2UZIR

Crystal structure of hras(g12v) - anti-ras fv complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-RAS FV HEAVY CHAIN
publication title Tumour Prevention by a Single Antibody Domain Targeting the Interaction of Signal Transduction Proteins with Ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2uziR00
4IDQA 1UFQA 2QM7A 1UKYA 1PVOA 2ZI9A 4ACAA 2W0SA 1ZP6A 2FFBA 3MD0A 2HV8A 5CM8B 1CP2A 2VHJA 1E79D 1GIAA 4Q4AB 1G5RA 3QE0A 3RABA 3MSXA 4IXMA 4N3NA 3HPQA 4P4UA 4NYJQ 5EXPA 3PITA 3P32A 1NY5A 4LDJA 4PC2A 3VR5A 2W6JA 4LBVA 4WW0A 2QSYA 4A6PA 3GJ4A 4GOKA 1TQ2A 3IQWA 3RLFA 2ZJAA 2C95A 2G1KA 2GAAA 1H8HD 4W7SA 2QL6A 5JWHA 3PCRB 3I4LA 1QHHA 4TMTA 3I1FA 4NBSA 4A0HA 3TVDA 5JEEA 3VNVA 5JHHB 2WMNB 1N5LA 4TSFD 1WMSA 4ILEA 4QOSA 3FWYA 2YOHA 4BUJA 2GK7A 3RAPR 1G3UA 3AGQA 1VKJA 1E2PA 4O25A 1MOZA 1EESA 3TSWA 1KNXA 1ZM7A 3I8SA 5F2EA 3W5JA 1GSIA 3B9PA 3MWYW 3MWJA 5EP3A 5A5GA 1RIFA 1MO3A 4BGDA 1CJVC 4NMMA 1H8ED 2ZRAA 4QG7A 2OXRA 3N5CA 5HKKA 1T5IA 1NNEA 1S8FA 5G3YA 2O8FB 3EZ9A 2VPPA 4JL6A 3TMKA 4O0MA 2OUKA 3UKDA 1BYUA 2A30A 2CHVA 5AJWA 5B58C 4A0RA 5JCPA 2V7QD 1GL9B 1WF3A 1ZW6A 2Q21A 4BFTA 4Q21A 1MABA 4GT1A 3BB1A 5KDOA 3U4QA 2D7CA 3NBZC 5HE9A 5E3HA 2ZETA 1WDTA 2IS2A 3AUYA 1KNQA 4F38A 3T06B 1NVVR 4DLTA 4W5JA 4Z54A 3TIFA 4CEHB 3GLHB 4U7DA 4R7ZA 1KI6A 1P2UA 4UJ5A 5EXTA 5J4VA 3OEEA 2W2XA 1ZM2A 3WP0A 4TLEA 4URZR 3NTUA 4L9SA 2J46A 1XTRA 4PC6A 3I5YA 1QVAA 3ZVRA 1S3GA 1ZAKA 1ZBDA 1LS1A 4DEYA 4OJKA 3PXGA 4WIAA 1G16A 5EXSA 2QROA 1G7RA 4GRAA 2I4IA 4C2TA 3U3OA 721PA 2A5YB 1Q3HA 5IHPA 1ONBA 2XOKA 2IK8A 1DO0A 5JJLA 2IXGA 2P6UA 1T0JB 2A5GA 1YZTA 3JVVA 4TYNA 1LNZA 1KI2A 3A58B 3RRZA 3EW9A 1FFHA 4BFYA 1EWRA 1CF4A 2O8DB 1DAMA 4V0MA 5KNCA 4PFSA 5FPYA 2ZJ5A 1ZM4A 2I3BA 1KYIA 1N5IA 3GFOA 2ZITA 5AWFC 4FMDF 2CLDX 2DWPA 4B3CA 2OBNA 4LHXA 1QVRA 2ZR7A 1CRQA 1E2DA 1QHGA 4QKQA 5BYKA 2ASEA 2IYXA 3AV0B 2IUUA 1GNPA 5J4KA 1G8FA 2GILA 1LF0A 1XEFA 4MRSA 4YMUA 2HXYA 4XTCS 4P4SA 2JDID 2W0MA 3FFAA 4DWJA 3U6KA 2BCJQ 1Z8FA 1X8LA 4BLOA 3TUZC 4GMDA 221PA 4TYQA 4B76A 1E96A 3CR7A 4N0EA 4PZZA 1RVDA 1XRJA 1VHTA 2WKPA 3BD9A 4H9GA 1FTSA 2FSGA 1XMJA 1SGWA 4JYCA 2H1LA 4QC2A 2AKYA 5FBWB 4BFXA 4DCNA 4EFLA 3JZMA 621PA 1P2VA 2QP9X 3LRPA 4R2IA 4ERNA 2Z6VA 1JALA 4JBXA 2R6CA 3SJCA 4MKGA 2FPMA 1P5ZB 1VCNA 1WQ1R 1DAIA 1OXXK 3GLIB 4OQFA 3BS4A 4RKFA 3K0SA 3A1SA 4M1YA 4Q9JA 3CNOA 1JJVA 3OEHD 1C9KA 4BLQA 2QT0A 1N25A 1XJQA 4LSGA 3FKSD 4DLXA 1OHHA 1TX4B 1ZYUA 4AKGA 2IYUA 2WJYA 2WKQA 1NLYA 2QT1A 2H92A 1XJ0A 3TUJC 1XNJA 4TLDA 4E03A 2FPLA 4Q1EA 2P65A 1W0KA 3I3SR 2CHGA 4URWR 4EPVA 5FL7A 1M8PA 4C30A 2B92A 3TUIC 5CK4A 4RKEA 2WIBA 2L0XA 2ZRNA 4B6FA 4LV5B 4MGKR 1P2TA 1L8QA 3QUSA 1CEEA 3KX2A 3CRRA 5CLLA 3BH0A 3H4MA 1VG9B 1U9IA 2RGNA 3KUDA 3ZGXA 1I2MA 2P2LA 1SXJB 2ZE8A 4D0GA 1OKKD 1FX0B 1JXMA 3WRYC 2J1LA 2GKSA 2LKDA 1TU3A 2ZE6A 2IF2A 1QZXA 4M21A 4XD7A 2V6JA 2G6BA 1ZNYA 2G88A 2D3WA 1WBBA 1PLLA 2IW3A 1NVVQ 4KODA 5DSZA 2P0EA 1CR2A 2QTHA 4C0BA 3VHLB 3NBXX 2V54A 4M1SA 2J5XA 3PEYA 2FGKA 1AKYA 2KB0A 4IDNA 1TNDA 4Q4JA 4YONB 2DY1A 3X2SA 2OM2A 5HCIA 1KY2A 4IOKA 3IHWA 5AK0A 2FV8A 2ORVA 3AKEA 5C2JB 4GP6A 4D0LB 3O8CA 5AUNB 4DSOA 1VCOA 2J59A 4ABYA 2JAQA 1TAGA 2VSOA 3BOSA 4B48A 3U3RA 4Z8XA 3AVYA 2W58A 2QTVB 4URYR 2Q0HA 4HLCA 3SZRA 5JI2E 4KYUA 2ANCA 1IONA 1XMSA 3RHFA 4EQ6A 5DI3B 2JATA 3BRWD 2QU8A 1RW4A 3CBQA 2RGBA 1YZNA 4HAYA 2Q3FA 5FUXA 2O5VA 2IHYA 5LPNA 1W2HA 1NVUQ 2VA8A 4UNQA 2ZSFA 4TYPA 4I1UA 3TLXA 3NBYC 4RD0A 1OH7A 2CLCX 4XSHA 1M2OB 2GZDA 3QG1A 3NG1A 4QJ3A 1E0AA 2GNOA 4RZ2A 1KMHA 4GL2A 1OXTA 3OHMA 1YE8A 2IYTA 1FP7A 2YYZA 1HY3A 4KSCA 2QE7A 4YXWA 2GHIA 4P4TA 1ZJ6A 2FG5A 1MO4A 4M9QA 1CU1A 1TF7A 1RRGA 2RHMA 4DHEA 3AF4A 1RRCA 5E95A 2OAQ1 2F1RA 2OCBA 2ZE7A 1VCIA 4LUCA 4LZZA 5H68A 2DFKB 2PMDA 5H1YA 4M2LA 1XP8A 1I4LD 2ZANA 3PIRA 5DYGA 3IO3A 1OYWA 5K8TA 4TLCA 1KJZA 3OAAA 3VR4A 4EJSC 3SU8A 3EPJA 3TR0A 1RC8A 1E79A 5FPHA 1JEDA 4ASUD 5JJKA 4NTZA 3P4XA 3PEVA 3LQRA 3TAUA 1G4AE 3NH9A 1GL6A 4LHWA 2R2AA 4PQYA 4XVUA 3QQ5A 1VIAA 4HAXA 3ICEA 1A7JA 1KOFA 2JCSA 4GBMA 3NDBB 3FHOA 3SR0A 2R65A 1OB5A 4BASA 1DAKA 1TEVA 3HJNA 2ZQ5A 2FGJA 3DZDA 2FMXA 5DHFA 3RWOA 3LV8A 3GLHE 4AC9A 4HYYA 2O8BB 2CVHA 4KLNA 3FMPB 1XTJA 4HDOB 3BB3A 1US8B 3ND8A 3ETLA 4JT4A 2FZ4A 4B3FX 4CVNA 5TMPA 5J4LA 2XJ4A 3BFKA 4AG5A 2RAPA 1QHHB 3BWDD 1UJ2A 2AR7A 5L3RA 1W0JD 1COWA 1YR6A 2C2HA 2VP2A 4TMVA 2FX3A 3SYNA 5HR5A 3ADCA 2REOA 3OE7D 2H16A 3E2IA 4LCBA 3I5XA 1H8EA 4R71A 1F2TA 2NO0A 2CDNA 1XD8A 2R44A 3WBJA 1BMFA 1VG0B 2AX4A 3QKRB 5CYOA 3QKTA 1N0WA 2REBA 1OF1A 4FINA 1CIPA 1GOTA 2N42A 3CKLA 4H1UA 2BIFA 2ZVPX 4BRUA 4JVNA 1XD2A 4BWYA 2Z4SA 4G5RA 1TU4A 1WP9A 3V00A 4GNKA 2WSSA 4TL9A 3UWOA 1HTWA 1J70A 3NEYA 3UMFA 2CE2X 1R0XA 1RJ9A 2XTNA 3C5HA 3QPVA 1E32A 2JGNA 3Q7PA 4IW3B 3THOA 2V9PA 2VEDA 3DOEA 4ZKEA 1E9EA 4QNMA 2DYKA 2MSEB 4LRWA 1G9XA 2PCLA 5IDVA 2DBYA 2VP5A 3EAQA 1G17A 4G5SA 1MH1A 4UNSA 3VMFA 4ZKDA 2ZROA 1ZMXA 5JCZA 1L4UA 4HLUA 5L3SA 1Z63A 5FI0B 2DR3A 2IYYA 2VBCA 1F60A 2O8CA 5JI3E 1U8AA 2OZEA 4PSVA 3T5GA 2QRNA 3VR6A 4UNNA 4DKXA 1XPUA 1HT2E 4L5BA 4QBIA 2D4HA 3W6NA 