2UZTA

Pka structures of akt, indazole-pyridine inhibitors
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 111
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uztA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uztA02
2JBOA 3COHA 5CT0A 4EOPA 4F7LA 4JQ8A 4F9WA 3HL7A 4IX4A 1BKXA 5IPJA 5E90A 4IIRA 4AFEA 2C6IA 1SVHA 4F64A 2J50A 4KAOA 4JR7A 4QPSA 4O7LA 1PHKA 2XMYA 3KL8A 3CTHA 5CX9A 3NMUF 4UMQA 1ZY4A 4HGLA 3GENA 4QQ5A 2VO0A 5EYDA 3GC9A 4XOYA 5J87A 3QWKA 3SV0A 4NKSA 4CD0A 3GBZA 3UIUA 3TG1A 2QLQA 2YIQA 2VX0A 3FC2A 5KMMA 4FEWA 4BF2A 4HYUA 1H08A 2YISA 4F0FA 5T3QA 3UMXA 2PVYA 4BCHA 4O7WA 3SA0A 4UMUA 4R77A 2GQSA 4RQKA 3PXFA 4APCA 3KXZA 1Q8UA 4K9YA 4RSSA 2CKQA 3GT8A 4KB8A 2BRHA 4S2ZA 4IAKA 4ZJVA 4EH4A 2JIIA 4GCJA 3V5LA 4HZSA 2G9XA 5AAEA 4UALA 2YN8A 3NYNA 4RVTA 5HICA 3PSCA 4U40A 4KIKB 4TYEA 4JRVA 4R7HA 5LMAA 4U3YA 2WIHA 3UIBA 5HG8A 2BPMA 3D9VA 3DJ5A 3KULA 3FY2A 2BDWA 3I4BA 5AWMA 3CR0A 1ZWSA 3R1QA 2UZBA 4O1PA 3VUDA 2BAJA 2HCKA 3QD4A 2A2AA 5DMZA 4LL5A 3A7JA 2PE1A 3QD3A 4M7IA 4PL5A 4FOCA 3UZPA 3QZIA 5E91A 2W1DA 1YI6A 5DPVA 1YDSE 3ACJA 1BUHA 2Q0BA 4BYIA 3KMWA 3KC3A 2OKRA 4LGHA 4LRJA 3HRCA 2IJMA 3GNIB 4HPTE 3COMA 3FZ1A 5GJGA 1UKIA 3R7YA 4N4SA 2ZAZA 4WO5A 1XWSA 3DDQA 2G2HA 4D2TA 5IDPA 3Q5ZA 4EUTA 1JKTA 4FL2A 3HUBA 4FT7A 4O0XA 1URCA 5FM2A 3GU5A 3Q9XA 4E5BA 4FK3A 5K0KA 2YCRA 1QPJA 1U59A 2ITTA 4B8LA 3V01A 4ACDA 4MXAA 4G16A 3QTQA 4IAAA 4IZ5A 3RGFA 3MA6A 4BCOA 5CSPA 5GIPE 2NO3A 3PWYA 5CQUA 3EN6A 3IW8A 4LG4A 3EZVA 1W83A 4MQ1A 3ZRLA 4ASEA 3DBQA 5GHVA 3A4PA 3W2OA 2B4SB 4CTBA 1YQJA 3E7OA 5AR5A 5HG5A 3GCVA 4PWNA 3LCDA 4M12A 5DR6A 3WZKA 4YR8A 2W05A 4FX3A 5BVNA 4OT6A 5JFSA 4FEUA 4AT5A 3G15A 1Q24A 1DI9A 3ENMA 3JVSA 3HAVA 3QAME 3G0EA 1H24A 2GQRA 5FXSA 3PZEA 3AMYA 5CZHA 4FUXA 3W10A 3ZRMA 1Q5KA 4FZ6A 5FEDA 4MD9E 4DG0E 3FKOA 5EOLA 3GFWA 3GVUA 4B6LA 4ERWA 2RFEA 4ITJA 4I5CA 3KREA 2ETRA 2WMXA 4UYAA 4RQVA 4GJ2A 3ZEWA 1PKGA 4UMRA 3VRZA 3P0MA 5LJJA 2ITPA 4IEBA 2HW7A 3F2RA 2RFNA 4GVAA 4F7JA 3MI9A 4UB7A 1APME 2A19B 2FB8A 4PDPA 4RMZA 2H96A 3UNKA 4DT8A 4FVRA 3UG1A 3UOHA 4O7RA 5EM7A 2W4OA 3LFQA 4U0IA 5DYJA 2AC5A 5HNBA 2X0GA 2VWZA 2YDKA 5HTCA 4F63A 4O0YA 2OJFE 2YIXA 3FC1X 5AIRA 2W4JA 4FA2A 4DG3E 4WSQA 3T9TA 4ANOA 4X2JA 4X3FB 4NYEA 5CAVA 3LJ0A 2RG6A 2C4GA 3LXNA 1NA7A 1GIJA 5IEXA 4GH2A 2RSVA 4AUAA 5DBXA 4HNIA 2GCDA 5LVLA 3DXQA 3RK7A 2CGXA 4LM5A 4C58A 1M17A 3UO4A 2LAVA 3WOWA 1UWJA 2B55A 1W7HA 4PPCA 5I4NA 3LCSA 5DGZA 3PVWA 1J1CA 3OG7A 5M51A 5AR8A 2C30A 3ZEPA 4OAUC 4MTAA 4BICA 3AC5A 3R8LA 1XJDA 3D0EA 1L3RE 5K4JA 3BYSA 3WZUA 3NUAA 2ONLA 1A06A 2PE2A 4DAWA 5F4NA 3UJGA 5J5TA 1OPLA 3EYHA 3ORZA 2ESMA 5E9EA 3FMEA 5FDXA 1YHVA 5FXQA 1REJA 4E6DA 4IB1A 4QYFA 3TEIA 2VV9A 3VS2A 3OBJA 2OFUA 5IA0A 1REKA 4L3JA 4WUAA 2OK1A 4TT7A 4UV0A 2EXEA 1HCLA 4AP7A 4E4MA 1XKKA 4C4GA 3GOPA 5HE1A 3MY5A 1OZ1A 4AWIA 3G9NA 3OUNB 3JYAA 3LKMA 5BPYA 3OEFX 4FTQA 2WIPA 4NM0A 5E1EA 2VX3A 2UW7A 3BHUA 4PQNA 4J98A 4BCGA 3I5NA 4CKRA 5A6NA 4AZEA 5EW9A 5EH0A 3DK6A 4GRBA 4IWDA 2C68A 3BELA 3OOGA 3PP0A 3BPRA 3QBNA 4DG2E 1G8SA 3E88A 2UUEA 3R01A 3IECA 5J79A 5DHJA 4EHGA 4IM3A 4WBBB 4CXAA 3QQHA 2RL5A 5C8KA 3S0OA 1WBTA 4JI9A 3ZO1A 5DT3A 3M1SA 2QI8A 4FKIA 2WB8A 4WG5A 4AW1A 4TWPA 4NW6A 3LFSA 3DTWA 2C5NA 2XK7A 4JNWA 1XH4A 4EH7A 3I0OA 2BALA 1XH6A 3BBWA 4XMOA 3AD4A 3FZRA 2ZDUA 4M68A 2VTIA 2Q0NA 3NUSA 3PTGA 4D0XA 3EB0A 3H0YA 3DU8A 4EWHA 3AC2A 3GCQA 4X2KA 4H3BA 3IW5A 3PP1A 4RC3A 3VF8A 5AM7A 5TOZA 3NRMA 3FL4A 3O17A 3QC9A 5IA3A 2C5OA 4UN0C 3W2SA 2PPQA 4IM2A 4P90A 1CKPA 4Z55A 4I5PA 4B99A 4C3RA 1WVXA 1OL1A 3KK8A 5FBOA 4DBNA 2HW6A 5GZAA 4I21A 4ZIMA 1JBPE 2WU6A 2XNBA 2IG7A 3F66A 3N9XA 2XK3A 3KVXA 3V8SA 5EG3A 1KSWA 2QO9A 4ZLZA 5M4IA 3DGKA 4GKIA 4IFCA 5J5SA 1KV1A 1VEBA 5L2WA 2I0VA 2Y7JA 2QOQA 3ZUVA 4WT6A 2CKEA 4L53A 1JSTA 2UZDA 2X4ZA 3P9JA 4M0YA 3ENHA 5HE3A 4RIWA 4F08A 3CE3A 4F9YA 3BEAA 4H3PA 3DT1A 3O7LD 4DGOA 4D2VA 1WBOA 3ZCLA 2VO7A 2XUUA 3LCTA 4ZTHA 4YBKA 1R0PA 4FSWA 5I9XA 3OT8A 2XB7A 4NWMA 2VNYA 2ZV8A 3TN8A 3TNIA 4XV2A 4C35A 3UGCA 3EH9A 1PW2A 4XYFA 4KUJA 5FUTA 2WKMA 4L42A 2JBPA 3PXYA 1T46A 4WRGA 1B38A 3GUBA 5HGIA 3FXXA 4EQMA 4IWPA 3VQUA 2GSFA 3U4WA 1DI8A 1SM2A 3I60A 2OBJA 3DFCB 3QWJA 1YW2A 4I5HA 2X6DA 3FSKA 4O22A 5CU6A 2WZJA 4B9DA 1JKKA 4YSMA 3GC8A 2PK9A 5A3XA 3ZTXA 3D2IA 3FPMA 3EN9A 3DS6A 4BIDA 4JDKA 4YP8A 4BDGA 2BROA 2ZM4A 3PIYA 4FSUA 4YPDA 4FIGA 2VTQA 4TYHB 5ANJA 2PZYA 5BUIA 5IQFA 4FSYA 5BUJA 3LMHA 4FTCA 2XS0A 2J2IB 5CAPA 2BRNA 4YNOA 5HCYA 1XQZA 5HBHA 4ZTSA 1PXMA 1M14A 3U6IA 4OW8A 1O6KA 2B54A 3L9MA 3ZO4A 4G34A 4O7YA 2R3GA 4ENXA 1XBAA 3K5UA 3ZDUA 3GC0A 4MX9A 5M08A 3CY3A 2VWIA 5A9UA 3AOXA 4U41A 3N51A 4FSNA 3R21A 3V6SA 4AAAA 3U6JA 5J1VA 1IAHA 3FLSA 5GZ9A 2B53A 4ZEGA 2O5KA 5BYYA 4FKSA 2IW6A 4IX5A 4RIXA 5HCXA 1PXKA 4FV9A 3BIZA 4ZOGA 1YOMA 1H25A 2GNFA 5KMOA 3A8XA 4TYJA 1F3MC 2PMIA 2WELA 1J1BA 4QMOA 3VAPA 3CCNA 1BX6A 1W8CA 4W4YA 4KKGA 4Q5EA 3EQGA 3K5VA 4I93A 3GEQA 2WMAA 3O0GA 4FZDB 4MNFA 3F82A 4YURA 4DFYA 4FNWA 4YJSA 3PRFA 3RPOA 5IA2A 2FO0A 4A07A 2PUIA 1YRPA 3ZLXA 2UW8A 2QNJA 3ALNA 2C0TA 2X9EA 