 2JGRA 3BWEA 3HLYA 1T5BA 4ISBA 1UADA 4U7HA 1KI7A 1LDGA 3G0BA 4QSMA 1PEAA 1ZRSA 3E7DA 1GHTA 1DIRA 5ARBA 4DPKA 1VHQA 4YJ3F 4I5EA 1Q0LA 2DH6A 4EWLA 5FBWB 3SPXA 5SZIA 5ETJA 2WD7A 1PR9A 1WEHA 3A1VA 4OHFA 2FUEA 3PHGA 3V1LA 2ORIA 3KQWA 1W76A 2W4IA 6YASA 4OKIA 4JLOA 2O2YA 4Q47A 3TZLA 3E5NA 1II8A 3HZRA 4MGHA 3SDBA 4BWYA 4N3BA 4FGLA 2Q4EA 4IQFA 3H4TA 2H1LA 2MIIA 2B4QA 4L08A 4D82A 5LZ4A 4RPLA 1KEKA 4KMSA 1J49A 3VOBA 5D85A 1TA9A 1T34A 3LPLA 3LRXA 2C94A 3L6UA 4OHRA 3BGDA 1G20A 3OTGA 4BP1A 5E8RA 1MAHA 3ZH9B 4MI9A 2W6OA 1H1DA 5AI9A 3KKLA 3V42A 4X1YB 3LGSA 2YN0A 3HFSA 4LFAB 4OI4A 4QNNA 4ZD6A 3CMCO 3RAEC 4ACBA 3ULKA 1PTJA 1VHDA 2MINB 2QZZA 1PWEA 4URXR 3GJQA 5DMXA 1V48A 1XLTA 1D2CA 3BVPA 4Q4AA 1LQTA 3KWMA 4ZWNA 1V37A 3H8VA 3K9GA 4O4JB 2IYFA 5ALRA 5LDHA 1L3IA 1KFBB 4RC9A 4DUZB 4W5QA 4WX2B 3K0AB 1L1FA 3TK1A 4JENA 2LCIA 4H7IA 3FF4A 4U6QA 4EAAA 4MTLA 2WHEA 4IIYA 2YV2A 4UTRA 5EKXA 2JCYA 3ONWA 3PJGA 4A82A 4NLLA 5EHZA 2YHIA 3EF0A 1BMTA 2JKVA 2WTAA 4AURA 3IQGX 3VNUA 1M2KA 2OORA 3D7LA 2AG6A 2GAFA 3TNLA 5PNTA 2IUSA 2B2XA 3L8CA 1YRHA 5F1KA 5TMBA 1T9AA 1VKHA 4K3UA 4NEHB 2WWWA 3B1WA 3W05A 4QATA 5AK3A 4HUJA 2O23A 1PDVA 2XBMA 1QH8B 2A0XA 1G0NA 2RAFA 5DBGA 3GZJA 2I3DA 4AG3A 4LX0A 5HIIA 2J9RA 2JKYA 4KU4A 4EABA 4DXDA 1E0JA 3FTPA 4YCDA 4L0MA 4NARA 4NS1A 1E2IA 2Q1WA 2IC5A 3NHAA 3QJYA 2D1TA 4RVGA 1HQKA 3SJZA 1OFHA 3C39A 3VNVA 3BN3A 1ZIXA 3HXPA 3H5LA 3RC9A 1AQJA 1QGOA 2CMGA 1PZFA 5IJWA 5E6RB 2DLCX 4HGRA 4B87A 4UAJA 3O3NB 3TB4A 1CUWA 2W2XA 1BXZA 1W0KD 2XCLA 4TMTA 5C8YB 4CXMA 4RYLA 3EIHA 1X1EA 3C3MA 2BFFA 3LRPA 1KZHA 3PFCA 4B82A 1BQ4A 3OEHD 1IAVA 1ODFA 4NH4A 