2UZIR

Crystal structure of hras(g12v) - anti-ras fv complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumour Prevention by a Single Antibody Domain Targeting the Interaction of Signal Transduction Proteins with Ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uziR00
2P3SA 2O5VA 4ZDJA 5JCZA 2H16A 3OESA 1W7AA 2VP2A 2GJ8A 5EUQB 4Z1MA 2HYIC 1NNEA 5BN5A 2BEKA 5FPTA 5FOUA 4Q7JB 3AF1A 3LH5A 2XB2A 4OHXA 2X77A 2PBRA 2V6IA 2XAUA 3PUYA 2QA5A 3FMOB 4C0LA 4W9MC 2R44A 1EXMA 4C0QC 1P75A 4DBLC 5L8VA 4H1VA 4OHVA 2ZUDA 3THWB 4Q4AA 3TMKA 5JRJA 4KAXA 4C9BA 4B6EA 3KFXA 4TLEA 3U6BA 1OKKA 4KCGA 1LVGA 2A5GA 1K5DA 4N3NA 3X1XA 4PTLA 3GJ0A 1W5SA 1SVOA 1J8YF 3QBVA 1OXUA 5EQTA 3KXLA 1P3JA 1NBMA 4DUGD 1RRGA 1YZNA 4WA7A 3LBIA 1ZRHA 5E4FA 3NHBA 3P32A 2OE2A 4D80A 2B7BA 2ZPTX 1IBRA 1R5NA 1IAQA 4TMTA 2YYZA 4Q4AB 1JAIA 3PCRB 5FI1B 1P6XA 1TQ2A 2Z83A 2FZLA 1DADA 4JBYA 1KO5A 1OHHA 2ZE6A 1HQYE 2GXUA 5KSOA 2PT7A 3N5CA 3I72A 1AS2A 4PSVA 1TQ4A 2CJWB 4ABYA 4DLTA 2QSZA 1Z29A 4R2HA 2DWOA 4Q1DA 4YDSA 2FFBA 2Q9CA 3GP8A 2YVUA 3B7GA 3GLHE 4ILEA 4WAUA 3R9XA 2G6BA 3HYRA 2A5FA 1ZP6A 1UF9A 1A82A 4FMDB 2O8FA 1VG1A 4OQXA 1NSFA 5B57C 4XTCS 4HLDA 1LS6A 3BS4A 1W0KA 3HR7A 1NVWQ 1KYIA 2D4HA 2WKRA 3HWSA 3BGWA 2WOOA 1IN8A 5P21A 3B6EA 1QG2A 4I1UA 2HF8A 3CLVA 2FG5A 1E2PA 1XF9A 2EVWX 5DHFA 4G1UC 3CF2A 1G9XA 3AVPA 4Q1BA 2MSCB 2R6FA 2XXAA 1DOAA 2F3TA 5IT5A 2XXAB 4PAMA 1T0JB 5FBQB 3D6TB 2QBYA 4QJ4A 3AQ4A 1DAIA 4BGDA 1DAEA 2WKQA 4M9SA 2IS6A 1T3HA 1NVUQ 5FI0B 5KNDA 4TQUS 2J1LA 3SE0A 4LJ4A 2IYUA 1E79A 2QPOA 1E1QA 1AGPA 2IEZA 3ECCA 1QDEA 3H4MA 4CEIB 1HE8B 4UNNA 1GG2A 3WY9A 5FPHA 5FR2A 3AGPA 5IK2D 2O8FB 3GLHA 3MJHA 1W4BA 5JLJA 3TIFA 4KSBA 2ZITA 3OEEA 4KFUA 4Q03A 2R6AA 2G88A 2D2EA 1MO5A 1DO0A 4JSYA 1SVKA 1NIJA 2JIZA 3DL0A 5EXTA 2QAGB 2ZI7A 4P4TA 3ZVNA 3DMDA 4DDUA 4PSAA 4GP7A 4TLAA 4OQLA 1QHHA 2ZJAA 2RGEA 3L2OB 1UKZA 3K53A 4M21A 5EP1A 2VO1A 2JLZA 3UMRA 4FMDF 5DISB 3H2YA 5J4LA 3ICQB 1KJZA 2CCGA 4M53A 4IFBA 4JJKA 3A8TA 4CW7A 1AJEA 1Z0IA 1VCMA 5J4VA 1AA9A 4O25A 3WRXC 5KOYA 5HTKA 5BWMA 5L3VA 4LBZA 3R7WA 1KI3A 1NMYA 4GI7A 4IJMA 5L3RA 1T0HB 2PZEA 2QTFA 1X3SA 2P6NA 4WZBE 1F5NA 4TT3A 2UZ3A 4JVLA 2IX3A 4NH0A 3VR1A 2GZAA 3LW8A 4B2IA 2WWWA 3K09A 5BN4A 4JYBA 5JSZA 1WRBA 3C16C 3LDAA 1B0UA 1ZD8A 5D3MB 1I2MA 2JLSA 4I4LA 1HT2E 3Q8XB 1KNXA 4A36A 2G9NA 1MR3F 1OH6A 2FPMA 2JDIA 3EZ9A 3PENA 2ASEA 4GFDA 2QENA 4M9QA 2ZAOA 4TYQA 4RFSB 1H8HD 2ZRNA 1R8SA 1XTRA 1ZC4A 2CHVA 3WBJA 1G6OA 4A0GA 4PC7A 2QRZA 1Q12A 4DUGA 2W6JA 3OEHA 3CX8A 2IXFA 5E7JA 3LWNA 4JSTA 1KDPA 2E87A 5LBIA 1NMZA 5DI3B 3H0KA 4KYUA 1EX6A 1P2TA 2SHKA 4DLRA 521PA 4ARZA 3BIFA 4A9AA 5CB6A 2D74A 1EFHA 2V54A 3GMTA 1KI6B 4A8JC 4BLRA 2IYWA 2NZ8A 4OL0A 4LBYA 5G3YA 2ZETA 1KSFX 1P9WA 4AYXA 2X2EA 1TL7C 1J8MF 4TN1A 4Q7KA 4QGGA 3I73A 3ZZUA 3LA6A 4LHZA 1KMHA 2BCGY 1KO4A 4PHFA 2OILA 3QKSB 2FX3A 4F4JA 1EFTA 3HU2A 2C77A 1OH8A 1SVSA 3F0TA 3NXSA 1IY0A 1N0WA 3CONA 1Y63A 4CEJA 4TMVA 3X1ZA 1HH4A 1HYQA 2VP9A 4I99A 1G6HA 4HLCA 1E2NA 1ETUA 1N3BA 1BYIA 1KK3A 1H65A 4TMXA 2NPFA 4HLUC 2W58A 1PV4A 1MRSA 3RLFA 4JLBA 4PC1A 4OQFA 3JZMA 3TQFA 4BWYA 2HT1A 3AM1A 3UKDA 2C98A 5DYGA 2IYVA 2GJKA 3HJNA 1J7KA 2OEPA 2GJSA 2YV5A 3TJZA 1C9KA 3FKSD 2WPDD 1WBDA 2VEDA 4E09A 5DSZA 1SHZA 4LX0A 3BK7A 4UJ5A 3AGQA 3HP1A 5F9FA 1ZCAA 1KJYA 1ZNZA 2IYYA 4YMWA 1Z0JA 2XOKD 4B43A 4XSHA 1M7HA 4WW0A 4XTRA 3AP2A 1IJEA 3U7GA 4L16A 3L0PA 4B3CA 1XEXB 3EX7C 3DHWC 5JJKA 5SZKB 2X19A 1RE0A 3I8SA 1PJRA 3MSXA 3GLGB 2KB0A 1XJQA 4EFMA 1IN5A 4IVQA 4OJKA 1ESMA 1BIFA 4HB3A 4EPYA 1T6NA 3CR7A 2H57A 1P2SA 2C9CA 2V1XA 2VLIA 1QG4A 3ZIAA 4B48A 2JCSA 3NDBB 2I1VB 2IYTA 1ZIOA 5TVKA 4B73A 1Q1QA 1SKYE 1VHTA 3BAFA 3DZDA 1OIVA 1AZTA 2BJVA 1XNJA 1F60A 1SXJA 1ZM9A 2IC5A 2ZIAA 5E3HA 5JECA 2D2FA 2QQ0A 4D82A 2P0EA 1FQKA 1GKIA 3U4QA 1GILA 1XEXA 2QAJA 1OXSC 1GWNA 1SXJE 1COWD 3PUXA 4IFEA 2HJVA 1W4CA 3U60B 1Z6TA 1T3LA 4QHYA 5IDVA 2PJZA 1CTQA 3LBHA 4DVGA 4RD2A 2ERYA 4B35A 4AKGA 4EPVA 2AHOA 2EWVA 4IDPA 1ZVQA 4LC1A 1W47A 2FSFA 2NO0A 1HV8A 4B2PA 2ZREA 2BV3A 4A15A 4QL3A 5BN3A 2N46A 3H86A 2ZTSA 4TZ6A 4FIDA 2VHJA 3NKVA 4BFSA 1AZSC 3IIJA 1XEFA 4FW9A 4NYMQ 1DAFA 1SVMA 2ECKA 2CNWD 3RS0A 4PO9A 5CIWA 2OCYC 5JCPA 1ZINA 4DT1A 5FOXA 2IYQA 1CBUA 4MA4A 4OHZA 2JAQA 3O8BA 2CHQA 2G0TA 4LC0A 1Q3TA 4LYJA 2O8CB 1XP8A 4Q7LA 1GNPA 2XITA 4DLUA 3L43A 4C2UA 5DN6D 2OXCA 5CK5A 5GADl 2XZLA 4OQNA 4LRWA 4OI1A 1XZPA 3LFUA 3ADCA 2W6JD 3OEHD 5TARA 1ZUHA 4FMBB 4RCZA 5H8WA 3CH4B 1DVRA 1FPMA 1JQLB 4V0KA 4OQMA 4B3XA 3SHFA 2XSZD 2WIBA 4LJAA 1TQDA 2H18A 2VHUA 3SNHA 2I3BA 1DE0A 2C96A 2VSXA 3L0OA 3NTUA 1GUAA 2AKYA 2QN6A 3T15A 3I5XA 5A0FA 2BBWA 1E2GA 1N0UA 1YQTA 4U02A 2QT1A 3CPEA 1RJ9A 4MKHA 3WNBA 2W6IA 3NEYA 3SDZA 1CJMA 1KKMA 3T5DA 3LW7A 1YRBA 3DDCA 4IOLA 1TU4A 2C8VA 1I4LD 1TF5A 4KODA 4UNQA 3N2EA 1U81A 4B3GA 1S96A 1NN1A 1U8AA 2NG1A 3K0EA 1E0SA 2IWHA 5JHHB 3BD9A 4R2IA 1KO1A 4URYR 3GJ8A 4O2RA 2NGRA 3U3OA 1TUIA 3W8RA 2GKSA 2OUKA 4JT4A 4D81A 4OKSA 1NVVQ 5EJEA 3AVYA 4EKDA 1NJGA 5FTNA 3BC1A 3QVUA 3B9QA 3TLXA 1CLUA 1XD2A 3REFA 1TX4B 3HR8A 3CF6R 1NG1A 3FKSA 5KDLA 2WPDA 