3R2YA 5DLSA 2HENA 4PV0A 5D41A 4ACMA 1XH7A 4K18A 4CGAA 1MP8A 5BVKA 4ANSA 4YHFA 2C6EA 2I0EA 4YZ9A 3UO5A 5I9WA 5M56A 1JPAA 3S4QA 3ULZA 2VD5A 4AT4A 3NX8A 5CNNA 3EHAA 4E4NA 5CS6A 1E1VA 4JDJA 4I23A 4W4WA 4ACCA 1YWNA 4RX9A 2C47A 1ZOGA 5ANDA 2PVJA 4RFZA 4HZRA 4C4JA 1JVPP 3RZBA 5E8XA 3R6XA 4QMWA 2HAKA 2GS7A 3KA0A 3PJ1A 4PUZA 4EBWA 4GIHA 1YI4A 3OVVA 4RVKA 3AQVA 3R71A 3PY1A 4S34A 4FEQA 4ITIA 4G5JA 5CF4A 4FIEA 4ZZMA 4L7SA 1CKJA 3RAWA 2I0YA 2VZ6A 1PMEA 2WTKB 2QO7A 3QU0A 4NT4A 4A4XA 4D2PA 4EZ5A 4G9RA 4IANA 4N70A 4RJ7A 5CQWA 5DEYA 5AFVA 5AAFA 3EYGA 4OTGA 3PXZA 4QP7A 4CTCA 5L6OA 2GDOA 2QU5A 2BUJA 4FTOA 2YAKA 2FVDA 3KRXA 4BGQA 3ROYA 4G3EA 4FV8A 2YERA 3HRBA 4MCVA 5HOAA 3ZFMA 3E5AA 5TE0A 4QYYA 2PZPA 3JUHA 4GFGA 4OLIA 4M69B 3LOKA 3V5TA 4C38A 4O81A 4PDYA 4AF3A 3PE2A 3NCZA 3RI1A 3HMMA 5HLPA 3ZH8A 3II5A 4ORKA 3VS3A 1Q8WA 3EWHA 3LE6A 3SAYA 5HIEA 1LEZA 3KF7A 3C4WA 3ATSA 4X21A 5IUIA 3TIZA 2R4BA 3H10A 3R7GA 3RK5A 1H07A 4WRSA 1ZYJA 3BE2A 4BFMA 4O38A 4EYJA 2AC3A 3HV4A 4IAZA 3TACA 4E3CA 5KO1A 3GGFA 3OD6X 3PZHA 2FSTX 4I0SA 4ZSEA 4WOVA 3QTSA 4EL9A 4IFGA 5HU9A 5IQBA 2YCSA 3MY0A 1Y8GA 2Z7QA 1V0BA 3DPKA 2J5EA 3R28A 3SHEA 3HYHA 2JLDA 3SOAA 4L3LA 3ORTA 1PJKA 4F0IA 4QRCA 5AV1A 5L2TA 5I9YA 2JIUA 3IDCA 4YPSA 5LQFA 5HE0A 4RGJA 1H27A 4FKJA 4FV4A 5HKMA 1ZYLA 2V5QA 3QLGA 4KSPA 2W5HA 5HE2A 3MSSA 4EH2A 5L8KA 3G51A 3I7CA 2OJGA 5CY3A 4DCEA 2WEVA 4BVUA 3W2PA 4E4LA 2IVVA 3BE9A 3P7CA 4ZLYA 3CC6A 3LJ2A 3MH0A 4Z3VA 1MRUA 3PYYA 2UW0A 3HV3A 4QPMA 2XK9A 4OT5A 4YO4A 4Y85A 4I20A 5C9CA 3BCEA 5DOSA 3ZMMA 3ZXZA 1QMZA 1SNUA 2V0DA 4XCUA 2QCSA 4TY1A 5BMSA 2BFYA 3BV3A 3LQ8A 4D2SA 4FF8A 4Y72A 1PMNA 4GL9A 1SVGA 3ORLA 4C4HA 4NEUA 3C1XA 1XH5A 3DKGA 3EZRA 4X2GA 4AZFA 4D4YA 3TDWA 4WHZA 2ITXA 5CI6A 3MPTA 4FVQA 5ITAA 4E6CA 1H01A 3FPQA 4ACHA 3LW0A 4UWCA 3VHEA 5ICPA 4AGDA 4HYSA 3H9FA 3MTFA 2WTJA 3NPCA 5AR2A 4I1ZA 1ZOHA 3QGWA 3VWAA 4TYIA 4OGRA 3BYUA 5M44A 3UZRA 4HJOA 5I9UA 1G3NA 1UU9A 3DBCA 3DXNA 4JIAA 4CT1A 5HO6A 4QMYA 1ZYSA 1DAWA 2XVDA 4UYNA 1GZNA 4X2FA 4A06A 3TZMA 5AR7A 3PVBA 4JG6A 2QOLA 5BMMA 2QU6A 3PXRA 1FVTA 4XNEA 4FEVA 5EYCA 3DFAA 2X7GA 3O7LB 3OROA 3C0HA 3AC4A 5L2SA 4FIHA 5C03A 1STCE 1Q3DA 4EK5A 5LVOA 2CGVA 4I4FA 2VTMA 3DB8A 3SKCA 5KKRB 2WHBA 3DBEA 4CT2A 4TXCA 2YA9A 3QF9A 4U7ZA 4GG5A 1URWA 4BHNA 3NIEA 5CEIA 5B7VA 4QMLA 2WQEA 4XG6A 3QRUA 3VRYA 1UA2A 5EDQA 3DBFA 5CEOA 3CKXA 4AE6A 4DGNA 3IS5A 4RFMA 4ASZA 1PXIA 4FV3A 4NCTC 4YJQA 1Y91A 4XJ0A 1Q8YA 2XEYA 4QNYA 2R3FA 3QD0A 4U3ZA 3CPBA 3MIAA 3EFJA 3SRVA 3FQEA 3H4JA 3Q53A 4G3GA 4F7NA 4O2PA 5EHLA 2HWPA 3E63A 5DIAA 1OIUA 2HWOA 3DAEA 5F1ZA 2I0HA 2X2KA 1ZMWA 5AP4A 1KOBA 4BTFA 4FG9A 4IAYA 3A8WA 3UP2A 5IISA 1F0QA 5AA8A 5JT2A 3PIXA 2X1NA 3ZONA 5J7HA 1VJYA 3MVHA 3NIZA 2OLCA 2C69A 3LFDA 3VBTA 3AD6A 1KE6A 3OOMA 2JITA 3PA3A 2PY3A 3MFSA 4JJRA 4NW5A 2DQ7X 2IZSA 3GFEA 1PXJA 4U44A 3F3WA 5ETAA 2YLFA 5K0XA 1OKVA 3M42A 3OCBA 2XNPA 3G0FA 3HAMA 3UBDA 3CD3A 5G1XA 4BTMA 4YLLA 4C2WA 3P1AA 3PXQA 3UNZA 1PXOA 3F3ZA 5CSWA 2UW9A 3RJCA 4DHFA 4M0ZA 3W8LA 4ZK5A 4MXXA 3OP5A 3OCTA 4EH8A 3WARA 5J9YA 2R3RA 3IW4A 2FSMX 3QA8A 3KXHA 3SXRA 1MUOA 4V04A 1PMVA 4Y83A 4BDHA 4B0GA 4D28A 4PP7A 2HK5A 4W8DA 2JDSA 3ZS5A 4H3QA 4QMUA 3KRRA 5DH3A 5IQCA 3F88A 5HORA 4GT4A 3ZZEA 1SMHA 2YM7A 4JAJA 5HTIA 4EK8A 5KZ0A 4D1XA 3QA0A 3FI4A 2X8EA 3DKOA 4NFMA 3VQHA 4F7SA 4LUDA 2WXVA 4QTEA 1H26A 2BZKB 3QTUA 4F1MA 5CAUA 1WBVA 2C5YA 1ATPE 1YOJA 4QD6A 3RPRA 4FTAA 5A4CA 2Y0AA 3FUPA 5LWNA 4GT3A 3QYWA 4DGLC 3KRJA 2FA2A 5FM3A 4BYJA 5AJQA 4FIFA 5A4TA 1A48A 3G6GA 4CCUA 4EC8A 4DTBA 2GQGA 4M15A 3G9LX 4ZP5A 4ERKA 2W0JA 4O6EA 1M7QA 4TKSA 3TT0A 3U51A 4RA5A 3LZBA 4J96A 2WQNA 4GJ3A 4R7BA 4XRJA 4WNKA 5AP0A 2JFMA 3F3UA 5CVGA 4CNHA 2VNWA 2PUUA 3PFQA 3BLQA 3KULB 4O1OA 3ERKA 2VGPA 4FYOA 2I7QA 4FNXA 2C1AA 2QOOA 5CVFA 1XH8A 4EEVA 3OF0A 4P2KA 5FGKA 4DFNA 2X39A 2CLXA 2B0QA 4GK4A 2F2UA 5LCJA 3QYZA 5EW3A 4DT9A 2OU7A 1R0EA 3FV8A 5A46A 1YXXA 4FUYA 2XM9A 4OBQA 4BR3A 4O7SA 2B52A 4YJNA 4F6UA 3KVWA 2XIZA 5CU0A 4L6QA 4ANNA 1H8FA 4D58A 4GVJA 4E6QA 4S30A 4YMJA 2BKZA 5BVWA 5IQDA 3IG7A 4NM5A 3Q52A 4EK4A 4KSQA 4D2RA 3OMVA 5L6PA 3G33A 3PJ3A 1H1WA 4AXAA 3F5UA 3FMHA 3KXMA 3L8VA 3QD2B 4FTUA 3UPZA 3FZPA 2F7ZE 4KRDA 4L68A 3BWFA 4QTCA 3A7GA 4EZ3A 4FKLA 3BHHA 3BU3A 1FINA 3FLNC 5AIKA 4J97A 4LQMA 3AC1A 4AOIA 4EHVA 3KN5A 3V8TA 3VS4A 5B2LA 4UZDA 3H3CA 4BCPA 5IG1A 3S00A 3PG3A 5IA4A 5KMNA 2ITOA 4I92A 4C34A 3DLZA 2XK8A 5H2UA 1UVRA 2B9JA 5AMNA 3EN5A 3NAXA 4UBAA 4NL0A 3HP5A 4Q5HA 3KXXA 2X2LA 2EXCX 5E1SA 1P4FA 2WTDA 4DLJA 4FVPA 2Y6OA 1Y57A 3P86A 4RVLA 2VTJA 5E8YA 1FGKA 5E8SA 3ANRA 5TO8A 5HX6A 4K1BA 5TT7A 2VX1A 4FKOA 4U42A 4G6LA 3IW7A 5C26A 1FMKA 2G1TA 2B9HA 4FTMA 4GKHA 3LFEA 3VC4A 3IDPA 5EI2A 3SW4A 5CXZA 4FKVA 4L67A 3QRKA 1B6CB 5DRBA 4BC6A 4KIOA 4TYGA 3NAYA 1H1PA 2GU8A 4DFZE 5JKGA 1WBWA 4O84A 3F5GA 1SYKA 3MJ2A 3QTXA 4O21A 3ID6C 4RA4A 3ZHPC 4BB4A 2PSQA 3I7BA 3UO6A 4FODA 4J52A 3DY7A 4X3FC 1EH4A 4YJUA 4AFJA 4RBLA 2W9FB 4XG4A 5D12A 5JGAA 2B9IA 3B8RA 3RNYA 4M84A 4U6RA 4WBOA 5T6KA 5IU2A 1CTPE 1H1SA 3DAJA 2EUFB 5D7VA 4E7WA 5JFVA 1OMWA 4U5JA 