2UZTA

Pka structures of akt, indazole-pyridine inhibitors
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
total genus 111
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uztA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uztA02
3CJFA 1RE8A 5DPVA 5IUIA 4QTAA 3RK9A 3LXLA 3DTCA 5DH3A 3AD5A 2EU9A 4FT0A 4U43A 5AP1A 5A54A 2HXQA 3UE4A 1JWHA 3IPHA 2YABA 4RLLA 4PV0A 2R7BA 3QTXA 1UWJA 4WRSA 1H08A 4GU9A 4LV5A 4EOLA 2O5KA 3D2KA 4BYIA 3F3ZA 4JS8A 5EW3A 1CKPA 3KU2A 3QRJA 3V5TA 3VW8A 5GIOE 3DAJA 3CQEA 1KUTA 3JPVA 2CDZA 2J2IB 2BKKA 4RX7A 3BPRA 4HYIA 2WIPA 4DLJA 2VGPA 4DAWA 3F69A 3FLYA 4YZDA 4ZLZA 4ZK5A 4E8AA 5HVJA 3WZDA 5K0XA 3EOCA 4CZUA 3DKCA 4O0YA 2PZYA 4AW0A 4KS7A 3LW0A 4I93A 4RWIA 4XX9A 4ZSJA 3R73A 3QTIA 1MRUA 3UO6A 2XRUA 3AOXA 3ZRLA 3CJGA 4FIIA 4TYIA 4O2ZA 3JS2A 2XJ2A 3U4UA 4I6BA 2YIQA 4C4HA 2VTJA 4A4OA 2OK1A 4ONAA 3FMDA 2QI8A 3N9XA 1PXIA 4JX7A 2XJ1A 2YIXA 5BYLA 4KS8A 4BY9E 5E8ZA 2V7OA 4NL0A 3DAEA 3TNWA 3KY2A 2VWZA 3IW8A 2X9FA 3R00A 4NM0A 2OXDA 4D2WA 5CAVA 2A4LA 2IZTA 2YIYA 4M0YA 4ERKA 4XUFA 2WMTA 3GBZA 5HLWA 5EI8A 3CPCA 2WMRA 4GVJA 3VS4A 3QRIA 4BCPA 5I3RA 1OIRA 1WBSA 1XQZA 4OUCA 5CAQA 2PVJA 1J1BA 5K9IA 3EIDA 4HOKA 2XK6A 4IX4A 1XKKA 3UO5A 2I0HA 5ETAA 4CG8A 4G17A 4L3LA 4EK5A 2BRBA 3OTVA 4LRJA 5CQUA 2X4FA 3R1YA 4RC4A 4OTDA 3DKOA 3WARA 4IACA 5KMLA 4D2SA 2XNOA 3MW1A 4KINA 4EBVA 4F99A 4DTAA 2G2IA 3D5WA 4GCJA 5EDPA 5D41A 3V51A 4DFNA 3QYWA 3WIKA 4A4LA 3MN3A 3FV8A 4EHVA 4AZTA 2QOQA 3EWHA 3GU8A 4PY1A 5E8YA 3FPQA 3PSCA 3VRZA 4FG9A 4C3FA 4DGNA 4CG9A 5AMNA 5GIPE 3TEIA 4I23A 3TTJA 4DGMA 3N4UA 3P9JA 2YZLA 3DJ5A 3FMEA 4IWOA 3HAMA 3VF8A 4AZFA 4D2TA 2B9FA 4FNZA 3WI6A 3MFUA 4OTWA 2VTIA 3R04A 3HYHA 3UIXA 4ZS0A 3HMMA 2CKOA 3EKKA 3PVGA 2OICA 2C5VA 2W9ZB 1PMEA 4DFZE 2W99B 1VZOA 4BDGA 3V6RA 1AD5A 2YLEA 4RVTA 4EC8A 1ZMWA 2YM7A 4IANA 3PIXA 5E8TA 4C4JA 3ID6C 2PVFA 3KULB 3W2SA 3IW5A 5BVOA 3UP2A 3MFTA 2GSFA 4O22A 1B39A 3WYYA 2QOBA 3AD6A 4GFGA 3ZSIA 3S3IA 3M11A 3FE3A 3VWAA 4F63A 3U6JA 4BWPA 2HXLA 4ZIMA 3PP1A 3OWPA 4NIFA 4QMYA 3UMXA 4FZ6A 5CZIA 3VJNA 2BVAA 2R3MA 5EI2A 2XNGA 3V8WA 3SW7A 3QBNA 4GKIA 3D7TA 5GJDA 3NGAA 4EOIA 3ZFXA 2ITYA 5FBNC 4AS0A 3LCOA 3GCQA 3MWUA 3A7JA 2WTWA 2UW4A 3QZIA 3S00A 2GTNA 4F4PA 1YDRE 2BRHA 5E8SA 4YR8A 3CD8A 3MIAA 5LOHA 5IA0A 4FEXA 3L9PA 1GIIA 3IS5A 2ZDTA 4ZTHA 4R7IA 4JLCA 3TZ8A 4RWKA 5ETIA 5DT3A 4Y72A 3IOPA 3FHIA 5K4IA 2HAKA 4QP7A 2CMWA 2G9XA 2VD5A 3OG7A 4RIWB 5DRBA 4F0IA 4EH8A 1G8AA 4JT3A 4CSVA 3P1AA 2O3PA 1JQHA 5AR5A 4QPSA 4QQ5A 5F9EA 4HCTA 4NM5A 4QMOA 4IWDA 3R8MA 3MY5A 3QL8A 5EYCA 2XM8A 2C47A 4RZWA 4CV9A 4GRBA 3FSKA 3JYAA 3ZSGA 5E8XA 4W9WA 5GJFA 2OZAA 2ERZE 4D1SA 3I6WA 2HYYA 3FY0A 3PJCA 1Q8WA 2BTRA 4YC6A 2BAKA 4LG4A 4TPTA 4BBFA 4DEAA 4ZLYA 5JGDA 4JAIA 3W8QA 5LMKA 2Z02A 2WU7A 5AUVA 3MJ1A 3LQ5A 4AUAA 5TO8A 3F5UA 2QOIA 2ESMA 3FMHA 4JX3A 5CEOA 1UNLA 2GFSA 2VTLA 1QL6A 3LAUA 1Q4LA 3FC1X 4QMXA 4W4VA 3ZO3A 2XIKA 4BC6A 4QMNA 4FTCA 3P86A 5B0XA 1ZOEA 2H8HA 4RJ5A 4X3JA 4QP8A 4FEVA 4O6EA 4XV9A 3SGCA 3AC3A 4Q5EA 1FGIA 3TIZA 2C6EA 2KULA 3KA0A 3OHTA 4ITHA 4O1PA 3THBA 4EUUA 2XIZA 3BGQA 3BYVA 4FV6A 2QOOA 2ONLA 3PZEA 1FPUA 4JR3A 1Y8GA 5JFWA 2BFXA 3BYSA 2QHNA 3FQHA 4J7BA 4FTJA 4DH3A 2VTRA 2YJRA 4GK3A 4ACGA 3RNIA 4BHZA 2OFVA 4YBJA 2X39A 2HENA 3C13A 3KGAA 4GUBA 2E9NA 4ANNA 3E7VA 2WHBA 3VBWA 2YLFA 3TV4A 3QQGA 2WQEA 4O0XA 4PMMA 4CVAA 2YWVA 3QA0A 2H6DA 4U9AA 3HL7A 5ICPA 5IQDA 2HW6A 4GFMA 4L53A 5EW8A 4FKGA 2XKDA 1ZZLA 2UW9A 4PX6A 3UQGA 4CT2A 2B9JA 3L9LA 5HOAA 3OUNB 4BDAA 1LUFA 1GJOA 3HRCA 3RGFA 5IPJA 1XBBA 3Q2JA 4DEHA 4PTCA 2ZM3A 3VNTA 4BIDA 4C0TA 2XB7A 2REIA 3E64A 4CTCA 2X9EA 4QRCA 2BPMA 5GINE 3P79A 1XH7A 2CNVA 4QMLA 4WBBB 1Q61A 2OF2A 4ASDA 4KSPA 5AUYA 5M07A 2FSLX 4FA2A 3SQQA 3OBJA 2ZB0A 3I60A 3TJCA 4R6VA 2X4ZA 3AT3A 3KB7A 5IA4A 3QUDA 5CI7A 4HYUA 2BDJA 5HCXA 3KCKA 4DF3A 4MBLA 4LMNA 4EZ5A 5HG5A 3PXYA 3Q52A 5LVMA 3CGOA 5FDXA 4ANBA 2J50A 3TKUA 5CANA 2WO6A 3IGGA 3D5UA 1OB3A 1YXUA 3UPZA 3BRBA 3NNWA 3EQIA 4DGGA 3FQSA 1KOBA 2OH0E 2EXMA 4YNEA 3FI3A 2FSTX 2RG6A 4IFCA 3R8VA 3TZMA 5JZNA 3VBVA 4AGWA 4QNAA 4BB4A 4BTMA 4D9TA 4JXFA 2Z7RA 4OTGA 2OLCA 3OS3A 2VN9A 3O2MA 4YLJA 4ZMEA 3QKLA 5KCVA 5FTOA 4RIOA 5HNBA 3FI8A 4FK3A 3ULIA 2VO6A 3MB6A 4B0GA 3IDPA 4ZLOA 1YHVA 4Y85A 2ZOQA 2X2KA 3DK6A 4FG8A 4NKSA 1H1WA 4B8MA 4O38A 3RM7A 4DT9A 2VWIA 1S9JA 4A06A 2OKRA 1GNGA 3ETAA 1SNXA 3P78A 3SAYA 4FTRA 2W05A 3UNKA 3F3UA 5HIDA 2C68A 2QHMA 3ZZEA 1QMZA 4FKSA 4PP9A 3PPZA 1E1VA 1W8CA 5DGZA 1JSVA 2WTKC 4LMUA 5H8BA 3LIJA 1KOAA 2B55A 2ZDUA 2WEIA 3KVWA 5H9BA 2CKEA 4BRXA 3BQRA 5D7AA 3FYJX 3AMBA 4M67A 1BLXA 3LCKA 1J7UA 3L8XA 3QX2A 5CF6A 5FP6A 3GP0A 4HCUA 2GNLA 4FTMA 3CXWA 3QQJA 3UC4A 4F9BA 5AA8A 3H0YA 4QMVA 4K9YA 4RA4A 3VS3A 4DEDA 3FLSA 2XIXA 3NPCA 3G6GA 5M55A 4QMQA 5FWKK 5LCJA 4XP3A 5FTGA 3JVRA 4FV7A 5AADA 3FDNA 5M08A 3BHYA 4RC2A 2C6KA 2BZJA 1LP4A 4OBQA 5IH4A 4B7TA 4CFNA 2OJIA 4A4XA 3HV7A 1OZ1A 4IDTA 4X3FB 3SX9A 4L3PA 3VS5A 4FV1A 5LWNA 1IEPA 4FTNA 4IJ9A 2G01A 1CM8A 3VC4A 3C4ZA 3BWFA 2BILB 3LMHA 4TYHA 2YHVA 3I7BA 4RX5A 5FM2A 4C2WA 4IB3A 1V1KA 1YOLA 