5D3MA 3IIKA 3ZD6A 4FI3C 1F6BA 5EP4A 2W2VA 5HKKD 2F6RA 3W6NA 2ATVA 4B3DA 2GAAA 2XOKA 3M1IA 2HXYA 3P4XA 1E94E 3KKOA 5J5CA 2FE4A 5JEEA 2F1RA 3T1VA 3AH8A 1QHNA 5KTYA 3OIWA 1XD8A 1OB5A 4MDEA 2ZJ2A 1R10A 3QXCA 3KJHA 1UEIA 4O3MA 2AFHE 3BBPA 3BFKA 4Q19A 4URWR 4GL2A 4ACAA 3K0CA 1A1VA 4E07A 4OI0A 3FMIA 1UDWA 3JVUA 3GFTA 4KBFA 3QNUA 1BO6A 3TR0A 3GD7A 4CYMA 3K0AB 2C78A 4KV9A 1KKLA 4QXAA 3TR5A 1OJLA 3E70C 4FWTA 3CX6A 4O0MA 3M4YA 4AWXA 3TW4A 1CJUC 2FNAA 4NDZA 3BOSA 1XEWX 3WYFA 3AVVA 4BPBA 1G20E 1FX0B 1XMVA 2VPPA 1XTIA 1RRFA 5CB8A 4Q9LA 5KSYA 5CJ2A 2GNOA 3R9WA 1JQJC 2QORA 3AUYA 1A2BA 1GM5A 2LKCA 3ZZTA 4BEJA 4RY2A 2W0MA 4PPNA 3U7FB 2IA5A 4E22A 1NG9A 2D3WA 3X1YA 3CUEF 4PXAA 4WBSA 3VR4A 1GIAA 1DAMA 1P60A 4MH0R 4C0JA 2J87A 3SQWA 2KJQA 2ZU6A 4NE2A 1XXHE 1GZSA 1L7VC 2C04A 2JJ8A 2QNRA 1CU1A 2ZSDA 3G5UA 3MG9A 4G0NA 4DWJA 1WB9A 1WF3A 4A8JA 3NWJA 2AKAB 2ZI6A 1W36C 2LWIA 5FOVA 1ZU4A 4P4SA 2FZ4A 1KI7A 5HE9A 4DEXA 3BB1A 1HE1C 2ONJA 4BASA 1JR3A 1P5ZB 3FHOA 3H1TA 3ZD7A 5JWHA 1X8KA 2XGJA 1MO4A 2IHBA 2AD5A 2UKDA 4CVNA 4DCVA 4M0LA 2FU5C 5TXGA 1OFHA 5JFGA 1JJVA 2J0UA 2J0UB 1ZM2A 1LTQA 2WWHA 4Q9HA 3TAHA 2QEQA 3S1AA 4V0NA 3KUDA 4HZIA 3EXAA 4LJ5A 2CK3A 2V9PA 3GJ4A 1E1RA 3U44A 2BC9A 3RS4A 1G19A 1G3UA 3SYLA 3OF5A 4WIAA 3T61A 3L8ZA 3GFOA 1KAGA 3NBZC 3NHAA 2CBZA 2VSFA 3QQ5A 3KTAA 1U98A 1D9XA 5KPDA 1ZNYA 5IHPA 1QHGA 2RGNA 4DLXA 3PEUA 1Q1ZA 4QJ3A 3RSLA 1OH7A 1ZU5A 1G1MA 3A4MA 4ZIRB 1AS0A 2OLKA 3NBFA 3TUZC 1II0A 3T1QA 3A36A 3FE2A 2FGKA 4DDVA 1WCV1 1YRAA 4HB4A 3ASZA 4PQRA 1FTSA 3K0FB 1ELOA 4LGMA 2KI5A 4PO1A 2OCAA 2R65A 5TB5A 4B34A 2DWPA 2NO7A 2GEUA 5BQ5A 1OXVA 3I92A 3UG6A 4D4KA 1E2MA 4C30A 1PVOA 2QP9X 1S0UA 3TSZA 2OBNA 3VKWA 1W48A 3BB3A 3P26A 4Q5IA 3A1UA 4AG5A 4U7DA 4XJXA 1FZQA 1LF5A 2WWGA 4K46A 4TTQA 2IS1A 2J59A 1NVVR 5CYPA 2Z0MA 3N70A 4KVGA 1IJFA 4IKEA 2ZSEA 3EPHA 3D8BA 2IYLD 4NONA 5HKKA 2H7VA 3F5FA 4JKYA 4GPTA 2NZJA 3WYGA 1G7SA 5AUNB 1CXZA 3ZVLA 2J0VA 5CJPA 1OFUX 3GJXC 4DCTA 2JIZD 4LUCA 2OFWA 2PMDA 3W5IA 2QTHA 5EP2A 1R2QA 1QVAA 1YZUA 1Q1EA 3KB2A 3L0SA 5DE3A 1G5PA 3Q5EA 5C18A 5HPYB 1AS3A 1Z0FA 2EW1A 2ZJOA 3LVQE 4HYYA 3VHLB 2QT0A 2TMKA 2LCFA 1XD9A 3IQWA 5FTMA 1T9HA 3P1JA 1CF4A 3IBGA 4HUTA 4AK9A 3EPLA 2FF7A 4K81B 3IKJA 3KDSE 2QP4A 2XZPA 3KJEA 3RAPR 2FWRA 2QAGA 3QI2A 2VP0A 1BS1A 5SZJA 1VCIA 2W0SA 3E2IA 2O8DA 4TL8A 5FBLB 3RABA 4DLWA 2H8KA 2ZI3A 4ZO4A 1JI0A 4TMWA 1E9RA 3ZLJA 2R9VA 4F93B 3PUWA 3QOFA 4IXMA 2ZJYA 5EZ5A 3ADDA 2C95A 2EWWA 1E9BA 1Z47A 1KDOA 2KSQA 3VNVA 3EA0A 1MT0A 1XXHA 4M1SA 3LLUA 4QRHA 3AKEA 4LDJA 4CEIA 5B30A 1RVDA 1S9HA 1TEVA 2KBFA 2D62A 2OZEA 4BZPA 1A2KC 3IPYA 4KI0A 4IRUB 2QMUA 1QBKC 2ZSBA 1YZKA 2I1QA 1YR9A 2FFQA 3CRVA 3ND8A 1G3RA 3IEVA 3DPUA 5JZVA 2QAGC 2Z43A 2J45A 2MMGA 3CRRA 1GTVA 2ORIA 4Q7MB 4DZZA 3THYA 2OSBA 2ZSAA 3K9LA 5EE1A 1O3YA 1UKYA 3TBKA 1E4YA 2EFCB 4KU4A 4X8LA 3U7EB 3C4JA 1DAGA 2ZJBA 1VCNA 3VAAA 3BB4A 2HUPA 4JLVA 4LJ7A 2GJ9A 3DO6A 3QXSA 3QXXA 2R8RA 2I4IA 3GLGE 3C41J 4ZKDA 2BDTA 2MMCA 2KWIA 2MSDB 2ZI4A 4MYCA 1E98A 2XJ4A 4D4MA 2ZRIA 3P27A 4ZV4A 1F2TA 1SKQA 421PA 4R71A 4G5QA 2D7DA 1E1RD 3CWZA 4HLUA 4C0HA 5EXXA 3FTQA 1FQJA 4HDQB 4XVRA 3SBEA 4D0GA 4DT1B 2JLRA 3GEHA 4V02A 3K0SA 2YZ2A 4LYHA 4M1YA 1GP2A 2GESA 4TYPA 3DM5A 1E9CA 1SKYB 1XRJA 2F7SA 4HAXA 2FDCA 3EIEA 1Z63A 5FH9A 2PEYA 1JEDA 3IBYA 4F4IA 4NYJQ 4Q9IA 1G7RA 1A5TA 2BBTA 1D5CA 1AKYA 4R98A 4YMUA 1MO6A 1SXJB 3A4LA 4W7SA 2FOLA 1KDTA 2QM7A 2JATA 4JL8A 3UWKA 2FPKA 2HJGA 3SYNA 5IK2A 5HZHA 5LD2C 1ZUNB 4DSOA 4TLCA 4DXAA 4FMCB 3KXIA 1GL7A 4BRUA 4FN5A 4M1KA 1F2UA 4HUQA 4FCTA 3BXZA 2ZRBA 4IVPA 1U2RA 1Z6AA 3V4RA 3RS5A 1IM2A 1DO2A 221PA 2CCJA 2J5XA 2YOGA 4QHSA 5E7IA 1QHXA 4DKXA 3AB3A 4A8JB 2A7QA 3D3QA 1FUUA 1GDDA 4MGIR 2FSIA 4EJSC 2ORVA 3CRQA 3KQUA 1E2LA 2PL3A 1YR8A 3WYAA 4MKFA 1E4VA 2EQBA 4Q21A 1E2JA 2PX3A 4L15A 1L4UA 2P5SA 1R0YA 3B1XA 3GQBA 2O8EA 2IYZA 4R7ZA 4XWAA 2YOHA 2DPXA 3THXB 2QBYB 2ZRJA 3I3SR 5CLQA 2ZRFA 2C99A 3KQHA 4Q4HA 2CMKA 1SZPA 2GF0A 3KX2A 3NH9A 3F3YA 4MYHA 1XTJA 1I4DD 2WZQA 3GJ5A 4QJ5A 4ARZB 5LPNA 4A2WA 2QI9C 2WJGA 2ZUCA 1W4AA 1S1MA 1G8HA 2RGXA 4NMMA 4A0HA 5TY0A 4BLOA 2JLWA 3QPWA 3TSOA 1G3QA 1R5BA 1M8PA 5FOSA 2GXAA 3WMEA 1II8B 1SGWA 4X8OA 1G3IA 4KO8A 5J40A 3TE6A 2OHFA 1Z08A 1ZUIA 2O8DB 5A5GA 2DHRA 5J4YA 2YWHA 3ETLA 2ZM5A 3HYTA 1MKYA 2VSOA 4W5HA 1TU3A 4QGAA 4UNRA 2AK2A 2OFOA 1EFRD 1U90A 3QG5A 4JL6A 1GKYA 1L8QA 1NP6A 3VR2A 3QJYA 4AC9A 4TQ9A 2F9LA 2IL1A 2QMOA 2VIIA 3LX8A 3KTAB 4HAZA 4LI0A 2OBMA 1CP2A 4OK3A 4XD7D 2WJVA 5JMTA 5L3QA 1TUEA 1R4AA 2XNSA 3BFVA 3LVRE 3RC8A 5DN6A 1IN4A 1JBKA 3R7WB 2RMKA 1U0HC 1F3OA 2UVQA 1QHYA 3OFNA 4U00A 3FVQA 3T1TA 1Z28A 1ZBDA 3GLIB 2XSZA 1KY2A 4Y0VA 2RGDA 1E2QA 4RD3A 3DOEA 4FXPA 4IDOA 4TLBA 1TAGA 1UM8A 2WJYA 4LHWA 3WHKA 3IEUA 3KL4A 3NC0C 5C46F 1OPXA 4F92B 4C4PA 2CL7X 3EPKA 4PSKA 4JL5A 2ODEA 3UMSA 2JA1A 2XNDD 3WXMA 1T5IA 4AIIA 2QZ4A 5LDDC 6Q21A 4DC9A 1GSIA 3VQTA 2YKGA 4LK2A 4AURA 3W6OA 1I4TD 2R2AA 4PANA 5B58C 4EQ6B 2O8EB 4OHWA 1VYVA 2DBYA 3KQKA 2Z5FA 3X1DA 4XVUA 4ESHA 1XTSA 1BKDR 1GFIA 4RD4A 3UPUA 3QPVA 1FL9A 2GBLC 4QG7A 1AQUA 2DWQA 3VU9B 1XCMA 