4KXFB 3AP2A 2FN4A 2WJVA 4TZ6A 4PAOA 1TF2A 1E2MA 1NMZA 4RD3A 2OG2A 1R0WA 4HDCA 1JAHA 5FPTA 3OIWA 3B6EA 2C8VA 1SHZA 4I1OA 3U44A 3PEUA 3EZFA 5IRCD 1FQKA 4FMBB 1IN6A 1IY0A 5FFMA 5FL3A 4V0LA 1AS2A 1YR9A 2F9LA 3WY9A 4XWOA 3SDZA 5P21A 1KJWA 2EVWX 3CH4B 4AG6A 5F9HA 2AN9A 3UWKA 2DB3A 1I4DD 2FZLA 3W3ZB 2J0QA 1SKYB 1G20E 5FTKA 1E9CA 2QAJA 1YHNA 1UM8A 2BDTA 5EE9A 3IHLA 1E2LA 3P4YA 5B30A 5IK2D 2X19A 5CIQA 3HPRA 3KQKA 2HF8A 4CEJB 1E9FA 2XNDD 4FWTA 4FI3C 1E9SA 2QPOA 1E2NA 4CZ2A 2OILA 4NCHA 4DDUA 4QJ5A 4TTPA 3WRXC 1RE0A 2OBMA 5CLQA 1Q1ZA 3FTQA 2WAYA 3Q7QA 5KSPA 1N6OA 1OIWA 1II9A 1E4YA 1NY6A 2EQBA 3T61A 4KCGA 2QRZA 4KBGA 1R2QA 1KSGA 1U0JA 3LWNA 3Q85A 4KJZA 2GCOB 4EPRA 4UXHA 1Q1BA 1X1SA 4IOJA 1HEIA 3IBYA 1HE1C 4Q9KA 2J87A 4Q1DA 2Q9AA 3RNLA 4BPBA 1NKTA 3T12A 2GXAA 4URXR 1SXJE 1Z08A 3EZ2A 2YNMA 3CIOA 3T1QA 2CEAA 4LK2A 3ZZ0A 3SJAA 1R0ZA 4HI0E 2FE4A 1XBTA 1KGDA 2UZ3A 1VECA 1E69A 1SZPA 2IWHA 2QAGB 2ODWA 4JLOA 3A1UA 3W8RA 1EX6A 3PG5A 3U7HB 1GWNA 3KKPA 2QORA 3CRQA 2ZU0C 2UVQA 2DFTA 4EPWA 3K70C 1W36B 1M74A 3U7FB 3SBEA 2Q6TA 4OKSA 3WMEA 4M0LA 3LQQA 2D74A 2YWFA 3WHKA 3QF7A 2BCGY 2VP6A 1X1RA 4PO1A 1P73A 5HCNA 3AP3A 5FI1B 3I62A 4CEIA 1UEIA 3AVPA 5A4JA 4O2RA 3KZ1E 1U98A 2IYLD 1IAQA 2QUZA 1ZM9A 1RPZA 3V4RA 2UZIR 1ZC4A 2VHQA 1IN5A 4JLVA 3LLMA 2ODNA 1KMQA 4KI0A 1CJMA 1Z28A 5BN5A 2JJ2D 2P3SA 3M4YA 3AVWA 1OFTA 3ZIAD 1A1VA 2IBMA 4PO9A 2BKEA 5BW8A 3B78A 2ANBA 2ZJYA 1UF9A 4CYMA 1IY2A 1JBKA 1ESNA 4PPQA 4XVRA 2VP9A 1KJYA 4RY2A 4LYAA 4B3BA 1GITA 2XB4A 1AGRA 5IT5A 1W47A 1GP2A 2PZGA 3EIHA 1XPOA 3FDIA 2GJSA 2FA9A 4QBGB 4HZIA 2YINC 4S2EA 3DHWC 5KDDA 5D3MA 4C4PA 1EFCA 3EPHA 1OV4A 3GFPA 2F9MA 1P7CA 2OO7A 2ZRPA 4HLQB 3QF4B 2FJUA 2HF9A 2IX3A 4L9WA 4GSYA 1X6VA 1KK1A 5C1BA 2NO7A 2VHTA 4MRNA 2AXNA 1Q3TA 2GJ8A 3A4LA 3E1SA 4A8JC 5LD2C 4F91B 2ZE5A 3GCGA 3AVTA 1WXQA 4DCSA 5EXXA 5AUQA 1ZRHA 1E2JA 2GJAA 4RFSA 4MYHA 3U2QA 4Q4JB 3TSOA 1AS0A 4IDPA 3FB4A 2HT1A 4Q9IA 4U02A 2MMCA 4B71A 1KO7A 4DLRA 1UKEA 3PV0A 4M9SA 2JLVA 2H57A 2IC5A 2A78A 4NYMR 4A4DA 2VSXA 3PQCA 1YKSA 5JJIA 3UMRA 2R62A 3ASZA 4IFEA 4EAQA 1XCPA 4BLRA 1U94A 2R6GA 5KO2A 2O8EA 4TTRA 4GPTA 1B0UA 2PX0A 1ELOA 1UPTA 4Q7LA 2JLRA 4D4MA 2GWHA 3MFYA 4ZV4A 1WBDA 4Z1MD 2BMDA 2CVFA 2XJ9A 4NONA 1E0SA 1EWQA 2LWIA 3CNLA 4IEIA 1KSJA 3DO6A 4C0QC 1Z06A 3CONA 2G3YA 1WRBA 1M7BA 2CCGA 2GXUA 2ZAOA 3GFTA 3L2OB 2RB4A 4C0AC 3VFDA 1BYIA 3L0OA 3WP1B 1X3SA 1DG1G 2ONKA 2WJGA 1XCGB 4PSAA 5K8LA 1M7HA 4EJSA 1KMHB 2IS6A 1JPJA 3RS3A 1GAJA 4C9BA 3QKSB 2W2TA 3A1VA 3EXAA 1F6BA 4C0LA 3SJZA 1Z47A 2PJRA 2MSDB 3BFVA 3HU2A 2QN6A 3MGCA 2GXQA 2WOJA 4HAUA 5EUQB 1AJEA 3M1IA 2ZSAA 1OPXA 5LB4A 4FD2A 4GOJA 4B74A 3SQWA 4ON9A 4N0DA 4B34A 1DAHA 1NBMA 4M8NE 4RD1A 5JMTA 4G1UC 1II8B 4NZYA 4OHXA 5DN6D 3K9NA 3SI7A 2GDJA 1KI3A 2O52A 4HSEA 1KDRA 1QRAA 2IUTA 4Q1CA 1NP6A 5K8UA 3TAHA 4LJ4A 3IDQA 3ZQJA 3SS8A 4GMXA 3A6PC 1ZUNB 2J0UA 1G8PA 2WWFA 3REGA 2EWVA 5IF9A 3B2EA 1HA3A 1KO8A 3MCAA 3B1ZA 5JLJA 1NKSA 2N46A 4QBHA 2VTKA 4FXPA 4NP6A 2WHXA 5DH9A 4OI2A 4DLVA 4HUTA 2WPDA 5E4FA 4QGAA 1E0JA 4FCTA 3KKOA 3M6AA 3ND9A 5JZVA 1E1QD 5CJPA 5DIFA 1D6JA 1OYYA 3RS5A 1SVWA 2VSFA 1GDDA 1XEWX 4EFNA 1KDOA 1XD9A 4C7OB 1G5PA 4ZDWA 2GEUA 1JEEA 1ESMA 1VCMA 1XX6A 2C77A 4Q18A 1NF3A 3KB2A 4LPKA 1VTKA 3GEHA 4KFTA 2W6ID 3LBNA 3MG9A 2V55B 3MMPA 4LBYA 2OHFA 2E1RA 1KI9A 1GNRA 2XB2A 3LAWA 2YWGA 2PMKA 4KBFA 2BBTA 4GZLA 1CBUA 4IVQA 2BVNA 4JLMA 1SKYE 3NKVA 4MKHA 4POAA 4XTRA 1J7KA 2EFEB 1Z3IX 1NMXA 2OCAA 2OLKA 1FL9A 2WWYA 1XD2B 1KDTA 1Z22A 4QM6A 1U81A 3CH5A 4EPXA 3QVVA 4HLUC 4B43A 4DSUA 4V0ME 1G3RA 2BKUA 3GJXC 3K0AB 4ZI3A 1RJ9B 3CWZA 4QGHA 4HB2A 1GILA 2WTUA 3ZLJA 4PQRA 3T35A 2FH5B 1DTSA 3QBVA 4PHGA 2ERYA 3AUXA 4MUBA 5FBRB 1Q57A 4K8OA 1U0HC 4DUGD 4XH9B 2P6RA 2Z83A 3EC1A 2ZS8A 3RRYA 1NVXQ 5M04A 4CT4B 3SC3A 1J90A 2C9OA 5L3QB 4CW7A 3CRW1 1G21E 5FBVB 4WAUA 1OLOA 2E9SA 2O8CB 4TZ0A 2C9CA 4QGFA 4NYMQ 1EFTA 3FMIA 3R7WA 3U3KA 5FR2A 3U7GA 1X8KA 3DDCA 2QA5A 3FMOB 4D81A 1CS4C 1ZD1A 1ZIPA 2QBYA 3VKHA 1ZNZA 2P5SA 5FOVA 2ZUDA 3RSOA 1SVKA 4DRZA 1XF9A 3PFIA 4EKDA 2C9YA 2IHBA 2J7PD 2YOGA 1N6KA 3BB4A 3BJIC 5FOUA 1UKZA 2O0KA 4IOLA 4Q7KA 3LH5A 3BORA 5EE3A 2YWEA 3GJ8A 3QBTA 1U8YA 1YVDA 3THWB 1HYQA 1XZQA 4B33A 2JJ1D 2VP4A 1OT3A 1FMLA 4Q1BA 3DM9B 3WYGA 1HH4A 3OIUA 4UQOA 2GRJA 2GVDC 1AGPA 2ZAMA 2XZOA 3Q5EA 5JS8A 1U99A 4UNPA 4US2R 4O2LA 4Q4HB 1V5WA 4EPYA 3FKQA 2QM8A 4OI0A 2ZJZA 3I92A 2J41A 1AM4D 1E1RD 4JL8A 4Y0AA 3ZZUA 1PUJA 3HYTA 2OESA 3DMNA 1T3SA 2OXCA 1JR3A 2WSMA 1PUIA 4FN5A 4IHQA 4D25A 1GRRA 3ZQ6A 3T1TA 1UBCA 1K5DA 1MO6A 4WXPA 2WJJA 2CLSA 3WXMA 5BWMA 4WA7A 2ONJA 4W5WA 4A0FA 1ZU5A 1Q1EA 1TF5A 2K5UA 2FWRA 2A5DA 2F3TA 2V6IA 3FVQA 3EPLA 1NN3A 5CM9C 4BEBA 5KTYA 4C0JA 4LBZA 3PUVA 2QGZA 3RS4A 3PR1A 2BEKA 1JECA 3C15C 2EYUA 4QBFA 3DMDA 2ZM5A 3WMFA 1DG3A 4KFUA 4XOIA 2CBZA 4V0KA 3Q72A 3FPAA 3VR1A 4EPTA 3K9HA 2QY9A 3KJEA 4Q03A 3KQLA 4MRPA 2JIZA 3K8YA 3R9XA 4G0NA 3QPUA 5BQ5A 3PUZA 1KTVA 3G0HA 1XEXA 2A5FA 1GZSA 3C7KA 2ZRHA 1CJKC 1Z0JA 3C14C 4BEJA 2AWNA 1SXJD 3KFXA 3J81k 3EWSA 3ECCA 521PA 3OF5A 5LBIA 3AGPA 4MDFA 3W6OA 1FNNA 1W4CA 2FPKA 2R6FA 