3PSBA 1I09A 2J0MB 4RJ8A 4YJOA 5T68A 3R7UA 3RWPA 3NVMB 2FSOX 4BZOA 3NYVA 3UYTA 2BAKA 1FPUA 3RNIA 5HZNA 1R3CA 4ZJIA 4BZNA 4F09A 5CF5A 3VS6A 4DBXA 3WZJA 1FQ1B 4PPBA 3R9DA 4U81A 3FYKX 4F9AA 1UU7A 4IVAA 3RMFA 4FZ7A 3DA6A 4C3PA 2GNGA 2GS2A 3JPVA 3F2AA 1YDRE 2PZIA 4NSTA 5A6OA 5ACBC 1JLUE 2PHKA 2GMXA 2Z2WA 2V7AA 2HELA 5AP3A 3RHXA 5I9ZA 5EDRA 1YVJA 3F3TA 2IVUA 4HOKA 4ACGA 4D2WA 4IMYA 4USEA 3FKLA 2BHHA 4O82A 2ERKA 1Y6AA 2HIWA 4G2FA 4YGAA 3QXOA 1W84A 4JAIA 4Y5QA 2W1FA 2BRMA 4JX3A 4YLJA 4QMNA 4UMTA 2V62A 3COKA 3W55A 4LRKA 4NJ3A 5AV3A 5CU3A 2Y9QA 4D1ZA 4PRJA 4MBJA 3FLYA 3NW5A 5EDPA 4RIYA 4L52A 3VUHA 5JFWA 3ZDIA 3DLSA 4CMOA 4LFIA 3DJ7A 3NVKI 5CEQA 5EKNA 4BDCA 1OBDA 4II5A 4H39A 3UPXA 3FKNA 4C02A 2C3JA 2QR7A 3OXIA 3QCXA 5HNGA 3TJCA 3A4OX 3TDVA 4EONA 5CZIA 3OWPA 4FSMA 3QTIA 4XG2A 3F9NA 3REPA 1MQ4A 4KRCA 4PMSA 4FR4A 3TZ7A 4AE9A 4IZAA 2XIXA 4L01A 5EYKA 4HCTA 4W8EA 5AUWA 4CZTA 2NNWB 5AX9A 2UZOA 4FKQA 3ZZWA 1M2PA 4MBIA 3HECA 5CLPA 3OZ6A 3THBA 2PVFA 4EQCA 2IPXA 2J4ZA 4ANLA 2VTOA 5L8LA 5BUEA 4UZHA 3MB7A 2XNNA 3ORNA 4RT7A 2WOUA 3DCVA 3NLBA 2F7EE 3VVHA 3V5WA 2OIQA 2R3KA 3ODYX 4BCKA 4R5YA 4MKCA 3U54A 2YIYA 2NRUA 4IBMA 3BHVA 4WNOA 2OH0E 5CAOA 2PMOX 3A99A 3AGMA 4MQ2A 4TZRA 4G31A 4PDSA 4AN9A 4A9UA 4UXQA 4C7TA 3LLAA 2GNLA 4D5KA 3QQUA 4CQEA 3UTOA 2GFCA 3FMKA 4V01A 2OXXA 2J6MA 5AUVA 2IZTA 4QP8A 2CGUA 5JN2A 2VWBA 4FSRA 5JZNA 5K3YA 3PSDA 2OGVA 3ZC5A 3QC4A 1OKWA 2PTKA 4EYMA 3V6RA 3P4KA 3Q9YA 4EOOA 2OFVA 5CT7A 4FKWA 3UVRA 4BCJA 4AX8A 2BDJA 3P78A 4PL4A 3AC3A 2C0IA 3LVPA 3HV6A 4AZTA 1YHSA 2OI4X 4U45A 1CM8A 2WMUA 2XF0A 3CTJA 5M06A 1Y8YA 4Z7GA 4FNZA 4ANBA 1OGUA 4PMPA 3KU2A 3NNUA 4O27B 4WIHA 2JFLA 3BU6A 5IZFA 3VN9A 3I1AA 4BY9E 3V5JA 1HCKA 3HP2A 3ALOA 5CSXA 4O86A 3NGAA 4KS8A 3GOKA 4BDAA 4IW0A 4X0MA 4NTSA 4MBLA 4CV8A 1XBBA 4O7VA 4HVIA 3C0IA 2JEDA 3WI6A 4A9SA 3RBWA 4B7TA 2QR8A 4NH1A 3U9CA 5GIOE 4DN5A 4BIBA 2JKMA 1LPUA 3A60A 4YNEA 3IDBA 3RALA 2ACXA 1TVOA 1YI3A 2OZAA 3NUPA 4ZS4A 3RAHA 1AGWA 4OR5A 3VBWA 2CMWA 4YC3A 4RIWB 4QP9A 4DEAA 5BVFA 3D5UA 1ZYDA 3TUBA 3QRIA 3FHIA 4HNFA 3NS9A 2DUVA 3HZTA 4FTNA 3KFAA 5C8NA 5M53A 3OT3A 4RC2A 3VUTA 2ZV2A 1XR1A 4MF0A 4J95A 4V0GA 4AGUA 4AW5A 4F1TA 5TKDA 3ROCA 4IB5A 4UXLA 5BNJA 2F7XE 1E1XA 5KMKA 2YM6A 2QKWB 2IWIA 2R3OA 5ANOA 1UU8A 5L4QA 3UZTA 3NW6A 4CMTA 4Y46A 1ZYCA 4ZZOA 3Q2MA 3PJ8A 3UC3A 2C6TA 1W98A 5DEWA 2C6MA 5EK7A 2RF9A 5KUPA 4IXPA 1IRKA 5BQ0A 2BDFA 4BHZA 4D4RA 1JQHA 2HYYA 1V1KA 4B4LA 3OXTA 2BILB 2IN6A 3WZEA 3ZOSA 2A27A 4DH3A 3NW7A 3GB2A 2J7TA 4XBUA 1PXNA 4J71A 2GNJA 3HX4A 3EQIA 4A4OA 3OWKA 4WG4A 5J8IA 5CALA 3PG1A 4IX3A 3D2KA 3FJQE 5L8JA 4IHPA 4DEBA 4EOMA 5AV4A 1ZARA 1TQIA 4MWIA 4AQCA 3Q2JA 5L2QA 4M13A 2HXLA 5I3RA 1OL5A 5HNIX 1M2QA 3MFTA 2Y4PA 4J8MA 4FKTA 4RIXB 2Z60A 3Q04A 5LCKA 5M55A 1QCFA 4U97A 4NIFA 2G2FA 5HVKA 1OUKA 3EKKA 3IGGA 4YZDA 2HZ4A 3E92A 4QO9A 4IDTA 1QL6A 1WVYA 2OICA 2W7XA 3LFCA 3L8PA 1NVQA 3BKBA 3ZUUA 5HBJA 3FY0A 3R63A 3O51A 4ZY4A 2QVSE 1R1WA 5H9BA 3SLSA 4ALUA 3FLQA 3KMUA 4IWOA 1ERKA 1UWHA 3DZQA 4CFWA 1O9UA 5A4EA 2UZNA 2R5TA 2BZIB 3E8DA 4L46A 5FD2A 4HCUA 1UKHA 3LFNA 4AU8A 1S9IA 4AGWA 2R3IA 1J3HA 4GV1A 3ATTA 2WTKC 3FZTA 3KMMA 3TNHA 4BDDA 2PUPA 3D15A 5FQDC 3TZ8A 2BIKB 3TNWA 3ITZA 4ZY6A 3D7ZA 3DBDA 3QQJA 2WNTA 3FMLA 4BTKA 5LARA 4HGSA 1GZ8A 4N57A 3UOJA 4M14A 4TWNA 2X7FA 4WNPA 2XIRA 3CIKA 3QCQA 4AS0A 3PA5A 3MVJA 1TQPA 2QOKA 3LXPA 5L6WL 2OF4A 2X8IA 3C0GA 3RPVA 1G5SA 2HY0A 3KKVA 5AP6A 3D5VA 2BZHB 2YFXA 5FEQA 5CEMA 3FXWA 4O96A 5AX3A 1NT2A 5M09A 4FT9A 4F9CA 3QUEA 2IO6A 3Q96A 3C4ZA 4TTHB 1XH9A 4GU9A 4Q9SA 1OIRA 3F61A 4CKIA 3FMNA 3QX2A 3R02A 3KCKA 1GNGA 3I6WA 4FV2A 4EBVA 3I5ZA 3VHKA 2WMTA 3C51A 4UX9A 2HXQA 3KF4A 3WBLA 3RINA 3Q6UA 4APPA 2W1IA 3Q6WA 4M67A 4CG8A 4ONAA 4QP4A 4A9RA 2G2IA 2V22A 2DWBA 4Y8DA 5CU4A 2WMVA 4X6RA 4M8TA 1WCCA 2PE0A 1OL6A 3CJFA 3FZOA 3QQFA 4FKPA 4AW2A 3BWJA 2X81A 1QPCA 4JT3A 4KIQA 2O0UA 5HO8A 3RPYA 2ITVA 3UIXA 3RAIA 1Q41A 3NYXA 5KMLA 3ANQA 4EHEA 3LFAA 4ZS0A 3LQ5A 5AAGA 3R9OA 5IUGA 3MS9A 4KINA 4XP2A 4BCNA 3LCOA 5CEKA 3I81A 1RE8A 3QUPA 2O3PA 3KGAA 2JAMA 2PL0A 3E87A 3A7IA 5C8MA 5IF1A 1MQBA 4RX8A 4FTKA 3L8XA 3KQ7A 2Y4IB 3QFVA 2IW8A 4CV9A 2IVSA 3UMWA 5DR9A 5LXMA 2GTNA 2IZUA 4C59A 4PNIA 4PPAA 3R7OA 2VO6A 4D1SA 3G5DA 3O2MA 5EHYA 5DN3A 4JLCA 4TNBA 4O7TA 4G6NA 5G6VA 2ZJWA 5EHOA 3VUIA 4IAIA 4DEGA 5DT4A 2XCKA 2E9NA 5AR3A 3HDMA 3HRFA 4M97A 4ZTMA 5JQ8A 2ZM1A 4FKRA 2WMQA 5HG7A 4FV5A 1LR4A 4O91A 1KWPA 2Q83A 3UODA 4FG8A 4EC9A 3P08A 5DT0A 4O0VA 4A7CA 4M3QA 3R8VA 3PPKA 4FICA 3D94A 3LXLA 3ULIA 1E9HA 5J9LA 3QGYA 4FTRA 3TL8A 3VUMA 3A2CA 3E8NA 3NUNA 4LV5A 3EFWA 5AADA 3GXLA 1IA9A 2F9GA 2ITZA 3QQKA 3R8PA 5CNOA 2Z02A 3TZ9A 3QZFA 3FI2A 3UVPA 4R5SA 4JXFA 1OIQA 3SG9A 3FLWA 5CANA 5M07A 2WQMA 2RFDA 4EOQA 3BX5A 4DFUA 3D4QA 4DFXE 4E26A 4YTIA 4QMPA 2PWLA 2X2MA 1J7LA 3F7ZA 3EQPA 2YHVA 3KB7A 1BL7A 3HMOA 4XOZA 3QQGA 5F20A 4D4VA 1J7IA 4OTHA 3AT4A 5CVHA 4RZWA 2CCHA 2WTIA 3VJOA 5LMKA 2J0LA 3B8QA 4BI0A 4D9TA 4E5AX 2ZMDA 5GNKA 2CKOA 3GCPA 2P33A 2R3JA 3C9WA 1FOTA 1GZKA 2E9VA 2WOTA 4KD1A 4XLVA 2X6EA 5D9HA 4MXZA 3C13A 