1DG3A 3EC2A 3QF4B 1ZNXA 1M1YE 3R9IA 2J7PA 2RB4A 1NN5A 2F43B 3IUYA 2AR7A 4MYTA 2P6UA 4GOKA 5AJZA 1W5TA 2CEAA 1EWQA 4JYCA 3B78A 3T34A 3VX4A 4A6XA 2ONKA 4JLNA 2Q3MA 4UJ3A 1Z5ZA 1VIAA 1X1SA 3OZXA 3SFVA 4WVFA 2Q9BA 4URUR 1HUQA 1XFAA 4JLKA 1JEEA 4G5SA 4EUNA 3B60A 4I81A 3FMPB 4YMTA 1CJKC 2R6GA 1U99A 2C5LA 5K8LA 3OAAD 4AYWA 1W49A 1CR2A 3A37A 3T5GA 1UPTA 5EXPA 5IF9A 2ZS9A 4B6FA 3CX7A 3PV0A 2A3RA 5FPYA 1N6OA 1XXHB 3SBDA 1ZMXA 4AKHA 2RAPA 3QENA 5UKDA 4C0AC 2LKDA 2B92A 5DH9A 4DLVA 1JPJA 1N5JA 5CDFA 2RGCA 3IQXA 4KFRA 1VYUA 1C4OA 1GRQA 4P3YA 1KK0A 3E1SA 5BYKA 5KUTA 4MDFA 1BMFD 4Q4JB 3SJCA 2GF9A 1RIFA 2WJHA 3MWKA 2IBMA 3QE0A 5G41A 3B1ZA 4XOIA 4KFTA 1YHNA 3HU3A 2VRWA 1T8UA 2IYXA 3WNCA 1G5RA 4ASUA 2J0SA 4EPWA 3VKGA 4B44A 2IW3A 4BFVA 2FEMA 2QUZA 5KSPA 4M1MA 5FR1A 3C14C 4BQSA 3U3MA 1Z0AA 4GMXA 5JWRA 1J90A 4OI2A 1OXXK 4F7WA 4F4CA 4YONB 2D06A 2ZSFA 2P67A 3EG5A 4X8HA 3KQLA 1US8A 5GJCA 1M7BA 4NYMR 2VP5A 1OH5A 3IO3A 2B6HA 3FMFA 2WMNB 1GAJA 1W36B 3CZPA 5FPSA 1OXTA 5AUQA 2QG6A 3C8UA 4LJ9A 3C5CA 2IK8A 1G4AE 3W34A 2ZU0C 2OO7A 3C15C 3FGNA 1KSHA 1OV4A 3I32A 5E7MA 1DELA 4JKIA 3TW8B 2V8OA 2ZR7A 1ZNWA 1Z6XA 1PUJA 3SZRA 4BFTA 4HB2A 1JR3D 1RJ9B 2FPLA 1KK1A 2FGJA 1HEIA 1MABA 2Q3FA 2G77B 3Q9LA 4EDHA 1E2FA 1L4YA 4GZMA 3VKHA 3PVSA 2IXGA 1GITA 1YJ5A 5JEDA 1DTSA 3ZGXA 1JXMA 2GDJA 5DNYB 2QPTA 2GXSA 4LYAA 2FFHA 2VF7A 4LV6A 1W0KD 5KHOC 4FWIB 2ZS7A 3M0EA 3OIVA 1N6HA 2PCLA 1BYUA 1UBEA 3W90A 5FFMA 2CK3D 2RH5A 2ZRKA 3U2QA 2OFXA 4LBWA 3NEJA 1WMSA 2GETA 3AEZA 4CGZA 4US1R 3RS2A 3NG1A 4KLNA 3ADBA 4Q4HB 1D2NA 1I2DA 3A1WA 3EA5A 5LB2A 2O8CA 4LWZA 1LB1B 3R20A 2P2LA 4Q4LA 2F55A 3TVTA 4LJYA 1OSNA 4BFYA 3BJIC 4L4UA 1JECA 1S3GA 2Q6TA 3OE7D 1E1QD 2VA8A 1OT3A 4UXJA 2PMKA 5AJWA 2ODBA 1W2HA 4LPKA 3QKUA 5F98A 1UKEA 3MWLA 4M8NE 2WJJA 1T4GA 1VCOA 4NYJR 2O8BA 3FFAA 4KHZA 2X8AA 4G5GA 1PLKA 4M9ZA 2J46A 3LNCA 1NY5A 2IT1A 2BHRA 2XB4A 3V4FA 1SVWA 4ON9A 4Q4JA 4GSYA 1S8FA 1N6RA 5B2ZA 2FSGA 1P73A 2L0XA 2QGZA 1IXZA 3W3AA 5FTJA 2J7PD 3NIBA 1W44A 4P31A 4D4LA 1ZCBA 3CM0A 4TTRA 2OT3B 3QVVA 3WRYC 4F91B 3BRWD 4RFSA 2NO9A 4Q1AA 3LX5A 3K9HA 1E0AA 2NO1A 3V9PA 4Z1MD 1FW6A 1W36D 4UXIA 1HY3A 1JALA 4Q00A 5FOWA 4FD2A 1G17A 3CPJB 4JIMA 3AVTA 3DVLA 1UBFA 2EFEB 2G3YA 4F38A 2GK6A 2ZVPX 1XWIA 2ODWA 2GAOA 1OW3B 1D2EA 1J99A 4G01B 1G5TA 1GNQA 3OAAA 2BM0A 3TUJC 1YZTA 4RVCA 2GCOB 1QF9A 2K5UA 1OKKD 3PQCA 4NCKA 1UKVY 3N2IA 4NP6A 3VTKA 3UANA 3SQXA 2ZANA 1E99A 2PLRA 1VECA 3QF4A 5FUVA 4MRSA 5HE8A 4HB0A 3TSWA 1U9IC 3V00A 4B76A 2FSHA 3AVWA 4NCIA 1P72A 2WMOB 1P61B 3DMNA 1N6LA 1NBMD 1TPZA 5H70A 1OIXA 8OHMA 5FL3A 3KB1A 5ANRB 1ZJ6A 1RPZA 4C7OB 3RRZA 4US0R 1S1CA 2RCNA 4TQAA 4Q48A 3ASYA 3REGA 2HDNB 5KDOA 4RKEA 1YU9A 3NBYC 2RGNC 4KLZA 1SVLA 1XMJA 4HZUB 1VYTA 1FP7A 1OHHD 3TH5A 121PA 2HYDA 2NO6A 4KYIB 3AF4A 3U3RA 2ZS8A 3FDIA 4GOXA 2CJWA 1NIPA 2ZUBA 4WZ6A 4XWKA 2XX3A 3G82C 2AXNA 2C2HA 2J41A 2OLJA 4IOMA 3B2EA 4LPSA 4D0NA 2CVFA 2IYSA 1VG0B 2IUUA 3VMFA 3EZFA 4KXFB 1N5KA 4M1WA 2YC4C 4P4UA 4MUBA 2PT5A 5CLLA 2P5TB 5JS8A 3KQNA 1KHTA 2H5EA 2OG2A 1N0VC 4BLPA 4S35A 4D4JA 5CITA 2JLVA 3VNUA 4TYWA 1O87A 3U7HB 1U94A 4RZ2A 1EESA 4RJLA 4N0DA 1NY6A 3KUCA 3NH6A 3ADKA 3K09C 3C7KA 1QHSA 2QTVB 4GRAA 3I61A 3RWOA 4Q1FA 4UKDA 2V7QD 4LHVA 2ZE8A 4FCWA 4QBFA 3I1FA 2GBLA 4JLAA 3WP1B 1LFDB 5ELXA 3CBQA 1UDXA 3I8XA 2ANCA 3PITA 4YXWA 4B75A 1NKSA 1TF2A 2GCNA 3Q5DA 4BUJA 1NKTA 1RYFA 1U0JA 5EE9A 4RZ3A 3WHLA 2QSYA 2ERXA 1U0LA 4NCJA 1DAKA 3PEVA 3E5HA 4Q9KA 1KO8A 3GLIA 1KI1A 1M34E 1Q1BA 1ZM3A 2XTNA 2ODNA 3WNDA 4D0LB 1D6JA 2RHDA 5JS7A 1KZ7B 1E96A 4B74A 2A78A 1K5GA 3BORA 1RC8A 3OEED 4JLOA 4ACBA 2QL6A 4AG6A 1N6IA 1ODFA 5AUOB 1KO7A 4RD6A 4AI6A 5HCNA 3VX3A 4IHQA 3ZZ0A 3NBXX 1GVNB 4LYFA 3OIUA 4XVQA 1EX7A 3ZS9A 1FMLA 3T12A 4PFSA 1Q22A 1ESNA 3RWMB 5GVSA 2J9RA 4URVR 4XSGA 1XZQA 1R8QA 3MCAA 4HATA 4Z8XA 1UBGA 4EJSA 5DLQC 2VQSA 4QOSA 1V43A 3THXA 3Q3JB 1LY1A 2YOFA 3A58B 2FFAA 3U44B 1RRPA 4LBVA 5EZ6B 2VHQA 3GJ7A 4LY6A 2FH5B 1Q21A 1XU4A 4RD1A 5K8UA 3GLFB 3P4YA 3TKLA 2P6RA 4DDTA 1COWA 1TEXA 3RDPA 2ZE7A 1W0JD 4LHYA 3T35A 4CDGA 3LQQA 2GJAA 2W83A 2REBA 1U9IA 1NLFA 2IF0A 1IONA 4NYIR 2PX0A 4Z51A 1RKBA 4K8OA 1OF1A 4Q66C 4BFWA 5BW8A 3CWQA 3VR3A 3BERA 5CDFE 1BOFA 4Q02A 5FOTA 4BLQA 3BH7A 4OBEA 4L9SA 1KOFA 1QZXA 2P65A 5F9HA 1ZW6A 1E2KA 1YE8A 5FBVB 1G18A 2D7CA 5CM9C 1G3MA 821PA 1J2JA 3CH5A 4JVMA 4QHTA 2IS2A 4CT5A 2ZJ5A 4ZI2A 3GLIE 2FV8A 3EC1A 2UZIR 4CEHA 3U5ZB 3WBKA 2G0NA 5LD2B 2HF9A 3GEIA 2RHMA 2AFIE 4M9XA 3X1WA 3IDQA 5D3QA 1UADA 3FPAA 2WSSD 3AKYA 1LNZA 1EFRA 3RANA 3EARA 3WMFA 2QE7D 4FINA 4CZ2A 3RS3A 3HU1A 3QXJA 4MKGA 5AJVB 4EPTA 3MD0A 3CRMA 4KBGA 1Q44A 2F43A 3ZDQA 3LXXA 1XMSA 2IYRA 2QRNA 5FPKA 2IS4A 2DCUA 3KKMA 4DLYA 1U8YA 2GVZC 3TK1A 5J4HA 1E0KA 2QM8A 1XTQA 3K8YA 4PO8A 4HLQB 4DRZA 1R0WA 2ZXUA 2ZRAA 2BM1A 2W00A 2YWFA 2OCBA 4H9GA 4YMSA 3I5YA 4MKIA 4PAQA 3OFND 4MRNA 3AF3A 3B1WA 1NSTA 1T5LA 1JR3E 1U8ZA 2NTYC 3HDTA 2CL0X 4A2PA 3P20A 5FBWB 2DR3A 4B3BA 2WM9B 4ZDKA 3SI7A 3D7MA 1WA5A 2V6JA 4N1AA 4PC3A 2A2ZA 1Z2AA 4POAA 3QKTA 1KK2A 4DIDA 1IOZA 1PLLA 1HT1E 1UAAA 2QP3A 3VHXA 5B64A 3CKLA 