1UU7A 3LCTA 3ZEPA 4AX8A 3COIA 2KTYA 2UVXA 3DBCA 3F7WA 5AUWA 5HNGA 5BPYA 5CSXA 3EHAA 2XEZA 2C5XA 4XBRA 1BYGA 5HD4A 3DNEA 1BX6A 3NVKI 4PMPA 1APME 3RMFA 4AG8A 3ACJA 3L9NA 5IMEA 1PXLA 4XV2A 2EVAA 2JDTA 3MA6A 3P5KA 4RRVA 4CFUA 2XKEA 4AZEA 2H9VA 2I0EA 4FSTA 1XBAA 2GHMA 4MF0A 2VTNA 4W4YA 2LAVA 4NIFB 4AE6A 3DZOA 1OL2A 1OKZA 2WQBA 3W2PA 4TL0A 5B2LA 5EH0A 4FTOA 2XJ0A 4EKLA 4FVQA 4OTPA 5EG3A 3GC7A 3T9TA 2A2AA 1YOMA 3ELJA 5KBRA 4Q9SA 4F0FA 3LXKA 3R1SA 4I0TA 1XO2B 1YWRA 1LPUA 2JDSA 5IF1A 2O8YA 1YI4A 4L42A 4MNEB 5EYKA 2JKMA 3C5IA 3EYHA 5LJJA 3MY0A 5J79A 4RVLA 1FMKA 4EL9A 4EH9A 5CF4A 3LFDA 1FINA 4DH1A 3HRBA 4E20A 2WGJA 4QTEA 4YTCA 5JZJA 3MDYA 4FV8A 3BHTA 4JG6A 2WOUA 5FEDA 5IQAA 4L44A 1W0XC 3GB2A 4JIKA 4FTIA 3FMJA 4YC8A 4AW5A 4O0RA 3LQ8A 3EQHA 3MI9A 3S2PA 3PG1A 4CTBA 2FVDA 4WG5A 3UVRA 5GNKA 5J95A 3LM0A 3LFFA 4U3YA 3TKIA 4IHPA 5DR6A 4GT4A 3M42A 5FEEA 2R3OA 1SVHA 2J90A 2OJJA 3UZTA 3WBLA 5L4QA 4JVGA 2QC6A 2FSMX 4JL9A 2F9GA 2I1MA 4M0ZA 4ZP5A 3LMIA 2UZWE 2PUUA 4S31A 4OAVB 3MB7A 4F6WA 4BZOA 4C38A 4B4LA 2WQMA 3UNZA 1H01A 1YI6A 4BCNA 4BCKA 4R78A 3C7QA 4QYHA 4FF8A 2VWXA 1VJYA 5CI6A 4FT3A 5IA5A 4L7SA 4V0GB 2W5HA 4Y95A 4JAJA 4X3FC 4AF3A 3I7CA 3O7LD 2VWWA 3TXOA 3UBDA 4J95A 5A9UA 3VHKA 4QP9A 1L3RE 5J1VA 3G90X 3R1QA 2BIKB 3PWYA 4EQCA 2BZIB 3QF9A 4GU6A 3CS9A 4U44A 3KQ7A 4FTUA 3W16A 1OM1A 2CLQA 2UW7A 5E8WA 1I44A 3OROA 1M17A 2PZRA 2QG7A 2J6MA 4I41A 2QODA 4HVHA 1WZYA 4E93A 1WVWA 4RX9A 2Z7SA 5ANGA 4BI1A 1ZYLA 2ZM1A 2Z60A 2C3IB 3PWDA 3VUGA 5FGKA 4FK6A 1GY3A 4G3DA 2CNQA 2ITNA 3BU6A 5DEYA 3NMUF 1I09A 4YURA 5EHLA 1QPJA 2G2HA 4RBLA 4QYEA 2OF4A 2ZVAA 2WMSA 2OH4A 3A99A 3FKNA 2JC6A 3I5ZA 3O23A 3KXNA 3V04A 2ETMA 1OKWA 3ZBXA 4MNFA 4CCUA 2JFLA 1UU9A 5KZIA 5EW9A 4C58A 2Y4PA 1PRYA 3GC0A 2R9SA 3GGFA 4IC7A 4EK3A 3ORTA 4NTSA 4YZMA 5ANOA 3W18A 3TDWA 3PUPA 5T3QA 2YACA 4C7TA 3ZUUA 4HGSA 4NKAA 3ZH8A 4AW1A 1U54A 3SXRA 1DI9A 4BIBA 4IM0A 3SW4A 2B9HA 2DWBA 2Z2WA 2BDFA 4GEOA 2P2HA 5TOZA 4TTHB 2W1EA 2UZLA 4L43A 4L67A 1Q5KA 4FOCA 5FXQA 3UO4A 4J96A 4WG4A 3WF7A 4UXLA 1ZOHA 4E5BA 3E62A 3EFLA 1H25A 4HW7A 1CSNA 4YZBA 4DBXA 4F08A 3DA6A 1O9UA 2E9UA 3SRVB 1BMKA 3R22A 4I0RA 1W82A 3RAHA 2BUJA 4JQEA 3LXNA 4EOSA 2P0CA 5KBQA 4BWKA 3TUBA 1PMUA 3UG1A 1R0PA 2OW3A 3BCEA 2CLXA 3NEWA 4FOBA 3BYMA 4EORA 4BF2A 4XHKB 1XH9A 5DMZA 1M2PA 4DFLA 3FZSA 4LOQA 4DFYA 4AGCA 3DJ6A 2FGIA 2ITXA 2WZJA 2PZIA 2WD1A 4LOPA 2GQRA 4E4NA 3NUPA 3RNYA 3R63A 4F7SA 3DFCB 2PE0A 3GCVA 4FKTA 1H1RA 2J0KA 2JFMA 1DAWA 2NO3A 3UPXA 2B7AA 2P55A 4TN6A 1JKTA 3QHWA 4G1WA 1Q3DA 3IG7A 5DT0A 5H3QA 1TQIA 4QYYA 5CASA 3R9RA 4ZMFA 3U87A 2R4BA 1PW2A 4XG9A 2YISA 3LJ1A 3BEAA 4MD8E 3C0IA 1BI8A 5AV3A 3IW6A 4YSMA 5J87A 3QD2B 3ZHPC 4A07A 3E8NA 2BFYA 1FBNA 1NY3A 4NSTA 4A9RA 2PVNA 5JSMA 2GFCA 2QQ7A 4QP1A 4APCA 4GJ3A 5DWRA 5EDRA 2XK3A 5AP0A 2BROA 2PVHA 4ENXA 4QMSA 3ZU7A 2DQ7X 4MBJA 4XNEA 3FXXA 4K8AA 2RFEA 5LARA 4O2PA 4AWIA 4ACMA 4RVMA 1MQ4A 3POZA 5EKOA 5IDNA 3COKA 4B8LA 5AV0A 2VTSA 4PWNA 2OJGA 3ODZX 4BDFA 2X7GA 2CNUA 4RG0A 4FSWA 4O83A 1E9HA 4AW2A 2V7AA 2W1FA 3P0MA 5AAFA 4BCMA 2ZJWA 2GPHA 4AT3A 4D2PA 4LUDA 5LVPA 4M13A 1JPAA 4CYJA 2IG7A 3RHKA 4FEQA 3CSVA 5AP5A 1JVPP 4JDHA 3ACKA 5DR2A 3G33A 4R1VA 3FAAA 4ZTQA 2VX0A 1V0OA 4MXOA 1MP8A 1YWVA 3S1HA 1OGUA 5C26A 4M15A 3QQHA 3NIEA 2NPQA 3H0ZA 4XG7A 2IN6A 2YM3A 3RKBA 3WZJA 3CD3A 5FXSA 3HV6A 3ZZWA 4YU2A 3GT8A 4K6ZA 4IM3A 2E9PA 3R7IA 4CGAA 4G3CA 3QLGA 2X6DA 4G6OA 3KVXA 2W4KA 4QMUA 4ZTSA 4IWQA 3OCBA 3MIYA 2WTVA 1P14A 1U5RA 4KIOA 5EQPA 4QQJA 1KSWA 2OO8X 2XS0A 2ZYBA 5HX8A 4UMRA 2W1IA 4O6LA 4BCHA 3GU7A 2YCRA 4RPVA 4AP7A 4E3CA 1XH6A 2PMLX 3HV5A 2B53A 4C33A 5FDPA 4MD9E 3BV3A 3V5LA 3NDMA 1VEBA 4ITJA 5EM6A 2WEVA 1PXJA 2RL5A 3E3BX 4NFMA 3R83A 4ANSA 1OL5A 5HBHA 5HI2A 2VWUA 5K4JA 4DINA 3MPTA 4R77A 3D9VA 3QYZA 3LKMA 5I4NA 1CKJA 3IGOA 5FQDC 3DK7A 4QP6A 3NUSA 3R71A 1PXNA 5A14A 4G3GA 4WKQA 5E90A 5K5NA 4I22A 3NNXA 1RJBA 3FWQA 5C4LA 3BHVA 4BN1A 5HTIA 2PUNA 1GIJA 3HV4A 2VTQA 3QTUA 3EN9A 2Z7LA 2PVYA 4LFIA 4LYNA 1DS5A 2PE2A 4LV8A 3O8TA 4N0SA 4FIGA 4YP8A 3TIYA 1XR1A 3RK5A 2JKKA 3FZ1A 4G3EA 1TKIA 4IB1A 3CIKA 1G3NA 2PMOX 3F2AA 4GVAA 5L6WL 3QTQA 4K18A 5HLPA 3VRYA 3FSFA 1XWSA 5HO8A 4IAZA 3ROYA 3UDBA 4I1ZA 2JKOA 5TT7A 5KKRC 3TUCA 3EN4A 3GOPA 4W9XA 5AM6A 1IAJA 5F20A 3FZRA 3ZFYA 4X21A 1ZY4A 4RSSA 2ZB1A 2LGCA 4JG7A 4EOOA 4O7SA 3VN9A 4JBVA 4NCTC 4FUYA 4YJPA 1IR3A 3WYXA 4I5HA 4V04A 5C8MA 3DOGA 4XYFA 4ALWA 2WOTA 1Z57A 5E8VA 4BGHA 4CD0A 4M3QA 1OITA 2ETRA 3NX8A 1JKKA 2WQNA 3F9NA 4PDSA 5FD2A 4QQCA 2X2MA 5J9ZA 2R3RA 4BGGA 2Q0NA 4V01A 3BGZA 1VYZA 3GENA 4XS2A 2W4JA 5L8KA 2VX3A 3POOA 4IVCA 4E4XA 4EK6A 4IZ5A 4IB0A 4E5AX 2OBJA 5L6OA 3FQEA 4Z16A 3NW5A 3G0EA 5AP7A 1YWNA 4FV2A 4GFOA 3QGWA 4K77A 4NH1A 4RIWA 4LQMA 3NR9A 2AC5A 3F66A 5KNJA 3QTSA 3A8XA 1KE8A 3H9FA 5J1WA 1ZLTA 4UV0A 3QA8A 2C30A 4FKVA 2BRNA 4G9RA 1U5QA 3OC1A 2W0JA 3TJDA 4CQGA 5AP2A 5ETFA 5L8LA 1Q8TA 3D0EA 3UQFA 5E1EA 4AT4A 1YHSA 3OP5A 4QMWA 4DTKA 4FTAA 1OIQA 2AYPA 2OIQA 4IX6A 4AZWA 2X7OA 4BTJA 3HVCA 4MCVA 3W8LA 2IVUA 4P7EA 4RGJA 4FTTA 1OVEA 1ZY5A 4S34A 2BDWA 2PVLA 3I0QA 4E6DA 