2UW6A 3K2LA 3UOLA 4PTEA 4MNEA 4LYNA 4C8BA 1OIYA 1YWVA 2BTRA 4BI2A 2O2UA 3HDNA 3R7VA 1OM1A 3BZ3A 5KCVA 4LRMA 5KKRC 4YSJA 3ZSIA 5IQAA 1CSNA 3EQFA 2QOFA 4GW8A 5HVYA 4G1WA 3HKOA 4EWQA 5KBQA 3OXZA 4QP3A 3W1FA 4D55A 2VTNA 1NW1A 5DA3A 4J53A 2BHEA 5HIBA 3LHJA 5HLNA 5K5NA 2O63A 4E20A 4C4EA 3E3BX 2JKQA 2PMLX 2ITYA 2R2PA 5HD4A 4F6WA 4JBVA 2FSLX 1H1QA 4G5PA 3WZDA 3CPCA 2YIRA 3LMGA 4I94A 1U5QA 3OBGA 4XBRA 3NUXA 3VW6A 3UQFA 4XHKB 4GYIA 4RWJA 1V0PA 1P5EA 2PVLA 3SXSA 4U80A 2W1EA 4W4VA 5E8VA 2VWVA 4IACA 4YJRA 2SRCA 2X8DA 1H00A 5HCZA 4KWPA 3Q4CA 4E6AA 5AUXA 5JRSA 4YTHA 5BVEA 4LGGA 3QKMA 1U54A 4PMMA 2J0KA 2OJIA 3R73A 4K8AA 5HIDA 3TTIA 1KE5A 3WYXA 4AZVA 4J99A 3MPMA 4EQUA 1PKDA 2H9VA 3ZC6A 3R04A 3Q5IA 5ETIA 2PVHA 2REIA 4KA3A 3TJDA 4NKAA 3WF8A 3PLAE 3TXOA 2XYNA 2C3IB 3VUKA 4LOPA 3SRVB 2A1AB 1R39A 3P7BA 4JVGA 3FSFA 4FV6A 4YTCA 4ALVA 2YM3A 3NCGA 3NR9A 4AZSA 4S33A 4ASDA 4FGRA 1OKYA 3QL8A 2BR1A 5I0BA 1PMUA 4BCFA 3CXWA 4J8NA 5C01A 1OKZA 3R30A 4MXOA 4QTAA 4ZJJA 1I44A 1P4OA 3KEXA 5AR4A 3EJ1A 1WBNA 3CP9A 2JKKA 4QTDA 2H8HA 2QD9A 4BDEA 2PUNA 4N0SA 2B7AA 4FKGA 3CY2A 2XIYA 3A61A 4O6LA 1VZOA 3HEGA 5DWRA 5M4FA 3SDJA 1KOAA 2C6OA 1H0WA 3PJ2A 3PPJA 4XV9A 2GNHA 4LI5A 2XK6A 1NXKA 3MW1A 5CTPA 5KNJA 3N4UA 4O2ZA 4RVMA 4XV3A 5E4HA 3U87A 2YEXA 5HVJA 1AQ1A 2O64A 3EMGA 5IQIA 3UQGA 3D7TA 3V3VA 3VJNA 2FGIA 2UZTA 4DH1A 2XNGA 3TUDA 2WMWA 2H34A 5EI8A 1W0XC 3S3IA 3VUGA 3ZBFA 1KUTA 3TV6A 4FSTA 5DRDA 4HVHA 2QONA 4I41A 4EH3A 5HHWA 3T3VA 2WQOA 3FMMA 4FZFB 3W33A 4OUCA 4KIPA 5FWKK 4HVDA 5HD7A 3ET7A 2CCIA 3S95A 4FV7A 3AGLA 4W4XA 4EKLA 1ZMVA 1S9JA 2QURA 5L2IA 3LFFA 3BGZA 4PY1A 2QC6A 2WD1A 3R7EA 4PNKA 4FTTA 3MDYA 3QX4A 4IDVA 3LFBA 2PMNX 1BMKA 4CVAA 3OW4A 4FT5A 3TCPA 4FEXA 4WKQA 2PVNA 5E92A 4IB3A 4JIKA 5AUYA 3N4VA 4ZMFA 4G9CA 4C61A 1Z9XA 3LXKA 3U9NA 5IEYA 2C6DA 1OB3A 4JBOA 4EOIA 4U79A 2I40A 2YM5A 5CSHA 4EI4A 5JH6A 1ND4A 4PTCA 1WVWA 3PIZA 4DINA 5LVNA 1PF8A 4K2RA 3K3IA 4H36A 3LCKA 3C5UA 5KMIA 3HMNA 5DE2A 3COIA 3SD0A 2XRUA 3PY0A 4QQJA 4DTKA 4Z7HA 1K2PA 5DI1A 3IQ7A 1QPDA 4RJ5A 5F95A 2XK4A 1K3AA 5IEVA 2HZ0A 4IAFA 1P14A 4G6OA 3C4XA 1TKIA 3GQLA 2W5BA 1ZZ2A 2QOHA 2WMBA 2PZRA 3NEWA 3PJCA 5D10A 3ZRKA 2GHLA 5CEPA 4IX6A 4IADA 1YHWA 2CKPA 1RQQA 3KXGA 4JQEA 3RCJA 2J5FA 3CSVA 3PVUA 5KZIA 1YXSA 1FMOE 1ZAOA 2UZLA 3BV2A 3JS2A 4RWLA 4BKYA 2XBJA 4O7NA 3CEKA 4GEOA 1PXLA 2ZB0A 4CYIA 1PRYA 2JKOA 1SNXA 2RIOA 4KS7A 1Q8ZA 3FLZA 1F5QA 2FH9A 4L45A 4N6YA 4AOJA 5E7RA 2VTHA 4GK2A 2WAJA 2YDJA 2C6KA 1UNGA 4G17A 2JGZA 3RAKA 4QNAA 4DEIA 4LMUA 3JR1A 3HUCA 2OWBA 4BL1A 3AMAA 3QXPA 4WNMA 5AA9A 4IVDA 3PWDA 2UVZA 3JVRA 5CWZA 5DR2A 2UZVA 3O96A 4FSZA 4K33A 4BDFA 3EN7A 2R7BA 4FMQA 5IKWA 3TV7A 4I5MA 3SX9A 2R3QA 4HW7A 4RX5A 5HTBA 1X8BA 4AN2A 5BYLA 1SVEA 3QTZA 2XNOA 3BYOA 4QTBA 1IG1A 3FWQA 4O83A 2A0CX 4I0TA 2C3KA 3WF6A 3NSZA 4GT5A 4XEYA 4N6ZA 3SXFA 4ANQA 2XH5A 5HLWA 3ZYAA 2KTYA 4USFA 4YHJA 3U8WA 3MH2A 4C4IA 4IB0A 4G3CA 4MF1A 1V0OA 4CCBA 3E8CA 2XP2A 4RPVA 3QKKA 4YLKA 1Q99A 2XKEA 3LM0A 4CFNA 4FBXA 3E7VA 3S1HA 3RK9A 3WYYA 4ZSGA 1OPKA 4C0TA 4OTDA 2X4FA 3FXZA 3Q32A 3GU8A 2XJ1A 1SZMA 5HX8A 2BFXA 3H0ZA 4CEGA 3ZM9A 5EQEA 3R1YA 4P4CA 3HMPA 5BX0A 3BBTB 1CKIA 4RJ6A 5DNRA 3O23A 5L3AA 3UNJA 3E93A 5AP5A 2YIWA 3OTVA 5CYIA 2CNUA 3HNGA 3UP7A 3R83A 2UVXA 4IE9A 4ZTQA 5DVRA 4MVFA 4NCTA 3ZFXA 3O8PA 4P7EA 4Y5HA 5DG5A 3VBQA 2ONLC 4QP2A 5CASA 1DAYA 4X2NA 4TPTA 4QYGA 3WF9A 3O71A 2W1CA 4BN1A 2WMRA 2CNVA 3P23A 4YJTA 3GU7A 4NM7A 5FLFA 3VS7A 2OIDA 4TWOA 1NVSA 2YABA 4K6ZA 4NTTA 2QKRA 4L8MA 2YZLA 4BBMA 4DYMA 3A7HA 2QLUA 2C6LA 5FTGA 2P55A 1PXPA 2WU7A 2C0OA 3DOGA 3NYOA 4C4FA 1NY3A 4XUFA 2OW3A 2P2IA 2FYSA 3H30A 4EK3A 5JGBA 4J1RA 4JRNA 3EQHA 2R7IA 2QODA 4RIYB 5C27A 3R8UA 3W32A 4CKJA 4FT0A 3MIYA 5I3OA 1VYWA 2VTLA 2VTSA 2R9SA 4P5ZA 4IJPA 4F4PA 3QTRA 4F70A 2VUWA 4FV0A 1AD5A 4KBAA 2VRXA 2P4IA 4CFUA 4FTIA 2EXMA 4NK9A 3DDPA 3HLLA 4KKEA 3FZSA 3ZO2A 5JEBA 3BLRA 4AW0A 4EOJA 4HYHA 3UYSA 2VWXA 3TM0A 2JDOA 4KNBA 3TNQB 3NWWA 4E1ZA 1RJBA 1M7NA 1A9UA 4RLLA 4KIKA 5EKOA 3PA4A 4A9YA 4BCQA 3FBVA 4DH7A 4D5HA 4L7FA 3QCSA 5IQHA 3IW6A 3MFUA 3RZFA 2YITA 1Q61A 4YTFA 3E62A 3BGQA 3QZHA 1OITA 4R6VA 5AP2A 1GAGA 5FDPA 4RJ3A 4AA4A 3BGPA 3RHKA 5EQPA 4C37A 4DLIA 2YJSA 4X7QA 1WBPA 4EJNA 2DS1A 1WFCA 4FIJA 4B8MA 4BIEA 1IR3A 3F5PA 5D11A 3VBYA 3LQ3A 3EIDA 4HPUE 4I24A 4C2VA 1XO2B 4R3RA 5GJDA 4L44A 3L9PA 4ZTNA 5M4CA 1MRVA 3VULA 4QP6A 4F1OA 4LV8A 1W82A 1JOWB 4O0TA 2GPHA 1UNLA 2QHMA 4AG8A 2XIKA 5M57A 2XKCA 2R3HA 2EB3A 4IZ7A 4W9WA 5ETCA 4EKKA 1FBNA 2NPQA 3HV7A 3W8QA 1JNKA 3BRBA 2P3GX 3UC4A 3EFKA 2HZNA 3DAKA 3OW3A 4XX9A 3JXWA 1IEPA 2VWYA 4EZ7A 4ALWA 1Q97A 2CN8A 5A14A 1J91A 3LPBA 4FKUA 3M2WA 4Q2AA 4ZTRA 3FQHA 3OFMA 3ZBXA 4F9BA 3R7IA 3JY9A 2W96B 2QG7A 2W4KA 5CF8A 5FRIA 5FP6A 1BI7A 3UDBA 5J7BA 5LVMA 1BYGA 1O6LA 4E8AA 1YKRA 2BCJA 5IA5A 1L8TA 2OXYA 3RCDA 2Z7LA 2RG5A 4XV1A 5E8UA 3SW7A 1WBSA 2EU9A 3W18A 4EHZA 1BL6A 3MH3A 4JX7A 3TKHA 4MD8E 3PLSA 4YZBA 2YM4A 3IOKA 4YZMA 3VS1A 2W1ZA 4RWKA 3FDNA 3ZLSA 5FEEA 3GCSA 4XP3A 1JSUA 4OTWA 2Y6MA 4MYGA 2GHGA 3VNTA 4EOLA 4FE2A 5E8WA 4D0WA 3C50A 