4II7A 2YNMA 1KI2A 1EWRA 721PA 3QKRB 3SU8A 5HZKA 1M74A 1KY3A 4Q47A 1H8EA 4ZCLA 4DLZA 2V1UA 4PZZA 1MO3A 1E2HA 2Z6VA 4M22A 5SZHB 4EQ6A 3K9NA 1NN3A 3LAWA 4KJZA 2RGBA 3PEWA 1GKUB 4ITRC 4V0LA 5DI9A 1FOEB 1II9A 3THOA 4QNMA 3U6KA 1VMAA 4BE7B 1MRNA 2VF8A 4P4SB 5DHAA 3MGCA 2W2TA 3AKDA 3SJAA 1RW4A 3KZ1E 3ZIAD 5G53C 3VU9A 1IY1A 4PHGA 4UNSA 4LOAA 2PCJA 4MQBA 3SJZA 3Q85A 1BH2A 3KJIA 4OHYA 1ZC3A 1E0JA 3O8DA 4QBIA 5FBRB 3BWDD 1YZLA 5LB4A 3W3ZB 4C0SA 1GOTA 5G3ZA 4ZI3A 1E9FA 2X2FA 1N2CE 5EXSA 2ZRLA 3CB4A 4CRWB 2ZEJA 4NCHA 1Z07A 5C4MA 4LHXA 4B2LA 2WWXA 2BMEA 3CW2A 5KNCA 1M2OB 1SULA 4QBHA 3CZQA 3O8RA 4C0BA 4EFNA 2YJTD 2O8BB 4Q18A 1P9RA 4Q01A 1FNMA 5F3WB 2Q9AA 4PHHA 1EFCA 1WP9A 1ZD9A 5F2EA 3AVXA 1T91A 2PEZA 4IOKA 4ZPXA 3R8FA 2AD1A 1WXQA 4RKFA 1BMFA 1V5WA 1E32A 4H1UA 3VR5A 3PIRA 1NN0A 3K70D 3ZQJA 2CNWA 2RKOA 2WAXA 1G4UR 1G8GA 3A4NA 4DHEA 3CIOA 1KI8A 1GL6A 4JT2A 1Z3IX 2BEJA 2GVDC 3W8NA 2BKEA 3TNFA 5KU1A 2ZAMA 4ASUD 3SYKA 5TV2A 1G16A 4NYIQ 4JMPA 2CDNA 3PJRA 1E2DA 3ZVMA 1RYHA 5TDHA 4YQFA 5CK4A 1E69A 3DOFA 3FB4A 4MITA 4BEBA 3SJBA 2HLDA 4DSUA 1G41A 1LS1A 2NMVA 1L2TA 2JLYA 1K6MA 2FJUA 2CE2X 2J3EA 1OYWA 1X8JA 1AIPA 2CLDX 2GRJA 4TSFD 1JB1A 3B8HA 2KE5A 3CPHA 4XD7A 3UATA 3NC1C 1PZNA 1G7TA 2E9SA 2B8WA 4XH9B 1KMQA 2WSSA 3G0HA 1DG1G 4E5UA 2GWHA 2J0QA 1IY2A 5JWOA 2BVNA 4TMKA 3EZ2A 4TLDA 3L0IB 3EAQA 4BZQA 2R6CA 3LD9A 2OAP1 1M6NA 2W6ID 3BH0A 1XDBA 2NPIA 3QKRA 3K0CC 4QGHA 5DYIA 3W9YA 5AUPB 4AKIA 1Z2CA 2CHGA 2XZOA 4ZIRA 2B21A 2C03A 4IW3B 2OBLA 2Y8EA 4PPGA 2HXSA 4OK6A 1FMJA 1OYYA 4BLSA 5C1BA 1N6NA 4O2LA 4I1VA 2WJIA 2WWFA 4EIWA 1JAHA 1FNNA 1VPLA 1AGRA 1XJ0A 2H92A 2XNDA 2CLCX 2WV9A 4PX9A 4NCNA 5EE3A 2QROA 3BH6A 3FFBA 3SR0A 5KPJA 4WXRA 2HT6A 3B1VA 2JJ1A 2GCOA 1E9EA 4CIDA 2YHSA 4MYUA 2IEYA 1UJ2A 4PC6A 1JXOA 2VHCA 1CULC 3W6PA 2PJRA 2QPAA 5AJXA 2KBEA 2OXRA 1ZM7A 1DPFA 4HSEA 4RD0A 2WWYA 1B23P 4PZYA 2N42A 4N0EA 1LF0A 4V03A 2VH5R 4IDHA 3B13B 2DY1A 3OE7A 4NL4H 1NMXA 3HPQA 3OIYA 3QG1A 1F2TB 1H8ED 1ZAKA 3GEEA 1P7CA 3EIQA 4RCYA 2ZR9A 1G8PA 1CR1A 1W46A 3QEJA 3AVQA 3Q7QA 2QMHA 1XPRA 2DFKB 3AP3A 1X1RA 2W2XA 4DSNA 1IQPA 4ZCMA 1Q57A 4CF7A 1EGAA 1Q20A 3TVDA 2QGNA 4TL9A 1Z8FA 3QIAA 1KZGB 3O47A 4Y0AA 3RYTC 5J4KA 4CEJB 3GLGA 3QF7A 4PAOA 3LV8A 2JLQA 3AP1A 3GLFA 2JEOA 3CO5A 1XBTA 4M1TA 3MUFA 1NVXQ 2A9KA 3UK6A 2REOA 2ZYUX 1S9DA 2Z4RA 4BFZA 2C9YA 3EW9A 3TUIC 3IO5A 5KYKA 1OFIA 2C9OA 1FP6A 3MMPA 4GZLA 3UWOA 3BE4A 3T06B 1DAHA 1KI9A 1XB2A 4RFVA 1FX0A 2BMFA 3IPXA 4LJ6A 4V0OA 1AKEA 5K8IA 3AVUA 1EG7A 3UIEA 4DDWA 4P0TA 2QU8A 2QY9A 3NVAA 3EZ7A 3Q7PA 1WBBA 1Z0DA 4KFSA 5SZIA 1S3SA 5J47A 1SXJC 3B1YA 3THWA 1RZ3A 2A30A 2JDID 1TTTA 4NZYA 4TL7A 4D6PA 4PQFA 1A4RA 2AN9A 4KITB 1H8HA 4A4DA 5KO2A 1NL3A 1S4QA 1W4RA 1KGDA 1DARA 1II8A 4QKQA 1KMHB 2Q3HA 3QPUA 4DEYA 2OCPA 3ZVRA 1VG8A 2AXPA 3SEAA 2F1HA 4W5WA 1J70A 2QMEA 5JJLA 4JLMA 1R7RA 4D2IA 2GK7A 1MV5A 3QSYA 4KVAA 621PA 2HCJB 2JJ2D 3LY5A 3D31A 1TADA 1E3MA 2WAYA 3KJGA 1CEEA 4EJSB 4PC2A 1Q3HA 1N5IA 1KI6A 3W5JA 2OV2A 2NOAA 2RGGA 2IUSA 1Z83A 2FN4A 4A2QA 2ZRDA 2J7KA 1LV7A 2CXXA 5DGXA 1CRQA 2OESA 2ZE5A 4QGFA 2OM2A 4WXPA 4TYNA 1NBME 1XEWY 2HCBA 5BXQC 1T8TA 3FYHA 3O8CA 1Y3AA 1XCGB 2GCPA 3IHLA 3PEYA 2GTPA 5JHGB 3H84A 3GPLA 3RNLA 2X1VA 5L3QB 3MFYA 4BLTA 4PR0A 2AK3A 2B8TA 4PHTA 3WP0A 3NDPA 4EAQA 1ONBA 1XMIA 1JNYA 2WICA 3U61B 3MLEA 3GFPA 3ZYCA 1XPUA 3DZ8A 2ZJ8A 3M6AA 3SN6A 4W5JA 1OLOA 1XCPA 2EFHB 1RRCA 4MGZR 1E79D 1WDTA 2VTKA 3EASA 2VYFA 4C3ZA 4JZKA 3HPRA 1D9ZA 1WQ1R 4NHOA 4LCBA 1E9AA 2V7QA 5JRZA 5K8TA 1P9NA 3MRSA 3GCGA 2IF2A 5E95A 1Z0KA 1S2MA 5IRCD 3GLHB 3RVBA 4A92A 3GJ6A 1DBSA 4UXHA 1NI3A 1X86B 2GHIA 1EFUA 5FTLA 4D25A 2RGAA 4KSCA 4ZKEA 1E6CA 1KDRA 3PFIA 3ZS8A 3GLFE 2JJ1D 2IWRA 4IVRA 2AWNA 5M04A 1K8RA 4JLDA 4LSGA 5EUMA 2O0KA 4G3XA 4OJQA 4OYHA 1YR6A 3IGFA 4PPFA 3EWAA 2ZRCA 4MGYR 4Q9JA 1VDZA 2O0HA 5DIFA 1OFTA 3ZH9B 3LRPA 5G40A 4HAVA 1ZD1A 4EPXA 1UFQA 2BOVA 1IXRC 4US2R 1SHKA 1TNDA 3FKQA 3UMFA 2WOJA 1WE2A 1KSJA 1KIMA 3CF0A 4PPQA 4R9UC 1SXJD 4C0KA 5FL7D 5A4JA 4WOPA 1TF7A 4HEJA 4QNRA 3RRMA 2XJ9A 3S1AB 4ZCIA 4HI0E 3K1JA 2CVHA 2BBSA 2ZI5A 3PR1A 1KTVA 4TT3D 5C4GB 4BFUA 2A5JA 5JSZB 2N1BA 1KNQA 1NLYA 4NKRA 4Z54A 5H68A 4URZR 3A1SA 1HURA 1R5OA 2PZGA 4Z8YA 1LW7A 4L8GA 4QM7A 5JBQA 5GJBA 1MOZA 5CM8B 2EFDB 4AD8A 4C2TA 4ESVA 1C1YA 1NRJB 2GEVA 4V0MA 3I4LA 3K9GA 4IDNA 3QY0A 3AVOA 5AR1A 1E2EA 2E1RA 4I1SA 5KSZA 5AK0A 4GP6A 1AQYA 2VHTA 5FTKA 2BWJA 2BBOA 5FUYA 1FUKA 1TQ6A 1TMKA 4M1OA 3KXKA 1ZM4A 3PXGA 4MUAA 4JVNA 3AF2A 3MWYW 2YWGA 3CNLA 3L8YA 3U3JA 2Q0HA 3DM9B 4YC7A 4B32A 3RHFA 2ZRMA 1YKSA 2CLSA 1QHHB 1SQ5A 3PUVA 4JBXA 5JJIA 2R62A 1AN0A 5CIQA 3Q72A 4HAYA 4HAUA 2Z4SA 3AUXA 1QHIA 2AWOA 1GNRA 2O52A 2V55B 2WWIA 1R0XA 2GZDA 2EFGA 3QXHA 1KJWA 4TWZA 1OE0A 1A7JA 4QC2A 1P2UA 1ZYUA 4YMVA 1CJTC 4TL6A 3SS8A 3FWYA 2QQEA 1VTKA 2AL7A 4GDFA 3QBTA 3UG7A 4A6PA 2BIFA 2ZRPA 3EWSA 3PG5A 4A0FA 3SC3A 5AJYA 2JJ2A 3U4QB 3SHWA 4NU0A 3RRYA 3DKPA 1G7CA 2V4ZA 3MAAC 3TQCA 1E9SA 1VHLA 4C7OA 3FHTA 3JVVA 3KFVA 3L82B 3WMGA 2ORWA 4PQYA 4FMCF 4OK5A 3CR8A 2QE7A 2VP4A 3ZJYA 2VBCA 5HCIA 3FOZA 3AKCA 2BCJQ 4M2LA 