2QNJA 2PYWA 1ND4A 3JY0A 5L2WA 5J7HA 4JNWA 4TYJA 3Q9WA 5JQ8A 2J5FA 4O0TA 5CEIA 3D5VA 3FJQE 1YXSA 4UMPA 4Q5HA 5HVKA 3E8DA 4FEUA 4U5JA 4RJ4A 2R3JA 4H1MA 1GZNA 4H3BA 4XBUA 4XV3A 4QTBA 2Y4IB 2YERA 1M2QA 1YQJA 4C2VA 3G5DA 4EEVA 2QR8A 4CMTA 5DT4A 3K2LA 3QHRA 4IX5A 4NCTA 2Y9QA 4LGHA 5CNOA 3N4TA 3IK3A 2W96B 1OBDA 4D1XA 1H26A 1R3CA 2XNBA 4OAUC 4YLKA 4BZNA 2JDVA 5AUXA 5KMIA 4ZSEA 1PXMA 4PNKA 5CU2A 4O0UA 3DXPA 3CQWA 3A8WA 5IA1A 3BLQA 4N57A 2C5NA 2NRYA 4FIJA 3F5PA 3ZLXA 4EWQA 4EHEA 4WHZA 1URWA 2FO0A 3IECA 2J51A 3CC6A 1GZOA 3MTLA 4FICA 5CZHA 3ZM4A 4Z7GA 4C37A 3G0FA 4D58A 4MAOA 3DDPA 2PUPA 4M66A 3R8UA 3SOAA 4HYSA 3PFQA 4AGDA 4EOJA 2W06A 3DGKA 2WIHA 1Q8UA 3O51A 4FODA 3ZLSA 1XHAA 2ITOA 3FLWA 3CTQA 4EHGA 5AV2A 1WBPA 4YSJA 5EKNA 1Q41A 5DI1A 3C5UA 3NWWA 3R7VA 5HTCA 5ACBC 4I6HA 1FGKA 4PF4A 4U40A 3SD0A 3O71A 1UU8A 3M1SA 3JVSA 3SG8A 1BL7A 3O7LB 5J8IA 4DFXE 4EKKA 1JNKA 4N4SA 2I0VA 2QR7A 2VX1A 1DI8A 1OPJA 2HW7A 3AC2A 4YTHA 4M68A 1KE7A 4RJ3A 3EQBA 3VBYA 3Q5IA 2W1ZA 4PNIA 4YJNA 4ARKA 4O1OA 2HZ0A 2PVKA 5FBOA 4BI2A 2YM5A 2O2UA 3MA3A 4DEIA 3ORXA 3ZSHA 3S0OA 1A06A 2IO6A 3QD3A 5A6OA 2ITZA 3ODYX 4XCUA 4EWHA 3FUPA 4AA4A 5CSVA 3L8SA 3QXPA 4QMTA 5FEQA 4QT1A 3PYYA 2QKRA 4TRLA 3BYUA 2WTJA 4BHNA 1QPCA 4XLVA 4F1OA 2NNWB 2W17A 4O7NA 3D4QA 3CLYA 1ZYDA 3GI3A 3MH1A 4F9YA 3RPYA 1R39A 4CQEA 5JQ5A 5M53A 4OBOA 3BV2A 2JDRA 3DJ7A 3HMOA 2B54A 2VTTA 5CENA 1IASA 1OKYA 4MK0A 2XYUA 4DEBA 3BLRA 2Q83A 2ZV8A 4MHAA 4C8BA 2XH5A 4EC9A 2PWLA 1BUHA 4YO6A 3GVUA 3HMPA 4FTLA 4YLLA 4BDJA 1J91A 4GV1A 4KWPA 4QD6A 4F65A 5C1QB 3COHA 3QCSA 1G8SA 2CGVA 5CEKA 5DVRA 1IAHA 2C6DA 3UYSA 3CKWA 3PJ1A 4E1ZA 4IVDA 5HLNA 3NAYA 5ETCA 4WUAA 2R3GA 3CTHA 3QRTA 4JRNA 3RVGA 4UZDA 2YN8A 2HZNA 4FX3A 5K0KA 3HGKA 3I1AA 4NM7A 5LWMA 2CN8A 2J0LA 5HGIA 4ZZOA 1JOWB 4MWHA 5CU0A 4WD5A 3WZUA 1T45A 4MX9A 5EHOA 1WBTA 4YBKA 1M14A 2VO3A 3UOLA 4ACCA 4HZRA 3ZMMA 3O8UA 3Q32A 3C4XA 3TNQB 5GHVA 5JH6A 5IQHA 4AQCA 4DITA 3ANRA 3PXFA 1REKA 3Q4UA 2XK4A 3O96A 4BI0A 4I6FA 4QMMA 2R3FA 4UMQA 4DA5A 5HBJA 3NCGA 2C6OA 4TWOA 2UZTA 3NS9A 4KKEA 5D11A 3W2CA 4ZOGA 5BUEA 2XP2A 4WIHA 4L7FA 3BBTB 1CKIA 4YNOA 4XG4A 3R9OA 2F2CB 2YIRA 5HIBA 4DEGA 4ZZNA 3U55A 4FT7A 4OLIA 1CDKA 1ZYSA 5AR8A 3AC4A 1H8FA 2JLDA 5AUTA 2VZ6A 3CGFA 3DBQA 4C59A 4Y83A 5A3XA 1IG1A 3HV3A 4W4XA 4EJ7A 3E63A 4ASEA 4M8TA 4F7NA 5AR4A 2YWPA 4ZJVA 3MV5A 5GZAA 2CKPA 3DNDA 3R8PA 3GNIB 4QP2A 3MVHA 3FY2A 3OMVA 3R1NA 4WRGA 5CSPA 1GZKA 1BKXA 2PMIA 5JFXA 3BU5A 4O27B 5JKGA 1CMKE 2H96A 3RCDA 3KF7A 3G9LX 3D94A 3KEXA 5LVLA 5FXRA 3WZEA 3PSBA 5HKMA 1TQMA 5HX6A 3EKNA 4IX3A 2IJMA 3FC2A 3DXQA 4PL3A 4JDJA 3PE2A 5LMAA 2Q0BA 5AP6A 3VUTA 1TVOA 5M57A 1KE9A 3Q9XA 4HCVA 2YA9A 4W8EA 3G9NA 2RIOA 4AAAA 3CY3A 1YW2A 5EM7A 5FP5A 3CR0A 4D2RA 2EXCX 1SZMA 3QZHA 4MXXA 1JLUE 3MFSA 4FZDB 3F3TA 3ZXTA 4DE4A 2CJMA 4OBPA 3LFQA 4EH2A 4UYAA 4AZVA 3T3UA 4FKWA 1GOLA 1H24A 4FG7A 4H1JA 4KIKA 4DH5A 3QZFA 3OUKA 4LRMA 4OTQA 3F88A 4ANOA 4DLIA 4UMUA 3LQ3A 2YAAA 1UKHA 5TF9A 4O7RA 3K3JA 3R9DA 2V22A 3BQCA 4X2NA 3HP5A 4LI5A 3V5WA 4FNXA 5A4CA 3F5XA 1UV5A 4IAAA 1UNHA 3QU0A 4CV8A 4DG0E 1ZRZA 2EB3A 3LFBA 4QPAA 3KMUA 5F94A 4H36A 4PPCA 4ENYA 2VGOA 4LGDA 4ZJJA 4CMUA 3CE3A 4RJ8A 1WMKA 2WU6A 4IW0A 1XH8A 4EK4A 5AUUA 2HZ4A 4J97A 1O6YA 3OBGA 3ET7A 4MWIA 3BX5A 4GG5A 4TWCA 5ANDA 4EYJA 3QQKA 2JGZA 5C01A 4GS6A 2WMQA 4APPA 4F1TA 4HNIA 1ZYJA 1H28A 4HNFA 1AQ1A 3NIZA 3W10A 1OL6A 2OJ9A 3N51A 4PQNA 4FT5A 3QRKA 2R3KA 3SOCA 3ENMA 3GXLA 5CAPA 3U6IA 4C34A 4MQ1A 3RI1A 4FL1A 3PPJA 3Q4TA 2IVSA 1OKVA 2X7FA 2ZM4A 5IMXA 4G6LA 4ZY6A 3R21A 5HCYA 3NYNA 2V5QA 4AA0A 1H1PA 4DC2A 1Q99A 2F4JA 1H1QA 3DV3A 4IZYA 4UXQA 2ZV9A 2VNWA 3HX4A 3V5PA 3JY9A 4ACHA 5KMOA 3SV0A 4C62A 3ALOA 3MH0A 3KXMA 3PY3A 3MY1A 5CVFA 3QWKA 2Z8CA 3LFAA 4NJ3A 4YJRA 5DN3A 2EXEA 5GZ9A 4U6RA 3K3IA 2XVDA 3U51A 5CS6A 4D9UA 3TG1A 2FSOX 2GU8A 4FKUA 4I3ZA 4FKIA 4GJ2A 3IO7A 4JDIA 3WF5A 3QGYA 3C4EA 1H0VA 3BHHA 4U0IA 3M2WA 3V5QA 3C51A 4FTQA 4X0MA 3KK9A 4NJDA 4PPBA 3LFEA 4OTRA 5HU3A 4H58A 3E5AA 4LUEA 1XH5A 3BU3A 3EQFA 2FYSA 2W5AA 1WAKA 5LQFA 2C0OA 2R0UA 4I0SA 3R9NA 4BCQA 4BR3A 4GIHA 5FTQA 3EFWA 4E7WA 2OZOA 4PTEA 1FQ1B 5CWZA 5H2UA 4USEA 3ANQA 2W1HA 5G6VA 3DU8A 4CFMA 4MVFA 3ZBFA 3ZTXA 4AGUA 4EH5A 4RQKA 5H8GA 3Q4CA 4MTAA 4F0GA 4DG3E 2PMNX 5DE2A 2C6TA 3WF6A 5JEBA 2BKZA 4EH7A 4DFBA 5A4LA 5AV1A 2JIUA 5DIAA 4AZSA 5M4CA 4Z55A 5EDQA 5A46A 3P7CA 2GNGA 4M97A 3IDCA 3W2OA 2BRGA 2IWIA 4CLIA 3PZHA 1HOWA 4Z9LA 4WO5A 4GT3A 4Q9ZA 3RTPA 5IEXA 1OIUA 3PLSA 3TL8A 4IZAA 2QU6A 2O64A 2DUVA 3ZDIA 4ZSGA 3ZS5A 4PPAA 3VHEA 4JI9A 2XA4A 1K3AA 4JR7A 4CKRA 5M09A 3MVJA 1V0BA 3DB8A 5I9YA 1O6LA 2UZDA 4AT5A 2JAMA 5EOBA 3NUYA 4L45A 5I9UA 3V5JA 1U4DA 1XH4A 4IDVA 1SMHA 4N6YA 4XP0A 3FMLA 4CCBA 4RWLA 4RIYA 3I5NA 4ERWA 5DNRA 4O86A 1UU3A 4FEWA 3VUMA 3A2CA 3RP9A 3U9CA 1R78A 2DS1A 4BCFA 3TUDA 4RZVA 3DKFA 4D5KA 1Q8YA 4XP2A 5L3AA 2BHEA 2RGPA 4PL4A 2QCSA 1V0PA 3PTGA 3EMGA 4IVBA 1T46A 3F82A 4QP3A 4R7HA 4WT6A 5CX9A 4DN5A 4AOTA 4V0GA 3F2RA 3G15A 2F7EE 2YCQA 3BGPA 5IA3A 1PKGA 4G9CA 3W1FA 3DXNA 4WUNA 5M4FA 3ORPA 4KIKB 2I0YA 3GUBA 4EONA 2YM6A 