1G64A 4RZXA 4BECA 2AL7A 1R10A 1YRAA 4TT3A 5JHGB 2ZRBA 2IL1A 4KAXA 4QFMA 2IS1A 4JBYA 5H8WA 4ZI2A 4CEIB 1GTVA 2OEPA 5GVRA 3Q5DA 3A36A 3ZIAA 3AVXA 1R7RA 4KHZA 4WOPA 1W2GA 4OK3A 1NRJB 3TW4A 1SVOA 4HAWA 2JLYA 1VMAA 4Q7MB 4CIDA 5B57C 2GF9A 1G5TA 2ZRLA 3O8BA 2BC9A 1SQ5A 5K8IA 4OI4A 4V03A 2AD1A 2ORIA 3MJHA 4RCYA 4DT1A 4AY2A 4HDQB 1CJUC 5CDFA 1YQTA 4A8JA 2XNSA 1SVSA 1T5LA 5A0FA 2YVUA 4AURA 2BBWA 2BOVA 4PAMA 3RS2A 3SYKA 4DDTA 2JLZA 3NC0C 3WNCA 4B3XA 4TLBA 5DLQC 1Q22A 5D3MB 3R8CA 3PVSA 4MRVA 2VF7A 1ZM3A 3GJ0A 1IN7A 5HPYB 2D2FA 4PHFA 4MDEA 4RVCA 1F48A 3RSLA 4LHYA 3VU9A 2JLQA 1HV8A 3HDTA 4US0R 3GLFA 1WB9A 4HZUA 1EX7A 5J40A 3KQHA 3A4NA 2QQ0A 3AKYA 1S3SA 1UDWA 3EPKA 4B35A 2WWXA 1DEKA 3MLEA 4L16A 2VHUA 3OIYA 4HAZA 1S96A 3NH6A 4C0HA 3TNFA 4RFSB 4DCUA 4E07A 2F43A 3AKDA 1XEWY 4Q1AA 2HLDA 3QI2A 4A2QA 2QG6A 3FOZA 3KJHA 2WWHA 4OQLA 2MMGA 4Q19A 3P20A 4P32A 4DCTA 3K0FA 1P6XA 2Z4RA 3QPWA 2NZ8A 3W3AA 3ZS9A 2NG1A 3I73A 2ZYTX 3HU3A 3ICQB 2EFGA 1QBKC 3OFNA 4TN1A 4Z1MA 2C5LA 1EFRA 3DPUA 4OHWA 1KIMA 5FR1A 5J4HA 1U90A 1OFIA 4ITRC 4QM7A 2VP0A 1Z6AA 4JLBA 2RGDA 5TARA 4M53A 2SHKA 3CLVA 2WJIA 1U0LA 1C1YA 1EK0A 1NL3A 1AN0A 2ZRKA 4JLPA 3R8FA 3GJ7A 3X1YA 2PH1A 1S9HA 2EFDB 1RYFA 4B47A 2CCJA 4I1SA 5J5CA 2OFWA 4BLTA 3UK6A 4JKYA 1RZ3A 3W6PA 1GL7A 4BRWA 4Q47A 5HTKA 2GF0A 4DLWA 3AM1A 2H5EA 2W6JD 3C16C 1M7GA 4RD2A 5KYKA 2IUSA 3KFVA 2ZRJA 2GEDA 4PC1A 4TL7A 2BMJA 1H8HA 1M6NA 1P9WA 1JPNA 4JKIA 4EJSB 2QSZA 4AYTA 4AI6A 5G41A 2GK6A 4LYHA 3I32A 4TSFA 2ZIAA 5LDDC 4DB4A 2J0VA 2ZJBA 2GBLC 2JASA 1NIJA 2YOFA 4HUQA 4TQAA 1W4BA 2V8OA 2QENA 3O47A 3IIJA 1FZQA 1IXSB 3QXSA 1MV5A 1JQLB 1OJLA 4NYIR 4XVQA 1VHLA 3EASA 2A2ZA 3CPJB 3KB1A 2XITA 4ARZA 4YMVA 2O8FA 1R8SA 1NI3A 1Z0KA 3AB3A 2EWWA 5DE3A 3N2IA 4I4LA 4DSNA 4ZCIA 3U3MA 4V0OA 2XSZD 1ZU4A 1DBSA 2AKAB 5HKKD 2X2FA 3QG5A 5DHAA 1B23P 4NKRA 1WE2A 3IO5A 4MKIA 2BJVA 1XTKA 2A7QA 2RGAA 2ATVA 2KWIA 1KSHA 3IPXA 3LFUA 4II7A 2V7QA 4A1FA 1G4UR 5FPSA 4Q5IA 4O3MA 5SZKB 1XFAA 4Y0VA 3QIAA 2VYFA 5EE1A 2QNRA 3NVAA 3DKVA 3WYAA 3BGWA 1LV7A 1DAGA 3AF1A 4RD6A 3W9YA 4D4KA 3ADBA 3THYA 3NEJA 1KI7A 1LVGA 3QNUA 3HU1A 3M0EA 1T0HB 4FMCB 3RANA 4OHYA 1MABB 3VTKA 4D6PA 3AF0A 2QI9C 3U4QB 2CXXA 1T91A 4HB0A 4LC0A 2H8KA 3VNUA 2ATXA 4MGIR 3OEED 5FOWA 5AJVB 2ZRCA 4Q1FA 4KITB 4E22A 4PO8A 1QDEA 4TL8A 3UMSA 4C2UA 4ZIRA 2F55A 1Z83A 4F7WA 2I1QA 5E7JA 3C8UA 1KI6B 3LVQE 2OT3B 3CR8A 4MGZR 3LLUA 2DPXA 3EIQA 2YHSA 1N2CE 4R98A 4OQNA 4KVAA 3LY5A 1E9DA 1W1WA 3BC1A 3IUYA 4MITA 2ZSEA 5ANRB 3TW8B 1JAIA 4P0TA 5TDHA 5DO9A 4DIEA 2D06A 4EIWA 4AIIA 1F5NA 1TQ6A 2PX3A 2IXFA 3KKNA 1KK2A 4L8GA 4NCNA 1TMKA 4NCIA 5EZ5A 3TRFA 5EJEA 1XJCA 2O8DA 2XOKD 5J4YA 3I61A 3EIEA 3NIBA 1UADA 4HLDA 4TL6A 3OESA 1Z6XA 4JT2A 2VO1A 4UXIA 2QPTA 1EXMA 3LX5A 3DM5A 3KTAA 3CZPA 3ZJYA 1P60A 1JB1A 5AR1A 5UKDA 2B8WA 4M1TA 4PPGA 5HZKA 3IEVA 3CX7A 1A82A 2AWOA 2KE5A 2ZSDA 3LBIA 4OBEA 4B3DA 4BE7B 5G53C 2FDCA 1KKMA 2C78A 1YZUA 3GJ3A 1Z5ZA 3AVOA 1FUKA 3O8RA 1GG2A 3A8TA 3EZ7A 3KXKA 4KU4A 4S35A 5CYPA 2B21A 4FMCF 2QP4A 4F4CA 3R7WB 3K0CC 3OIVA 4WZBE 2JDIA 1G291 5FOSA 5AUOB 1VIYA 2Z5FA 1GKYA 3FHTA 4DIDA 1NIPA 1TUEA 2B6HA 2ZU6A 4JVLA 1QHNA 1DS6A 4BZXA 8OHMA 4LY6A 1KHTA 4MGYR 3AH8A 3VX4A 4P4SB 2ZS7A 3ONWA 1IBRA 2FSIA 4CT5A 2E87A 1IHUA 4LHVA 1E1RA 4PR0A 4QNRA 2BBOA 4ZDIA 1F2UA 2CE7A 1W36D 2V3CC 2WVJA 4D4LA 4OK6A 3TE6A 1BO6A 2QAGC 4P31A 2GCNA 1XZPA 3LXRA 2QZ4A 1TQDA 2ZTSA 3OEHA 3U3JA 3FE2A 1QF9A 2ZREA 4YMSA 2NTYC 1IXRC 3FKSA 1NMYA 3KKMA 4GP7A 3CWQA 3REFA 4BFWA 4BLSA 2RGXA 1OHHD 1TUIA 3QXJA 1S4QA 3KUCA 4B2LA 3KJGA 3CRVA 4JYBA 5GJCA 3ZH9B 3UATA 1G1MA 2FSHA 1FMJA 3N2EA 4A2PA 4Q7JB 4AK9A 3KJIA 1SKQA 3CNNA 3L82B 4NYIQ 3K1JA 5FTNA 1RKBA 3K9GA 3DZ8A 1XB2A 3U7EB 1DELA 3GJ6A 1W7AA 4OK5A 3PUWA 1W0KD 3CZQA 1JJ7A 1K5GA 2NQ2C 4MYCA 1A2BA 4LOAA 2CHQA 2NO1A 3UIEA 3WNBA 1S9DA 1E99A 2WZQA 2HJGA 2W2VA 3ADKA 3SQXA 2PJZA 2OCYC 1Q44A 1NN5A 5J47A 1AA9A 3WMGA 3K53A 2AFHE 2IYQA 3CF6R 2H17A 3H0KA 3DVLA 1O3YA 1XXHE 5FBQB 4GDFA 4AWXA 1E2FA 2FOLA 4OI1A 4B3GA 4JLKA 4EDHA 1OKKA 3MUFA 3LW7A 2UKDA 1XU4A 2OV2A 4YDSA 2XX3A 2GXSA 4XD7D 5C4GB 2C04A 2NO6A 3VKGA 3BBPA 1TTTA 1DARA 1LW7A 1GUAA 1Y63A 3ZVNA 1ODFA 2ODBA 4LBWA 3RRMA 5JEDA 1Z0DA 2PCJA 1XXHA 2WBLC 3U61B 5F98A 2C96A 4NL4H 2Q3HA 2ZS9A 1FQJA 2GVZC 3SE0A 1PJRA 3NDPA 4XWKA 4JIMA 3IBGA 2CK3D 1G7CA 4B32A 3UPUA 2F7SA 4PXAA 1LY1A 1NLZA 3D31A 3PJRA 1P62B 3V9PA 4H1VA 5JRZA 4TTQA 3KDSE 5ELXA 2RGGA 1GKUB 3AKCA 3CRMA 1M1YE 2WIAA 5EUMA 4BFZA 2CL0X 1CRPA 1EFUA 1NN1A 1T3LA 3G5UA 1GVNB 1N6HA 4LYFA 4B44A 5DI3A 2VHCA 4LV8B 1N0VC 3T5DA 4KV9A 4MKFA 4JJZA 4D82A 1IQPA 1N6LA 3R20A 4ZCMA 4A8JB 3FFBA 4LV6A 4JZKA 2ZYUX 2OCPA 2WKRA 2ZRGA 1DAFA 1J8YF 1P2SA 2EFHB 1VDZA 4JLNA 2NIPA 5LD2B 2RH5A 4DB2A 4NH0A 2NO9A 3NXSA 3GLGE 4BQSA 2XAUA 3SFZA 4Q9LA 4IOMA 4TMWA 3UXMA 3K0EA 2A5JA 3AVUA 4EQ6B 4OJQA 5FOTA 4DJTA 4JL5A 4M22A 4FIDA 1CXZA 1MRNA 2PLFA 2DHRA 3KXLA 3VU9B 3S1AA 3BXZA 1R8QA 2O0HA 5FPKA 1ANKA 2LKCA 3GLGA 3ZZTA 5SZJA 2GJKA 3NBFA 1GM5A 1J8MF 3KL4A 4YC7A 3TGPA 4BLPA 4XIGS 3TKLA 4YXWD 3C41J 2QE7D 4BFSA 2F43B 2PEYA 5GJBA 5JECA 2ZJ8A 2AFIE 