1MABB 4JVSB 1XPOA 3ZQ6A 2V3CC 3GJ3A 3MJRA 5TMPA 2WBLC 3LO5A 4A82A 4B71A 3IILA 4MGKR 2ZYVX 3F8TA 4TTPA 4EFLA 2IUTA 3K70B 5JI2E 3CRW1 1FTNA 3LLMA 4ERNA 4NBSA 2BMDA 1G291 4BECA 1N6PA 4GBMA 4YXWD 2XEXA 1R0ZA 4P32A 2NIPA 1XD2B 4MRRA 1MH1A 1JPNA 1NJFA 1FFHA 2ZJZA 2H1LA 4UQOA 3FHCB 1D2MA 4D26A 4HDOB 4QM6A 3A1TA 4G5OA 1N25A 1X8LA 5H1YA 4BRWA 1KAOA 3TGPA 4OI4A 4A1FA 1GRRA 3SFZA 4XIGS 3RRNA 1P4SA 1NF3A 2G1KA 5FUWA 3EPJA 1GRNA 2ZROA 1Q0UA 3A1VA 1YZQA 2ZVQX 1YVDA 1G21E 3QUSA 2ZQ5A 4IOJA 1ZIPA 2GEDA 4DCUA 4CT4B 2ZI9A 4FCVA 1KSGA 4ZDIA 5DI3A 4DB4A 3C5HA 3QKSA 4ZDWA 4JLPA 2WVJA 3X2SA 4HDCA 2CL6X 1DEKA 1M7GA 1VIYA 2NQ2C 2ZRGA 4RSGA 2PZFA 1E9DA 3U3KA 4G5RA 1OIWA 2JGNA 4MRPA 2DFNA 2GZHA 5EE5B 4DSTA 3K0FA 2GA8A 2GILA 4JBWA 5FL7A 4AY2A 1CIPA 1CJVC 4TMZA 1CR0A 1GL9B 3EIHA 1X6VA 1YR7A 3CNNA 4UNPA 2O0JA 4LV5B 1W0JA 1CKEA 2WHXA 2BJWA 2YWEA 3T1OA 4GOJA 4V0ME 1IN6A 4XWOA 4AYTA 1F2UB 4HUQB 4YDHB 4L5BA 4HZUA 4DJTA 4YLGA 3RS7A 4B33A 4BZXA 1IN7A 4P33A 2OAQ1 3TRFA 3K70C 4LJ8A 4NTZA 1AK2A 4M4SA 1HTWA 2Q21A 2DFLA 5GJWC 5KNBA 4RZUA 3RSOA 1KI4A 3CNOA 4TZ0A 3B5JA 1HA3A 1G64A 4LZZA 4DB2A 2YC2C 4L9WA 1CS4C 5EP3A 1Z6GA 3VR6A 2B7CA 2XTMA 4QFMA 1G8YA 2JLUA 4QBGB 1UBCA 1D8TA 2AX4A 2VL7A 4LV8B 4B3FX 1YZGA 2F3RA 4DCSA 3IHWA 3LQRA 4IXNA 3SOPA 1T3SA 3A6PC 1CRPA 1VKJA 2A5YB 4IEEA 4MRVA 4DIEA 2H17A 3RC3A 4S2EA 5BYJA 4PZLA 5HR5A 2F9MA 2WIAA 5CYOA 3R8CA 4JJZA 5C2JB 2PH1A 3AF0A 1F48A 1P62B 2FMXA 2WSMA 4B47A 1US8B 4DCNA 5JI3E 2HLDD 3KKQA 3B85A 2WTUA 4TYYA 2JASA 3DKVA 3QEOA 4E03A 2EYUA 3K0AA 4GT1A 2A5DA 3B82A 1W2GA 3UXMA 3PUZA 4IDQA 2JLXA 1XX6A 4TSFA 1E2IA 5L3SB 3ICEA 2DB3A 5EE0A 4X8MA 1P2VA 4URXR 3B9PA 3VFDA 3THYB 2PLFA 1XJCA 2YINC 1N6KA 2VP6A 4NPHA 4JS0A 2HV8A 4Q1EA 3MWJA 2ZR0A 2ZYWX 1N5LA 4IEIA 2BMJA 5GVRA 4AKEA 1AM4D 1PUIA 2CE7A 2ANBA 2ZYTX 2ATXA 2F1IA 4DLSA 4I1OA 5DO9A 1R6BX 3OHMA 4JLJA 5FUXA 1HQCA 3IIMA 3ND9A 2FEOA 2HEIA 5L3SA 1Z06A 1ANKA 2EU8A 1EK0A 1Z6YA 4U5XA 1PLJA 1Z22A 2R6DA 4WZAE 2ZRHA 5KDDA 1XTKA 1QRAA 2MSEB 2XTZA 2IXEA 4HAWA 1NLZA 3ONWA 1OB2A 3DEFA 1RFLA 3LBNA 3EZ6A 4GMDA 1W1WA 1SVIA 2F1JA 3KKPA 1UEJA 5GJVC 3I62A 1QVRA 3TAUA 2IHYA 2GXQA 2WKPA 2EYQA 4RZXA 3J81k 1JR6A 4EPRA 2CCKA 3BFXA 2FA9A 3AV0B 1DS6A 4J0QA 2DFTA 1G8FA 1VG9B 4BFXA 4Q1CA 2REXB 2G83A 1IXSB 1IHUA 2G1JA 3JZAA 3KKNA 1JJ7A 4CEHB 4GNKA 3LXRA 5AWFC 2BKUA 1CR4A 4A0RA 2DYKA
chains in the Genus database with same CATH superfamily
1MBZA 2O5VA 2P3SA 3WSTA 5I7WA 4LC9A 3OESA 2F4VB 2PL9A 3RBAA 3UWMA 5FV7A 4Z1MA 2QVLA 3WI7A 1SU4A 1NNEA 4JP2A 4YJGA 3AHGA 4DSAA 3I5AA 3MUOA 3TPFA 4RTKA 1LPBB 2WV7A 5EMNA 4MUKA 2GSWA 3LH5A 3H1GA 1EINA 3GVCA 1KU6A 4OHXA 1WSWA 2BGWA 2QA5A 4W9MC 4C4ZA 3ABRB 3G2JA 1EXMA 1W88B 1NXTA 1P75A 3JQAB 3FSGA 3QVOA 5C0OE 4TXHA 4OHVA 2P3QA 4GL4A 3UKOA 2J30A 4N3BA 1FDSA 4FBMA 5AM4A 4LXTA 4MMZB 4Z9YA 1N2IA 2M98A 3D3JA 4LY0A 1CRZA 1OKKA 4B6EA 3U6BA 3T1YB 2A5GA 2JCYA 3CH7A 4DQDA 4BQFA 4AZSA 3JQGB 3GJ0A 4LA4A 4LTDA 2UZ4A 1SVOA 3HL0A 1J8YF 3E6AA 4UATA 5K0GA 1NBEA 1S7GA 1OQAA 1XLUA 2AFHB 3LF1A 1GTG1 4D74A 2VRCD 1NQOA 3NKFA 4KIUA 3V6MA 4NJMA 4PBTA 3PUHA 3TQRA 1VJ0A 3SSMA 1XYVA 1YZNA 1I4WA 2WTNA 3LBIA 3KZCA 3VO9A 4ZWNA 4JLSA 3WKEA 3TVYA 3IUBA 1E92A 3DBLA 1N77A 2FUG1 4IIUA 4ZYUA 2AG1A 1IAQA 2NXEA 4TMTA 1TUGA 3BXGA 4DJ5X 1Z13A 3NT5A 1Z35A 1G21A 1FQWA 3QUCA 1ZWKA 4Q4AB 5EJ4A 1C2YA 3JATB 2YXDA 4Q1VA 2FZLA 1ZLXA 3KLBA 3NBAA 2IODA 1HQYE 3GJQA 3L1IA 3OWOA 1NA5A 2I03A 4JXKA 3WRVA 5KSOA 5LQCA 4MIEA 2P77A 2V6FA 1YRLA 4ABYA 2ZIEA 4V3BA 5ALYA 1CUWA 5AIAA 2VPWA 4Q1DA 4MI6A 4QASA 1PX0A 2UYYA 3KQPA 3LT0A 2OM6A 4YDSA 1D03A 4ZOBA 2HSWA 3F3MA 2Q46A 3C39A 4UAJA 5E6RA 5I8PA 1P1RA 1Z0SA 1XSEA 3TAXA 4WAUA 3U9TA 4F5YA 2GCGA 3UGJA 3T3DA 1UF9A 2WTAA 4OBXA 1OFUA 4FMDB 1VG1A 1SOVA 3JD0A 4HLDA 1LS6A 4XTCS 3NUQA 3KSBC 3HR7A 4YCLA 1NVWQ 1JXQA 2BE9A 2V6MA 2WKRA 3G79A 3BL8A 3GZJA 4TMFA 3LY9A 2WB2A 1IN8A 3OJFA 4TRRA 1N78A 5E9JA 1E2PA 1UQRA 1CFJA 4WCFC 1ONSA 5DHFA 4ZRDA 3X0DA 2YYSA 1QONA 3AVPA 1YVUA 2UZAA 1NPTO 2EAUA 1JHVA 2Z56A 1N3YA 2F3TA 4BBZA 5IT5A 1T0JB 3HKEB 3D6TB 4WK6A 4Z1MD 1VJDA 4QJ4A 4YCNA 1ZISA 1YMQA 2BJHA 2PKXA 4O2BF 2YJ4A 1E7MA 2WKQA 3PHLA 1JFFB 3QNMA 1T3HA 5D3KA 4B82A 5B3KA 3H75A 3AQIA 2NUAB 2J1LA 4KRXA 1EK5A 4LK3A 4LJ4A 3DZCA 2OHGA 2QPOA 2Q50A 1QDEA 3H4MA 5J2TB 4CEIB 1HE8B 3B6MA 2AEMA 2NVUA 4OSOA 4OKNA 3LPAA 2QTCA 4KQGA 1Y1KE 3HHEA 4AS1A 1RI2A 1FUYB 3GLHA 3NNDA 4X24A 2IHZA 2GFIA 1VBNA 5JLJA 4QAQA 1Y6FA 1T9GS 2ZITA 3HNRA 4KSBA 5TIIA 1RLTA 1V35A 3GQVA 3OZVA 1V11B 3JARB 4RZQA 3UTCA 4GRDA 3DL0A 4GX1A 2TYSB 2X0NA 3OX4A 3U0VA 4FGJA 1JDVA 2UUBB 4DDUA 5A5DA 3JZIA 4BYMA 1POWA 3AOEC 3E9QA 4TLAA 2VNAA 3KO8A 1C30B 5CVCA 2RGEA 4UBOA 1UKZA 5SY6A 3K53A 3FOEC 4DDMA 1QPGA 2VO1A 2PTHA 2Y0EA 2AYYA 3CNBA 2JLZA 4M8SA 4Z0HO 1OTHA 1GL3A 1QUEA 4A5SA 5DGDA 5J4LA 5MN5A 1KJZA 3RVLA 4GECA 4YPFA 1PT6A 3M3PA 4JJKA 3A8TA 9ABPA 1AJEA 3ZBQA 3RIHA 2DECA 2X14A 1VCMA 4O25A 3WRXC 3ZTYA 4CQNA 5KOYA 1NKVA 4RH1A 1ECCA 1WZUA 3NHZA 5ALQA 2WT8A 1NMYA 1RKXA 2PZJA 4GI7A 1WXEA 4MCIA 2RG7A 2NXJA 4JXZA 4J1SA 4PF1A 3HO8A 4ZMRA 1F5NA 2QRVB 4TT3A 