5LLDA 4EZEA 4NULA 4A1FA 4LJ6A 2F3QA 2MYTA 2FWNA 1WAMA 3NRJA 3VAZA 2IH2A 3UMRA 2WTMA 1KBOA 4H60A 3F6SA 1O5OA 4HDMB 1E1KA 1RJEA 2WA2A 1JG6A 1OWMA 1GGEA 1SQGA 3A1DA 3JWPA 3OQPA 2F8MA 4TXMA 4UUMA 4PR0A 3PFBA 4BMZA 4KSCA 1M1UA 1P3DA 4MEJA 2GZ2A 2JCXA 3KLPX 4KG7A 3BWCA 5BXQC 2PAFA 2ZVQX 2WJWA 3VHXA 2FZCA 4BV2A 1FNCA 1NZFA 1P62B 4EGAA 5BRJA 1HEYA 1H9BA 1HOXA 4B8WA 4MS1B 4X1IA 4ARSA 1XO1A 1FTWA 4R2IA 1OTYA 3EEIA 3N2KB 4FB5A 4MVJG 3BMXA 4TTSA 1VKOA 1ZO8A 2ACEA 1RJGA 1CUCA 2BWJA 3KOMA 1ZUNB 4X7BA 5TR9A 2CXPA 1EFRA 3S2GA 4F2PA 1NW9B 1Q19A 1UZNA 4YRKA 2X8LA 3H1AA 2DTXA 4FBLA 2GASA 2IYRA 4M36A 4ZU6X 3IT1A 1FDVA 3I1IA 3V32A 4DPMA 1EK2A 4GLJA 1NN5A 4EEKA 2OR3A 2FJ0A 2X5NA 4NZ9A 3DDSA 2QIOA 3IP1A 5FEMA 5TPWA 1FLAA 4CQMD 3L6CA 1ZL2A 3P8ZA 4JB8A 1SZPA 1Z4PX 2O52A 3PQEA 4WDQA 4II2A 1W5SA 4WKGA 5BW5A 1PN3A 2JFPA 4ARUA 3PCRB 3ZCQA 1DJLA 1YZGA 1KMCA 3PD0A 1ZR4A 5LA6A 1H6BA 3FWPA 3OA0A 4Y2VA 5A6SB 4WKPA 1XPOA 5D3MA 3VR5A 3PJEA 2RG7A 2FLVA 1EGMB 2B0CA 4YIHA 5LZ9A 3TW8A 3OX2A 2JCBA 3P9RA 3OKFA 1A71A 1I14A 4IDAA 1Z7EA 4MA4A 1UOEA 1K8YB 1WV0A 3VOAA 3GEIA 2WTBA 1OYOA 1KQOA 4FCTA 2IKQA 3R5KA 1AN9A 4F8JA 3LGXA 5L7TA 5DNAA 4FN5A 3H5TA 2FWJA 1VPVA 1UK8A 2V7XA 2CHFA 1NA5A 2PFKA 4LJSA 2CYAA 2HV8A 3ROEA 4BWFB 1FFSA 3IEXA 4C1BA 3J7TA 4ZRNA 1E89A 2QGFA 1NMEA 1D1PA 1QMPA 2RHGB 3NUQA 3ND9A 5IC6A 4AJ1A 2ZB2A 1F2UA 5IBPA 2CLCX 1OI2A 2NZVG 5K1ZA 1YV9A 3GGJA 4PSDA 4R01A 3RPEA 2PKRA 1ELOA 1X0VA 1X3SA 1CR4A 3NBQA 4LJKA 2C9ZA 5FFNA 1Z07A 4WFIA 1AQYA 2H65A 4FHZA 4KUHA 3AJRA 4HQLA 2HLNA 2GXQA 3TLZA 3R76A 1PGNA 4WOBA 1Z3CA 3V6LA 1DIBA 2EERA 1RZUA 1W59A 5DIFA 4YCNA 1M73E 