2HZIA 4WA9A 2R0IA 2B1PA 3MH2A 3TZ9A 4FMQA 3VS2A 3MVLA 3VW6A 5I5ZA 3PP0A 4BCIA 3HUCA 2VV9A 3Q60A 3R7YA 1FVVA 2AC3A 4MXCA 5JGBA 2OU7A 5AM7A 4ZSAA 5IQBA 3ZO2A 4ZAUA 3DAKA 3EJ1A 2WMWA 1J1CA 2Y6OA 4ID7A 1UNGA 4OT6A 4AN9A 5BQ0A 1W7HA 3V3VA 2PE1A 4QYFA 2XBJA 3ZO1A 4EQMA 2ITTA 3RALA 3A62A 4A9SA 2UV2A 4BKJA 3EL8A 2J7TA 1PY5A 4RLKA 2WTDA 5D12A 5IEYA 5HESA 5AAGA 1M2RA 2OI4X 2ZAZA 5CSWA 2QOHA 3H9RA 5CAUA 5FUTA 3FKLA 5IQCA 4ZY4A 4IZ7A 1FVRA 4KBCA 3A60A 1SM2A 5TR6A 4E6AA 4ZJIA 4GK4A 2W7XA 3EN5A 3G2FA 5BVNA 3EQGA 4JBPA 2XK9A 2I6LA 2QD9A 4USFA 5IISA 3GC9A 3H4JA 4H05A 3ORMA 3QCYA 2BMCA 5KKRB 5EQEA 2VO7A 3DB6A 4AU8A 2IVVA 1WVYA 3LE6A 3ZUVA 3FZOA 4G34A 4WSYA 3A4OX 2Y4IC 4AOIA 4L6QA 4EOPA 2BZHB 4BGQA 1KV1A 1OL1A 3QD4A 4NZWB 3EFJA 3UJGA 3RWPA 5BUJA 5C9CA 1ZXEA 5I9WA 4HVSA 1URCA 3EYGA 4L00A 2PY3A 1TQPA 3COMA 3AC8A 3C4FA 3PXZA 2WXVA 4C57A 4R5SA 2HCKA 5HVYA 3ZLYA 2GQGA 3OCTA 3Q2MA 2Y6MA 3PRIA 4CYIA 3OOMA 2XNNA 3LFCA 4U97A 2QG5A 2R64A 4UN0C 5F4NA 3C50A 5M44A 2B52A 3PVBA 1OUKA 4UWCA 1Q97A 3TN8A 3DT1A 3HEGA 4LL5A 1QCFA 1ZMVA 3O50A 3ZLWA 3DQWA 4KD1A 1FOTA 3VQUA 4IFGA 3D14A 4MD7E 4H3PA 2A19B 3F3VA 3U54A 4TXCA 3R02A 3LXPA 5HORA 3Q6WA 4FYNA 2C5YA 2BRMA 2FUMA 2HOGA 4XOZA 5CU6A 5DLSA 1WBWA 3FKOA 4F7JA 4U42A 4J98A 2VU3A 2WAJA 2YEXA 1H0WA 5K3YA 4AFJA 3R7UA 4I5PA 4L3JA 4BCOA 3ORIA 3DK3A 4ANLA 3BWJA 5EYDA 2X8DA 3ORNA 1P4OA 5IKWA 3AXWA 5C4KA 1JKSA 2WMXA 4UZHA 1LR4A 1W84A 2WQOA 3FMMA 3LJ2A 4BFMA 5LMBA 5LVNA 3QTWA 4CZTA 4HVIA 3C4CA 3KN6A 3IW4A 4IWPA 2UZBA 1GIHA 3KRLA 3VUIA 3LOKA 5F95A 1RQQA 2GS7A 3EN7A 4FZFB 5ANEA 1Q3WA 5D9HA 3NYVA 4WNMA 4FSQA 4TY1A 3KMMA 4P5ZA 5L8JA 4IAKA 1OI9A 5CQWA 3VUHA 4ASZA 4GSBA 3BKBA 3NAXA 5KHXA 1JSUA 1U46A 5JGAA 4E6QA 4GL9A 4U80A 4YZNA 5FM3A 3Q3BA 5CXZA 2W5BA 3R6XA 4JJRA 4NWMA 3O8PA 5AX9A 3QXOA 4NK9A 3B2WA 3DS6A 2RF9A 1STCE 1W98A 3FMNA 1WCCA 3IOKA 3FI2A 4TW9A 2R7IA 2BTSA 4FGBA 2XIYA 3SXFA 4NTTA 4MKCA 5D10A 3IDBA 3KRXA 3QAME 1CTPE 4IM2A 4RJ6A 3OW4A 3ZRMA 2P3GX 4CMOA 3OWKA 3P7BA 5J9LA 4C02A 1R0EA 4YHJA 3RBWA 4JOAA 3E8EA 3BELA 1WBVA 2VUWA 2ITQA 2ITWA 2SRCA 2YDJA 2BIYA 4BZDA 1K9AA 4IBMA 5IZFA 4GKHA 3UYTA 4J1RA 4QOXA 2AUHA 5EOLA 3TWJA 3RK7A 2GQSA 4DGLC 4X6RA 5C27A 2GTMA 4PRJA 4XRLA 4Z3VA 2IPXA 4J99A 2QURA 3Q6UA 4D5HA 3C0HA 4UWBA 4BDDA 4IC8A 5IH5A 4BICA 5IQFA 2NP8A 4CFWA 2JITA 4LGGA 4DH8A 3I0OA 2IZUA 4NUSA 2WB8A 3ALNA 4FV0A 4O7YA 3PVUA 4YO4A 4CFXA 3P23A 3UVQA 3U9NA 3I4BA 3ORKA 2ITUA 3SLSA 4BIEA 4O81A 5AAEA 3WF9A 3TNPC 2PU8A 4TKSA 3P4KA 4PL5A 5BVEA 5AEPA 1YHWA 4NM3A 2WMBA 2YM4A 3UZPA 3NW6A 5AR3A 5M4IA 2WKMA 1NVRA 2HK5A 5J5SA 5B2KA 4BTFA 3PDTA 1Y8YA 3HLLA 4U79A 5KMJA 3P08A 3KXHA 3PXQA 3OT8A 2QOFA 3F61A 4XG3A 4AA5A 4X2FA 1ERKA 2BAJA 2B9IA 2XK7A 2YDKA 3QTRA 4EHZA 5I9ZA 2CGXA 2WTIA 3AT4A 4M69B 2X2LA 4N6ZA 3RINA 1JKLA 5DRDA 4C3RA 5H8EA 3NRMA 3OD6X 2HELA 1RDQE 5KZ0A 4R5YA 2XYNA 5CT7A 2OWBA 3O0GA 2XNEA 4ZTNA 4YTIA 4IB5A 4YPSA 3HA6A 3VIDA 1YDTE 2XNPA 5HE0A 5B7VA 2CCHA 1XBCA 3VJOA 3OY3A 1L8TA 2WMVA 5L2SA 2PL0A 3QWJA 1BL6A 4XJ0A 4ZSLA 2G15A 3B8RA 5DOSA 5HHWA 4NEUA 1B38A 1PYEA 4K1BA 4LL0A 4QMPA 4AE9A 4BYJA 4EH4A 1NXKA 4OTFA 3OXTA 3TV6A 3W2QA 2PTKA 2XK8A 1YXVA 5CVGA 3OY1A 3UZRA 3R2BA 5CNNA 2CKQA 5HG8A 1ZMUA 4R8QA 2IVTA 5IEVA 3MVMA 2YFXA 4KSQA 4O91A 3LHJA 4WG3A 3Q4ZA 4RQVA 4FBXA 2I7QA 3UNJA 4BDKA 4FIEA 3VQHA 1RW8A 4J8MA 3NNVA 4M12A 5KHWA 3A7FA 2UVZA 3EN6A 2CPKE 4KA3A 3ROCA 3GU4A 4F7LA 3AT2A 3D5XA 1Q62A 4Y8DA 4EOMA 2QO9A 4FV9A 3KKVA 1U54B 2YDIA 3KC3A 3FL4A 2FA2A 3C1XA 1KE6A 4EYMA 2A0CX 3DBEA 5AIRA 2XKCA 1WFCA 3FL5A 1Y6BA 2GDOA 1OUYA 4YJVA 5DG5A 5DR9A 3V8SA 3ZCLA 4IVAA 4OTIA 4DGOA 4RIYB 1OL7A 2WPAA 3FBVA 4GT5A 3ZOSA 4D55A 4F1MA 3UQCA 1YXTA 3DDQA 3UOHA 5AA9A 4FIHA 1MRYA 5DEWA 3H9OA 4YZCA 2QOCA 2BCJA 2YM8A 3W55A 2C6IA 4BDBA 3LLAA 2R3IA 2XNMA 1H07A 1U59A 5CAOA 3U8WA 3TNIA 3ZRKA 3NCZA 5CEPA 4KKHA 5JRSA 5B2MA 4G3FA 2UZVA 4BDCA 4CLJA 5ITAA 3VS6A 5CU4A 4CXAA 1Q24A 4UWYA 3QTZA 4XMOA 4A9UA 5IQIA 3KK8A 4O7ZA 1WBOA 3H10A 2QO7A 4FSUA 4M7IA 1HCKA 3MSSA 5TKDA 4AXAA 4U7ZA 4C36A 4ZTMA 4EK8A 1ZOGA 5KE0A 4XRJA 4O96A 2ERKA 3R0TA 4IADA 4DT8A 3W33A 4BKZA 4FKJA 4CKIA 4A9TA 1IA9A 1KWPA 1R1WA 2C3KA 3LCSA 4Y5QA 4EUTA 3S95A 2JDOA 4AFEA 3ENHA 4EZ3A 2R3QA 4HZSA 1M7NA 5JFVA 3AQVA 4RFMA 1FVTA 5HD7A 4KAOA 3DZQA 4QTDA 3L9MA 2P2IA 3R30A 3E88A 2C69A 3QX4A 3IONA 4DG2E 3PJ2A 5FLFA 4K11A 3QKMA 3EH9A 5CEMA 5AJQA 2DYLA 2WNTA 1M52A 3PJ3A 2OSCA 4Q2AA 4FSYA 3GC8A 4EZ7A 4KIQA 2JAVA 1SNUA 1ZAOA 2O65A 2ZV2A 2VWVA 3LFNA 3RHXA 3DTWA 5HNIX 2BHHA 3LLTA 5K5XA 4FSZA 2UZEA 3R7EA 3NUUA 5DYJA 4MXZA 3FEGA 3CY2A 4FTKA 4FKOA 4NU1A 5HO6A 1YVJA 4GMYA 4FZAB 2VTHA 2OGVA 3EQRA 5HCZA 4FC0A 2QONA 4XG6A 3OVVA 3CCNA 3HMIA 3QLFA 3VBTA 4YUQA 2XM9A 3OCSA 3RAIA 5KO1A 4H3QA 3WE8A 2VNYA 3L1SA 3DFAA 1Y57A 2HY0A 1PF8A 1NT2A 4ZS4A 2UUEA 4HGLA 3VO3A 3D15A 2VTMA 3OFMA 4IAIA 2WTCA 4FV5A 3QC4A 3BE2A 3QZGA 3F6XA 3SA0A 3PVWA 5A4EA 5EM8A 2J0JA 3GQIA 3K54A 3C9WA 3MJ2A 2J9MA 3VUKA 3PA4A 4WNOA 2QLQA 1O6KA 4S2ZA 3VULA 3AD4A 2HWPA 3ZUTA 1GZ8A 5J9YA 3KF4A 3MTFA 3G51A 2HIWA 5ACKA 2XF0A 3DCVA 5LMKC 3RPVA 5JT2A 