4YQFA 1NBME 1IY1A 3CB4A 1KI4A 2G0TA 2GESA 3TR5A 2ZXUA 2QMOA 1T9HA 1W5TA 3K0FB 3OZXA 5KDLA 5BN3A 1XTIA 1YZKA 3DKPA 2ZRMA 3GP8A 1Q21A 4HEJA 5B2ZA 3LVRE 2XZPA 5FH9A 3ASYA 3OAAD 3Q9LA 1W4RA 2F1JA 4JSYA 3VKWA 4ZDJA 3BFXA 4US1R 2PLRA 4JJKA 4ASUA 1G19A 1F3OA 2C99A 2JA1A 3EA0A 2JLSA 2OE2A 3P26A 1LTQA 1KI8A 4NPHA 5GJWC 3UG6A 3RC3A 2GTPA 3ZD7A 2DFNA 2O8BA 1SHKA 2CNWD 3B1WA 1US8A 2GBLA 1N5KA 1T8UA 4GI7A 2D62A 2QPAA 3KKQA 5CJ2A 2OAP1 2Z0MA 4YMTA 1E9RA 1P75A 1LS6A 3IPYA 2D2EA 2HXSA 2A9KA 2ZYVX 4ZO4A 2BJWA 4RSGA 4YLGA 4BZPA 2WV9A 1Z0IA 5CB8A 3RVBA 3QSYA 3H86A 4IVPA 2J9RA 4MQBA 1IJEA 1X8JA 4PTLA 2ZSBA 3QKRA 1NVWQ 4LYJA 1W0JA 1G6OA 5GVSA 1Z29A 5JSZA 2Q9BA 2JLXA 4Z8YA 1COWD 1R5NA 1G3MA 3KXIA 1GFIA 2HCJB 2AHOA 4HUQB 3OE7A 4U00A 1OH8A 2BM1A 3W90A 2XSZA 3EWAA 4PSKA 1UBGA 1BMFD 4ARZB 4IJMA 4QHSA 4KYIB 2OFXA 2N1BA 2Y8EA 3LA6A 2R9VA 2YC4C 4A82A 3CUEF 1OB2A 2R6DA 1OW3B 1UAAA 1F2TB 1KDPA 1JXOA 2DWQA 2W00A 3F8TA 1O87A 4KVGA 5FTMA 3SBDA 4DBLC 4WXRA 2WSSD 1G3IA 2JLWA 1AZTA 4FMDB 1I2DA 1OXUA 1DE0A 2HCBA 3B13B 3FGNA 1OXSC 4PQFA 1N6IA 3B7GA 3BE4A 4QGGA 1W44A 5KUTA 4D4JA 2G1JA 3GJ5A 4RFVA 4QHTA 2DFLA 3A4MA 3BIFA 4RJLA 3ZDQA 3EX7C 2F1IA 5BN4A 4UKDA 1OFUX 3QXHA 3THYB 1ZD9A 1N6RA 5EZ6B 2QEQA 4A2WA 1T8TA 4IFBA 3E70C 4DDVA 1E9AA 3AP1A 2G9NA 3GQBA 4F4JA 4IDHA 3ADDA 3W8NA 1DAEA 2WWGA 3TQCA 3NHBA 4QJ4A 4M9XA 1R0YA 4DZZA 4WZAE 4TMZA 3B1YA 5L3SB 5EP4A 1SVIA 2BEJA 4ZIRB 4V02A 1YU9A 2IYRA 3NC1C 2PT7A 3HYRA 1G3QA 2RKOA 1E6CA 3SHFA 1A4RA 4LJ8A 2KSQA 1CR0A 1XTQA 3DEFA 2QMHA 4M1KA 1XWIA 2A3RA 3B1XA 2ZUCA 3PUYA 1J99A 3U44B 2IEYA 1N3BA 4G5GA 4CEJA 1E2EA 3BERA 5AJYA 1UDXA 3SHWA 1JR3E 3K0CA 2FU5C 1P3JA 3X1XA 2YV5A 3TVTA 5IK2A 3QJYA 3T1VA 3WBKA 1QG2A 3KTAB 1L4YA 2CMKA 3G82C 1U8ZA 2XNDA 3B1VA 4LWZA 3AF2A 3SEAA 2BHRA 3IIKA 3MAAC 2XTZA 5B64A 4RZUA 5EE5B 2YKGA 2GCOA 1RRPA 4PPNA 2ZR9A 2GAOA 4PZLA 1UEJA 4NDZA 4HB4A 1UBFA 2IWRA 5KOYA 4LJ5A 1Y3AA 4LC1A 3BAFA 1HQYE 2ODEA 2PT5A 1EFHA 4FWIB 5JBQA 5DI9A 1HURA 421PA 3U6BA 1A2KC 1IOZA 1HUQA 2QAGA 1G7TA 5KNDA 2J0SA 1CLUA 2NOAA 821PA 3L8ZA 1P9RA 4NE2A 4URUR 4JVSB 5C18A 4JBWA 2DWOA 1KO5A 3L8YA 4AKIA 1P4SA 1D9XA 2REXB 3GPLA 1Z07A 1DOAA 1KI1A 4TYYA 5DGXA 2JJ8A 1F2UB 1VG8A 4P33A 3RDPA 4CF7A 1E2QA 4I81A 4IEEA 4KFRA 1E2GA 3RC8A 4N1AA 2G77B 2QTFA 2XTMA 2OBLA 4A15A 4CDGA 2EW1A 1BH2A 1ETUA 5L8VA 1MRSA 1RFLA 4GOXA 4CGZA 2EYQA 3QOFA 2ZI7A 2VF8A 2GZHA 2Z43A 4LHZA 3RYTC 3K09C 3WYFA 1FP6A 2XEXA 4TWZA 1SXJC 4LJ6A 2X77A 4OYHA 3CPEA 2OLJA 3GMTA 1KK3A 5GADl 1U2RA 1PV4A 1YR8A 2NMVA 2ZJOA 2GJ9A 3CF0A 2JJ2A 4FCVA 3GEEA 5CDFE 1II0A 3FYHA 4PC7A 1ZUHA 2FEOA 1W46A 4G5OA 4Q48A 2J3EA 3ZYCA 4KFSA 3KQUA 1P72A 3I8XA 1RYHA 4IXNA 1UKVY 4F92B 5DISB 2GEVA 1G18A 3CM0A 1A5TA 1Q20A 3THXA 1XMIA 2P6NA 4A0GA 1S1MA 1TADA 2GZAA 3IEUA 5KSOA 3QF4A 4JVMA 1ZCBA 1GRQA 5LB2A 2ZPTX 4A36A 2ZVQX 1QHXA 4WZ6A 2YC2C 4PX9A 1DPFA 3Q8XB 2ORWA 4FCWA 4YDHB 3GLFE 3WHLA 5JFGA 4JSTA 4BFUA 3MWKA 4D26A 2F1HA 2IYWA 1D2EA 5E7MA 1Q1QA 1FNMA 2CK3A 4JS0A 5EE0A 2WWIA 2CJWA 1XXHB 2PEZA 2OFOA 3ZVLA 3EZ6A 4KLZA 1FW6A 1NSTA 2X2EA 1OH6A 3ZD6A 4GFDA 1CJTC 4RCZA 2V1XA 4M4SA 3TSZA 4RD4A 4CRWB 2B8TA 1MO5A 3ZS8A 3U60B 1NSFA 4C3ZA 3VQTA 2KI5A 2BV3A 3BH6A 3SJBA 4X8HA 2XXAA 1R5OA 2AK2A 3LX8A 1AK2A 4D0NA 3LBHA 4D2IA 4MRRA 4XJXA 2NZJA 3IQXA 3QXCA 3H2YA 2XZLA 1I4TD 2B7BA 1P61B 4A92A 1JQJC 1BOFA 1QHYA 2IYVA 2QGNA 4A9AA 3FMFA 3T1OA 2LCFA 1W49A 3D8BA 1K8RA 2J7KA 2W83A 4TMXA 3NWJA 3X1WA 2O8EB 1Z2AA 5FTJA 4YMWA 5AUPB 3EARA 2ZR0A 4PPFA 4UJ3A 1BKDR 1SVMA 2PZEA 4Q4AA 5FUVA 1JNYA 1JI0A 3IKJA 3H84A 3MRSA 3S1AB 1IXZA 1OH5A 2RCNA 2KBEA 3QKSA 1GRNA 1EG7A 2QMUA 4DLUA 121PA 4NU0A 5GJVC 3VR2A 4HAVA 4K46A 4XSGA 3GLGB 2H7VA 2BM0A 3VR3A 5DNYB 2QP3A 3AF3A 1HQCA 4OQXA 3B82A 1JR6A 1NN0A 4NCJA 1RRFA 4Q00A 1CKEA 4WVFA 1KZ7B 2EFCB 2C03A 5G3ZA 4OHVA 4PANA 1II8A 2BMFA 4HB3A 4TMKA 5KNBA 3A37A 5D3QA 4EUNA 4W9MC 4B6EA 4MYUA 2VH5R 5JWRA 5FTLA 1G6HA 1Z0FA 1KO4A 3CX6A 2P5TB 1Z6YA 3HR7A 3NHAA 3R9WA 2FFQA 1NBMD 5DN6A 2B7CA 1LFDB 2P67A 3LXXA 4LGMA 1YR7A 4R9UC 3Q3JB 3PUXA 2CNWA 4DLYA 1LF5A 4KO8A 1BIFA 1AIPA 1T3HA 1Z6GA 2PZFA 3BK7A 1OIXA 4Q01A 5SZHB 3D6TB 1C4OA 3SN6A 1AS3A 5BYJA 3L0SA 2QMEA 3B8HA 1YJ5A 3K9LA 2NPIA 4NCKA 3SOPA 3LD9A 3W5IA 5F9FA 4D80A 4DEXA 3QY0A 3TJZA 4PAQA 3N70A 4E09A 3FHCB 2WPDD 5SZIA 1NJGA 2J0UB 3W34A 5FUYA 4C0KA 4DXAA 4C7OA 1E1QA 4MYTA 4G5QA 4ZCLA 1XPRA 1ZNXA 3RWMB 1G8YA 2RGEA 5CB6A 2HYIC 1CR4A 1ZVQA 2WOOA 4CEHA 2FFHA 1Q0UA 3GLHA 4QHYA 1TL7C 2FEMA 1DO2A 4OQMA 2F6RA 1YZGA 4QL3A 4X8MA 2HJVA 4L4UA 3X1DA 5JSZB 1KAOA 2VQSA 1DVRA 2W6IA 3L0PA 2HYDA 1XCMA 3PEWA 1ZCAA 1ZINA 3A1WA 1AQYA 5CITA 1CULC 3P27A 4PHHA 3BH7A 2IYSA 4TLAA 1PLJA 4AKHA 3K0AA 1LB1B 1NLFA 1S1CA 1G8HA 1E2HA 1W48A 3V4FA 3B60A 1DADA 4JLAA 4JLDA 1KZGB 2EU8A 2WICA 3RRNA 1J2JA 1R6BX 2ERXA 4URVR 1HE8B 3F3YA 4QXAA 4DSTA 4W5HA 1ZC3A 2IT1A 3AQ4A 1R5BA 4OL0A 5CK5A 4V0NA 4JLJA 4DCVA 1YRBA 1G8GA 1GKIA 3MWLA 3CO5A 4M1MA 1MR3F 1XDBA 5L3QA 1QG4A 4DUGA 1MKYA 2ZI5A 1PLKA 2ZI6A 3GEIA 1S2MA 4IDOA 3CPHA 4LJAA 3D7MA 4X8OA 1E3MA 2HUPA 3HWSA 1XMVA 2KJQA 3TQFA 5KPJA 2I1VB 4Q02A 1N5JA 