3QNMA 2UVQA 4URYR 2C7RA 3LKBA 1YK0A 1E4OA 4WN3A 3TLEA 1NXXA 1WUHS 2H5JA 3CUKA 2W42A 3RJMA 2J4DA 4I19A 1V43A 4G1CA 4KYUA 4TGLA 3OJEA 4C5CA 5HRAA 1AKVA 1Z9BA 4PNZA 2FPGB 4DNPA 5AW0A 3ELDA 4OATA 4JP2A 4YPVA 2NU6A 3S55A 2NTYC 4CL8A 5DHPA 5HBRA 3IUSA 2HBRA 2BTEA 4OH7A 2H1HA 2ZYAA 3N58A 4FOSA 3GT7A 2QW8A 3G9XA 4YRQA 1U63A 1T1RA 3KL4A 1ARZA 1N2ZA 3KUKA 4B3FX 1Q7BA 5LOVB 1IC6A 4MARA 5IWAB 3I6BA 4P98A 4JR1A 2B3TA 5FWAA 1BD4A 3JSXA 3A0RB 5FNVA 5L6LB 4OGLA 4EPXA 4XEHA 4N5NA 5LP6F 4HMQA 3MM4A 2IOFA 5ERYA 4XDHA 2EZ4A 2WWTA 4GXQA 1K97A 4ZZ0A 2BFEA 3EDMA 2AK2A 1ZMBA 2EYUA 4D9EA 4YRZA 3RS2A 3HI6A 3RAPR 4HKTA 3VV3A 1OX4A 1FUEA 4I2VA 3VKGA 1CNMA 1RNLA 1ZHFA 1C29B 1P7WA 3U44B 5LMUB 2IT1A 1U0HC 2VS1A 4P3KA 3SQDA 1R4AA 3CLTC 3C8DA 3GZNB 4R1MA 4HMOA 2Z95A 3SS8A 8ADHA 1N5MA 1LVGA 3LOUA 1G8HA 3RW9A 1H5NA 4GI1A 4HNAA 4AJ9A 4RTQA 1PLKA 1VJDA 3FZGA 1JEYB 5KJEA 2V7EA 4PAOA 1A9XB 5ADHA 1G8MA 5FXMA 2GZ3A 1Q1GA 2YS6A 1QXSA 3H8JA 3K2EA 2O8BB 3W8EA 1W46A 1YJBA 2YZGA 1E9CA 1PYOA 2WKPA 3WYBA 3LLSA 1VBMA 2DXIA 4KJZA 3P0IA 1Z82A 4LZPA 1R00A 4B3JA 1ZC3A 5ITZB 2GPJA 3PUYA 4W4TA 4BIIA 1C7QA 1C7RA 3ER8A 3HS3A 4EZBA 4BY9E 1OIWA 1VFPA 2FW9A 3AL3A 3S8EA 1K9SA 1E4EB 1JUDA 3QJGA 4S0XA 3STHA 4R71A 1NNI1 1WS6A 2D4AA 4ESVA 2O2SA 4QEDA 3CZRA 3UWOA 2NU7A 1XVAA 4N5MA 1NONA 4LHXA 4WLFA 2ZW9A 4YRLA 4CLRB 2FSHA 3FBTA 4CQLA 4MX8A 5LP6B 2QI9F 1EBUA 3F2IA 3FI9A 4JR2A 5CCDA 1FQOA 3E3OA 2G5GX 2GD6A 4F92B 1J9ZA 2F67A 5FL7A 4O2AF 2IZ6A 1XZNA 2IZ7A 2YWHA 1V25A 4OB6A 3PLNA 5L40A 3KTDA 2RHHA 3I76A 4PWYA 1KRWA 2HGZA 1JJFA 4LWQA 2AJTA 5G3ZA 5KYXA 1G8GA 4JJZA 1JVSA 2VQ6A 5E9JA 3T3IA 1H42A 