4DEEA 3ZONA 4XV1A 4D4SA 3NUXA 4QPMA 4MYGA 2X1NA 4PDPA 5AIKA 2XMYA 5AR7A 3RPOA 4U8ZA 4G2FA 4DYMA 3VBQA 5AUZA 1H1SA 3FYKX 3NYXA 4U81A 5IA2A 2E9VA 3GOKA 4L9IA 3Q96A 4AOJA 4F70A 4RIXB 2GNJA 3PXRA 4L8MA 4FGRA 1KE5A 4LM5A 3ZYAA 3VVHA 4I94A 4BDHA 4RFZA 2F7ZE 3UIUA 3EZVA 3BI6A 5HTBA 3QUPA 4GW8A 4UEUA 3RPSA 3JR1A 3KRJA 4FVPA 4CZYB 5HE2A 5IH6A 3ZXZA 2CCIA 3F3WA 3FHRA 1X8BA 4IXPA 4EH6A 1GAGA 2ITPA 3PY1A 4FVRA 3ZDUA 4ASXA 2VRXA 1REJA 4R3CA 2X8EA 4ACDA 2PPQA 1HCLA 1F3MC 1OECA 3GU5A 3R7GA 4HYHA 3MESA 1J3HA 2YAKA 2C1BA 3SG9A 4DCAA 2OG8A 2A27A 2XEYA 4II5A 3H3CA 1NVSA 4W4WA 2JD5A 4G5PA 1PXOA 1H00A 2VWYA 5AP3A 5FRIA 4F6UA 2OFUA 3HRFA 3OWLA 3QD0A 4J8NA 4WBOA 2RFDA 2UVYA 3BBWA 3OCGA 2JBOA 5HBEA 3S4QA 4B99A 4JBQA 3FLQA 2CSNA 3LJ0A 5HE3A 2ITVA 1JBPE 1PHKA 1OBGA 4O7TA 5LCKA 3K5UA 3ORLA 3RCJA 3MS9A 3QC9A 3E8CA 3I81A 3O17A 2QOLA 4FZ7A 4BBMA 4QQTA 1E1XA 1MRVA 2UW3A 5HZNA 4YMJA 4OR5A 5JK3A 2OIDA 5CU3A 3CPBA 4DFUA 3I79A 4KABA 3FZPA 4WNPA 4DHFA 4IJPA 2RG5A 4TYEA 3R2YA 3TM0A 2E9OA 1JSTA 4FSNA 4B9DA 2FB8A 4LRKA 4QYGA 2F2UA 4ZY5A 3RM6A 5CY3A 4YGAA 1F0QA 3PPKA 4YJOA 3AMYA 1SVGA 3TNHA 2CN5A 4X3FA 4RVKA 5DBXA 1ATPE 3MYGA 2IW9A 4L46A 3KRRA 3AG9A 2PZ5A 3ITZA 3OXIA 3R28A 4ALVA 2QOKA 5CALA 4YJQA 4FKQA 3RPRA 2Y8OA 3IQ7A 1SVEA 4HJOA 5HG9A 3PLAE 3E92A 4YJSA 3DBDA 3ZC5A 3BE9A 4W8DA 4I5MA 2XRWA 4FV3A 3JUHA 3UOJA 4L01A 4D28A 2Z7QA 1YRPA 3DQXA 4BL1A 2WFYA 3AC5A 2F7XE 2UZOA 1ZYCA 4F9AA 1G5SA 3OEFX 1QPDA 3MH3A 3OOGA 3Q04A 5C03A 3T3VA 4KBAA 4PMSA 5GZ8A 3FLNC 4TWPA 3A7IA 1H4LA 3DKGA 3E93A 4RMZA 4HGTA 3WIGA 5JMSA 2C0IA 4YZ9A 3R8LA 4MF1A 5I0BA 3HDNA 3G6HA 4GK2A 3LMGA 5AFVA 1OPLA 4MXYA 1NVQA 2PZPA 2F49A 1PKDA 4FKPA 4TT7A 3UVPA 2W4OA 4E4LA 3ZM9A 5CF5A 3DLZA 2EB2A 4OT5A 3TI1A 3VS0A 3U6HA 1AGWA 2W1DA 4U3ZA 5AX3A 4FNWA 4FI1A 5HEZA 4M84A 3SXSA 5EK7A 2XZSA 2CGUA 2GCDA 4C35A 3PG3A 1UKIA 4I92A 4ZZMA 4D4YA 3AGMA 2ZMDA 4S33A 3GCUA 2PVRA 3BIZA 5BVFA 4FIFA 1K2PA 2XKFA 3Q9ZA 4NT4A 3GQLA 3NUAA 1WVXA 2YJSA 3F2NA 3QFVA 5ANIA 5BYZA 4R1YA 3MFRA 4G5JA 4I6QA 3UODA 4KIPA 4TYGA 5L2QA 3L8PA 1PMVA 2JIIA 4F9WA 2RFNA 2JEDA 5EYMA 1W83A 3PIYA 4MNEA 3TT0A 5G1XA 4E5WA 2O63A 2PULA 3UG2A 5J7BA 5L2IA 5D1JA 4A9YA 3A61A 1XJDA 3HZTA 5E4HA 4O0VA 1A48A 2UW0A 1OMWA 4RC3A 4P2KA 3QALE 4JBOA 1P2AA 1NW1A 5F1ZA 3TACA 4AN2A 3HECA 3NW7A 3V6SA 2R3NA 3FXWA 1P4FA 1A9UA 3K5VA 4C4IA 2H34A 2BAQA 4P5QA 3DBFA 3QKKA 2J4ZA 4WOVA 5BUIA 5E92A 4J52A 4KRCA 3UP7A 4D1ZA 3BLHA 4X2KA 4F09A 3NVMB 5D7VA 3FXZA 4TNBA 1IA8A 4BTKA 3TDVA 2ZMCA 4PUZA 4FE2A 3H30A 3KFAA 3AC1A 4Y46A 3EFKA 2G1TA 2QVSE 2C3LA 4IAFA 4BKYA 2IW8A 3ZEWA 4LOOA 3TCPA 3KL8A 5EHYA 3REPA 3UTOA 5BVWA 4DH7A 1OIYA 3NYOA 2P33A 3BHUA 5HG7A 3WILA 2QU5A 5LXMA 3HMNA 4ZXTA 3DPKA 3OWJA 3IW7A 3T8OA 4I24A 4NW5A 3TV7A 4CNHA 1BI7A 4GG7A 3W2RA 4B6LA 2XBAA 3KMWA 4KKGA 4CKJA 4R7BA 2XUUA 1B6CB 1F5QA 3Q9YA 3F5GA 3OT3A 4RWJA 5ANJA 4O0WA 3SVVA 3HUBA 3OW3A 4QMZA 5IQEA 1YXXA 3E7OA 4IEBA 4HVDA 4XOYA 2XCKA 3IKAA 4GYGA 4PDYA 4UYNA 4XH6A 4KBKA 3A7GA 3LCDA 5C8NA 3ZO4A 4HPTE 2W9FB 3KXGA 2UW8A 2VTPA 2XIRA 4OTHA 5CTPA 3KXZA 2G2FA 2WMUA 2X6EA 4CEGA 5E91A 3QCXA 5A4QA 3MGYA 5AR2A 2JBPA 3SKCA 4IIRA 1H27A 4OGRA 4DBNA 4G31A 3GFWA 4K33A 4KNBA 2OXYA 4ANQA 1J7IA 4YHTA 2ONLC 4O7LA 5CYIA 1LEZA 3VAPA 2P4IA 3CBLA 4JG8A 3Q5ZA 5FG8A 3E87A 1Z9XA 1JAMA 3WF8A 1DM2A 3D83A 2J0MB 5CXHA 1UWHA 4L68A 4HVGA 2QO2A 4R3PA 3R7OA 3W32A 2B0QA 3ORZA 5BX0A 5T68A 4E6CA 2UZUE 2J0IA 3D2IA 3ATSA 2WELA 1FMOE 3F7ZA 3KRWA 2R5TA 4Y5HA 4KRDA 4YTFA 3GU6A 2VWBA 3CKXA 5GJGA 4M69A 2C1AA 4R3RA 3P7AA 3PXKA 4UB7A 3SRVA 3EQDA 2X8IA 1Z5MA 4IMYA 4RFYA 5BVDA 4YJTA 1PMNA 4X6QC 3RZBA 4RJ7A 5M4UA 4IE9A 3LZBA 3DLSA 3R01A 5HU9A 4Y73A 1SYKA 4MBIA 3CTJA 4D2VA 1PJKA 2CGWA 5BNJA 5IU2A 4BDEA 5E9EA 4XG8A 3ZC6A 3UGCA 3KULA 4J71A 2R3HA 2R3PA 2YZAA 4KB8A 4USDA 4FL2A 4G6NA 4X2GA 4XLIA 2C0TA 4F9CA 3U4WA 2EWAA 4S32A 4JQ8A 4I4EA 2UW6A 4EI4A 3WOWA 4GYIA 5IG1A 2OXXA 2GNIA 5AP4A 2JKQA 3V01A 5M06A 4XEYA 4FUXA 2PK9A 5KUPA 3TZ7A 3UIMA 2BR1A 5DA3A 5ANKA 3UMWA 4PTGA 2JIVA 3NUNA 4ZTRA 3D7TB 4RX8A 3QRUA 2UZNA 2FH9A 2GHGA 5E8UA 3LFSA 3D7ZA 4X7QA 4O7WA 4BBEA 4D4VA 3B2TA 3SHEA 1Y6AA 1YOJA 2NRUA 1M7QA 2VTAA 3CEKA 3KXXA 4BVUA 3WZKA 5KMMA 3QUEA 3DY7A 4MEDA 2W1CA 3UIBA 3SC1A 3BEGA 3NZ0A 5I9XA 1J7LA 3LM5A 3EB0A 3MBLA 3PA3A 4EOQA 1YI3A 4IQ6A 3ULZA 4X2JA 3BYOA 5IDPA 5AV4A 2OIBA 2YIWA 5A4TA 1VYWA 5JN2A 1WBNA 4D0WA 2F57A 2PSQA 2X0GA 3QQFA 4A7CA 4JQ7A 5C8KA 2C5OA 3VF9A 4OW8A 1PXKA 4EBWA 1DAYA 3BZ3A 3RAWA 4D4RA 4EQUA 3II5A 4P4CA 4BCJA 2Y0AA 3TTIA 3PY0A 4ORKA 4WSQA 5E1SA 2C4GA 2EUFB 2YCFA 1Y91A 5HO7A 5HICA 4I5CA 4FYOA 5CF8A 1UA2A 1ZZ2A 2XCHA 3RZFA 4TWNA 3A7HA 3CQUA 3KCFA 4UBAA 5JRQA 1Q8ZA 4TNDA 4JRVA 4CFVA 2WMAA 3I6UA 2V62A 3NNUA 3RJCA 1PYXA 2RSVA 4IH8A 5KMKA 4YJUA 4RT7A 2PHKA 3PSDA 4BWXA 1KV2A 3OF0A 3QQLA 5BYYA 5BVKA 3HAVA 4QP4A 2VAGA 5IUHA 1QPEA 4TZRA 3VUDA 4HGEA 5JFSA 2V55A 3EZRA 4CRLA 5T6KA 3R8ZA 2Y7JA 4Z7HA 4FKLA 2GMXA 3RWQA 4EOKA 2GHLA 4E4MA 2QLUA 4FT9A 4O21A 2W1GA 1P5EA 5M51A 2J5EA 3MPAA 3QQUA 5L2TA 3C0GA 4O84A 4V05A 4F64A 3HA8A 4JDKA 4UALA 4BDIA 3PA5A 1NA7A 