4Q9ZA 1YWRA 3NNVA 3PDTA 2OZAB 3HGKA 3P79A 4ID7A 2R3MA 3QALE 3QRTA 5ANKA 3CD8A 5HG9A 3ZSGA 5JSMA 3BLHA 3ORIA 4F65A 2YZAA 4CQGA 2W1GA 3GCUA 2BIYA 3EOCA 4IH8A 4ITHA 4KBCA 3NUUA 2XM8A 3NZ0A 2XCHA 2XZSA 3DXPA 2LGCA 1Z57A 2XNMA 4O0RA 3CGOA 4LL0A 1KV2A 4BBEA 4GIIA 4V0GB 5EFQA 2F57A 4CRLA 4OAVB 3L1SA 3OTUA 2OH4A 3G90X 3DNDA 2IZRA 4I0RA 4ZXTA 3ORKA 3LM5A 3RM7A 4R3CA 3NNWA 4TN6A 4CFMA 2PULA 3RPSA 4ZZNA 2WO6A 3HVCA 4BRXA 4JQ7A 4Z16A 3TWJA 3FL5A 1H1RA 4JG8A 4H1MA 2W06A 3QKLA 3PXKA 3AXWA 3OS3A 4X3FA 2ZM3A 3B2WA 3C4CA 2EWAA 3TV4A 4L43A 4F99A 4DEDA 4QMSA 1FVVA 4DEHA 3CBLA 5J95A 4AOTA 3D83A 5IMXA 3LMIA 4ZTLA 1H0VA 4WA9A 3NDMA 5DFPA 4C57A 5F9EA 5FP5A 5AP1A 1VR2A 4JR3A 3E3PA 3R9NA 4AACA 2RKUA 4CFXA 2GNIA 1Z5MA 2H6DA 3Q60A 4FI1A 4QYEA 4EOSA 3UQCA 4YU2A 2XJ0A 2FUMA 3H9OA 5IH4A 5KX8A 5ANGA 4OTPA 3C7QA 5BVDA 2WTWA 5E8ZA 2QG5A 5JZJA 4W9XA 2J0IA 4RLKA 4ENYA 4FSQA 2PU8A 4XLIA 5K4IA 1OI9A 3E8EA 3O8UA 2QOCA 4BDIA 3BQCA 2J90A 4OTQA 2HZIA 3CQWA 4QMVA 4L00A 1JKLA 2UZEA 2XKDA 3SQQA 2F49A 3L9NA 3QLFA 4NIFB 4L9IA 4QQCA 3FMJA 3OC1A 3D5WA 4HCVA 3PVGA 5I5ZA 1WAKA 3TI1A 3WF5A 1GZOA 4RIOA 5ETFA 4U43A 4A9TA 5H8EA 2I1MA 3HA8A 4P5QA 2ZOQA 4FOBA 4CYJA 1GOLA 3MESA 2QQ7A 3QUDA 1G8AA 4R1YA 4BGGA 2QO2A 1KE8A 3W2QA 3AD5A 1DM2A 2XBAA 3MV5A 5JMSA 1HOWA 3D14A 3WIGA 4ASXA 1WZYA 4I3ZA 3KXNA 5H8GA 1LEWA 2BTSA 1Q62A 2E9OA 4BDJA 3FI8A 4WUNA 3EQRA 2X9FA 3W16A 3E64A 2W5AA 4DA5A 2ITWA 2VO3A 3D5XA 5FTQA 3V8WA 5TF9A 4E5WA 3GI3A 3DQXA 3SGCA 3BHYA 3EQDA 3RM6A 1UU3A 5CENA 4BZDA 4DFLA 4QQTA 4ZSJA 2JDTA 4PP9A 3V04A 3V5QA 5AV2A 2NP8A 4EH6A 4H05A 4NUSA 3DNEA 4QOXA 3BYVA 4LGDA 5E8TA 3RTPA 3C5IA 1CMKE 3MFRA 1WMKA 2VWWA 3B2TA 3IO7A 4PF4A 2BKKA 3R1SA 4BKZA 3N4TA 4IM0A 2YLEA 4I22A 3GU6A 4CZUA 5AV0A 5CAQA 5IH5A 1Q8TA 3WE8A 3QHRA 3ORPA 4F0GA 3NUYA 3PE1A 4G3FA 2UW3A 3ETAA 2J9MA 4GYGA 2Y4IC 3QCYA 5A4QA 4I6FA 2VTTA 3MH1A 4NZWB 4CLIA 2VN9A 2Z8CA 3KY2A 3O8TA 4NFNA 3AT3A 4RWIA 4CRSA 5LMKC 4R3PA 4PDOA 3W2RA 5CU2A 2VTAA 4XS2A 2B9FA 3OY1A 4MEDA 2W9ZB 3VF9A 3ACKA 1JAMA 4OBOA 5HO7A 4NJDA 5J9ZA 3VIDA 3HMIA 2WTVA 4WD5A 4O0UA 2R3LA 3OEZA 2V55A 3CQUA 4IJ9A 4S32A 4RRVA 4QYHA 4JL9A 4DFBA 4FL1A 4BDKA 4BI1A 5JRQA 3MWUA 3CKWA 3ZLWA 4FTJA 3UIMA 3BI6A 4JOAA 5LWMA 1U4DA 1OVEA 4DH8A 5ANIA 4IWQA 2Z7SA 5KHWA 2JIVA 2PYWA 1ZLTA 4Z9LA 4GFMA 3GP0A 4K0YA 1M52A 2VTPA 2I6LA 4NM3A 4XG3A 5IDNA 3FMDA 1YXVA 3PPZA 4JBQA 2OIBA 5H3QA 3S2PA 1PYEA 2CDZA 1LP4A 2UW5A 2WMSA 5EW8A 4OBPA 3K54A 5HESA 4EJ7A 4MXCA 4AT3A 1KE9A 1OL7A 4E4XA 1BI8A 2V7OA 4BCIA 3QRJA 2ETMA 2YCFA 3AT2A 4PL3A 4J7BA 3RKBA 2XKFA 2E2BA 4D9UA 4FG7A 4GUEA 4CLJA 4AA0A 4U8ZA 5D1JA 4CG9A 4FT3A 4GK3A 2DYLA 2CSNA 4QMTA 5AUZA 1J7UA 2A4LA 4KABA 5IMEA 3F2NA 3VBXA 2EB2A 3A7FA 5LMBA 3DTCA 5EM8A 4UMPA 3BYMA 5CXHA 4TYHA 3DKFA 3AG9A 3V51A 3P7AA 3QHWA 4I6QA 4DE4A 3Q3BA 1LUFA 2ITQA 3R00A 4GUBA 5KMJA 4FYNA 1OUYA 3ZM4A 2VTRA 3DV3A 4FNYA 4MH7A 2IW9A 2R0IA 3IGOA 2W99B 3POZA 1IA8A 3HV5A 2XEZA 3LJ1A 4USDA 4MWHA 4H1JA 3U55A 2ITNA 3TIYA 3F5XA 5A54A 3F7WA 4DEEA 2C5XA 3QQLA 3R22A 4MNEB 5FXRA 1RDQE 1IAJA 4YJPA 1YOLA 4HVGA 2CLQA 2G01A 4TRLA 1VYZA 3PUPA 2RGPA 4GMYA 4RJ4A 3OUKA 2WFYA 4H58A 4DGGA 4DH5A 4BWKA 3ZSHA 3DK3A 3JY0A 4X3JA 3MN3A 4AA5A 2E9PA 3WE4A 2JC6A 4UWYA 2PVKA 5KBRA 4U9AA 4F6SA 3HA6A 5EM5A 4GG7A 1GIHA 1ZOEA 4I6HA 3U6HA 3GC7A 4AGCA 3BU5A 4EH5A 1XHAA 1OECA 5LVPA 4ZY5A 4TWCA 2HY81 1GJOA 4IC7A 3EL8A 4HGEA 2GHMA 5C4KA 3BQRA 4EORA 1MRYA 2YWPA 4O0WA 4GU6A 4ZAUA 4Y73A 2R0UA 2JDVA 3MPAA 1O6YA 5AUTA 1JKSA 2BMCA 4QMMA 4FGBA 2OF2A 4GSBA 2YJRA 5F94A 4IQ6A 1U54B 4G3DA 2EVAA 4XRLA 4JBPA 3ORXA 3VBVA 3OWLA 5HU3A 5I9VA 4UY9A 4BWPA 3UOKA 3CJGA 5HBEA 3R2BA 2OSCA 3EKNA 2ZYBA 5HQ0A 3MY1A 4HYIA 4D4SA 4GFOA 4ZMEA 3MGYA 2J0JA 4I4EA 2OJ9A 2QHNA 1ZY5A 4E73A 5EYMA 3G6HA 3GQIA 5KHXA 2ZV7A 3KRWA 2BVAA 5EOBA 1U5RA 3DK7A 2YACA 3DB6A 2BRBA 4M66A 4RC4A 3K3JA 2VAGA 2KULA 5FTOA 4L3PA 2PVRA 3WILA 3LIJA 2YAAA 5EM6A 4CZYB 3EQBA 3FI3A 3R1NA 2XA4A 3RP9A 4BBFA 3A62A 3EFLA 3TKIA 5KE0A 4CMUA 5IQEA 2UVYA 2CJMA 2JDRA 1Q3WA 5M4UA 1JSVA 3M11A 3TNPC 3TTJA 3MYGA 4JDHA 1K9AA 1OL2A 5CI7A 4IC8A 4M69A 5B2KA 4CSVA 5GINE 2C5VA 5AEPA 3R8MA 2XRWA 2WEIA 2UZWE 2QOBA 3EN4A 4CFVA 4BDBA 1OBGA 4UEUA 5J1WA 4C36A 4YZNA 2O65A 1JWHA 2XYUA 2C1BA 2XNEA 1ZMUA 5FG8A 3R8ZA 3D7TB 4PMTA 1R78A 4YHTA 2YWVA 3CQEA 2WPAA 3EQCA 2ZDTA 2AYPA 4LMNA 5B0XA 5EQYA 2BAQA 3KCFA 4LOQA 3IPHA 5B2MA 3UG2A 1UNHA 4MHAA 3F69A 3QTWA 5JGDA 4K77A 2R3PA 2UW4A 2ZVAA 3DZOA 3I6UA 4PTGA 5EI6A 3R9RA 4ARKA 3IKAA 2ZMCA 2CN5A 1PYXA 2Y8OA 4BGHA 1FVRA 1T45A 4QMZA 4DGMA 2RFSA 3L9LA 1KE7A 4MK0A 5A4LA 3ZFYA 4EK6A 2CNQA 4KBKA 5CF6A 4QPAA 3CS9A 4DITA 4YUQA 2OXDA 2F2CB 4BTJA 3I79A 5JFXA 5AM6A 2VGOA 4FZAB 2GTMA 2NRYA 3T8OA 3P5KA 5JK3A 2CHLA 1BLXA 1NVRA 2C3LA 2YDIA 3GU4A 3RVGA 4FL3A 2OJJA 1YXTA 3FAAA 4FIIA 3SVVA 3ZU7A 1U46A 3AC8A 3DJ6A 3ELJA 1XBCA 4JS8A 2CGWA 4UWBA 3ZLYA 5IH6A 2W17A 4YZCA 5K5XA 2X7OA 5TR6A 3WIKA 3R0TA 4FV1A 4Y95A 3W2CA 5D7AA 4MXYA 3OCSA 4YC8A 5H8BA 1IASA 4O7ZA 4DF3A 3MA3A 4R8QA 4E93A 2J51A 1UV5A 3Q9ZA 3RWQA 5GZ8A 4JG7A 4IZYA 4CFFA 2QOIA 3IK3A 4OTFA 4LOOA 