2IX3A 1FS4A 3EHDA 4EF5A 1KRHA 4XYLA 3NTRA 2BF7A 4ETMA 5K3EA 1XA0A 3AEUA 4JYBA 3GV0A 3C16C 4IG9A 2VDUE 2XYQA 5CXXA 3WL5A 3GP3A 3MTDA 2XR1A 5B7NA 3LDAA 3WK8A 1JKFA 1ZD8A 1E3SA 1TJYA 2IPMA 2WM8A 3I6ZA 3T3IA 5IFLA 4NLLA 2GBPA 4Y2JA 3TEMA 3K8OE 1W19A 4ZVUA 2BEWA 1MR3F 5CD9A 1SD2A 1GG8A 4YV2A 2ASEA 1E6KA 1S8OA 2G0AA 1IRXA 2ZRNA 1XTRA 3ELWA 5FLKA 2DRIA 1JDJA 3A05A 3GYGA 2X0FA 3QEAZ 2PSJA 4OHPA 1WUIS 4DUGA 2W6JA 2IXFA 1MAVA 3K0HA 4R1UA 5DW3A 3LWNA 5LBIA 3I23A 5DI3B 3H0KA 1UKBA 5DSTA 1A8PA 4KYUA 3K4PA 3R76A 4YY3B 3HDJA 4DLRA 1P2TA 1P3DA 3H4VA 4ZU6X 1AK1A 1CUVA 2AFRA 3JQAA 1D3AA 1TYDE 521PA 3TI9A 4ARZA 2V54A 3KLPX 4NNPA 4R2KA 3AR9A 1F20A 4BLRA 1OI2A 1V5EA 1B8OA 3RUFA 4LBYA 3MJTA 3OT4A 3ADOA 3H9BA 2K2QB 1G42A 1KSFX 1UP6A 1NHWA 1QQ6A 1XP5A 2IP1A 2PUHA 2X2EA 3F4KA 3QOWA 2FUG6 2IOFK 2YWRA 1X7WB 4KB5A 4TN1A 3S68A 2IUYA 3LK6A 3ZZUA 4E13A 1M1XB 3LA6A 4FT4A 3DAPA 2CVQA 3ZWOA 2EJCA 3H9CA 5IBCA 2JAWA 4U2FA 5JE8A 3QMPA 4D9CA 1M8JA 5B7QA 1C7IA 4W8OA 3PPYA 3S1SA 5JAOA 2C77A 1TAHA 3ZJUA 2G36A 1OH8A 1T3GA 2EBFX 3OQJA 3TW8A 1KJNA 5JBIA 4CEJA 1NATA 3L8HA 3X1ZA 2PYDA 2C92A 2VP9A 4WDQA 3UK7A 3QVGB 2VBIA 2X76A 1ETUA 1N3BA 5I5EA 1MLDA 5BQOA 1BVUA 1KVSA 4NDAA 4FDLA 2X0EA 2O5CA 3MFQA 3KLNA 3H87A 3OQIA 2FR0A 3CJTA 1DFHA 4YCMA 5K8JB 3G6KA 3W5CA 3ITEA 5DYGA 3ACDA 1BE1A 1ADYA 1J7KA 4ER3A 2DH5A 4PIVA 5F9MA 1TYBE 2VDPB 2CFIA 2YY6A 3BYZA 4YJDA 2X5OA 4Q3CA 4M1QA 5K0TA 4UJ5A 4MLZA 2JB9A 1KH1A 1OPRA 1U2PA 1ZCAA 3C98A 1KJYA 3FCEA 4CCAA 2IYYA 5HUQA 2VK8A 5J43A 4XSHA 4WW0A 1OWNA 1UMDA 1W75A 3L0PA 3HYCA 3EVNA 3RKSA 4PLCA 5SZKB 2H31A 4NE9A 3MSXA 1PJRA 3WYBA 2HK6A 5A4IS 3GLGB 3BGIA 3KQMA 3IDOA 2IVZA 4ND1A 1JEAA 3R6DA 4P5PA 1IN5A 1J21A 2P75A 3QWFA 1Z5VA 4HDMA 3EXFB 4MULA 3T4EA 3HP7A 4FFBB 3U1TA 1DJOA 2YV2A 1T6NA 1IIRA 3CA8A 1NJ8A 2UVDA 2BZ0A 2C9CA 3O0TA 4UU7A 4AXXA 1YE3A 5JYEA 3RUHA 4AMBA 1RQPA 4L0CA 3ZI7A 4B48A 1OCEA 2JCSA 4RZSA 2X0DA 2G1UA 5JS8A 1YFKA 2I1VB 2IYTA 3ISVA 4K6FA 2AJ8A 3SC4A 3H1EA 1DKNA 1SKYE 1VHTA 3PQDA 4JP3A 3DZDA 4UVIA 2W9XA 4NV3A 1TJPB 4X66B 4CCYB 2B20A 2ZSUA 1R6AA 1YZYA 2OPBA 3BMXA 4ZCQA 1EUZA 2QQ0A 3L4BA 2AN4A 1GKIA 4R0VA 4QVKA 4QFDA 5IZ4A 1T6YA 1GWNA 4IFEA 3U60B 1EUQA 2HJVA 3K31A 3I9LA 2BGMA 1Z6TA 3QVWA 1LJ8A 4G26A 5JD3A 3LUFA 2G9QA 1W8IA 1FSSA 1O2DA 3LUPA 4EARA 2FKNA 5A05A 3PDIB 2WQ6A 4K3UA 2M1XA 1BXZA 2EWVA 1PNVA 1F1JA 2OVBA 3ZHUA 4DANA 1TK2A 4TOIA 4XGNA 1S8AA 4YACA 4FYMA 3B5IA 2GD0A 5FWAA 4YRSA 1CDOA 4B3MB 2ZREA 4QL3A 2NU8A 3ZG6A 4EGCB 3BTOA 1PVDA 1K7XB 3A3NA 3NOVA 4XUCA 4TZ6A 1P4AA 1TYZA 4FIDA 5JC8A 4F46A 1VFPA 1AZSC 3IIJA 2AMLA 3OLVA 1ZESA 4NYMQ 3T3MB 3ZHOA 1DAFA 3O38A 4FS3A 1WW2A 3LT5A 3WE7A 4N8EA 4Y9SA 2OCYC 1M2EA 5CX4A 2VK4A 1ZINA 3YASA 3D6VA 4UHJA 4OG2A 1E59A 4CKBB 5FOXA 4L5YA 4DT1A 3FBTA 3TKAA 1U3UA 4XEUA 5J3JA 1CBUA 4ZRNA 2H0RA 4OHZA 3ISTA 3V4PB 5K5EA 1QGOA 4LC0A 3BWVA 4EG0A 2POQX 3BICA 4BLWA 3AOGA 1AKUA 4MVJA 1XP8A 2H5JA 4I36A 1PR0A 1DC3A 4CV2A 1N5OX 1RYBA 3ET4A 4RXMA 3AILA 4C2UA 2EDCA 2WJWA 5JNRA 1IBKB 4JI1B 4OQNA 4OI1A 4NZZA 4YP5A 5J63A 1JYSA 1BEUB 2B8JA 4NZ9A 1N3LA 3DOOA 4O1MA 2IZ0A 3CEAA 3OEHD 1B2RA 1GRVA 1JSCA 4FMBB 4RCZA 5CTAA 5EWMB 5TARA 4EA7A 3CH4B 2IPXA 1QX4A 4OQMA 2RI6A 3A4TA 3RVOA 4Y7CA 4LJAA 2VHUA 3D3WB 5JATA 1PZGA 1I1HA 1RHJA 1ITZA 5EIEA 2O2SA 3KHSA 4COKA 3KKLA 1U7OA 1N7HA 3UMCA 4EM6A 4JODA 5KYUA 2OZLA 1O97D 1SHTX 3H7IA 4NABA 1D1QA 1UKAA 2VJQA 3IP5A 3F67A 1HMYA 1HE2A 1RJ9A 2LDBA 6LDHA 3W6ZA 4EECA 2DU8A 1V5FA 1CJMA 1IVYA 3HKDB 4MVJP 3T5DA 3LW7A 2ID4A 2O3RA 3NHRA 3DDCA 3O8QB 6ABPA 3RTAA 2C8VA 3WAKA 3UBTA 1GZDA 4UNQA 4DR2B 3MAJA 5I3ZA 2ZZKA 2FMTA 2NG1A 2Q2WA 1MN6A 3BZUA 1U8FO 4Y1RA 4H3KB 1K3TA 3BD9A 3GGJA 4R2IA 3BGSA 3LC1O 5ERGB 3GJ8A 4MWOA 8MHTA 2FN9A 5DNEA 1NW5A 3U3OA 1TUIA 3ESXA 3OTQA 1T2NA 2GKSA 1GA4A 5JDIC 1E4EB 4B3SB 4J43A 1UT5A 3H5NA 1EA7A 1NJGA 2ORYA 2J9XB 3KZMA 3QVUA 4EKDA 2PJDA 1T1RA 3I28A 1XD2A 3PNVA 5CH3A 4H6VA 1TX4B 2CFTA 3FTNA 2W93A 1E3EA 2PRZA 4MV8A 1JIJA 3NJRA 4DV4B 2QRUA 3FKSA 1T2DA 4KTVE 5KDLA 2MYPA 2QN9A 3ZD6A 6REQA 2BLNA 2G70A 3AXTA 3BDAA 1NFRA 4PZDA 3CB2A 2BMAA 1ZQ1A 4XDZA 3HEBA 2ATVA 2ZULA 5HMLA 1N8SA 4WNAB 3L8CA 3VH1A 4DLLA 5JADA 3BTSA 5EN4A 3KCQA 4C5CA 1Z56C 1Y4ZA 1XLTC 1K27A 3AH8A 5A1JA 1SOMA 3OIWA 2OYSA 4IJ5A 4F91B 1DRUA 4D97A 1QVVA 4HYEA 4A03A 5I7EA 2ZJ2A 3PC4A 4ZVVA 2E4WA 4ND3A 4O3MA 4IIVA 4Q19A 2ZTLA 4KPEC 3ANLA 1NR5A 3K0CA 3CMCO 4HX5A 2CHUA 3FMIA 1Z8DA 1JSZA 2JBHA 4HEHA 3GFTA 5E9QA 2HDWA 3PKZA 1XCOA 3TR0A 4X1IA 3GD7A 4Z3KA 3T5MA 1JH8A 1EI9A 2PLWA 4L4XA 4RQAA 4CYMA 1XLVA 3AU9A 1X80B 1SVUA 3K0AB 4N7BA 4TWJA 2PU7A 5I4IA 4QXAA 3RFCA 1UK6A 1NYLA 5DM70 1VJ1A 3ML1A 4PQEA 1AUXA 3C7CB 3QOXA 3TW4A 3P9CA 5JNWA 1VHDA 1WUYA 2NUAA 5BVHA 4GKJB 4BNIA 1R66A 3WYFA 2HRCA 1EK1A 1YR1A 4Q34A 1RXSA 1V37A 2MDTA 2P3LA 3GH1A 4MJ7A 4BMPB 2RHBA 3VOTA 3T9CA 3R9WA 2RAVA 4OHCA 3KM0A 1SD5A 2YV1A 1A1SA 1FSGA 3AUYA 3E9DA 3MT7A 5AKIA 4YRJA 5JNTA 3KV3O 3G23A 1XPJA 2HSJA 4BEJA 4EA6A 2YTZA 5DHUA 2V9ZA 3IPLA 4RHTA 4UTVA 1RACA 2IA5A 2NVUB 3GEGA 4HNQA 4D02A 5JH7A 3BGVA 2D3WA 2LIVA 4KXNA 1E6WA 3TZEA 3VR4A 5AW5A 2ZBUA 