4FNYA 2C6LA 2C3JA 1YKRA 2PVMA 4U45A 3WE4A 4EJNA 2A1AB 4NW6A 4DTBA 3FZTA 3PRFA 3EL7A 2GNFA 4ITIA 4DCEA 4FR4A 3FPMA 4FKRA 4GH2A 4J53A 4N70A 3OTUA 4L52A 2OZAB 4U41A 4F6SA 1OPKA 2VO0A 5J5TA 5IQGA 2E2BA 3QCQA 3L8VA 4O82A 3LPBA 4H39A 3HDMA 3FLZA 4YHFA 2GS6A 2UW5A 2BZKB 5TE0A 3KN5A 3PE1A 4I21A 5HE1A 2PUIA 3LVPA 4IAYA 2HY81 3C4WA 4YPDA 1MUOA 5CSHA 1IRKA 3NLBA 3ATTA 5EFQA 3B8QA 3N4VA 1EH4A 2WTKB 4C3PA 4C4EA 3CP9A 1MQBA 5M56A 3GCSA 4UMTA 4KUJA 5AWMA 4G16A 5IUGA 2B4SB 3VS7A 4K2RA 4JIAA 2IZSA 4S30A 4FV4A 2HWOA 4PMTA 2YITA 4AN3A 5E7RA 3UC3A 4PP7A 2ZV7A 4QNYA 3HP2A 5LVOA 4ANMA 3R9HA 1PXPA 2CHLA 2R3LA 4CRSA 2ETKA 5CT0A 4ZEGA 5KMNA 3PJ8A 2IZRA 4GUEA 3SDJA 2IW6A 4K0YA 3VS1A 3UOKA 4FSRA 1S9IA 1UVRA 3FMKA 1LEWA 5HQ0A 4D0XA 4NFNA 4UX9A 4C61A 4PDOA 2V0DA 5BMMA 4C4GA 3T9IA 3A4PA 1ZWSA 5KX8A 5DHJA 4BCGA 2OJFE 3OEZA 4I4FA 3ERKA 4AACA 3ZFMA 5EM5A 3TKHA 4MXAA 5L6PA 4NYEA 3FI4A 3JXWA 4MQ2A 4RIXA 4E26A 3OXZA 3HKOA 1ZARA 2ACXA 2RFSA 2X81A 5CVHA 5I3OA 4FL3A 3V8TA 3RAKA 4WNKA 4E73A 4M14A 4EH3A 3GEQA 4XG2A 4UY9A 4QTCA 4ALUA 2O0UA 3GCPA 5EQYA 4FSMA 5HIEA 5EI6A 5DFPA 3HNGA 4YC3A 2YCSA 4MH7A 5CLPA 4O0SA 4ZTLA 3VBXA 5CEQA 5I9VA 2QKWB 4I20A 3EQCA 1VR2A 3Q53A 3NSZA 3KREA 3AGLA 4RA5A 2BALA 3GFEA 4O7VA 3OZ6A 3E3PA 4HPUE 4TYHB 2GS2A 2I40A 2RKUA 2C6MA 2GNHA 3MPMA 1YDSE 4CT1A 3EQPA 5BMSA 2R2PA 3PIZA 4P90A 4C4FA 5A6NA 4QO9A 4GIIA 3AMAA 2VTOA 4CFFA
chains in the Genus database with same CATH superfamily
3CJFA 1RE8A 5DPVA 3BL7A 5IUIA 4QTAA 3RK9A 3LXLA 3DTCA 5DH3A 3AD5A 2EU9A 4FT0A 4U43A 5AP1A 5A54A 2HXQA 3UE4A 1JWHA 3IPHA 2YABA 4RLLA 4PV0A 2R7BA 3QTXA 1UWJA 4WRSA 1H08A 4GU9A 4LV5A 4EOLA 2O5KA 3D2KA 4BYIA 3F3ZA 4JS8A 5EW3A 1CKPA 3KU2A 3QRJA 3V5TA 3VW8A 5GIOE 3DAJA 2X0QA 3CQEA 1KUTA 3JPVA 4BJJA 2CDZA 2J2IB 2BKKA 4RX7A 3BPRA 4HYIA 2WIPA 4DLJA 2VGPA 4DAWA 3F69A 3FLYA 4YZDA 4ZLZA 4ZK5A 4E8AA 5HVJA 3WZDA 5K0XA 3EOCA 4CZUA 3DKCA 4O0YA 2PZYA 4AW0A 4KS7A 3LW0A 4I93A 4RWIA 4XX9A 4ZSJA 3R73A 3QTIA 1MRUA 3UO6A 2XRUA 3AOXA 3ZRLA 3CJGA 4FIIA 4TYIA 4O2ZA 3JS2A 2XJ2A 3U4UA 4I6BA 2YIQA 4C4HA 2VTJA 4A4OA 2OK1A 4ONAA 3FMDA 2QI8A 3N9XA 1PXIA 4JX7A 2XJ1A 2YIXA 5BYLA 4KS8A 4BY9E 5E8ZA 2V7OA 4NL0A 3DAEA 3TNWA 3KY2A 2VWZA 3IW8A 2X9FA 3R00A 4NM0A 2OXDA 4D2WA 5CAVA 2A4LA 2IZTA 2YIYA 3W0NA 4M0YA 4ERKA 4XUFA 2WMTA 3GBZA 5HLWA 5EI8A 3CPCA 2WMRA 4GVJA 3VS4A 3QRIA 4BCPA 5I3RA 1OIRA 1WBSA 1XQZA 4OUCA 5CAQA 2PVJA 1J1BA 5K9IA 3EIDA 4HOKA 2XK6A 4IX4A 1XKKA 3UO5A 2I0HA 5ETAA 4CG8A 4G17A 4L3LA 4EK5A 2BRBA 3OTVA 4LRJA 5CQUA 2X4FA 3R1YA 4RC4A 4OTDA 3DKOA 3WARA 4IACA 5KMLA 4D2SA 2XNOA 3MW1A 4KINA 4EBVA 4F99A 4DTAA 2G2IA 3D5WA 4GCJA 5EDPA 5D41A 3V51A 4DFNA 3QYWA 3WIKA 4A4LA 3MN3A 3FV8A 4EHVA 4AZTA 2QOQA 3EWHA 3GU8A 4PY1A 5E8YA 3FPQA 3PSCA 3VRZA 4FG9A 4C3FA 4DGNA 4CG9A 5AMNA 4DHZA 5GIPE 3TEIA 4I23A 3TTJA 4DGMA 3N4UA 3P9JA 2YZLA 3DJ5A 3FMEA 4IWOA 3HAMA 3VF8A 4AZFA 4D2TA 2B9FA 4FNZA 3WI6A 3MFUA 4OTWA 2VTIA 3R04A 3HYHA 3UIXA 4ZS0A 3HMMA 2CKOA 3EKKA 3PVGA 2OICA 2C5VA 2W9ZB 1PMEA 4DFZE 2W99B 1VZOA 4BDGA 3V6RA 1AD5A 2YLEA 4RVTA 4EC8A 1ZMWA 2YM7A 4IANA 3PIXA 5E8TA 4C4JA 3ID6C 2PVFA 3KULB 3W2SA 3IW5A 5BVOA 3UP2A 3MFTA 2GSFA 4O22A 1B39A 3WYYA 2QOBA 3AD6A 4GFGA 3ZSIA 3S3IA 3M11A 3FE3A 3VWAA 4F63A 3U6JA 4BWPA 2HXLA 4ZIMA 3PP1A 3OWPA 4NIFA 4QMYA 3UMXA 4FZ6A 5CZIA 3VJNA 2BVAA 2R3MA 5EI2A 2XNGA 3V8WA 3SW7A 3QBNA 4GKIA 3D7TA 5GJDA 3NGAA 4EOIA 3ZFXA 2ITYA 5FBNC 4AS0A 3LCOA 3GCQA 3MWUA 3A7JA 2WTWA 2UW4A 3QZIA 3S00A 2GTNA 4F4PA 1YDRE 2BRHA 5E8SA 4YR8A 3CD8A 3MIAA 5LOHA 5IA0A 4FEXA 3L9PA 1GIIA 3IS5A 2ZDTA 4ZTHA 4R7IA 4JLCA 3TZ8A 4RWKA 5ETIA 5DT3A 4Y72A 3IOPA 3FHIA 5K4IA 2HAKA 4QP7A 2CMWA 2G9XA 2VD5A 3OG7A 4RIWB 5DRBA 4F0IA 4EH8A 1G8AA 4JT3A 4CSVA 3P1AA 2O3PA 1JQHA 5AR5A 4QPSA 4QQ5A 5F9EA 4HCTA 4NM5A 4QMOA 4IWDA 3R8MA 3MY5A 3QL8A 5EYCA 2XM8A 2C47A 4RZWA 4CV9A 4GRBA 3FSKA 3JYAA 3ZSGA 5E8XA 4W9WA 5GJFA 2OZAA 2ERZE 4D1SA 3I6WA 2HYYA 3FY0A 3PJCA 1Q8WA 2BTRA 4YC6A 2BAKA 4LG4A 4TPTA 4BBFA 4DEAA 4ZLYA 5JGDA 4JAIA 3W8QA 5LMKA 2Z02A 2WU7A 5AUVA 3MJ1A 3LQ5A 4AUAA 5TO8A 3F5UA 2QOIA 2ESMA 3FMHA 4JX3A 5CEOA 1UNLA 2GFSA 2VTLA 1QL6A 3LAUA 1Q4LA 3FC1X 4QMXA 4W4VA 3ZO3A 2XIKA 4BC6A 4QMNA 4FTCA 3P86A 5B0XA 1ZOEA 2H8HA 4RJ5A 4X3JA 4QP8A 4FEVA 4O6EA 4XV9A 3SGCA 3AC3A 4Q5EA 1FGIA 3TIZA 2C6EA 2KULA 3KA0A 3OHTA 4ITHA 4O1PA 3THBA 4EUUA 2XIZA 3BGQA 3BYVA 4O4DA 4FV6A 2QOOA 2ONLA 3PZEA 5J9ZA 1FPUA 4JR3A 1Y8GA 5JFWA 2BFXA 3BYSA 2QHNA 3FQHA 4J7BA 4FTJA 4DH3A 2VTRA 2YJRA 4GK3A 4ACGA 3RNIA 4BHZA 2OFVA 4YBJA 2X39A 2HENA 3C13A 3KGAA 4GUBA 2E9NA 4ANNA 3E7VA 2WHBA 3VBWA 2YLFA 3TV4A 3QQGA 2WQEA 4O0XA 4PMMA 4CVAA 2YWVA 3QA0A 2H6DA 4U9AA 3HL7A 5ICPA 5IQDA 2HW6A 4GFMA 4L53A 5EW8A 4FKGA 2XKDA 1ZZLA 2UW9A 4PX6A 3UQGA 4CT2A 2B9JA 3L9LA 5HOAA 3OUNB 4BDAA 1LUFA 1GJOA 3HRCA 3RGFA 5IPJA 1XBBA 3Q2JA 4DEHA 4PTCA 2ZM3A 3VNTA 4BIDA 4C0TA 2XB7A 2REIA 3E64A 4CTCA 2X9EA 4QRCA 2BPMA 5GINE 3P79A 1XH7A 2CNVA 4QMLA 4WBBB 1Q61A 2OF2A 4ASDA 4KSPA 5AUYA 5M07A 2FSLX 4FA2A 3SQQA 3OBJA 2ZB0A 3I60A 3TJCA 4R6VA 2X4ZA 3AT3A 3KB7A 5IA4A 3QUDA 5CI7A 4HYUA 2BDJA 