4FC0A 3SC1A 3NNXA 2VWUA 4QP1A 4QMQA 2OZOA 1P2AA 4FTLA 4YO6A 2B1PA 4XP0A 3TKUA 4BWXA 4C33A 5LOHA 3FQSA 1DS5A 4OTRA 4V05A 3CTQA 4YC6A 4S31A 2PVMA 3T3UA 4RG0A 5ANEA 2ERZE 2ZV9A 3Q4ZA 1GY3A 4DTAA 3VO3A 5BVOA 1YXUA 3C4FA 2JD5A 3FE3A 4FK6A 4XG9A 5IQGA 3UE4A 4LUEA 4C3FA 2OG8A 2P0CA 4R78A 4I6BA 4AN3A 4R1VA 3ZO3A 3BHTA 1B39A 5FBNC 2Z7RA 5GJFA 4TW9A 4DCAA 3FEGA 4XG7A 2W1HA 4R7IA 4ANMA 1ZRZA 1ZXEA 2WQBA 2WTCA 3FHRA 1Y6BA 2R3NA 1FGIA 3MTLA 3MVMA 3OHTA 4ZLOA 2HOGA 1YDTE 4BCMA 4EUUA 3VS0A 3F3VA 3ZUTA 2ITUA 4XG8A 2YM8A 3OY3A 3TUCA 5AUUA 4QMXA 4RX7A 3KK9A 3POOA 4EH9A 2CPKE 2BZJA 4OTIA 3SOCA 4DC2A 4KKHA 2WGJA 5AP7A 5K9IA 1ZZLA 3MJ1A 4IVCA 5IUHA 1GIIA 4TL0A 1H28A 3MBLA 3ODZX 2GFSA 3PY3A 4K11A 4XH6A 4ZSLA 2ZB1A 1H4LA 2AUHA 2P2HA 4QT1A 3R9HA 3V5PA 4YJVA 5CSVA 3T9IA 4AZWA 3LAUA 2G15A 5C4LA 3IOPA 2E9UA 2UV2A 2ETKA 2F4JA 4BKJA 1M2RA 5IA1A 1Q4LA 3AMBA 3Q4TA 4WG3A 4X6QC 4PX6A 2JAVA 2PZ5A 5BYZA 4A4LA 5HI2A 4JDIA 3QZGA 5ACKA 5JQ5A 3Q4UA 3MVLA 2O8YA 3IONA 2GS6A 3DQWA 1QPEA 4HGTA 3ZXTA 3UVQA 4ZSAA 3F6XA 4EOKA 1TQMA 3SG8A 3KRLA 3OWJA 4C62A 3H9RA 3VW8A 4RZVA 3CLYA 3PRIA 3I0QA 2XJ2A 3VS5A 4IVBA 4MAOA 4WSYA 4HVSA 3BEGA 4MD7E 2BRGA 3EL7A 3L8SA 2UZUE 2YCQA 4TNDA 4YBJA 3CGFA 4O0SA 3C4EA 3FYJX 3U4UA 3LLTA 3MB6A 4GS6A 2OO8X 1CDKA 3DKCA 1OPJA 3KN6A 3Q9WA 3WF7A 5C1QB 3O50A 3OCGA 2R64A 2VU3A 2IVTA 3ORMA 4NU1A 4RFYA 5HEZA 1PY5A 1RW8A 3G2FA
chains in the Genus database with same CATH superfamily
2JBOA 3COHA 5CT0A 4EOPA 4F7LA 4JQ8A 4F9WA 3HL7A 4IX4A 1BKXA 5IPJA 5E90A 4IIRA 4AFEA 2C6IA 1SVHA 4F64A 2J50A 4KAOA 4JR7A 4QPSA 4O7LA 1PHKA 2XMYA 3KL8A 3CTHA 5CX9A 3NMUF 4UMQA 1ZY4A 4HGLA 3GENA 4QQ5A 2VO0A 5EYDA 3GC9A 4XOYA 5J87A 3QWKA 3SV0A 4NKSA 4CD0A 3GBZA 3UIUA 3TG1A 2QLQA 2YIQA 4FRFA 2VX0A 3FC2A 5KMMA 4FEWA 4BF2A 4HYUA 1H08A 2YISA 4F0FA 5T3QA 3UMXA 2PVYA 4BCHA 4O7WA 3SA0A 4UMUA 4R77A 2GQSA 4RQKA 3PXFA 4APCA 3KXZA 1Q8UA 4K9YA 4RSSA 2CKQA 3GT8A 4KB8A 2BRHA 4S2ZA 4IAKA 4ZJVA 4EH4A 2JIIA 4GCJA 3V5LA 4HZSA 2G9XA 5AAEA 4UALA 2YN8A 3NYNA 4RVTA 5HICA 3PSCA 4U40A 4KIKB 4TYEA 4JRVA 4R7HA 5LMAA 4U3YA 2WIHA 3UIBA 5HG8A 2BPMA 3D9VA 3DJ5A 3KULA 3FY2A 2BDWA 3I4BA 5AWMA 3CR0A 1ZWSA 3R1QA 2UZBA 4O1PA 3VUDA 2BAJA 2HCKA 3QD4A 4FJVA 2A2AA 5DMZA 4LL5A 3A7JA 2PE1A 3QD3A 4M7IA 4PL5A 4FOCA 3UZPA 3QZIA 5E91A 2W1DA 1YI6A 5DPVA 1YDSE 3ACJA 1BUHA 2Q0BA 4BYIA 3KMWA 3KC3A 2OKRA 4LGHA 4LRJA 3HRCA 2IJMA 3GNIB 4HPTE 3COMA 3FZ1A 5GJGA 1UKIA 3R7YA 4N4SA 2ZAZA 4WO5A 1XWSA 3DDQA 2G2HA 4D2TA 5IDPA 3Q5ZA 4EUTA 1JKTA 4FL2A 3HUBA 4FT7A 4O0XA 1URCA 5FM2A 3GU5A 3Q9XA 4E5BA 4FK3A 5K0KA 2YCRA 4I6LA 1QPJA 1U59A 2ITTA 4B8LA 3V01A 4ACDA 4MXAA 4G16A 3QTQA 4IAAA 4IZ5A 3RGFA 3MA6A 4BCOA 5CSPA 5GIPE 2NO3A 3PWYA 5CQUA 3EN6A 3IW8A 4LG4A 3EZVA 1W83A 4MQ1A 3ZRLA 4ASEA 3DBQA 5GHVA 3A4PA 3W2OA 2B4SB 4CTBA 1YQJA 3E7OA 5AR5A 5HG5A 3GCVA 4PWNA 3LCDA 4M12A 5DR6A 3WZKA 4YR8A 2W05A 4FX3A 5BVNA 4OT6A 5JFSA 4FEUA 4AT5A 3G15A 1Q24A 1DI9A 3ENMA 3JVSA 3HAVA 3QAME 3G0EA 1H24A 2GQRA 5FXSA 3PZEA 3AMYA 5CZHA 4FUXA 3W10A 3ZRMA 1Q5KA 2X0QA 4FZ6A 5FEDA 4MD9E 4DG0E 3FKOA 5EOLA 3GFWA 3GVUA 4B6LA 4ERWA 2RFEA 4ITJA 4I5CA 3UDSA 3KREA 2ETRA 2WMXA 4UYAA 4RQVA 4GJ2A 3ZEWA 1PKGA 4UMRA 3VRZA 3P0MA 5LJJA 2ITPA 4IEBA 4AXCA 2HW7A 3F2RA 2RFNA 4GVAA 4F7JA 3MI9A 4UB7A 1APME 2A19B 2FB8A 4PDPA 4RMZA 2H96A 3UNKA 4DT8A 4FVRA 3UG1A 3UOHA 4O7RA 5EM7A 2W4OA 3LFQA 4U0IA 5DYJA 2AC5A 5HNBA 2X0GA 2VWZA 2YDKA 5HTCA 4F63A 4O0YA 2OJFE 2YIXA 3FC1X 5AIRA 2W4JA 3VONA 4FA2A 4DG3E 4WSQA 3T9TA 4ANOA 4X2JA 4X3FB 4NYEA 5CAVA 3LJ0A 2RG6A 2C4GA 3LXNA 1NA7A 1GIJA 5IEXA 4GH2A 2RSVA 4AUAA 5DBXA 4HNIA 2GCDA 5LVLA 3DXQA 3RK7A 2CGXA 4LM5A 4C58A 1M17A 3UO4A 2LAVA 3WOWA 1UWJA 2B55A 1W7HA 4PPCA 5I4NA 3LCSA 5DGZA 3PVWA 1J1CA 3OG7A 5M51A 5AR8A 2C30A 3ZEPA 4OAUC 4MTAA 4BICA 3AC5A 3R8LA 1XJDA 3D0EA 1L3RE 5K4JA 3BYSA 3WZUA 3NUAA 2ONLA 1A06A 2PE2A 4DAWA 5F4NA 3UJGA 5J5TA 1OPLA 3EYHA 3ORZA 2ESMA 5E9EA 3FMEA 5FDXA 3W0SA 1YHVA 5FXQA 1REJA 4E6DA 4IB1A 4QYFA 3TEIA 2VV9A 3VS2A 3OBJA 2OFUA 5IA0A 1REKA 4L3JA 4WUAA 2OK1A 4TT7A 4UV0A 2EXEA 1HCLA 4AP7A 4E4MA 1XKKA 4C4GA 3GOPA 5HE1A 3MY5A 1OZ1A 4AWIA 3G9NA 3OUNB 3JYAA 3LKMA 5BPYA 3OEFX 4FTQA 2WIPA 4NM0A 5E1EA 2VX3A 2UW7A 3BHUA 4PQNA 4J98A 4BCGA 3I5NA 4CKRA 5A6NA 4AZEA 5EW9A 5EH0A 3DK6A 4GRBA 4IWDA 2C68A 3BELA 3OOGA 3PP0A 3BPRA 3QBNA 4DG2E 1G8SA 3E88A 4JMQA 2UUEA 3R01A 3IECA 5J79A 5DHJA 4EHGA 4IM3A 4WBBB 4CXAA 3QQHA 2RL5A 5C8KA 3S0OA 1WBTA 4JI9A 3ZO1A 5DT3A 3M1SA 2XAMA 2QI8A 4FKIA 2WB8A 4WG5A 4AW1A 4TWPA 4NW6A 3LFSA 3DTWA 2C5NA 2XK7A 4JNWA 1XH4A 4EH7A 3I0OA 2BALA 1XH6A 3BBWA 4XMOA 3AD4A 3FZRA 2ZDUA 4M68A 2VTIA 2Q0NA 3NUSA 3PTGA 4D0XA 3EB0A 3H0YA 3DU8A 4EWHA 3AC2A 3GCQA 4X2KA 4H3BA 3IW5A 3PP1A 4RC3A 3VF8A 5AM7A 5TOZA 3NRMA 3FL4A 3O17A 3QC9A 5IA3A 2C5OA 4UN0C 3W2SA 2PPQA 4IM2A 4P90A 1CKPA 4Z55A 4I5PA 4B99A 4C3RA 1WVXA 1OL1A 3KK8A 5FBOA 4DBNA 2HW6A 5GZAA 4I21A 4ZIMA 1JBPE 2WU6A 2XNBA 2IG7A 3F66A 3N9XA 2XK3A 3KVXA 3V8SA 5EG3A 1KSWA 2QO9A 4ZLZA 5M4IA 3DGKA 4GKIA 4IFCA 5J5SA 1KV1A 1VEBA 5L2WA 2I0VA 2Y7JA 2QOQA 3ZUVA 4WT6A 2CKEA 4L53A 