1BEUB 3K1AB 4X93A 4C04A 4D3DA 4HNVA 2MSDB 1ZKDA 2AF4C 2ZYDA 3A6HA 4R2XA 3H5OA 1DKMA 4MQEA 4MQ5A 3WL7A 1TKBA 5FEUA 1L7MA 4CKCA 2BONA 2R97A 4AJNA 2GPSA 4MUKA 5JECA 1W75A 1K7SN 3FTEA 4EHNA 4KAXA 4HEA6 2WKRA 1TT5A 1FEZA 5C8XA 2EFEB 3IA7A 1FIUA 4BC0A 2OB1A 4F5ZA 2HA4A 3VR3A 3GPLA 1U2QA 3O4JA 4NCXA 1S4MA 2R751 4JI7B 1YMVA 4IXTA 2Y92A 1MTOA 4QELA 3NBUA 3UMBA 5C7LO 4K6KA 2V9ZA 2XTMA 3PXDA 3TLGA 4FMPA 1NBHA 5BOVA 4P5DA 4JP3A 3UJBA 3BD8A 3WISA 5EQDA 1GQRA 1EFPB 3M6UA 4KQXA 1JFFB 4YMIA 1YFLA 1LV7A 3COWA 2JJ2D 3OCXA 4I5FA 3RJ5A 1PT5A 2RAVA 3O8DA 1PLJA 2PJZA 3V4RA 4KC0A 1U90A 2BUAA 2WSBA 2SCUA 3OCJA 5EYPA 1OFGA 3IQEA 2XUDA 3JVVA 3LP5A 5D3ZA 1ZKMA 2XE7A 1YA8A 5FUVA 1RWQA 2PRJA 3AXSA 5AM4A 1J99A 3RBXA 4B44A 4UASA 3MS2A 1QE3A 3AEQA 1R5JA 2D2IA 5AW3A 1DE0A 1OSNA 1H9AA 4PNEA 2XKKA 3IDFA 4JA0A 3TSCA 4R83A 1UXKA 3H05A 1FX0A 4LDAA 4TVBA 3M33A 4MI6A 3NRCA 1FDOA 1ZD2P 1I0ZA 3AF1A 3ZOKA 2OM2A 4F11A 4M0CA 3A8TA 1CDZA 4L78A 2YZ7A 2WT8A 3HGTA 5KVSA 1E8MA 3RYHA 2HFJA 3VR6D 1EGAA 4CLEA 2XUHA 3CW9A 4JD5A 3E81A 2DLNA 3TB6A 4H6PA 5HZGA 5KIAA 3LBAA 4JCCA 4P7BA 1QHYA 3VKVA 2ASEA 1QYXA 3DAFA 5JNSA 5KNCD 1V4BA 2G4CA 2GLTA 5EJGA 1RMTA 1J9GA 3DLTA 3EEOA 2WNHA 1T0IA 1EUQA 4ZVOA 1PSWA 4BV9A 2AKAB 4EBFA 1HORA 1OLSA 4YYEA 1H2XA 2V6BA 5DM0A 3LFUA 2ZREA 4US1R 4CMGA 3GRUA 4ND1A 3I3OA 2FKAA 3NCTA 2J6IA 2PH5A 3AW8A 3QBEA 1VOTA 2ISSD 5B30A 1LU9A 3ZXSA 2OXCA 1NW4A 2BGJA 1YQDA 2VPYA 1C1DB 2YC2C 1K0UA 3H5NA 1YHYA 4Y6LA 5AOBA 3AR8A 4OI0A 4TSFA 2VPTA 1G42A 1QLJA 1VMDA 3D81A 5H4HA 1M6EX 1HC7A 3EW9A 3IPXA 5FHQA 3C7CB 5K3FA 4F1KA 1Z5NA 1CE8B 4Z2YA 1N6IA 5K0ZA 2UZAA 3IJRA 