5HCXA 3KCKA 4DF3A 4MBLA 4LMNA 4EZ5A 5HG5A 3PXYA 3Q52A 5LVMA 3CGOA 5FDXA 4ANBA 2J50A 3TKUA 5CANA 2WO6A 3IGGA 3D5UA 1OB3A 1YXUA 3UPZA 3BRBA 3NNWA 3EQIA 4DGGA 3FQSA 1KOBA 2OH0E 2EXMA 4YNEA 3FI3A 2FSTX 2RG6A 4IFCA 3R8VA 3TZMA 5JZNA 3VBVA 4AGWA 4QNAA 4BB4A 4BTMA 4D9TA 4JXFA 1XMLA 2Z7RA 4OTGA 2OLCA 3OS3A 2VN9A 3O2MA 4YLJA 4ZMEA 3QKLA 5KCVA 5FTOA 4RIOA 5HNBA 3FI8A 4FK3A 3ULIA 2VO6A 3MB6A 4B0GA 3IDPA 4ZLOA 4AXFA 1YHVA 4Y85A 2ZOQA 2X2KA 3DK6A 4FG8A 4NKSA 1H1WA 4B8MA 4O38A 3RM7A 4DT9A 4LDTA 2VWIA 1S9JA 4A06A 2OKRA 1GNGA 3ETAA 1SNXA 3P78A 3SAYA 4FTRA 2W05A 3UNKA 3F3UA 5HIDA 2C68A 2QHMA 3ZZEA 1QMZA 4FKSA 4PP9A 3PPZA 1E1VA 1W8CA 5DGZA 1JSVA 2WTKC 4LMUA 5H8BA 3LIJA 1KOAA 2B55A 2ZDUA 3P5JC 2WEIA 3KVWA 5H9BA 2CKEA 4BRXA 3BQRA 5D7AA 3FYJX 3AMBA 4M67A 1BLXA 3LCKA 1J7UA 3L8XA 3QX2A 5CF6A 5FP6A 3GP0A 4HCUA 2GNLA 4FTMA 3CXWA 3QQJA 3UC4A 4F9BA 5AA8A 3H0YA 4QMVA 4K9YA 4RA4A 3VS3A 4DEDA 3FLSA 2XIXA 3NPCA 3G6GA 5M55A 4QMQA 5FWKK 5LCJA 4XP3A 5FTGA 3JVRA 4FV7A 5AADA 3FDNA 5M08A 3BHYA 4RC2A 4FJVA 2C6KA 2BZJA 1LP4A 4OBQA 5IH4A 4B7TA 4CFNA 2OJIA 4A4XA 3HV7A 1OZ1A 4IDTA 4X3FB 3SX9A 4L3PA 3VS5A 4FV1A 5LWNA 1IEPA 4FTNA 4IJ9A 2G01A 1CM8A 3VC4A 3C4ZA 3BWFA 2BILB 3LMHA 4TYHA 2YHVA 3I7BA 4RX5A 5FM2A 4C2WA 4IB3A 1V1KA 1YOLA 1UU7A 3LCTA 3ZEPA 4AX8A 3COIA 2KTYA 2UVXA 3DBCA 3F7WA 5AUWA 5HNGA 5BPYA 5CSXA 3EHAA 2XEZA 2C5XA 4XBRA 1BYGA 5HD4A 3DNEA 1BX6A 3NVKI 4PMPA 1APME 3RMFA 4AG8A 3ACJA 3L9NA 5IMEA 1PXLA 4XV2A 2EVAA 2JDTA 3MA6A 3P5KA 4RRVA 4CFUA 2XKEA 4AZEA 2H9VA 2I0EA 4FSTA 1XBAA 2GHMA 4MF0A 2VTNA 4W4YA 2LAVA 4NIFB 4AE6A 3DZOA 1OL2A 1OKZA 2WQBA 3W2PA 4TL0A 5B2LA 5EH0A 4FTOA 2XJ0A 4EKLA 4FVQA 4OTPA 1XMMA 5EG3A 3GC7A 3T9TA 2A2AA 1YOMA 3ELJA 5KBRA 4Q9SA 4F0FA 3LXKA 3R1SA 4I0TA 1XO2B 1YWRA 1LPUA 2JDSA 5IF1A 2O8YA 1YI4A 4L42A 4MNEB 5EYKA 2JKMA 3C5IA 3EYHA 5LJJA 3MY0A 5J79A 4RVLA 1FMKA 4EL9A 4EH9A 5CF4A 3LFDA 1FINA 4DH1A 3HRBA 4E20A 2WGJA 4QTEA 4YTCA 5JZJA 3MDYA 4FV8A 3BHTA 4JG6A 2WOUA 5FEDA 5IQAA 4L44A 1W0XC 3GB2A 4JIKA 4FTIA 3FMJA 4YC8A 4AW5A 4O0RA 3LQ8A 3EQHA 3MI9A 3S2PA 3PG1A 4CTBA 2FVDA 4WG5A 3UVRA 5GNKA 5J95A 3LM0A 3LFFA 4U3YA 3TKIA 4IHPA 5DR6A 4GT4A 3M42A 5FEEA 2R3OA 1SVHA 2J90A 2OJJA 3UZTA 3WBLA 5L4QA 4JVGA 2QC6A 2FSMX 4JL9A 2F9GA 2I1MA 4M0ZA 4ZP5A 3LMIA 2UZWE 2PUUA 4S31A 4OAVB 3MB7A 4F6WA 4BZOA 4C38A 4B4LA 2WQMA 3UNZA 1H01A 1YI6A 4BCNA 4BCKA 4R78A 3C7QA 4QYHA 4FF8A 2VWXA 1VJYA 5CI6A 4FT3A 5IA5A 4L7SA 4V0GB 2W5HA 4Y95A 4JAJA 4X3FC 4AF3A 4AAYA 3I7CA 3O7LD 2VWWA 3TXOA 3UBDA 4J95A 5A9UA 3VHKA 4QP9A 1L3RE 4AXDA 5J1VA 3G90X 3R1QA 2BIKB 3PWYA 4EQCA 2BZIB 3QF9A 4GU6A 3CS9A 4U44A 3TMOA 3KQ7A 4FTUA 3W16A 1OM1A 2CLQA 2UW7A 5E8WA 1I44A 3OROA 1M17A 2PZRA 2QG7A 2J6MA 4I41A 2QODA 4HVHA 1WZYA 4E93A 1WVWA 4RX9A 2Z7SA 5ANGA 4BI1A 2NYAA 1ZYLA 2ZM1A 2Z60A 2C3IB 3PWDA 3VUGA 4DDIA 5FGKA 4FK6A 1GY3A 4G3DA 2CNQA 2ITNA 3BU6A 5DEYA 3NMUF 1I09A 4YURA 5EHLA 1QPJA 2G2HA 4RBLA 4QYEA 2OF4A 2ZVAA 2WMSA 2OH4A 3A99A 3FKNA 2JC6A 3I5ZA 3O23A 3KXNA 3V04A 2ETMA 1OKWA 3ZBXA 4MNFA 4CCUA 2JFLA 1UU9A 5KZIA 5EW9A 4C58A 2Y4PA 1PRYA 3GC0A 2R9SA 3GGFA 4IC7A 4EK3A 3ORTA 4NTSA 4YZMA 5ANOA 3W18A 3TDWA 3PUPA 5T3QA 2YACA 4C7TA 3ZUUA 4HGSA 4NKAA 3ZH8A 4AW1A 1U54A 3SXRA 3UDTA 1DI9A 4BIBA 3PUFC 4IM0A 3SW4A 2B9HA 2DWBA 2Z2WA 2BDFA 4GEOA 2P2HA 5TOZA 4TTHB 2W1EA 2UZLA 4L43A 4L67A 1Q5KA 4FOCA 5FXQA 3UO4A 4J96A 4WG4A 3WF7A 4UXLA 1ZOHA 4E5BA 3E62A 3EFLA 1H25A 4HW7A 1CSNA 4YZBA 4DBXA 4F08A 3DA6A 1O9UA 2E9UA 3SRVB 1BMKA 3R22A 4I0RA 1W82A 3RAHA 2BUJA 4JQEA 3LXNA 4EOSA 2P0CA 5KBQA 4BWKA 3TUBA 1PMUA 3UG1A 1R0PA 2OW3A 3BCEA 2CLXA 3NEWA 4FOBA 3BYMA 4EORA 4BF2A 4XHKB 1XH9A 5DMZA 1M2PA 4DFLA 3FZSA 4LOQA 4DFYA 4AGCA 3DJ6A 2FGIA 2ITXA 2WZJA 2PZIA 2WD1A 4LOPA 2GQRA 4E4NA 3NUPA 3RNYA 3R63A 4F7SA 3DFCB 2PE0A 3GCVA 4FKTA 1H1RA 2J0KA 2JFMA 1DAWA 2NO3A 3UPXA 2B7AA 2P55A 4TN6A 1JKTA 3QHWA 4G1WA 1Q3DA 3IG7A 5DT0A 5H3QA 1TQIA 4QYYA 5CASA 3R9RA 4ZMFA 3U87A 2R4BA 1PW2A 4XG9A 2YISA 3LJ1A 3BEAA 4MD8E 3C0IA 1BI8A 5AV3A 3IW6A 4YSMA 5J87A 3QD2B 3ZHPC 4A07A 3E8NA 2BFYA 1FBNA 1NY3A 4NSTA 4A9RA 2PVNA 5JSMA 2GFCA 2QQ7A 4QP1A 4APCA 4GJ3A 5DWRA 5EDRA 2XK3A 5AP0A 2BROA 2PVHA 4ENXA 4QMSA 3ZU7A 2DQ7X 4MBJA 4XNEA 3FXXA 4K8AA 2RFEA 5LARA 4O2PA 4AWIA 4ACMA 4RVMA 1MQ4A 3POZA 5EKOA 5IDNA 3COKA 4B8LA 5AV0A 2VTSA 4PWNA 2OJGA 3ODZX 4BDFA 2X7GA 2CNUA 4RG0A 4FSWA 4O83A 1E9HA 4AW2A 2V7AA 2W1FA 3P0MA 5AAFA 4BCMA 2ZJWA 2GPHA 4AT3A 4D2PA 4LUDA 5LVPA 4M13A 1JPAA 4CYJA 2IG7A 3RHKA 4FEQA 3CSVA 5AP5A 1JVPP 4JDHA 3ACKA 5DR2A 3G33A 4R1VA 3FAAA 4ZTQA 2VX0A 1V0OA 4MXOA 1MP8A 1YWVA 3S1HA 1OGUA 5C26A 4M15A 3KIOC 3QQHA 3NIEA 2NPQA 3H0ZA 4XG7A 2IN6A 2YM3A 3RKBA 3WZJA 3CD3A 5FXSA 3HV6A 3ZZWA 4YU2A 3GT8A 4K6ZA 4IM3A 2E9PA 3R7IA 4CGAA 4G3CA 3QLGA 2X6DA 4G6OA 3KVXA 2W4KA 4QMUA 4ZTSA 4IWQA 3OCBA 3MIYA 2WTVA 1P14A 1U5RA 4KIOA 5EQPA 4QQJA 1KSWA 2OO8X 2XS0A 2ZYBA 5HX8A 4UMRA 2W1IA 4O6LA 4BCHA 3GU7A 2YCRA 4RPVA 4AP7A 4E3CA 1XH6A 2PMLX 3HV5A 2B53A 4C33A 5FDPA 4MD9E 3BV3A 3V5LA 3NDMA 1VEBA 4ITJA 5EM6A 2WEVA 1PXJA 2RL5A 3E3BX 4NFMA 3R83A 4ANSA 1OL5A 5HBHA 5HI2A 