1JSTA 2UZDA 2X4ZA 3P9JA 4M0YA 3ENHA 5HE3A 4RIWA 4F08A 3CE3A 4F9YA 3BEAA 4H3PA 3DT1A 3O7LD 4DGOA 4D2VA 1WBOA 3ZCLA 2VO7A 2XUUA 3LCTA 4ZTHA 4YBKA 1R0PA 4FSWA 5I9XA 3OT8A 2XB7A 4NWMA 2VNYA 2ZV8A 3TN8A 3TNIA 4XV2A 4C35A 3UGCA 3EH9A 1PW2A 4XYFA 4KUJA 5FUTA 2WKMA 4L42A 2JBPA 3PXYA 1T46A 4WRGA 1B38A 3GUBA 5HGIA 3FXXA 4EQMA 4IWPA 3VQUA 2GSFA 3U4WA 1DI8A 1SM2A 3I60A 2OBJA 3DFCB 3QWJA 1YW2A 4I5HA 2X6DA 3FSKA 4O22A 5CU6A 2WZJA 4B9DA 1JKKA 4YSMA 4O4CA 3GC8A 2PK9A 5A3XA 3ZTXA 3D2IA 3FPMA 3EN9A 3DS6A 4BIDA 4JDKA 4YP8A 4BDGA 2BROA 2ZM4A 3PIYA 4FSUA 4YPDA 4FIGA 2VTQA 4TYHB 5ANJA 2PZYA 5BUIA 5IQFA 4FSYA 5BUJA 3LMHA 4FTCA 2XS0A 2J2IB 5CAPA 2BRNA 4YNOA 5HCYA 1XQZA 5HBHA 4ZTSA 1PXMA 1M14A 3U6IA 4OW8A 1O6KA 2B54A 3L9MA 3ZO4A 4G34A 4O7YA 2R3GA 4ENXA 1XBAA 3K5UA 3ZDUA 3GC0A 4MX9A 5M08A 3CY3A 2VWIA 5A9UA 3AOXA 4U41A 3N51A 4FSNA 3R21A 3V6SA 4AAAA 3U6JA 5J1VA 1IAHA 3FLSA 5GZ9A 2B53A 4ZEGA 2O5KA 5BYYA 4FKSA 2IW6A 4IX5A 4RIXA 5HCXA 1PXKA 4FV9A 3BIZA 4ZOGA 1YOMA 1H25A 2GNFA 5KMOA 3A8XA 4TYJA 1F3MC 2PMIA 2WELA 1J1BA 4QMOA 3VAPA 3CCNA 1BX6A 1W8CA 4W4YA 4KKGA 4Q5EA 3EQGA 3K5VA 4I93A 3GEQA 2WMAA 3O0GA 4FZDB 4MNFA 3F82A 4YURA 4DFYA 4FNWA 4YJSA 3PRFA 3RPOA 5IA2A 2FO0A 4A07A 2PUIA 1YRPA 3ZLXA 2UW8A 2QNJA 3ALNA 2C0TA 2X9EA 3R2YA 5DLSA 2HENA 4PV0A 5D41A 4ACMA 1XH7A 4K18A 4CGAA 1MP8A 5BVKA 4ANSA 4YHFA 2C6EA 2I0EA 4YZ9A 3UO5A 5I9WA 5M56A 1JPAA 3S4QA 3ULZA 2VD5A 4AT4A 3NX8A 5CNNA 3EHAA 4E4NA 5CS6A 1E1VA 4JDJA 4I23A 4W4WA 4ACCA 1YWNA 4RX9A 2C47A 1ZOGA 5ANDA 2PVJA 4RFZA 4HZRA 4C4JA 1JVPP 3RZBA 5E8XA 3R6XA 4QMWA 2HAKA 2GS7A 3KA0A 3PJ1A 4PUZA 4EBWA 4GIHA 1YI4A 3OVVA 4RVKA 3AQVA 3R71A 3PY1A 4S34A 4FEQA 4ITIA 4G5JA 4O4EA 5CF4A 4FIEA 4ZZMA 4L7SA 1CKJA 3RAWA 2I0YA 2VZ6A 1PMEA 2WTKB 2QO7A 3QU0A 4NT4A 4A4XA 4D2PA 4EZ5A 4G9RA 4IANA 4N70A 4RJ7A 5CQWA 5DEYA 5AFVA 5AAFA 3EYGA 4OTGA 3PXZA 1XMMA 4QP7A 4CTCA 5L6OA 2GDOA 2QU5A 2BUJA 4FTOA 2YAKA 2FVDA 3KRXA 4BGQA 3ROYA 4G3EA 4FV8A 2YERA 3HRBA 4MCVA 5HOAA 3ZFMA 3E5AA 5TE0A 4QYYA 2PZPA 3JUHA 4GFGA 4OLIA 4M69B 3LOKA 3V5TA 4C38A 4O81A 4PDYA 4AF3A 3PE2A 3NCZA 3RI1A 3HMMA 5HLPA 3ZH8A 3II5A 4ORKA 3VS3A 1Q8WA 3EWHA 3LE6A 3SAYA 5HIEA 1LEZA 3KF7A 3C4WA 3ATSA 4X21A 5IUIA 3TIZA 2R4BA 3H10A 3R7GA 3RK5A 1H07A 4WRSA 1ZYJA 3BE2A 4BFMA 4O38A 4EYJA 2AC3A 3HV4A 4IAZA 3TACA 4E3CA 5KO1A 3GGFA 3OD6X 3PZHA 2FSTX 4I0SA 4ZSEA 4WOVA 3QTSA 4EL9A 4IFGA 5HU9A 5IQBA 2YCSA 3MY0A 1Y8GA 2Z7QA 1V0BA 3DPKA 2J5EA 3R28A 3SHEA 3HYHA 2JLDA 3SOAA 4L3LA 3ORTA 1PJKA 4F0IA 4QRCA 5AV1A 5L2TA 5I9YA 2JIUA 3IDCA 4YPSA 5LQFA 5HE0A 4RGJA 1H27A 4FKJA 4FV4A 5HKMA 1ZYLA 2V5QA 3QLGA 4KSPA 2W5HA 5HE2A 3MSSA 4EH2A 5L8KA 3G51A 3I7CA 2OJGA 5CY3A 4DCEA 2WEVA 4BVUA 3W2PA 4E4LA 2IVVA 3BE9A 3P7CA 4ZLYA 3CC6A 3LJ2A 3MH0A 4Z3VA 1MRUA 3PYYA 2UW0A 3HV3A 4QPMA 2XK9A 4OT5A 4YO4A 4Y85A 4I20A 5C9CA 3BCEA 5DOSA 3ZMMA 3ZXZA 1QMZA 1SNUA 2V0DA 4XCUA 2QCSA 4TY1A 5BMSA 2BFYA 3BV3A 3LQ8A 4D2SA 4FF8A 4Y72A 1PMNA 4GL9A 1SVGA 3ORLA 4C4HA 4NEUA 3C1XA 1XH5A 3DKGA 3EZRA 4X2GA 4AZFA 4D4YA 3TDWA 4WHZA 2ITXA 5CI6A 3MPTA 4FVQA 5ITAA 4E6CA 1H01A 3FPQA 4ACHA 3LW0A 4UWCA 3VHEA 5ICPA 4AGDA 4HYSA 3H9FA 3MTFA 2WTJA 3NPCA 5AR2A 4I1ZA 1ZOHA 3QGWA 3VWAA 4TYIA 4OGRA 3BYUA 5M44A 3UZRA 4HJOA 5I9UA 1G3NA 1UU9A 3DBCA 3DXNA 4JIAA 4CT1A 5HO6A 4QMYA 1ZYSA 1DAWA 2XVDA 4UYNA 1GZNA 4DHJA 4X2FA 4A06A 3TZMA 5AR7A 3PVBA 4JG6A 2QOLA 5BMMA 2QU6A 3PXRA 1FVTA 4XNEA 2X0OA 4FEVA 5EYCA 3DFAA 2X7GA 3O7LB 3OROA 3C0HA 3AC4A 5L2SA 4FIHA 5C03A 1STCE 1Q3DA 4EK5A 5LVOA 2CGVA 4I4FA 2VTMA 3DB8A 3SKCA 5KKRB 2WHBA 3DBEA 4CT2A 4TXCA 2YA9A 3QF9A 4U7ZA 4GG5A 1URWA 4BHNA 3NIEA 5CEIA 5B7VA 4QMLA 2WQEA 4XG6A 3QRUA 3VRYA 1UA2A 5EDQA 3DBFA 5CEOA 3CKXA 4AE6A 4DGNA 3IS5A 4RFMA 4ASZA 1PXIA 4FV3A 4NCTC 4YJQA 1Y91A 4XJ0A 1Q8YA 2XEYA 4QNYA 2R3FA 3QD0A 4U3ZA 3CPBA 3MIAA 3EFJA 3SRVA 3FQEA 3H4JA 3Q53A 4G3GA 4F7NA 4O2PA 5EHLA 2HWPA 3E63A 5DIAA 1OIUA 2HWOA 3DAEA 5F1ZA 2I0HA 2X2KA 1ZMWA 5AP4A 1KOBA 4BTFA 4FG9A 4IAYA 3A8WA 3UP2A 5IISA 1F0QA 5AA8A 5JT2A 3PIXA 2X1NA 3ZONA 5J7HA 1VJYA 3MVHA 3NIZA 2OLCA 2C69A 3LFDA 3VBTA 3AD6A 1KE6A 3OOMA 2JITA 3PA3A 2PY3A 3MFSA 4JJRA 4NW5A 2DQ7X 2IZSA 3GFEA 1PXJA 4U44A 3F3WA 5ETAA 2YLFA 5K0XA 1OKVA 3M42A 3OCBA 2XNPA 3G0FA 3HAMA 3UBDA 3CD3A 5G1XA 4BTMA 4YLLA 4C2WA 3P1AA 3PXQA 3UNZA 1PXOA 3F3ZA 5CSWA 2UW9A 3RJCA 4DHFA 4M0ZA 3W8LA 4ZK5A 4MXXA 3OP5A 3OCTA 4EH8A 3WARA 5J9YA 2R3RA 3IW4A 2FSMX 3QA8A 3KXHA 3SXRA 1MUOA 4V04A 1PMVA 4Y83A 4BDHA 4B0GA 4D28A 4PP7A 2HK5A 4W8DA 2JDSA 3ZS5A 4H3QA 4QMUA 3KRRA 5DH3A 5IQCA 3F88A 5HORA 4GT4A 3ZZEA 3BLAA 1SMHA 2YM7A 4JAJA 5HTIA 4EK8A 5KZ0A 4D1XA 2X0PA 3QA0A 3FI4A 2X8EA 3DKOA 4NFMA 3VQHA 4F7SA 4LUDA 2WXVA 4QTEA 1H26A 2BZKB 3QTUA 4F1MA 5CAUA 1WBVA 2C5YA 1ATPE 1YOJA 4QD6A 3RPRA 4FTAA 5A4CA 2Y0AA 3FUPA 5LWNA 3W0MA 4GT3A 3QYWA 4DGLC 3KRJA 2FA2A 5FM3A 4BYJA 5AJQA 4FIFA 5A4TA 1A48A 3G6GA 4CCUA 4EC8A 4DTBA 2GQGA 4M15A 3G9LX 4ZP5A 4ERKA 2W0JA 4O6EA 1M7QA 4TKSA 3TT0A 3U51A 4RA5A 3LZBA 4J96A 2WQNA 4GJ3A 4R7BA 4XRJA 4WNKA 5AP0A 2JFMA 3F3UA 5CVGA 4CNHA 2VNWA 2PUUA 3PFQA 3BLQA 3KULB 4O1OA 3ERKA 