1V43A 2YWHA 5FOXA 3TBKA 3QKUA 4ESVA 4ZPXA 1XTSA 2VL7A 2YJTD 3AVQA 4EFMA 1AKEA 4PC3A 1G7SA 3VX3A 3LNCA 2RHDA 1Z6TA 4NHOA 1T4GA 1FPMA 2JLUA 4F93B 1ZIOA 2GETA 5FBLB 1Z0AA 2Q9CA 3HR8A 2ZI3A 1N0UA 1E98A 2O0JA 5F3WB 3T15A 1VYTA 4AYWA 3THWA 1KSFX 2J7PA 1VYUA 3P1JA 2CL6X 2IXEA 2IYZA 1W4AA 2OSBA 1VG1A 3GLIE 1TQ4A 1YZQA 1IM2A 5JWOA 3U5ZB 4TQ9A 2QBYB 2MSCB 4J0QA 2PBRA 3L0IB 4Q4LA 1OE0A 4Q4HA 1KKLA 2JJ1A 4DDWA 1E94E 2GCPA 5CIWA 5TY0A 2HEIA 3CX8A 4G01B 3UG7A 2RMKA 1KK0A 2WAXA 3DL0A 4G3XA 4L15A 4Z51A 5TV2A 4LJYA 1P9NA 3GLIA 4LI0A 3O8DA 5AJXA 3HP1A 1E9BA 5G40A 3SYLA 5EP1A 3LO5A 1EGAA 1QHSA 1JR3D 1D2MA 4K81B 1OSNA 1OXVA 5C4MA 2J45A 5TVKA 4MA4A 4NYJR 4M1OA 1E4VA 2RGCA 2QQEA 4GZMA 4ESHA 3PENA 1NG9A 4BZQA 3C5CA 5E7IA 1W36C 1IJFA 1AQUA 4KSBA 5HE8A 6Q21A 4B75A 3H1TA 2VIIA 3RS7A 2R6AA 4DLSA 4JMPA 1G41A 2G0NA 3K70D 3CW2A 1OIVA 2TMKA 2WMOB 4Q9HA 1X86B 1N6NA 1SULA 2G83A 2ZEJA 5BXQC 5EQTA 4UNRA 2ECKA 4PHTA 5HZHA 3D3QA 1L7VC 1BS1A 1Z2CA 4IRUB 1FTNA 3K70B 1D8TA 4QRHA 2JIZD 1WCV1 2IA5A 3B85A 1YZLA 5TB5A 3K09A 5FL7D 4M9ZA 1KO1A 3QENA 3JZAA 5TXGA 1SXJA 3SNHA 4B2IA 4MH0R 3F5FA 5EP2A 1FX0A 1E2IA 1ZNWA 2H18A 4LX0A 2R8RA 3CF2A 4AKEA 1TPZA 4HATA 3I72A 3QVUA 4XWAA 1NG1A 5KHOC 2ZUBA 1XEXB 3EG5A 5JRJA 3EA5A 4IVRA 2ZRDA 2ZYWX 2AD5A 1L2TA 2NGRA 4TT3D 4DVGA 2VLIA 3UANA 5KPDA 4UXJA 2DCUA 2YZ2A 3DOFA 2C98A 3KQNA 2V4ZA 1KY3A 3VAAA 1OFHA 4MUAA 3TH5A 3AEZA 1U9IC 2RGNC 2IF0A 2HDNB 2CCKA 2FF7A 4B73A 2WWWA 1KAGA 5JS7A 2FSFA 2X1VA 2HT6A 2BBSA 1ZD8A 4RZ3A 3JVUA 1D9ZA 1T6NA 5C46F 3ZVMA 2Q3MA 4AD8A 2IS4A 1SVLA 4IKEA 3F0TA 4R2HA 4WBSA 1FOEB 1UBEA 3L43A 1E0KA 3A1TA 1CR1A 1N6PA 4M1WA 3R9IA 1FUUA 2CL7X 2FNAA 4BFVA 4C0SA 2X8AA 4TYWA 3LDAA 1W5SA 3THXB 5KSZA 3X1ZA 1HT1E 1CTQA 3AVVA 4DT1B 2ZI4A 5KSYA 5FUWA 3GD7A 1D2NA 1M34E 4B2PA 3RS0A 1QHIA 3QXXA 1IN4A 2V1UA 1R4AA 2KBFA 1PZNA 3EC2A 1K6MA 4F4IA 3C4JA 3LW8A 4LJ9A 4DC9A 4OHZA 2CJWB 4DLZA 4I1VA 1ZUIA 4TQUS 1TEXA 1VYVA 3B9QA 4I99A 4PZYA 2D7DA 2AXPA 1GNQA 3QEJA 4FW9A 3T34A 2ZRFA 4LJ7A 3GLFB 2PL3A 4ZDKA 4A6XA 1E2KA 3TK1A 4HZUB 1VPLA 2BMEA 4X8LA 5KU1A 3E5HA 3IGFA 2VRWA 2GA8A 2HLDD 5DYIA 1H65A 4AYXA 4P3YA 1D5CA 2WM9B 3QEOA 2BWJA 3MJRA 2AK3A 1Q12A 2XXAB 2F3RA 1AZSC 4Q66C 4ACBA 2NPFA 2XGJA 5L3VA 1S0UA 3B5JA 3WNDA 3IILA 1NJFA 5H70A 5AJZA 3VHXA 2FFAA 2ZRIA 2ZJ2A 3IIMA 2IEZA 3OFND 1IN8A 1WA5A 4LPSA 3SFVA 4E5UA 4U5XA 2JEOA 1EFRD 2WJHA 1MT0A
chains in the Genus database with same CATH superfamily
1IH8A 3KVVA 1R00A 4QO7A 3E2PA 1E1MA 2ZI9A 4WV3A 3HCFA 2W0SA 4O2BF 1ZH6A 3VDRA 1ZP6A 2PFGA 4W63A 3UMBA 5IN4A 5IJZA 3IKLA 4KVZA 1QDLB 3FF1A 5CM8B 1OYOA 3GG2A 3H1PA 3N9IA 3P2EA 1YB1A 3WE7A 1GKKA 3Q7EA 4OAOA 3VTZA 1PYDA 3ZWWA 4D56A 1Q0HA 2CXRA 4IXMA 4B84A 4Z7OB 3H2BA 4Z4CA 2ZATA 2W5UA 4EWLA 2OZLA 1UOEA 3DL4A 3T1HB 2AOWA 2WEKA 5AJUA 3H05A 5CAEA 4GOKA 2WHPB 1AGNA 3N7UA 4W5TA 5EQJB 1VIDA 2GAAA 1ECCA 1H8HD 4M8KA 1QX3A 2W43A 3AC0A 4W7SA 4WEOA 5JWHA 3TNJA 3I4LA 1XG5A 3GA0A 3GC6A 4NBSA 3OWOA 3MW8A 3TVDA 2WNIA 4A0HA 4CM9D 3VNVA 4AP6A 3OI7A 3R9KA 3RKUA 1WMSA 4DV5B 2CLLB 3FWYA 4UHJA 2PZ8A 3ED1A 4OG2A 4D96A 3KCNA 3K2BA 3RAPR 1V7QA 1EESA 5EHXA 4RTRA 5D5PA 4CF6A 3A2NA 3WFZA 5F2EA 3W5JA 1DKPA 4MJLA 3MWYW 2Z5GA 5AKEA 5C5DA 5EP3A 5A5GA 4CM8B 4Y9RA 4ICIA 3R0JA 4NMMA 2A1UA 2GS9A 4WCVA 1Z4LA 3GOHA 3H5VA 1DRWA 1WX1A 2I4TA 4MVJD 1T5IA 2YUTA 3L4BC 2IDZA 3U56A 2JHCA 2H65A 1PS0A 4H3SA 3TMKA 4FHZA 3MINA 2OUKA 1NOJA 3UKDA 4A91A 4BQPA 2A30A 3ZY2A 2XTJA 4XI9A 5CMLA 1YRLA 4YQZA 1GL9B 2VJDA 4TUYB 1GGHA 2Y0EA 3OO0A 4RVDA 4X92A 1YBHA 1ZGHA 3A9WA 4Q21A 4BFTA 9ATCA 5J3JA 2PUEA 2J5KA 1FYEA 3IB3A 1NI5A 1E5LA 4PRZA 3ST7A 3U4QA 1TYCA 3R5JA 3NBZC 1SU6A 5HE9A 2WABA 4RWZA 2IY8A 1WDTA 2I6UA 1R0KA 3DVQX 3F7MA 4DRXB 3T06B 1MPXA 2IV3A 3KLMX 2EKQA 2SCUA 2VDQB 4RLHA 2QTBA 2QR5A 3I9V1 3M5PA 1C29B 5EXTA 1L5MA 4B83A 2HMTA 3GJZA 3OEEA 2NTJA 1SO8A 5BSTA 5TGZA 1KZHA 3TW8A 4BP9A 3RBZA 2AF4C 3ZW9A 3DXYA 3G49A 3NTUA 1CF9A 4L9SA 4A8TA 3K73O 3I5YA 1BKSB 1DTWB 5TPZA 5AIBA 5B1EA 1S3GA 2CZCA 3ESCA 3HMKA 4RHEA 4BJ5A 4YP0A 2K2WA 2VDRB 3HUEA 3ZE8A 1QFYA 5AOVA 3GP3A 5EXSA 1L3BA 2G9UA 4PQGA 1J0XO 4JP2A 1BA2A 4GRAA 5KOHA 1Z5GA 3NPMA 1R27A 3II6X 2ADFA 3CY6A 2VJKA 4M36A 3TD9A 5IHPA 2XOKA 4BX0A 4EG7A 5AICA 1E60A 2IXGA 3INNA 5I8WA 3RROA 4ZTZB 5A1TA 5J1SB 3JVVA 5B58T 4TYNA 3RRZA 4R0MA 2B25A 3EW9A 1N92A 3ICVA 3M6IA 4Q9DA 5ECDA 3UGKA 3ZZMA 1RLMA 3RYIA 5LQKA 1E7QA 1EWRA 1R74A 2O8DB 1JDNA 1EMDA 1CF4A 5D6OA 4LE2A 5FPYA 3RR2A 1CZKA 3JATA 4JENA 1ZOOA 5H82A 3I4CA 4HD8A 4J7XA 4TUYF 4UPDA 3TTUA 4LOJA 3GFOA 4H0CA 5AWFC 2CLDX 3QHPA 5DWQA 1OBCA 2R87A 3AV0B 4DAOA 2JBHA 1Q0PA 3A6KA 5J4KA 2BEUB 1G8FA 2OCXA 2GILA 3RJ9A 1E62A 1TA4A 4KWCA 2FLWA 4DJ5X 3F7OA 3KVYA 3IVRA 2A14A 4KMRA 1M5RA 2IU6A 1U5BB 4V38A 4YMUA 4QOJA 2FY8A 1O97D 4GS5A 3IDOA 4L2IB 4I6GA 4P4SA 4AW9A 2JDID 2W0MA 4BKPA 4ALJA 3B3AA 5LLTA 2R11A 3AO0B 2E7ZA 4I1YA 3P9IA 2WV7A 1X8LA 3EXHA 4TYQA 3WV5A 1E96A 2JAXA 2Y27A 4B76A 5A5VA 2PWPA 1RVDA 3O1LA 2B35A 4FZ5A 1XRJA 1VHTA 2AVDA 3EQ6A 2IPMA 1WXIA 2D7JA 4H9GA 2H2GA 1X70A 3F6CA 3AKZA 1SGWA 2BHTA 2H1LA 2UVPA 2AKYA 4IDDA 5F5LA 4QDOA 