2J85A 2WABA 3F8TA 1P73A 2HRRA 3KXLA 1EBBA 3ROQA 3TZBA 2RKBA 2C4NA 3GGCA 2R6ZA 4GOKA 3VYUB 1YDFA 1U7DA 2FMFA 5E6UA 4CEHA 4OMCA 3OY2A 4LJYA 1RQ7A 5IEBA 3F5MA 4TX1A 4MHOA 1EWVA 4HN2A 3PRJA 1S5PA 1JJ7A 4PC2A 4PXAA 5LDDC 5HGJA 3UG7A 5DSXA 4F56A 5ESWA 3IC5A 2JPDA 4B74A 2REXB 4NV3A 3VI3B 1QHHB 3MWYW 3GW8A 4LV6A 3OC0A 4BUZA 1YDMA 4IIHA 3RT7A 3RHSA 4AN1A 1Y4DE 2ODPA 2PGLA 1IN5A 1WZEA 3B6MA 3COYA 3HA5A 3T0FA 2AFHA 4UMEA 3L4JA 3T9BA 4MVJI 4NCIA 2X0JA 2CW5A 3OJFA 1QQTA 3NOXA 3VZQA 4DIEA 4B4UA 4Y2HA 5KYVA 3G5LA 5FTJA 2QE7D 3CE9A 5K2MA 2YYSA 1YH3A 5IYZF 4MS3B 3EGXB 4CT4B 3CVWA 5IVKA 2YL2A 5JROA 3HG7A 1XZPA 2PCJA 5CEJA 4CL0A 1GNVA 2JFHA 1M83A 2WTXA 1H1LA 1QBGA 2ORVA 3EOZA 2C2HA 3LWBA 1JAYA 3NIBA 2EQBA 2JI8A 3RS8A 4A10A 2XUJA 5IJZA 2O2GA 2PLAA 4P38A 1VXOA 2JEZA 3OPYA 3FOCA 1SR8A 1RPZA 3AT1A 1I5EA 2E85A 2I4LA 4G8DA 4UAVA 4DNFA 2P90A 1PR6A 4XB2A 2NZUG 2ZR0A 4IZOA 4HT3B 1I36A 3I9FA 1EAYA 2Q2QA 4QUDA 2EU8A 1PFUA 5GY7A 2ZUCA 4MYUA 4LV8B 2BAGA 4WXHA 2GF2A 1FFXA 2O59A 1E3WA 1URPA 1KTIA 2NYRA 2C92A 3Q9SA 4G9BA 3L92A 1YVPA 2BT4A 1PJAA 1XDDA 2JHCA 1XMJA 4X94A 4F85A 3U5ZB 5TDHA 1C9EA 1GG5A 1S2IA 2EZ8A 3RTAA 3WZ2A 4RHYA 4B48A 4MV4A 3WLEA 2N3ZA 4BQOA 4NBVA 1YVDA 3DCIA 4O2RA 1HRKA 2FZEA 4KAFA 2EW8A 3KKZA 2DR2A 3PQ3A 5M29A 4DLPA 1J7JA 1I2ZA 1T5IA 4ZC8A 7ADHA 1T4BA 2HBYA 3CYFA 5ER6A 3OX4A 2VTDA 3ET4A 1QR2A 1A8SA 5FWXB 3JARA 5K4HA 1NVDA 4OQZA 1TQDA 2OZVA 4RMGA 3OZUA 1OR8A 2X77A 2XT6A 4DCGA 4GLLA 1T2AA 1KDPA 4NU5A 4RZ2A 3WHPA 4EJFA 1KWKA 3TD9A 4LYEA 5LYJF 2I67A 2Q0QA 5EP1A 3LTEA 4A5OA 2BDEA 1I80A 2D5AA 2FRDA 4F3NA 2AL7A 3VU3A 1C4OA 1XKLA 2NO1A 2XGSA 2Y4OA 