2VGPA 4FYOA 2I7QA 4FNXA 2C1AA 2QOOA 5CVFA 3AKJA 1XH8A 4EEVA 3OF0A 4P2KA 5FGKA 4DFNA 2X39A 3AKKA 2CLXA 2B0QA 4GK4A 2F2UA 5LCJA 3QYZA 5EW3A 4DT9A 2OU7A 1R0EA 3FV8A 5A46A 1YXXA 4FUYA 2XM9A 4OBQA 4BR3A 4O7SA 2B52A 4YJNA 4F6UA 3KVWA 2XIZA 5CU0A 4L6QA 4ANNA 1H8FA 4D58A 4GVJA 4E6QA 4S30A 4YMJA 2BKZA 5BVWA 5IQDA 3IG7A 4NM5A 3Q52A 4EK4A 4KSQA 4D2RA 3OMVA 5L6PA 3G33A 3PJ3A 1H1WA 1VLRA 4AXAA 3F5UA 3FMHA 3KXMA 3L8VA 3QD2B 4FTUA 3UPZA 3FZPA 2F7ZE 4KRDA 4L68A 3BWFA 4DDGA 4QTCA 3A7GA 4EZ3A 4FKLA 3BHHA 3BU3A 1FINA 3FLNC 5AIKA 4J97A 4LQMA 3AC1A 4AOIA 4EHVA 3KN5A 3V8TA 3VS4A 5B2LA 4UZDA 3H3CA 4BCPA 5IG1A 3S00A 3PG3A 5IA4A 5KMNA 2ITOA 4I92A 4C34A 3DLZA 2XK8A 5H2UA 1UVRA 2B9JA 5AMNA 3EN5A 3NAXA 4UBAA 4NL0A 3HP5A 4Q5HA 3KXXA 2X2LA 2EXCX 5E1SA 1P4FA 2WTDA 4DLJA 4FVPA 2Y6OA 1Y57A 3P86A 4RVLA 2VTJA 5E8YA 1FGKA 5E8SA 3ANRA 5TO8A 5HX6A 4K1BA 5TT7A 2VX1A 4FKOA 4U42A 4G6LA 3IW7A 5C26A 1FMKA 2G1TA 2B9HA 4FTMA 4GKHA 3LFEA 3VC4A 3IDPA 5EI2A 3SW4A 5CXZA 4AQKA 4FKVA 4L67A 3QRKA 1B6CB 5DRBA 4BC6A 4KIOA 4TYGA 3NAYA 1H1PA 2GU8A 4DFZE 5JKGA 1WBWA 4O84A 3F5GA 1SYKA 3MJ2A 3QTXA 4O21A 3ID6C 4RA4A 3ZHPC 4BB4A 2PSQA 3I7BA 3UO6A 4FODA 4J52A 3DY7A 4X3FC 1EH4A 4YJUA 4AFJA 4RBLA 2W9FB 4XG4A 5D12A 5JGAA 2B9IA 3B8RA 3RNYA 4M84A 4U6RA 4WBOA 5T6KA 5IU2A 1ST0A 1CTPE 1H1SA 3DAJA 2EUFB 5D7VA 4E7WA 5JFVA 1OMWA 4U5JA 3PSBA 1I09A 2J0MB 4RJ8A 4YJOA 5T68A 3R7UA 3RWPA 3NVMB 2FSOX 4BZOA 3NYVA 3UYTA 2BAKA 1FPUA 3RNIA 5HZNA 1R3CA 4ZJIA 4BZNA 4F09A 5CF5A 3VS6A 4DBXA 3WZJA 1FQ1B 4PPBA 3R9DA 4U81A 3FYKX 4F9AA 1UU7A 4IVAA 3RMFA 4FZ7A 3DA6A 4C3PA 2GNGA 2GS2A 3JPVA 3F2AA 1YDRE 2PZIA 4NSTA 5A6OA 5ACBC 1JLUE 2PHKA 2GMXA 2Z2WA 2V7AA 2HELA 5AP3A 3RHXA 5I9ZA 5EDRA 1YVJA 3F3TA 2IVUA 4HOKA 4ACGA 4D2WA 4IMYA 4USEA 3FKLA 2BHHA 4O82A 2ERKA 1Y6AA 2HIWA 4G2FA 4YGAA 3QXOA 1W84A 4JAIA 4Y5QA 2W1FA 2BRMA 4JX3A 4YLJA 4QMNA 4UMTA 2V62A 3COKA 3W55A 4LRKA 4NJ3A 5AV3A 5CU3A 2Y9QA 4D1ZA 4PRJA 4MBJA 3FLYA 3NW5A 5EDPA 4RIYA 4L52A 3VUHA 5JFWA 3ZDIA 3DLSA 4CMOA 4LFIA 3DJ7A 3NVKI 5CEQA 5EKNA 4BDCA 1OBDA 4II5A 4H39A 3UPXA 3FKNA 4C02A 2C3JA 2QR7A 3OXIA 3QCXA 5HNGA 3TJCA 3A4OX 3TDVA 4EONA 5CZIA 3OWPA 4FSMA 3QTIA 4O4FA 3F9NA 4XG2A 1MQ4A 4KRCA 4PMSA 4FR4A 3REPA 3TZ7A 4IZAA 2XIXA 4L01A 5EYKA 4HCTA 4W8EA 5AUWA 4CZTA 2NNWB 5AX9A 2UZOA 4FKQA 3ZZWA 1M2PA 4MBIA 3HECA 5CLPA 3OZ6A 3THBA 2PVFA 4EQCA 2IPXA 2J4ZA 4ANLA 2VTOA 5L8LA 5BUEA 4UZHA 3MB7A 2XNNA 3ORNA 4RT7A 2WOUA 3DCVA 3NLBA 2F7EE 3VVHA 3V5WA 4QDVA 2OIQA 2R3KA 3ODYX 4BCKA 4R5YA 4MKCA 3U54A 4QDEA 2YIYA 2NRUA 4IBMA 3BHVA 4WNOA 2OH0E 5CAOA 2PMOX 3A99A 3AGMA 4MQ2A 4TZRA 4G31A 4PDSA 4AN9A 4A9UA 4UXQA 4C7TA 3LLAA 2GNLA 4D5KA 3QQUA 4CQEA 3UTOA 2GFCA 3FMKA 4V01A 2OXXA 2J6MA 5AUVA 2IZTA 4QP8A 2CGUA 5JN2A 2VWBA 4FSRA 5JZNA 5K3YA 3PSDA 2OGVA 3ZC5A 3QC4A 1OKWA 2PTKA 4EYMA 3V6RA 3P4KA 3Q9YA 4EOOA 2OFVA 5CT7A 4FKWA 3UVRA 4BCJA 4AX8A 2BDJA 3P78A 4PL4A 4MUQA 3AC3A 2C0IA 3LVPA 3HV6A 4AZTA 1YHSA 2OI4X 4U45A 1CM8A 2WMUA 2XF0A 3CTJA 5M06A 1Y8YA 4Z7GA 4FNZA 4ANBA 1OGUA 4PMPA 3KU2A 3NNUA 4O27B 4DDIA 4WIHA 2JFLA 3BU6A 5IZFA 3VN9A 3I1AA 4BY9E 3V5JA 1HCKA 3HP2A 3ALOA 5CSXA 4O86A 3NGAA 4KS8A 3GOKA 4BDAA 4IW0A 4X0MA 4NTSA 4MBLA 4CV8A 1XBBA 4O7VA 4HVIA 3C0IA 2JEDA 3WI6A 4A9SA 3RBWA 4B7TA 2QR8A 4NH1A 3U9CA 5GIOE 4DN5A 2A98A 4BIBA 2JKMA 1LPUA 3A60A 4YNEA 3IDBA 3RALA 2ACXA 1TVOA 1YI3A 2OZAA 3NUPA 4ZS4A 3RAHA 1AGWA 2XARA 4OR5A 3VBWA 2CMWA 4YC3A 4RIWB 4QP9A 4DEAA 5BVFA 3D5UA 1ZYDA 3TUBA 3NFGB 3QRIA 3FHIA 4HNFA 3NS9A 2DUVA 3HZTA 4FTNA 3KFAA 5C8NA 5M53A 3OT3A 4RC2A 3VUTA 4LDTA 2ZV2A 1XR1A 4MF0A 4J95A 4V0GA 4AGUA 4AW5A 4F1TA 5TKDA 3ROCA 4IB5A 4UXLA 5BNJA 2F7XE 1E1XA 5KMKA 2YM6A 2QKWB 2IWIA 2R3OA 5ANOA 1UU8A 5L4QA 3UZTA 3NW6A 4CMTA 4Y46A 1ZYCA 4ZZOA 3Q2MA 3PJ8A 3UC3A 2C6TA 1W98A 5DEWA 2C6MA 5EK7A 2RF9A 5KUPA 4IXPA 1IRKA 5BQ0A 2BDFA 4BHZA 4D4RA 1JQHA 2HYYA 1V1KA 4B4LA 3OXTA 2BILB 2IN6A 3WZEA 3ZOSA 2A27A 4DH3A 3NW7A 3GB2A 2J7TA 4XBUA 1PXNA 4J71A 2GNJA 3HX4A 3EQIA 4A4OA 3OWKA 4WG4A 5J8IA 5CALA 3PG1A 4IX3A 3D2KA 3FJQE 5L8JA 4IHPA 4DEBA 4EOMA 5AV4A 1ZARA 1TQIA 4MWIA 4AQCA 3Q2JA 5L2QA 4M13A 2HXLA 5I3RA 1OL5A 5HNIX 1M2QA 3MFTA 2Y4PA 4J8MA 4FKTA 4RIXB 2Z60A 3Q04A 5LCKA 5M55A 1QCFA 4U97A 4NIFA 2G2FA 5HVKA 1OUKA 3EKKA 3IGGA 4YZDA 1W2FA 2HZ4A 3E92A 4QO9A 4IDTA 1QL6A 1WVYA 2OICA 2W7XA 3LFCA 3L8PA 1NVQA 3BKBA 3ZUUA 5HBJA 3FY0A 3R63A 3O51A 4ZY4A 2QVSE 1R1WA 5H9BA 3SLSA 4ALUA 3FLQA 3KMUA 4IWOA 1ERKA 1UWHA 3DZQA 4CFWA 1O9UA 5A4EA 2UZNA 2R5TA 2BZIB 3E8DA 4L46A 5FD2A 4HCUA 1UKHA 3LFNA 4AU8A 1S9IA 4AGWA 2R3IA 1J3HA 4GV1A 3ATTA 2WTKC 3FZTA 3KMMA 3TNHA 4BDDA 2PUPA 3D15A 5FQDC 3TZ8A 2BIKB 3TNWA 3ITZA 4ZY6A 3D7ZA 3DBDA 3QQJA 2WNTA 3FMLA 4BTKA 5LARA 4HGSA 1GZ8A 4N57A 3UOJA 4M14A 4TWNA 2X7FA 4WNPA 2XIRA 3CIKA 3QCQA 4AS0A 4DHZA 3PA5A 3MVJA 1TQPA 2QOKA 3LXPA 5L6WL 2OF4A 2X8IA 3C0GA 3RPVA 1G5SA 2HY0A 3KKVA 5AP6A 3D5VA 2BZHB 2YFXA 5FEQA 5CEMA 3FXWA 4O96A 5AX3A 1NT2A 5M09A 4FT9A 4F9CA 3QUEA 2IO6A 3Q96A 3C4ZA 4TTHB 1XH9A 4GU9A 4Q9SA 1OIRA 3F61A 4CKIA 3FMNA 3QX2A 3R02A 3KCKA 1GNGA 3I6WA 4FV2A 4EBVA 3I5ZA