3GFGA 1GIAA 1P60A 2Q7XA 3RJTA 1JBEA 3RWMB 4DPKA 1UJ5A 3ZW8A 3FTDA 5KYWA 3O3NB 1TJ5A 4DV2B 2QNRA 3HXOA 3MG9A 4ID9A 1LRKA 3BQ9A 4XI9A 4DWJA 1WB9A 2ZSHA 3DGFC 4M98A 3IAEA 4JBGA 5TS2A 5AD1A 3RAEC 1H66A 2ZI6A 1XNQB 5FOVA 3TQTA 5HE9A 1SA0B 1T5OA 2R79A 3KLOA 1KWGA 1KPGA 1K0UA 4BASA 2PR2A 1K6IA 4J29A 2ZTHA 3ZD7A 1WTCA 1AQLA 4EOGA 1U8CB 4AB1A 3IOYA 4MUMA 3CBGA 5GGYA 2W70A 1RLIA 1KEWA 4U5QA 3VZQA 4CVNA 4DCOA 1QG6A 3T9DA 4DCVA 2FU5C 5TXGA 5JFGA 3AJ8A 1JJVA 4OLHA 4YP0A 1C0KA 1WU8A 4KXVA 5HFNA 1D6NA 1E9VA 4BJ1A 1P0MA 1VRVA 2J0UB 5EJ8A 3HXKA 3TAHA 4PU0A 4BNVA 1QCDA 1VA5A 1XDDA 2DR0A 3IP8A 3IT2A 5EC8A 2XIJA 3U39A 4O2AF 1GZ3A 3JQPA 2QVCA 1BZYA 4BJ3A 3QOYA 1PV2A 4F9EA 5IUKC 3CEHA 3O2SB 2FPUA 1R18A 1ZGGA 2HTFA 2V9PA 1Y3IA 3COSA 3GJ4A 3OZTA 4FFRA 3RS4A 1G19A 1WM1A 2O0LA 1JE1A 3TSYA 2IYNA 3H83A 1XK7A 3JQBA 3LUHA 3T7JA 3NBZC 2VYVA 4QYXA 3WQSB 1XR3A 1V9CA 1PNOA 3DWGA 1S2GA 5SY9A 2UZ1A 3QQ5A 3VDQA 2FPWA 4IIJF 4Z0PA 3BE6A 4C2AA 1QHGA 1OH7A 5ILOA 1ZU5A 3A4MA 2Q3EA 5CT4A 5DHRA 1FE8A 4RWZA 1QKJA 1YO6A 2WU8A 2YXPX 3IVCA 5BNFA 3ZE7A 4ENPA 3KT3A 3TUZC 1EUCB 3FE2A 1KDZA 4ARCA 1WCV1 1BE6A 2DCMA 3ASZA 5AO9A 4DR3B 2YS7A 1VGQA 2QTWB 2PH5A 3OP4A 4TV9F 5C5IA 3K0FB 3N2KB 3NIGB 1KZ6A 2CXPA 4PO1A 1HLGA 2FN3A 5D3ZA 4U6SA 2X2OA 2MSLA 3IQFA 5DU2A 3W7AA 3GH3A 1E2MA 4PFQA 3KT6A 4F9FA 1PVOA 3RUAA 1FRZA 2PXCA 3TSZA 4N03A 3WOHA 1WCIA 2OBNA 4Q5IA 3WFJA 4XJXA 1QLHA 3UHFA 4JC5A 2IS1A 1RM5A 1XZNA 5J2UB 2J59A 1NVVR 1MVNA 1X9IA 2H7YA 4H77A 4GKAA 4IKEA 2VBGA 3PFHA 5DW0A 3EPHA 5HKKA 4BCDA 2H7VA 1G4HA 3F5FA 4E12A 3Q8LA 3VPBA 1IHOA 3WYGA 1UK8A 1RAHA 4XPIA 5AUNB 1HRKA 1LPNA 1GSOA 3ZVLA 5KWJA 4HFJA 1NJSA 4LGYA 1XZIA 2H7CA 5D2CA 3D59A 1U7WA 5A3QA 5THQA 1UPCA 2DWUA 3TM4A 3A06A 3Q5EA 4H7JA 5KKNB 3MOGA 1AS3A 4LSWA 1NQ5A 1Z0FA 3H8JA 3IP1A 5G1NA 3ANTA 1RLUA 5KC8A 2V3VA 2F00A 1CQZA 2ZJOA 2OWDA 3BSFA 4KQ6A 1BW9A 3MMNA 4N76A 2VHWA 4HYYA 4PRYA 2I8AA 1J1ZA 3VOSA 1ZH6A 2TMKA 4RH0A 1XD9A 3HN6A 2JFWA 5LDGA 1IEVA 1HDGO 4IGKA 4AK9A 3ROKA 3KDSE 2QP4A 3L4SO 5CB4F 2FWRA 2QAGA 4PE5B 3V7WA 4DV5B 3F9RA 2B25A 1Z7EA 2Y2VA 2FQYA 1FDIA 4NBTA 5K03A 1YB7A 1OLUA 4MDYA 1H2YA 1VCIA 4LX8A 1DX6A 4YJ2B 2W0SA 1D5WA 3GFBA 2QRVA 2OFFA 3TRIA 1Y1QA 2V4UA 4J2HA 5EIBD 5EWLB 1JI0A 2FP3A 1ZUWA 2EV9A 5LZ7A 4DOMA 3ZLJA 2P62A 2R9VA 5F51A 1I1QB 1NF9A 4TVBA 1L9KA 3WL6A 3QOFA 2ZJYA 3ADDA 4JX9A 2W6MA 3GQBB 3HJCA 4XRGA 1XC7A 3V1MA 1LPAB 4KK3A 3JYHA 4YT2A 1OAOA 1G2PA 4QRHA 2PUBA 3UCXA 1QIEA 2EJWA 2B98A 2PKQO 4UUBA 5B30A 1S9HA 5BY2A 2LP4Y 2KBFA 4MV6A 1U0BB 2D62A 3VKFA 2KX7A 3E3AA 2J4FA 2OY0A 3VJMA 1A2KC 1U4NA 3AUFA 4KI0A 3EXHA 3UV7A 4DLPA 2JNWA 5HNKA 4REQA 3ICWA 4CLXA 3KWLA 3KJQA 4YO7A 3GDFA 1CDZA 4MP3A 2C97A 2FFQA 3ND8A 4KUGA 4D0SA 4WXMA 4EATA 2X86A 4OAPA 1XLTA 1NYRA 3KBBA 4W1QA 5EE1A 1UKYA 4ALMA 2IYPA 3A9RA 4ETIA 4JB3A 2W7TA 5CLHA 1E4YA 3JTMA 2EFCB 1Z4JA 2FPOA 2WQ7A 4HVAA 3OQ1A 4ALKA 2BEWB 3KJFA 2X4DA 2XUHA 4JJ4A 4DA4A 2ZJBA 1UPAA 4FEYA 4MB6A 3VAAA 2HUPA 2YVQA 3PFNA 4NAVA 3GUZA 4YROA 2GEBA 3FLEA 5CAEA 2JC3A 5ELLA 3RH0A 4J3FA 3QXSA 3CSDA 2VK2A 2A57A 1XHFA 1J24A 1DC8A 2EP7A 2Q5FA 3QXXA 2R8RA 2R8YA 1HO3A 4HY3A 3EGWA 4MTCA 2RONA 1DKQA 1DQNA 2FPGB 2I4IA 2W8BA 1BROA 1EGQA 2CMFA 4BP1A 1MJGA 2KWIA 2P11A 3LUCA 5BN3B 1R4NA 1U1GA 2CNNA 1WPXA 3H5WA 3JS5A 4JC8A 5BWLA 4XQEA 3P27A 1VSTA 3VTAA 2KQUA 4JLUA 4UM8B 5BSWA 3F3KA 3I64A 3CWZA 5I9TA 2BYTA 4JD5A 5DTEA 4XVRA 5FPQA 5JQWA 2Z3VA 3GEHA 4V02A 3HCWA 2W6PA 3K0SA 2YZ2A 3OPQA 2GESA 1ZOLA 5BVHB 2I2CA 3FNRA 7YASA 4LJRA 1WZ2A 4GGMX 1SKYB 3PX3A 1A4IA 4HAXA 1JG3A 4WN9A 3IBYA 3KSUA 3PWKA 3IODA 3R09A 3LKBA 3TCKA 1QF7A 1D5CA 2KPOA 3A4LA 4W1RA 1PR2A 4PEVA 2HLHA 5AXDA 3UN1A 2QM7A 1S2NA 2I2XB 4JL8A 2IBSA 3F5MA 4W6QA 3MWEB 2HJGA 3P45A 4RIGA 2WUGA 3SYNA 3AR3A 4W82A 5ICCA 4Y6QA 4DXAA 2GZ1A 4FMCB 4DW8A 1PQYA 4A5OA 4AICA 2AOTA 2SCUB 2ZRBA 1W76A 1XQWA 3AY6A 1KIFA 3ZE6A 221PA 4XPZA 4R40A 2IHJA 1NNLA 2IUEA 2Y0PA 2A7QA 4FOPA 5CURA 2GO1A 2NZUG 4G41A 2GLUA 1KJJA 5DRYA 4FONA 2ORVA 1XAGA 1YR8A 4PAWA 1K7SN 2QRKA 4YT5A 2EQBA 1M34B 4UUOA 5E9AA 3B12A 1BFDA 3CUSA 3E61A 1FUEA 2D5LA 3DEHA 2H51A 3B1KA 3HVIA 3P9KA 1R0YA 4N3CA 3B1XA 4QLAA 4XRRA 3WGTA 3ZV6A 1JVBA 3PDWA 3HI6A 2YOHA 1PD0A 4F1KA 2A5LA 4POOA 2QBYB 4BX9A 1U4SA 1E3TA 1SWVA 1YJBA 4PYIA 4ZOCA 4CQLB 2C99A 2I6XA 1C3OA 1OLXB 3AIOA 3KX2A 4Y2VA 3F3YA 1BXGA 2REQB 3KKKA 4BNJA 2C54A 4M83A 2ZUCA 2HMAA 3TR6A 4G23A 2L69A 3OZDA 4I5DA 5TSDA 4BLOA 1C14A 2PGLA 3CTPA 3B3FA 1I6WA 2XUPA 3KUKA 3CG4A 4XWYA 4BBJA 4KYTA 2XHZA 4IUDS 3F6PA 5FOSA 5HF9A 4CIBA 1Z4LA 1TMOA 1JDNA 1B3RA 1SGWA 4HNTA 5AVTA 3S2ZA 1J8VA 3BX1A 3OCCA 4JQSA 2A86A 5J40A 3TE6A 3TZKA 4JJ8A 1B6GA 5A5GA 2P4EA 2YWHA 1JEYB 2W6QA 2ZM5A 1ZOIA 4UM7A 3HYTA 2P6PA 1MKYA 1TE2A 4K9LA 5ALKA 1MZPA 1TU3A 3RT9A 4YYEA 4RA6B 4KQ9A 1NSYA 1F0KA 4UOQA 1XXLA 2H0QA 4EBBA 2FUEA 3IP7A 2A1UA 2VIIA 2R1VB 5JCOA 1BDMA 2FY8A 3D0RA 4HAZA 4CF7A 4MS4A 2WHPB 4OK3A 3JZDA 2CZCA 3IUSA 4GKVA 3T4UA 1TXGA 5JMTA 3BFVA 3NBKA 1IN4A 4G5HA 4KIJA 3AINA 3GGPA 3R7WB 1NTRA 4NK4A 1XDWA 3SIWA 1A9TA 3CCBA 3HYSA 2EFYA 4KR2A 4BNHA 1R64A 3PXBA 1J5EB 1WS6A 2F3PA 