3EWNA 1Q77A 4FOOA 3QBJA 1H0SA 2I7CA 1ZR2A 1MNAA 1NHWA 4GOXA 4OF4A 3AYZB 1HGXA 4OM8A 3MJ4A 5ES4B 2BBWA 1YTLA 2VQ3A 1YRLA 3BXXA 4IZHA 4TKZA 4R1TA 5ED0A 1QQ5A 3K16A 1FTQA 2V54A 4P84A 1A4UA 3ZCRA 5JAOA 4MR8A 2I3AA 1SK9A 1DKOA 2VKTA 2ZE7A 2GCIA 3HDYA 3MXTA 1NRXA 4OJKA 4P6VF 4ZAWA 1TMOA 4CLOA 2IPLA 3EVNA 1BNCA 2DCMA 2WMDA 1QHEA 5CNIA 4QLOA 3AETB 1U28A 2RK4A 2VH1A 2X7JA 3OM0A 1DLIA 3P0JA 5HE9A 2Z8YA 2Y0DA 3T5GA 1JQKA 4RA9A 4P4SA 1A9YA 1DV1A 2R5FA 1JLRA 1PYGA 4WKNA 2I6UA 3N8NA 3DWFA 4M4SA 4YNBA 1IEVA 4U0KA 1VPTA 1YB6A 2XDQA 3WNCA 4F93B 2LVBA 2DWUA 3ZDBA 1WD7A 3ISVA 3HBJA 2ICAA 4B31A 1E6CA 4C7BA 3CPSA 2I87A 2VLBA 4IOJA 4LZJA 2PZFA 1EM6A 3KE8A 4NDAA 5BURA 5I3ZA 1YDGA 3R3XA 4QJ3A 2LE0A 4ZVVA 2I1QA 2JC3A 2SKDA 5CPBA 2JS7A 1KI6A 3WSWA 3PWSA 2O2CA 4FT4A 6NULA 3UYKA 1UT8A 1E1CB 2H3EA 4QZVA 1NI4B 3OKAA 1WNTA 1MJFA 1S3GA 2VNJA 1XJ0A 1B14A 2J09A 2YASA 5D1NA 2WNSA 2WM2A 5CEFA 1MJGM 4ISCA 1M34E 5KNBA 3OIDA 3X2EA 3K9WA 4R3WA 2GNPA 3OPMA 2OAQ1 5EXDA 3AMVA 1P4SA 4TKMA 1T9GS 3HY6A 3RFFA 3FNBA 1EVJA 3JQGA 3GOQA 2GEVA 3G9QA 3ONVA 1NRWA 5IN5A 3V8QA 3I4CA 1AS2A 2KE5A 2PL1A 2XNSA 4D46A 4FMBB 3UK6A 2YUIA 1ZNYA 4KITB 1S7GA 3SHVA 5SZHB 4BQQA 3ROGA 2PRIA 3HM2A 2GHTA 1ZSYA 1Y3DE 1AQLA 2A3NA 4WXYB 3HB9A 4LRTB 1XQVA 2E4UA 2P41A 1KDOA 3DOHA 4JLDA 1FW6A 3IO3A 2UYQA 2NQTA 3P9PA 3RUPA 2Y1FA 3HJHA 4DBLC 1E1YA 3BMCB 2DWCA 2H18A 2V0GA 1MFZA 1ZD4A 4WERA 1M1XB 2XOXA 1PS9A 1W94A 3DSRA 3KAKA 3LBYA 4FYIA 5DCUA 5J5AA 3V8RA 2XXBA 4R40A 3ZGYA 4DCPA 2BFPA 2BJWA 5IYZA 2WHPA 3U4IA 4L3VA 4IFEA 1LX7A 3CLUC 5HIMA 3JR7A 1UBKS 1A9OA 4M1ZA 5FI3A 4C2UA 1PE0A 3SJCA 5DLEA 3W6UA 