5FBWB 3TZCA 2QVCA 3E8XA 1P2VA 3JASA 3AZPA 2J85A 4ZO6A 3VPFA 4Y18A 4UEWA 3LL7A 4FQ7A 4ERNA 2Z6VA 1MBZA 3UWPA 4GYYA 1L4EA 2QL5A 4JBXA 5ALLA 1F6DA 3SJCA 1BCSB 1PSWA 4BNMA 3LCUA 5HILA 1CE8A 1T25A 2AEMA 4RW0A 1WQ1R 5HQTA 4NAVA 4OQFA 3BS4A 2BR4A 3K0SA 1JW9B 3A1SA 4M1YA 1N1EA 2YNMC 3CNOA 4ZODA 4UTOA 5DM0A 3OEHD 4PLVA 1ODKA 4BV8A 1EJ0A 2QT0A 1EUDB 1XJQA 4ENWA 2APJA 4DLXA 2P9TA 2YMMA 5GAJA 1V6AA 1T3TA 4NE7A 1WU7A 4LNHA 3RH0A 3PFNA 4M6WB 1COZA 2QLFA 2XYGA 4DR4B 1NLYA 1QYVA 2FOXA 3OCCA 5DHUA 1DXYA 3KUKA 1XNJA 4I7EA 2F8SA 5DP1A 4E03A 2ABWA 1ZICA 3GA5A 2P65A 3NVMB 5BW6B 1OLUB 2CGEA 4FZJA 4FOPA 5E2AA 3TLCA 5IDXA 4BJ3A 2UZ4A 1PUXA 2XKBA 1D1QA 1TT5A 1IG3A 1UPXA 2QQFA 3E48A 2RHJA 3E9CA 4KKXB 4FSHA 2OXTA 2WIBA 3WFIA 4EKIA 2ZWPA 3EVDA 3K6RA 1VLQA 3GRVA 4MGKR 1JN0A 3S8YA 3RFUA 2H4WA 1K6IA 3B9RA 3FOEC 2E5FA 3ETCA 5CLLA 3RF6A 2CXQA 3K94A 2RGNA 3OZVA 3BKWA 3PNBA 3JCZA 3PUKA 4LJSA 3C3CA 3A7DA 3OLVA 1JXMA 5CDTA 2TECE 3BRCA 3CC8A 2EGHA 3WRYC 1YS7A 2GKSA 2Q3JA 1GUFA 2V6FA 2LKDA 1V1RA 3E9YA 1TU3A 1SUPA 4N5NA 5DW3A 1QZXA 1Q0SA 4FGKA 4TRJA 4LFAB 1L5OA 3FJOA 4R8VA 1JEYA 4U7FA 4IMPA 2Y4NA 3AUAA 4HNQA 1KJ8A 3VYSB 4CTMA 4I5DA 4FLFA 4CV3A 1O5IA 4KODA 5JFOA 3PJFA 5MGNA 3TIVA 5JG7A 2QTHA 4C0BA 3PXEA 2RJ3A 1XZEA 5L40A 3A2KA 1IBSA 2FPPA 1IN1A 1V8ZA 1A88A 2NNWB 3JQEA 1PKEA 3FCSB 3HGTA 4Z4FA 1K4MA 1UK9A 2W71A 2FGKA 1ORTA 1Z8NA 3L7JA 4KTTE 2KB0A 4IDNA 1TNDA 2CWWA 2EIXA 4C2BA 2P9QA 2OM2A 1I2ZA 1KY2A 3Q7IA 3FBGA 2XWSA 1POWA 2B4RO 2ORVA 1H2ZA 3WXBA 2HU5A 5MFPA 1QO0D 2MCFA 5AUNB 2AJCA 1VCOA 1TLTA 1VGRA 2J59A 3E61A 4LTMA 4ABYA 1KQFA 2JAQA 4B48A 3DMPA 3G2JA 4ARZA 3QU7A 1J5PA 3AVYA 1PFGA 5IAEA 4BNIA 1LVUA 3SZRA 2V45A 1HEYA 3KPJA 4HLCA 5CH3A 3GT3A 4ZHSA 3L0ZA 5JI2E 3IA2A 4GU5A 3ZY5A 2FXVA 2XCRB 1GARA 4N48A 1XMSA 1Y7TA 2O7RA 3PIDA 3EOBI 4PX2A 5AKXA 4MXDA 1BMQA 1WXGA 1CUEA 2FMIA 5F7ZA 3RBAA 5D85A 1RW4A 1Y7LA 2RGBA 3CBQA 4EF5A 1NVEA 1P19A 3K35A 5E6UA 3N3AC 3TIXB 2NZWA 2VZEA 5FWXA 1L5NA 1WUJS 1NVUQ 2VA8A 4RV4A 1JLRA 1HNWB 2ZBUA 1UBOS 1RTKA 4AKSA 1QE0A 4TYPA 4G5YA 2MYNA 2IODA 5E6RA 3NBYC 3DGFC 2BFBA 4CETA 2E21A 5ALTA 1YCGA 1U3TA 2CLCX 5A5FA 5AW5A 2QLMA 3GJTA 4NVRA 3JQAD 1E0AA 4AUNA 2PV7A 1KMHA 3PWSA 3PGA1 4KN8A 4XQCA 3HLTA 4GM1A 4HFNA 2A4MA 4KSCA 2QE7A 1RHMA 3QLEA 5L7TA 3ORSA 1CFJA 2AF3C 2C4VA 1ESCA 1MO4A 3EXEA 1CU1A 1TF7A 1IBCA 1RRGA 2C0CA 2RHMA 3WWDA 1PR5A 3AYZB 5GIPE 3K31A 5CVVA 2ZE7A 1Z6QA 3H87A 1X1CA 1V16A 2NTEA 3QPAA 1EG2A 3QHQA 4GOOD 4FXOA 1RI3A 3IO3A 5DYGA 4AN0A 1S3FA 1YCDA 2C0PA 1VL0A 5K3SA 4F1JA 4EJSC 3TR0A 2ZWOA 1V4VA 5I8ZA 5FPHA 5AW1A 4U7TB 4NTZA 5DHRA 3CLUC 3PEVA 1IBKB 5JJKA 2JBAA 1G4AE 2O1WA 5EY5B 3WLOA 1WETA 4K1XA 2ADOA 3GA7A 3EVEA 4UUPA 8ADHA 3RVMA 1A7JA 2GA9A 2JCSA 1GA6A 2R79A 4G41A 3QY9A 3SBXA 3WK6A 2PL5A 4OHFA 4O4LA 1WDWB 3BZBA 3OY7A 1EP2B 1SR8A 1QS0B 2R85A 3KYJB 4OY3A 3HKDB 3IBTA 4NBVA 1MX1A 1ZMOA 1LK7A 1ARZA 1J33A 1FSSA 1SBQA 2HGZA 2HLHA 2G5GX 2ZAIA 3AL2A 4LISA 4OHCA 4E3ZA 2ADMA 4HYYA 4KX3A 2CVHA 1B14A 3DD1A 2Q8PA 2E5LB 3G2IA 1XZNA 2FUNB 3R3WA 3L18A 1MZVA 3QRWA 4KO4S 1ENPA 1QG6A 2FZ4A 4C6RA 2QS9A 3GRYA 8AT1A 1ENOA 1BE0A 1MCZA 3OP1A 3QW4B 3JWGA 4QASA 4AICA 5AQEA 5ILGA 2XJ4A 5J4LA 5TMPA 4FE4A 3G0IA 1UWLA 1MJGM 1CNMA 1X9IA 2BELA 2HK7A 3L4BA 2AR7A 3PC4A 3P9PA 4P4NA 5AO9A 3LZCA 3D4OA 3OJCA 4AXXA 2C2HA 3NUGA 5CA1A 3ADCA 1KYWA 4A10A 4IJKA 1UZLA 4RA9B 3OE7D 4KE6A 2EX0A 4K3UA 2EP7A 4RL6A 5DCLA 4MAMA 1H8EA 2M1ZA 1HK7A 3RUAA 3I5XA 2L82A 4B7UA 2R44A 3QKRB 1J2TA 2E4VA 3OQ1A 4KQIA 1FNSA 4WERA 4UBMA 4DDMA 1CUXA 2REBA 1OF1A 3R0QA 2J48A 4FINA 2VNIA 1DBWA 4BS9A 2AA3A 1G9SA 2PSDA 3NDRA 3VZPA 5JZMA 3KHKA 1XD2A 4JJ8A 4LMRA 4BWYA 4GNKA 4RE5A 3OPYA 3QPBA 5SY6A 2G08A 1Z0SA 3UWOA 1HTWA 3JZDA 1J70A 1ZH0A 5AM0A 3WVNA 2CUNA 4AF7A 2I4NA 2XTNA 4O6VA 1JU9A 4WFKA 3QVGB 2E4AA 3BX1A 3C5HA 4IW3B 3OHSX 1DX9A 3IKMB 3STVA 2D54A 2V9PA 3V1TC 2VEDA 4P6VF 1V39A 4DZRA 4ENTA 2WQ7A 1CQJA 3RT1A 1TIKA 2WT9A 3ZXIA 1MD9A 2EL7A 1G9XA 4ZKDA 1J0DA 3B53X 1N7HA 4CKCA 3NHZA 1Q7CA 2O3RA 3UJNA 1EAYA 4E5NA 2AMFA 4HLUA 3UT6A 2WYIA 4Y6PA 1VHWA 4BE9A 1OAOC 4KNYA 3BXXA 2HPAA 1A9TA 4RVGA 2OV1A 2WUVA 5FI0B 1F60A 4TSRA 5JI3E 5KSZA 5D1HA 4DKXA 4UTRA 4BL5A 3VR6A 4UNNA 2PGJA 2PZBA 3GJRA 3NP7A 5AXBA 1XHLA 1CNEA 3VOSA 2G40A 4PYJA 4FHCA 2IHKA 2ZJFA 3LBYA 4L5BA 4P9NA 1W85B 3W6NA 4Y6QA 5KYNA 2I7CA 2NNLD 3AP2A 1EX9A 3V2IA 2WSIA 2BFFB 2VT2A 2DJ5A 3WGQA 4L5AA 2CSXA 3EEOA 1JAHA 1SELA 2LBPA 5DCWA 4I1OA 3URMA 1TMGE 2NYAA 1GTG1 4MZDA 3UPDA 4H4DA 3DCYA 1IQRA 5GP1A 4YV0A 1UOOA 3PD7A 4ZYXA 5CT4A 3DV0A 1JMYA 1YR9A 2F9LA 3BTOA 3ESDA 3C85A 4Y1RB 5P21A 3TIGA 4AS2A 3PQ4A 4BE4A 5BSEA 4I55B 3TVYA 1M0TA 5F9HA 2WD7A 3HJCA 5IZCC 3W3ZB 5L3ZA 1GUBA 1Y9AA 1SKYB 1Z9BA 4JCCA 4U7WA 2D5AA 1A4UA 1E9CA 1C41A 1YHNA 2GO7A 4NSNA 2B5WA 1PG2A 2CXNA 4U2EA 3UUGA 5IKEA 1UM8A 2BDTA 3E9EA 1IK4A 3HRIA 1GUZA 1GZUA 1I3MA 1TVKB 3IHLA 4UOEA 1P0MA 2X19A 4ZMBA 5B30A 5IK2D 3ORQA 2A1TS 3HPRA 2VH2A 2Y67A 1WD7A 3C7AA 3JAWB 4YCJA 4ZAZA 3SEFA 5TQJA 4HYQA 5F9MA 1BXGA 3GPCA 2EKLA 4ZK6A 4FWTA 1E9VA 1L7QA 4BJ1A 4QQNA 1Y4ZA 2ZT5A 3OCXA 1C5KA 1M67A 3GPDG 4U2FA 