2XQJA 1B6SA 3T1TA 3CN9A 3ZGOA 1JHMA 1MA3A 1KY2A 4KQWA 3JYNA 2DEUA 4HEA1 2MYNA 3DOEA 4TLBA 4D79A 1KY5A 2FWJA 1UM8A 3NC0C 2AOWA 1QF6A 4C4PA 2CL7X 1ZEMA 5FA8A 4GR4A 1C7FA 2JA1A 1C1DB 2Q9UA 4UUAA 4PLPA 3IYLW 4O8CA 1KERA 1C81A 1U3DA 3UPTA 2CL5A 4DIBA 6Q21A 1GSIA 4F6LA 5AYVA 4LK2A 4EKNB 3AI3A 4U0KA 3HK2A 2JA2A 2R2AA 3DUFA 4B8ZA 2YFKA 3NIWA 1L7OA 2UXBB 1TRHA 4EMUA 2YJGA 4P7JA 1VYVA 2WKWA 3VHRA 4G1BA 5ICGA 5FNZA 3X1DA 1HYEA 3PXAA 4WKNA 4P82A 2W22A 1P74A 1BKDR 3FPLA 1DI0A 2AG8A 2O3JA 4H7FA 4NQZA 4P3NA 5TS3A 3UPUA 4ZANA 4BMSA 1MX9A 4IY1A 4PYRA 5JLAA 3ZCRA 5DBHX 3EB9A 5TMDA 2GYYA 2GBLC 3E27A 3FDJA 4LNHA 4DIFA 3WR5A 3QF4B 3EC2A 5CDYA 1X7YA 1DZIA 3R9IA 3IUYA 3BE8A 1T0BA 3DUFB 1WBBA 4MYTA 3O1HB 2PVSA 3OCVA 4UZFA 2YDXA 4I14A 4O4HB 2PK3A 1T6ZA 3GJRA 3T34A 1G20B 1BH6A 4N82A 2XWJI 4A6XA 1DIRA 4EHIA 1KQGA 2H1RA 1NOIA 2A7XA 2L2QA 4R05A 3PCTA 4UJ3A 5CIYA 4BUZA 1Z5ZA 1UJNA 1VIAA 3FYUA 4WVFA 4J7CA 1BHQ1 1HUQA 4URUR 2Z3ZA 4EUNA 1MFZA 4PVDA 3TL2A 2I3ZA 1YA6A 1KZ1A 2QTAA 4B79A 5K8LA 3OAAD 3TCNA 1JSLA 3N8IA 1W49A 1GVHA 1CR2A 2XMDA 1UPTA 3AONB 4F2WA 4LF5B 1LCIA 4B6FA 1N6OA 2QN3A 3IR7A 3KB6A 4KXWA 5LDHA 5JSUA 4DLVA 2CLFB 3AI7A 5CDFA 4KFRA 4X93A 1T9KA 2ZJ0A 3A4YA 4W7IA 4TLMB 1CEXA 2RJ3A 5K0CA 1KK0A 3OZBA 4QT0A 3LWBA 1BMFD 1HLPA 2NSJA 2XRZA 3CVXA 4K26A 3IQHX 3MWKA 2H4XA 4QPNA 3LCJA 1EUDB 1H6BA 1XDSA 4K2AA 1YHNA 1MAHA 2VRWA 3J7AC 1L7RA 4Z49A 3FOWA 3I12A 1G5RA 2F3QA 3LX4A 2JEYA 4QRDA 1JQAA 1FXWA 2HRBA 5FO0A 4ASUA 4BFVA 3OM8A 1JL3A 2NTEA 4M1MA 5EIHA 4D7AA 1F0NA 4GICA 4BLVA 1FA9A 1Z5WA 3DB1A 3W4KA 4BQSA 2O19A 3G49A 2EQAA 3QMVA 3NHYA 4NATA 5CW1A 4OI2A 3LUAA 1BS2A 1GDTA 1LNSA 3M7IA 4X1IB 5EIWA 4KHPB 5B58T 1FFCA 2CYCA 1O03A 4J4BA 3PFBA 3ETHA 1T36B 2AUMA 2QE6A 1N5MA 1J22A 3ZLVA 4X20A 4R8LA 1EFPB 4KZKA 4MK4A 3CFYA 4FZ3A 1GAJA 1I3LA 1L1RA 3BG5A 5KTNA 1W36B 1UOPA 1ZCJA 4RVFA 3VPCA 1Q19A 2I22A 2JK0A 3C8UA 5AH0A 4GF5A 3C5CA 1KQ3A 2VRNA 3GFFA 3P52A 5IAGA 5LC1A 5A4MS 2HMTA 5DM2A 4JCCA 2OO7A 1YBFA 3FGNA 3AERB 1RXYA 1KSHA 1OV4A 1TVKA 3AETA 4JUFA 2QD1A 2PGJA 3TKYA 3UXHA 5A06A 3D02A 1BXGB 3MM4A 1I94B 1K86A 1NV8A 2FG6C 4RY0A 2HF7A 3ILVA 1FMFA 4IKPA 1Z6XA 3OH8A 3MJ4A 2C5SA 3R9XB 4EG1A 3S0JA 2P9BA 3WMWA 2FPLA 1KEZA 2VNIA 3CO0S 3DMHA 3HSSA 4IHJF 4XR9A 4CKCA 4RTPA 2I4LA 1ECJA 3O3CA 3ERCA 2LVBA 2IXGA 5JEDA 4X92A 1FF9A 1FLNA 2KW5A 5DNYB 4OQDA 3COJA 2JIQA 1J0AA 3CCCA 1M2VA 1K06A 3L02A 4YRIA 4LV6A 3GDWA 3OJLA 4Q37A 1QC5B 1W0KD 3ZH2A 5KHOC 1ZRSA 3ZU4A 1X77A 3C4VA 4FWIB 5JXGA 3WGNA 1XQVA 3ON5A 1PD1A 1UBEA 2GD6A 1G8SA 3HCEA 3RBVA 3IMEA 1K3FA 2BTQB 2C9ZA 3K1AB 4JYPA 4HSGA 4RF4A 3U7RA 5FFMA 3CWCA 1M54A 3U2QA 2G5TA 1ZIXA 3FIUA 3S81A 1EVYA 3DDNA 3NEJA 4HR7A 2B2CA 2W2OA 3QGMA 3REQB 4GM4A 1USUA 3KOOA 3VI4B 3B2NA 3NG1A 1EYZA 1YZHA 4E08A 4HMPA 1K8XB 1FFXB 3STYA 3TE7A 3MTQA 1HT3A 3GZNA 1TT5A 2EERA 4FNOA 2C57A 5AI0A 2O8CA 3MUNA 3NWPA 4LXGA 4DMFA 1TIKA 4MUFA 3JRWA 3RSCA 4HK4A 4LJYA 3EXIB 4GOMD 4BFYA 5ERXA 4MJ3A 1S3GA 2Q6TA 2XB9A 2TS1A 5FPPA 3U3ZA 2B4KA 4BNZA 1OT3A 3D4LA 4X3PA 1ATIA 3CZRA 3NHFA 2EWMA 4EHLA 1UKEA 3MWLA 1JS1X 1C3XA 1KP2A 4X44A 2H5IA 4YASA 3ZN2A 4ZTZB 2XGGA 3UMJA 4RELA 3FFAA 2I3AA 2PQMA 3H5LA 3GEBA 4V0QA 4O4IA 4Q3KA 2B30A 3ZDEA 3HCFA 4PYNA 1AQJA 4OB7A 2BTEA 5EHGA 4ON9A 3V8PA 4K6CA 4AUNA 4H35A 1QIJA 1RLMA 3W3AA 3TN7A 3RFUA 1ZCBA 2C1EA 4IS2A 2Q1SA 1YFJA 4RFSA 2Q6IA 4D99A 3C0KA 1E0AA 2NO1A 2W8BB 2WAAA 2J85A 3ASVA 3C3MA 5DYNA 1KVRA 1Y5MA 4ERXA 5TQ0A 4JUBA 4RQUA 3Q6MA 3LCMA 2BI8A 4HPWA 4JIMA 4R83A 3VPFA 1UXHA 1UM9B 4E2XA 4X64B 1JMKC 1XWIA 4N6GA 1OW3B 1D2EA 1PV1A 4GZ3A 5JO9A 1OWOA 5HQ3B 2O05A 2I78A 3KPVA 3OAAA 2BM0A 4GPIB 3UWDA 1R8XA 1SVNA 1NVDA 3OTWA 2GCOB 3EGXA 1FYDA 1Q7GA 1OKKD 1QF9A 3F4LA 3PQCA 2YBEA 4V1CA 3QKWA 1N1DA 3UJPA 4MWBA 3EGOA 2AA3A 1LBIA 1XRRA 5IP5A 3QWAA 4NP6A 3BF8A 4D9NA 3SQXA 2QL7A 1RKQA 2PLRA 2XQFA 4UNRA 1M10A 4MRSA 4MIYA 1U9IC 3TIVA 4HRVA 4LVNA 2WMOB 1NBMD 4O8ZA 2DLCX 4DG5A 3RYHA 2E82A 1OIXA 1UODA 1H1DA 3PC8C 2DHQA 8OHMA 5FL3A 1YS1X 5H9WA 3DZHA 4W4TA 2P7HA 1GCUA 3GVPA 1ZJ6A 4GVXA 4C7OB 3RRZA 5IJ0A 4US0R 2JG3A 2MINA 4M1ZA 2EBWA 4WGFA 1P2BA 4H0FA 4J0JA 2X3UA 4Q48A 1TUBA 1HK7A 2XMBA 2X7HA 2OXTA 2IFTA 1KMNA 5D5PA 4JELA 1SVLA 3F6RA 4BO4A 5JRDS 2HI0A 4G0XA 1OHHD 1FNCA 1Y8RB 1UL1X 3D64A 3GT3A 3L1JA 5IJXA 3SR3A 5IZCC 5KQGA 2GFHA 4WL0A 3U4HA 4YLYA 4DNFA 3U3RA 5KQPA 5FI3A 5EJ6A 4WZ6A 3LFTA 4WY2A 1UBHS 3O21A 2XX3A 3G82C 1XG5A 2OLJA 3GA5A 3HJGA 4WK2B 3B2EA 1EK2A 2F48A 4J8PA 5HBRA 2CVFA 3DMGA 2VDRB 4M87A 2ZXEA 2GZ3A 3V97A 3IELA 3DXXA 3QLUC 3QTTA 3EF0A 5A9SA 2G76A 3FI0A 1ZX1A 2X5KO 1Y9DA 1OBCA 3NYIA 3QFFA 3M3DA 2WFLB 4L27A 3TFQA 1J56A 2HGZA 1U0EA 2G4VA 2Z8YM 5HOQA 3ONDA 4M8LA 3TZHA 2OG2A 1I13A 1SCBA 4D4JA 4EMBA 3VNUA 3RUPA 1SBNE 5CGZA 3IERA 4N0DA 3FWZA 2OCGA 3K0BA 4DAEA 1UPBA 1H2HA 3ADKA 3CMMA 3MRVA 2QTVB 3BXHA 3RWOA 1PDVA 4Q1FA 4UKDA 1ESCA 4D4GA 1P1HA 1UANA 2X8JB 2GBCA 2ZE8A 3F71A 4QBFA 4X71A 4DA6A 2CFSA 2VZ0A 5K7SA 5ELXA 3OHSX 1YAJA 4L8VA 2JBAA 1B74A 4OHUA 2ANCA 3ZK8A 4DDHA 2FSVA 4U2GA 4UUQA 1R50A 3OQBA 4MAFA 5JSYA 1RYFA 5C8YF 5K4GA 3VAZA 2QSYA 3EXG2 3L46A