2VWUA 5K4JA 4DINA 3MPTA 4R77A 3D9VA 3QYZA 3LKMA 5I4NA 1CKJA 3IGOA 5FQDC 3DK7A 4QP6A 3NUSA 3R71A 1PXNA 5A14A 4G3GA 4WKQA 5E90A 5K5NA 4I22A 3NNXA 1RJBA 3FWQA 5C4LA 3BHVA 4BN1A 5HTIA 2PUNA 1GIJA 3HV4A 2VTQA 3QTUA 3EN9A 2Z7LA 2PVYA 2XALA 4LFIA 4LYNA 1DS5A 2PE2A 4LV8A 3O8TA 4N0SA 4FIGA 4YP8A 3TIYA 1XR1A 3RK5A 2JKKA 3FZ1A 4G3EA 1TKIA 4IB1A 3CIKA 1G3NA 2PMOX 3F2AA 4GVAA 5L6WL 3QTQA 4K18A 5HLPA 3VRYA 3FSFA 1XWSA 5HO8A 4IAZA 3ROYA 3PFYA 3UDBA 4I1ZA 2JKOA 5TT7A 5KKRC 3TUCA 3EN4A 3GOPA 4W9XA 5AM6A 1IAJA 5F20A 3FZRA 3ZFYA 4X21A 1ZY4A 4RSSA 2ZB1A 2LGCA 4JG7A 4EOOA 4O7SA 3VN9A 4JBVA 4NCTC 4FUYA 4YJPA 1IR3A 3WYXA 4I5HA 4V04A 5C8MA 3DOGA 4XYFA 4ALWA 2WOTA 1Z57A 5E8VA 4BGHA 4CD0A 4M3QA 1OITA 2ETRA 3NX8A 1JKKA 2WQNA 3F9NA 2X0PA 4PDSA 4QQCA 2X2MA 5FD2A 2R3RA 4BGGA 2Q0NA 4V01A 3BGZA 1VYZA 3GENA 4XS2A 2W4JA 5L8KA 2VX3A 3POOA 4IVCA 4E4XA 4EK6A 4IZ5A 4IB0A 4E5AX 2OBJA 5L6OA 3FQEA 4Z16A 3NW5A 3G0EA 5AP7A 1YWNA 4FV2A 4GFOA 3QGWA 4K77A 4NH1A 4RIWA 4LQMA 3NR9A 2AC5A 3F66A 5KNJA 3QTSA 3A8XA 1KE8A 3H9FA 5J1WA 1ZLTA 4UV0A 3QA8A 2C30A 4FKVA 2BRNA 4G9RA 1U5QA 3OC1A 2W0JA 3TJDA 4CQGA 5AP2A 5ETFA 5L8LA 1Q8TA 3D0EA 3UQFA 4BJJB 5E1EA 4AT4A 1YHSA 3OP5A 4QMWA 4DTKA 4FTAA 1OIQA 2AYPA 2OIQA 4IX6A 4AZWA 2X7OA 4BTJA 3HVCA 4MCVA 3W8LA 2IVUA 4P7EA 4RGJA 4FTTA 1OVEA 1ZY5A 4S34A 2BDWA 2PVLA 3I0QA 4E6DA 2QNJA 2PYWA 3W0MA 1ND4A 3JY0A 5L2WA 5J7HA 4JNWA 4TYJA 3Q9WA 5JQ8A 2J5FA 4O0TA 5CEIA 3D5VA 3FJQE 1YXSA 4UMPA 4Q5HA 5HVKA 3E8DA 4FEUA 4U5JA 4RJ4A 2R3JA 4H1MA 1GZNA 4H3BA 4XBUA 4XV3A 4QTBA 2Y4IB 2YERA 1M2QA 1YQJA 4C2VA 3G5DA 4EEVA 2QR8A 4CMTA 5DT4A 3K2LA 3QHRA 4IX5A 4NCTA 2Y9QA 4LGHA 5CNOA 3N4TA 3IK3A 2W96B 1OBDA 4D1XA 1H26A 1R3CA 2XNBA 4OAUC 4YLKA 4BZNA 2JDVA 5AUXA 5KMIA 4ZSEA 1PXMA 4PNKA 5CU2A 4O0UA 3DXPA 3CQWA 3A8WA 5IA1A 3BLQA 4N57A 2C5NA 2NRYA 4FIJA 3F5PA 3ZLXA 4EWQA 4EHEA 4WHZA 1URWA 2FO0A 3IECA 2J51A 3CC6A 1GZOA 3MTLA 4FICA 5CZHA 3ZM4A 4Z7GA 4C37A 3G0FA 4D58A 4MAOA 3DDPA 2PUPA 4M66A 3R8UA 3SOAA 4QEBA 4HYSA 3PFQA 4AGDA 4EOJA 2W06A 3DGKA 2WIHA 1Q8UA 3O51A 4FODA 3ZLSA 1XHAA 2ITOA 3FLWA 3CTQA 4EHGA 5AV2A 1WBPA 4YSJA 5EKNA 3TYKA 1Q41A 5DI1A 3C5UA 3NWWA 3R7VA 5HTCA 5ACBC 4I6HA 1FGKA 4PF4A 4U40A 3SD0A 3O71A 1UU8A 3M1SA 3JVSA 3SG8A 1BL7A 3O7LB 5J8IA 4DFXE 4EKKA 1JNKA 4N4SA 2I0VA 2QR7A 2VX1A 1DI8A 1OPJA 2HW7A 3AC2A 4YTHA 4M68A 1KE7A 4RJ3A 3EQBA 3VBYA 3Q5IA 2W1ZA 4PNIA 4YJNA 4ARKA 4O1OA 2HZ0A 2PVKA 5FBOA 4BI2A 2YM5A 2O2UA 3MA3A 4DEIA 3ORXA 3ZSHA 3S0OA 1A06A 2IO6A 3QD3A 5A6OA 2ITZA 3ODYX 4XCUA 4EWHA 3FUPA 4AA4A 1W2DA 5CSVA 3L8SA 3QXPA 4QMTA 5FEQA 4QT1A 3PYYA 2QKRA 4TRLA 3BYUA 2WTJA 4BHNA 1QPCA 4XLVA 4F1OA 2NNWB 2W17A 4O7NA 3D4QA 3CLYA 1ZYDA 3GI3A 3MH1A 4F9YA 3RPYA 1R39A 4CQEA 5JQ5A 5M53A 4OBOA 3BV2A 2JDRA 3DJ7A 3HMOA 2B54A 2VTTA 5CENA 1IASA 1OKYA 4MK0A 2XYUA 4DEBA 3BLRA 2Q83A 2ZV8A 4MHAA 4C8BA 2XH5A 4EC9A 2PWLA 1BUHA 4YO6A 3GVUA 3HMPA 4FTLA 4YLLA 4BDJA 1J91A 4GV1A 4KWPA 4QD6A 4F65A 5C1QB 3COHA 3QCSA 1G8SA 2CGVA 5CEKA 5DVRA 1IAHA 2C6DA 3UYSA 3CKWA 3PJ1A 4E1ZA 4IVDA 5HLNA 3NAYA 5ETCA 4WUAA 2R3GA 3CTHA 3QRTA 4JRNA 3RVGA 4UZDA 2YN8A 2HZNA 4FX3A 5K0KA 3AKKA 3HGKA 3I1AA 4NM7A 5LWMA 2CN8A 2J0LA 5HGIA 4ZZOA 1JOWB 4MWHA 5CU0A 4WD5A 3WZUA 1T45A 4MX9A 5EHOA 1WBTA 4YBKA 1M14A 2VO3A 3UOLA 4ACCA 4HZRA 3ZMMA 3O8UA 3Q32A 3C4XA 3TNQB 5GHVA 5JH6A 5IQHA 4AQCA 4DITA 3ANRA 3PXFA 1REKA 3Q4UA 2XK4A 3O96A 4BI0A 4I6FA 4QMMA 2R3FA 4UMQA 4DA5A 5HBJA 3NCGA 2C6OA 4TWOA 2UZTA 3NS9A 4KKEA 5D11A 3W2CA 4ZOGA 5BUEA 2XP2A 4WIHA 4QDVA 4L7FA 3BBTB 1CKIA 4YNOA 4XG4A 3R9OA 2F2CB 2YIRA 5HIBA 4DEGA 4ZZNA 3U55A 4FT7A 4OLIA 1CDKA 1ZYSA 5AR8A 3AC4A 1H8FA 2JLDA 5AUTA 2VZ6A 3CGFA 3DBQA 4C59A 4Y83A 5A3XA 1IG1A 3HV3A 4W4XA 4EJ7A 3E63A 4ASEA 4M8TA 4F7NA 5AR4A 2YWPA 4ZJVA 3MV5A 5GZAA 2CKPA 3DNDA 3R8PA 3GNIB 4QP2A 3MVHA 3FY2A 3OMVA 3R1NA 4WRGA 5CSPA 1GZKA 1BKXA 2PMIA 5JFXA 3BU5A 4O27B 5JKGA 1CMKE 2H96A 3RCDA 3KF7A 3G9LX 3D94A 3KEXA 5LVLA 5FXRA 3WZEA 3PSBA 5HKMA 1TQMA 5HX6A 3EKNA 4IX3A 2IJMA 3FC2A 3DXQA 4PL3A 4JDJA 3PE2A 5LMAA 2Q0BA 5AP6A 3VUTA 4F78A 1TVOA 5M57A 1KE9A 3Q9XA 4HCVA 2YA9A 4W8EA 3G9NA 2RIOA 4AAAA 3CY3A 1YW2A 5EM7A 5FP5A 3CR0A 4D2RA 2EXCX 1SZMA 3QZHA 4MXXA 1JLUE 3MFSA 4FZDB 3F3TA 3ZXTA 4QDEA 4DE4A 2CJMA 4OBPA 3LFQA 4EH2A 4UYAA 4AZVA 3T3UA 4FKWA 1GOLA 1H24A 4FG7A 4H1JA 4KIKA 4DH5A 3QZFA 3OUKA 4LRMA 4OTQA 3F88A 4ANOA 4DLIA 4UMUA 3LQ3A 2YAAA 1UKHA 5TF9A 4O7RA 3K3JA 3R9DA 2V22A 3BQCA 4X2NA 3HP5A 4LI5A 3V5WA 4FNXA 5A4CA 3F5XA 1UV5A 4IAAA 1UNHA 3QU0A 4CV8A 4DG0E 4LV7A 1ZRZA 2EB3A 3LFBA 4QPAA 3KMUA 5F94A 3W0SA 4H36A 4PPCA 4ENYA 2VGOA 4LGDA 4ZJJA 4CMUA 3CE3A 4RJ8A 1WMKA 2WU6A 4IW0A 1XH8A 4EK4A 5AUUA 2HZ4A 4J97A 1O6YA 3OBGA 3ET7A 4MWIA 3BX5A 4GG5A 4TWCA 5ANDA 4EYJA 3QQKA 2JGZA 5C01A 4GS6A 2WMQA 4APPA 4F1TA 4HNIA 1ZYJA 1H28A 4HNFA 1AQ1A 3NIZA 3W10A 1OL6A 2OJ9A 3N51A 4PQNA 4FT5A 3QRKA 2R3KA 4O4CA 3SOCA 3ENMA 3GXLA 5CAPA 3U6IA 4C34A 4MQ1A 3RI1A 4FL1A 3PPJA 3Q4TA 2IVSA 3BL9A 1OKVA 2X7FA 2ZM4A 5IMXA 4G6LA 4ZY6A 3R21A 5HCYA 4O4FA 3NYNA 2V5QA 4AA0A 1H1PA 4DC2A 1Q99A 2F4JA 1H1QA 3DV3A 4IZYA 4UXQA