1CWUA 1SNYA 2VJCA 2N0SA 3N39C 1QGUA 4ML3A 3WNVA 4P58A 3SC2A 2XUOA 2WAYA 3BHJA 1Q7RA 3CF4A 2J5BA 1OIWA 3G6WA 1E4YA 3NW9A 2CZQA 5HGJA 1QH8A 3L07A 3T61A 2Z08A 2H1IA 4UHEA 2P9ZA 2ZYSA 3LWNA 2FQWA 4FDUA 4KJZA 3IXLA 3C3DA 2PTGA 2I4MA 3QWIA 2WINI 2FQQA 4LXUA 4Q1DA 3UFXA 4BPBA 5T4EA 5AW9A 2Q2OA 3LOPA 2GXAA 5EJ6A 3SZOA 4G5HA 1NF8A 1LJLA 4WZBA 1WW2A 2OO3A 5KYWA 4BNWA 3B89A 4MS4A 4AJKA 5ADWA 1FS4A 2YNMA 1P0FA 3H17A 1A2QA 4DPLA 3I53A 1PQPA 1QJCA 1R0ZA 3CH6A 4HI0E 3ZE7A 2CBGA 4FDAA 3IE0A 1KGDA 3AY6A 4BVAA 4IINA 3R44A 4LFBB 2BE7A 4EUFA 5K3FB 2YCLA 5KJ1A 1HDIA 2IJGX 2QAGB 3W8RA 4WWHA 3U7HB 1DJMA 2EZTA 2HSWA 2ZIUB 3KKPA 2DF8A 1T29A 5IHXA 5DNVA 3KE9A 2XDAA 3FB1A 1QIGA 4YWHA 1M74A 5BMVA 3U7FB 3SBEA 3KV3O 5BOVA 3SVZA 2Y93A 4IF6A 1I6LA 3EZGA 3ISTA 5BWCA 4BGUA 3EJ6A 1EBBA 3V2HA 4F06A 3HUFA 4PSDA 4BX9A 2CB9A 1P73A 4X3CA 5HCNA 5FI1B 3A1FA 3PFCA 4CQMD 3ND7A 3AVPA 1I2CA 1LK0A 5FADA 4CLXA 5A4FS 3VJMA 1YDMA 3UHAA 1LTHR 3U44B 1I1HA 1IAQA 4XX1A 3EWNA 3UMYA 4FGLA 2PX6A 2VHQA 4I0WB 4JLVA 3DXXA 4F5WA 4LEIA 3LLMA 3G85A 4KI0A 1Z39A 3FROA 5BN5A 4MHSA 2P3SA 2FUEA 4NQZA 3AVWA 1OFTA 2WKWA 4FYJA 4PFJA 3WRYA 1IEWA 3U09A 3LRTA 2IBMA 4PO9A 4EBFA 1BN6A 2BKEA 2V5UA 3B78A 4K8RB 5HQ3A 1HZZA 1ZIYA 1IY2A 2IIQA 1GCIA 1UT5A 3D4NA 4F2GA 4XVRA 3A06A 1DBVO 1LWOA 3OP4A 3V8VA 4RY2A 3VXKA 4LYAA 3QJGA 1OPRA 1BOOA 1QC5A 3WLTA 3I30X 3LQ4A 3EIHA 1V1MB 4GIBA 2BAGA 3BMCA 3IMGA 3ZU4A 4Q3BA 3BE6A 4ZOEA 4EUHA 4UE3S 1R9NA 2B1RA 4MVWA 5KDDA 3HWRA 1YA4A 3I76A 4C4PA 1NA5A 3LUHA 1W1UA 1OV4A 3GFPA 2VZ9A 3UFBA 5K0TA 2B2XA 5HOEA 1X80A 3I1IA 2HF9A 5F33A 3FCUB 1D2RA 4OLJA 1KK1A 1NONA 3SZ3A 1P7YA 2CJYA 1T9GS 3CG4A 5AMXA 1GY8A 1KDVA 4RJJA 3HJRA 2XYRA 1KQ3A 4MUJA 1BJTA 5BMOA 3UCEA 4RTKA 2WZCA 5LD2C 2ZE5A 1LDYA 3AVTA 3QNMA 4RK0A 3TS1A 2BF7A 4D57A 2HLNA 3O4IA 4FHFA 2B30A 4RFSA 1F7VA 2DSNA 2CKDA 2A7XA 4Q4JB 1QIKA 1AS0A 1MIOA 3PDJA 4Q9IA 3TPZA 4RQUA 4U02A 4EJMA 2DHDA 1XOIA 2MMCA 4MPDA 4B71A 4DA6A 5LQNA 1QU2A 4L6IA 4WJZA 2Q62A 4DLRA 1UKEA 2EG5A 2EP5A 1Z38A 2A78A 4DR5B 3UGQA 4NYMR 3HM2A 1P7WA 2VSXA 4GR4A 3TTTA 1PFVA 1YKSA 3O2QB 4GWLA 4TWAA 1MDBA 4QT0A 3K0KA 4EAQA 3MT8A 4BLRA 4WOKA 5FX2A 1SOAA 2O8EA 1M9NA 1ELOA 4NS4A 4OMFG 2TMDA 1UWCA 3OMWA 3JAKA 2R8YA 4RKQA 1ULHA 4N8DA 5D7NA 3FWKA 2XAAA 4DQ0A 2VSNA 3KAJA 4H1HA 3MFYA 4K6MA 1Z5VA 1R0RE 1JA1A 4MGEA 4RABA 4Z1MD 5EJ2A 2XJ9A 4Q12A 3TOCA 4ETNA 2W98A 4IEIA 3EN0A 4MLDA 1CVRA 1KSJA 4C0QC 2Y76A 5HEKA 1EGVB 3CONA 4EGCB 1HYHA 4ISBA 4RORA 1VSBA 3EBPA 3ICOA 3IUQA 4RSMA 2Q5FA 1QP0A 5DVZA 1XF1A 4GPD1 1AHPA 3SVLA 4R7TA 3TKAA 5HDBB 4WJLA 4MMZB 2ONKA 1KDZA 1CQPA 3LX6A 2X22A 2VJPA 1XCGB 4C5AA 4WKNA 3T5MA 1M7HA 2CVPA 2VAXA 4EJSA 3DWFA 2C83A 3NONA 2O3UA 2I4RA 3O6VA 3OIDA 2O59A 5FAXA 1GAJA 4D5EA 5JQGA 1M0EA 2C9MA 2HWWA 4DUPA 2XUGA 4R40A 1C1XB 4TQGA 4C0LA 2NVWA 2O20A 1IQ0A 3T3GA 5IW8A 3SIPA 1YKGA 3BFVA 2QN6A 3VH1A 1KQGA 2WOJA 1NZDA 4QUIA 4OBBA 1VB3A 1TK9A 1PYGA 1EBUA 3GEMA 1MG0A 4GSKA 4RWEA 2DWCA 4U6NA 4GOJA 3A70A 2XHZA 1YGYA 3CN7A 4QYWA 2AFIA 2ZBGA 4B34A 4K3VA 4RD1A 4TROA 1KVQA 1WLSA 2RJOA 3JWEA 4G1UC 3K9NA 4HL6A 3S7ZA 3WOVA 1DKRA 3H04A 4G36A 4HSEA 1FZTA 1SUDA 2Q5HA 1KDRA 4F11A 3X1JA 2IUTA 2X9LA 2GT1A 4RMJA 4LJ4A 5ALXA 1XTTA 3UGTA 1KC3A 3ZQJA 2ZP1A 1E89A 4L57A 3A6PC 3STWA 1ZUNB 2D0PB 3LKBA 2WWFA 5EIBC 1E7YA 2EWVA 3CEPB 3PQDA 3REGA 3S0JA 3WV4A 1HA3A 1REQB 5F21A 4CLOA 1P5FA 2ONZA 3B1ZA 3UQYS 3VVBA 2FEPA 4GXTA 3SLGA 3FGZA 3ZJ4A 2HRCA 4GPIB 2VTKA 1F51E 3QKIA 4OI2A 3O3CA 3QYFA 4GP9A 3QVXA 1GZDA 1KH1A 1SIBE 3SKXA 3M6AA 4UZSA 3ZZNA 5JZVA 5K0CA 3MRTA 5CJPA 4LZJA 5DIFA 3IE1A 1VFPA 2PXCA 4J0EA 1GDDA 1QJ4A 3G1TA 5JNUA 1IHPA 1YCHA 1XD9A 3QELB 4ZXPA 1JYFA 4G4JA 1P6QA 3HL0A 1JEEA 1VCMA 1XX6A 4K87A 4O3FA 4YGYA 1C4XA 1NF3A 2ZWIA 2UUCB 1DXHA 2Q0XA 4I4NA 2ZYDA 3LBNA 1AE1A 2V55B 5CFOA 1E1CA 4QWMA 1Q7BA 2X86A 3C7CB 4HGRA 4ZI7A 3R5FA 1CDEA 1YZHA 5I9SA 2B4KA 5IN5A 2XB2A 1HM5A 3FD8A 1CP3A 1PR4A 1H3EA 2O7NA 2BBTA 3GG9A 1GPAA 1K86A 1SKYE 3A6FA 4DWOA 4WK2B 1EZ1A 2UUAB 3ZNQA 4QFDA 3RK4A 1EWVA 4PRYA 1FL9A 3RTBA 2WWYA 1KDTA 1Z22A 1ZOSA 4C7MA 1U81A 4DM4A 3CH5A 4DXDA 4EPXA 1YFLA 1OAOA 3DOJA 5LXTB 2OY0A 3HVKA 4DSUA 1G3RA 4HHEA 4TKUB 4L4SA 1T8WA 3NV9A 1KU0A 3KKEA 1CRZA 1JLSA 1TKAA 1GILA 3ZLJA 2BYTA 4J49A 1ETHA 4HOYA 1XZLA 2O2CA 1QIMA 1UKAA 3MAJA 4M7RA 2ERYA 3TLEA 2HNBA 3AUXA 4MUBA 2YZMA 4CM4A 3KHTA 1L1FA 1U0HC 1JQAA 1QF7A 1R8XA 3RSSA 5IBPA 3M4ZA 1PK7A 4RKYA 1NVXQ 1Q1GA 5M04A 3OOJA 4ND2A 5KU7A 4GWKA 2DETA 3L04A 3SXJA 3WL8A 3CRW1 3KYCB 2QL7A 3C5VA 1G21E 3NS7A 4LVOA 5FBVB 1PVDA 4LI3X 1EK2A 5COQA 2RGUA 4AJJA 4NYMQ 2MINB 4G63A 1EFTA 3FMIA 3U3KA 4QYMA 2QA5A 4FSDA 3FCAA 2CFOA 3VKHA 4DMHA 1IAVA 2ISSD 4CR8A 2P5SA 3RSOA 4DGSA 2HMVA 3L7AA 3CYFA 2H59A 3TZHA 5FOUA 1X74A 3EG9A 4WK6A 1UKZA 2XMQA 1PJ3A 2H85A 2O0KA 2P77A 2ZT7A 4OMDA 4Q7KA 4DJEC 1DEXA 2XLBA 1G98A 4R8SA 3RU3A 1AQIA 1FBNA 3GNLA 1Z33A 3QBTA 4HEA6 5A5EA 3SOZA 2Q6IA 3WIOA 2VRNA 2IPAB 1MO2A 3B12A 3DM9B 2ORED 3LQKA 3MTJA 1WZUA 2DX7A 2GRJA 4AVYA 3DO5A 1AGPA 4IGEA 1A4XA 3B9BA 1LBSA 2Y0PA 1Y4AE 1KYTA 4UNPA 4US2R 3H2JA 2Y2VA 4Q4HB 2PX2A 1HDYA 2QM8A 2PUGA 