1FMJA 3MEQA 3WLNA 4K0KB 5F7JA 4C0JA 1J8QA 2HB6A 5AW4A 4GMHA 3PEWA 2ECKA 2DPLA 4Y6SA 4RVNA 1BXGA 2IEZA 3TRHA 2OXTA 4CEJA 2HGSA 3BRWD 5HVNA 2WQZA 4BZQA 4JC4A 5C37A 2Y67A 4OQFA 1ZJ4A 2YYYA 4JQZA 2WUVA 4RWEA 5EMNA 4BDTA 1EVKA 4EY8A 4TYPA 2WD9A 2P3QA 1LLQA 5E1MA 2L0XA 5LU8A 2BMJA 3C3AA 4GOJA 2B35A 2Q1TA 3CFYA 2D62A 3D6JA 2VHZA 1R15A 1DXYA 2BFMA 4NZZA 4U5XA 1K4KA 2M32A 2JCSA 3IHTA 3UC5A 4D4GA 3T54A 5JXWA 2IV3A 2PXXA 3UK0A 1IN7A 1K7CA 4JLAA 4JLJA 4AJOA 3LOQA 3CBQA 1L7EA 3L04A 4KYIB 4MWTA 3TQOA 5IKMA 4DTCA 1DC5A 2QVBA 3D5TA 3H8WA 3MTGA 1JAZA 4UE2A 2B7LA 3EFOB 4X95A 4MMXB 3SIRA 3DR5A 2G9UA 5JC8A 1Y4ZA 3C1AA 4CF6A 4BQSA 4IGIA 2PPLA 3JWJA 3LBFA 2Q3DA 1G59A 2WINI 3NBKA 4QECA 4RZSA 4MA5A 3MUOA 1CQIB 1WDLA 3HNOA 1EDEA 2FUCA 4IV8A 2QLNA 3AM5A 3TKAA 3ADCA 3QKUA 2DERA 2VIIA 4RGYA 2ATVA 3OJLA 1KI9A 2PT5A 1MHPA 5LZ8A 4UEKA 3R6DA 4ARAA 1QZXA 1G5PA 3A25A 3INNA 4YXFA 1S2GA 4D96A 3MWEA 2EJBA 4DADA 1E0KA 3G0OA 1CR0A 2PT7A 2CC2A 4WKOA 4ZAVA 3SZLA 1BMFD 1WBBA 1N1EA 1ESMA 2I6XA 5H83A 4A8JA 2OBNA 1QRUA 1TO2E 4PLCA 821PA 2GXAA 5DHAA 4F21A 2B8EA 3OZFA 4YUVA 3ZBTA 4L4ZA 2ON6A 2Q50A 4ZZ1A 2LXNA 1TM4E 3SBOA 2OG1A 2WM9B 2WFZA 4BGEA 3FCCA 2FSSA 2R1VA 1Y5RA 1TMKA 2JGDA 2IF0A 1AK1A 1UBCA 1FFXB 4J1SA 4OREX 3T5TA 1JHZA 3V3KA 4Y2YA 4FFNA 3GVHA 1COWD 2C4MA 4JBGA 3HY4A 2AJBA 1BKYA 2PG3A 2QGZA 4KR0A 1SB9A 1OAOC 3LYUA 2Z09A 2ONCA 3TLJA 2H4FA 2V8BA 3N2GA 1H6DA 1O95C 2DUUA 1JF8A 4IMPA 1MV8A 1E2NA 2NXEA 4R7ZA 1E3IA 1TM1E 1T2VA 4F0JA 4RU1A 1GZ4A 3NP9A 3LL4A 2JGMA 4H9GA 3MK31 2QRZA 2DBQA 4QDUA 5LR6A 2C4WA 4Z0TA 4Q3NA 4GZMA 3EH1A 4KE6A 4QT0A 4L95C 1C9KA 5A1JA 1VKZA 4HD8A