4OI0A 3ABQB 3H5RA 3I92A 4S0XA 3ZZUA 4N82A 2Y1GA 1RXSA 5K4GA 3L8FA 1PUJA 2YWRA 3HYTA 5CNIA 4BY9E 4MPPA 1AXGA 1T3SA 1J42A 3SZMA 3T4XA 1E66A 3D2CA 4BNTA 4I50B 1TM2A 4H0FA 2WSMA 4RF5A 2F4VB 2FZKA 4MVXA 4IIYA 4RAOA 1SY7A 5C5CA 4P2GA 4YMGA 1K5DA 2IUEA 2YYYA 1GZHB 3C87A 3F7NA 1NNUA 4LXQA 1DEAA 3COYA 2P2GA 2O0LA 2KLBA 2PUTA 3FKJA 3LECA 3VTFA 3O82A 2X2OA 3WISA 1QOZA 1VE9A 3D7NA 1WSDA 5CLHA 2WG2A 1OLXB 1NN3A 3DNMA 4FE3A 2YWXA 4HR7A 3RU7A 4C0JA 4ZC8A 4S2UA 2BEKA 1YSCA 1HZJA 5DOZA 1OTXA 2EYUA 2P1RA 2QY6A 3DMDA 3MD9A 3MYRA 2X3YA 1RAFA 3OPMA 3F71A 1ZMRA 5EIOA 3RT9A 1BWPA 3K5PA 3KNZA 3ZK8A 3KQLA 3C24A 3FPAA 3VR1A 3HZOA 4EPTA 4B17A 1XVAA 1EUCB 3Q1LA 1EB9A 2P2CA 3K8YA 5LOVF 4G0NA 1GDTA 3H75A 3KPVA 2OHGA 2FN9A 3JQFC 4GM4A 5TS2A 1OLSB 1IK6A 1CJKC 3CUUA 2VDVE 2PR7A 1GJRA 1JEJA 3EWSA 4P7FA 1K5HA 3HDVA 2JRLA 4KC0A 4YAOA 3VO2A 5LMZA 3OF5A 1XZAA 3W6OA 1XZCA 1W4CA 4JI0B 4RZXA 1ODTC 2WILA 1HDRA 2RSLA 1TZCA 3KZNA 4FOLA 4Y1EA 2AC4A 5GOZA 2BGTA 3LUDA 2NZVG 1WZ2A 4TT3A 4X7MA 4E94A 2HPZA 3BCRA 3N8NA 4G1EB 4RY9A 2CHFA 3L4JA 1QYCA 1BFDA 4BNHA 5H8WA 4Y7CA 4ADSG 2BKXA 4XM0A 4JI1B 4ZI2A 1T2EA 4JNCA 2HX1A 3Q5DA 4BIMA 5KNBH 5TEVA 3URKA 4I50F 3AVXA 1G9TA 1R7RA 4JDPA 1W8DA 4WOPA 5G1PA 4EB6A 4K9KA 4NENB 1JLLB 1SVOA 4HAWA 1T9CA 1VMAA 3D3JA 3H1GA 4FOOA 4Q7MB 2JLYA 2G9ZA 4M99A 3DAPA 1DX4A 5H16A 5J1TB 2LDBA 3F5MA 4O2BA 1APBA 2BC9A 4BTVA 4KPUB 2SBTA 3UBTA 4PG8A 4LNAA 1GL3A 2O3SA 3KDAA 3PRHA 4N8SA 4OI4A 4V03A 1Q6YA 3R7FA 1FLAA 5EMNA 5CVEA 5CDFA 1A69A 1YQTA 4GL4A 4GVLA 4TVOA 5FFNA 3C3EA 1SBYA 1YR3A 1W30A 2I29A 2PSHA 3PQFA 3T3NA 2YVUA 1SCKA 5G0VA 3U7RA 3UTDA 2BBWA 1UQUA 1VBKA 4GW3A 4PAMA 4QOGA 5ALWA 3RS2A 1YWGO 4H4EA 5FWAA 2YXBA 3AEKA 4IFTA 4DDTA 4YV2A 1F8GA 1RVV1 2Z3ZA 1CZRA 2RFLA 3QGMA 1GZ3A 4GYKA 4I14A 4YCBA 5CRIA 4A8PA 1K7XB 2R7KA 5JAPA 5CNKA 5F1OA 4RVCA 5JAOA 1PDOA 4LHYA 3VU9A 1ZDMA 5B37A 2H9AA 3AZQA 3LZ6A 2CV0A 1E3EA 5KYTA 2P90A 3N5KA 5B3AA 3LC2O 4Q34A 1SVUA 4GOMD 2QQ0A 4KTVE 2HLPA 2JJQA 1K66A 2Q3BA 3IT2A 2WWXA 4FLEA 1DEKA 1S2IA 1PYOA 3UMJA 4F6CA 1GSAA 3DKKA 4HAZA 1OB5A 4H17A 1IMOA 1DC6A 5GTDA 5JJ5A 4JSRA 3W6ZA 1THGA 4KQGA 4R84A 3LJKA 4E07A 2YVQA 2JCBA 4E4TA 1FMFA 1XV5A 2I3ZA 4UFPA 2FVYA 2XCLA 4R8KA 4UMFA 4X85A 4EUKA 2VATA 3L6RA 4FGJA 4K6HA 3WLPA 2WWHA 3E05A 4JI2B 4LOIA 3BE8A 1KYQA 5IC4A 4HGPA 1JG4A 3OZIA 1WDKA 4P32A 2J07A 2PT6A 2QPLA 2REQB 1EDZA 1P6XA 2PKCA 4FFPA 2W2QA 2NZ8A 3W3AA 1ST3A 2W11A 3EPRA 4BDSA 4BJHB 1TTPB 3D3EA 1QBKC 1QGDA 4RY0A 2ZJ0A 1ZCZA 3GDHA 2FUCA 2JGEA 4TN1A 3DPUA 3K9BA 5KJEA 5NLLA 1OC4A 3H16A 4L76A 4PFQA 3WIVA 4I36A 3T3IA 4QM7A 3AJEA 2RGDA 1DFHA 2NTNA 5I9NA 1DTEA 1OWLA 1C9EA 2HQ1A 4WCDA 3V2GA 2WB4A 3WA6A 1K08A 1NL3A 4DF3A 1RBQA 1AN0A 2F3SA 2ZRKA 3CSDA 2I7TA 2Q8QA 3FCYA 3PVZA 1OT5A 1YRYE 3VMMA 1S9HA 3VR6H 4FFWA 4PTZA 2WHPA 3LMKA 4J3FA 5BPHA 1CJSA 1GPWB 2EEZA 2I65A 4BLTA 3RSCA 5K3BA 3LHIA 1U31A 4Q47A 4ER7A 2MR5A 3AF6A 2ALJA 2G9RA 5J2UB 3VR5D 4DLWA 2NQ8A 5KYKA 1DV2A 1VGVA 2IUSA 4KO1S 2ZRJA 5EPEA 2GEDA 2HUNA 4JKIA 1P9WA 3I12A 2PU5A 3BTVA 5AI4A 1L1QA 4R2WA 1U11A 5FV4A 2GK6A 2AGVA 1TCBA 3LY8A 2YW9A 1QV7A 4RS4A 2FX5A 3NGXA 2BGWA 1WZNA 5SYMA 4F5YA 2ZJBA 2GBLC 1VI2A 4ZOLB 4L1KA 2RBKA 1JIKA 4ZVNA 3K9FC 1R3DA 2A9QA 1W4BA 3PC7A 4TQAA 4B6RA 4KR2A 3O47A 2IZ1A 4FYYA 2I0FA 4IQ0A 1ZH2A 2C3YA 3T52A 1IXSB 3QXSA 1MV5A 4OVKA 4AUKA 1NBAA 1OJLA 5I3ZA 4NYIR 1PX0A 1U6IA 1Y1TA 2H29A 3EASA 1G8AA 3CPJB 3KJQA 3OG9A 2VUSA 4QXQA 1NXPA 1T9KA 1GG8A 3CWCA 3OZSA 4L6AA 3OZBA 2C3PA 1O6ZA 2G09A 4DY6A 1NI3A 2V6MA 1ORVA 3AB3A 3STXA 3SXUB 2BJHA 1FFCA 5KKCA 3S99A 5IXYA 2UZAA 2AKAB 2WUEA 4II3A 4TUYA 1BW9B 2X2FA 3FDJA 1V35A 3GAMA 2AW5A 3FHLA 4Q3CA 3D4PA 3IO5A 1WXFA 1B15A 1O03A 4K9PA 4J9UE 3H9JA 2RGAA 4LGYA 3RODA 1O0CA 4WLVA 1F4VA 2WHYA 1YHYA 3P9ZA 3F1KA 4Q5IA 3GIWA 4DRXA 3DFIA 1NKVA 3C45A 2I3GA 2VYFA 1WHTB 4I2NA 3KWFA 3VISA 1S2NA 1EPUA 1GTZA 2VJYA 3K2IA 3PYXA 1RXVA 1IWPB 3BGWA 3DLAA 3AF1A 3GB9A 3DOUA 1T15A 5JSHA 1C7IA 1X7XB 2B1QA 2EKDA 5F64A 1QKKA 1LVGA 3QNUA 3S5JA 1T0HB 2F64A 3P9YA 4FMCB 5KWJA 4OHYA 2IX9A 5J2UF 3FI9A 5TEWA 4JFRA 5JDCC 3RVRA 2W8BB 4HWRA 1OCEA 3AT1A 4HB0A 3CA8A 2XH8A 3F5QA 1PZGA 3T7JA 4D5GA 1QONA 4K0KB 3VNUA 3K1AB 1FNCA 3UY4A 3B1FA 1QDEA 1U0OC 3DEJA 2CFCA 4KXQA 4BLWA 1D6SA 3FLBA 4ZIRA 4F7WA 2BDUA 1XRQA 2BSXA 2GBPA 4Y6OA 4TMFA 4KNVA 1VIMA 1A04A 2W2OA 1X9HA 1K68A 1N2CE 2YHSA 2JAOA 4LIPD 2ZSEA 2VQEB 1JAIA 4X71A 1KGSA 4ZQBA 1PJAA 2MIIA 3MGBA 4HGYA 5TDHA 5DO9A 3RADC 5FEMA 4KK4A 2XT9A 2D06A 3FZGA 1QYXA 1F5NA 2DG2A 2P8JA 2OV6A 3KKNA 3NU1A 4IXDA 4NCNA 2VDLB 2P9EA 4BNNA 2O8DA 4AZWA 1I4EB 2VZ8A 1NBHA 5HVNA 4I9NA 3EIEA 3ESRA 1UADA 2WM2A 3F90A 3L8HA 3R09A 4TL6A 4JT2A 1DJPA 4M9UA 2VO1A 4RXUA 1FFBA 1XL1A 1NQOA 2QPTA 4E5VA 3ZE1B 3LX5A 1F7UA 1MENA 3RQIA 1EWYA 1I24A 3FCXA 3UM9A 4JELA 1RADA 1Y0BA 3ZJYA 1QGYA 2BEUA 4G1MB 3NORA 4YBZA 5AR1A 5UKDA 4M1TA 3CGGA 5A06A 3ET5A 4C76A 5HZKA 1A82A 1XLUA 1U0GA 1BA3A 2HI0A 1UZMA 2AEJA 1JDVA 5LDGA 4YV1A 5MF6A 1YJ8A 1AMOA 1SKAA 1U5BA 3GJ3A 3TMYA 2IH4A 4L2IA 2QX7A 2V5AA 1FUKA 1Z3CA 4K9OA 2DXIA 1DRVA 4EX6A 3EZ7A 3GRZA 5CYPA 2ZFUA 1J23A 2CLEB