2UZTA

Pka structures of akt, indazole-pyridine inhibitors
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
336
Chain Sequence
b'VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 111
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uztA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uztA02
4EQCA 2YLFA 1Q5KA 4X2GA 3I79A 2WQOA 2C6IA 3KKVA 1W8CA 4PPBA 5HBHA 2XYNA 4GFOA 4XJ0A 5GJFA 3TV7A 4AAAA 2Y0AA 5CF8A 5BYYA 4NYEA 4IVDA 3SX9A 1H1QA 5IUHA 5I9YA 3I6WA 4HNFA 4MXCA 4QMPA 5HE3A 2V7AA 4MH7A 4YJOA 1Y6BA 3C4ZA 5DR9A 4BBFA 4ZZOA 3ZFYA 3DZOA 3OOGA 2VNWA 4F99A 4TYHB 3GCPA 3NEWA 4DA5A 2IVUA 3ZFXA 2WFYA 3BHYA 3VS5A 4RFZA 4EK8A 1URWA 4FGBA 4LGDA 5H8GA 4MBJA 3ZLYA 4IWOA 5LWMA 4G5JA 3R7OA 5CXHA 3U6HA 2RL5A 3LFQA 2ITNA 5CQWA 5M56A 4BF2A 3Q6WA 4AP7A 3H0YA 4IZYA 3MI9A 4WG3A 3ZS5A 4AGCA 4Z3VA 4P5ZA 4DAWA 2CKPA 3DAEA 2OZAA 3R9OA 4O91A 2Z7RA 1B39A 3MBLA 5EQPA 4YZNA 3LVPA 4YHTA 1VYWA 4D1SA 3DK6A 2ONLA 3VS1A 2OF2A 2WTWA 5EW3A 4DH1A 4TWOA 4LV5A 2W06A 2X81A 4LMUA 3OHTA 5CU4A 4B7TA 1O6KA 2XNEA 4RGJA 3FMKA 1DM2A 4APPA 4L45A 1Y6AA 3UNKA 3WF9A 4PNKA 3FUPA 4IBMA 1H26A 1M52A 4WG5A 3GENA 3P08A 4WOVA 3R7EA 1YKRA 4U43A 4UWYA 4AW5A 1IA9A 3R71A 4NM5A 3RK9A 5AJQA 5DI1A 3F7ZA 4XV3A 2IO6A 3BGQA 3F88A 4XRLA 3E7OA 3SVVA 4WNMA 5AAFA 4TW9A 1GNGA 1KE8A 3W1FA 2UZVA 4RIWA 2PVNA 3ENMA 1MP8A 2XVDA 3BU3A 5IA4A 2W4JA 4Y5QA 1BUHA 4ZMFA 5EI8A 2FA2A 4EHZA 5A9UA 1G5SA 2ACXA 5E8WA 1R39A 1ZXEA 5IQBA 5K5NA 5M08A 1GIJA 2XYUA 1UV5A 4GV1A 4QMMA 2BZHB 5FGKA 3DDPA 1XH5A 2DS1A 3BHHA 3DPKA 2W1IA 2HZNA 1Y57A 3W2PA 3PWYA 2PK9A 1APME 2GMXA 2GNIA 2XEYA 2Z7QA 3MYGA 4BGGA 4K6ZA 3SHEA 3JVRA 3FLZA 3TZMA 4BC6A 4KRDA 3GU7A 4IX5A 3HX4A 1SNXA 4IM0A 4PF4A 4ZJJA 4ARKA 3AD5A 2ZV2A 4XP2A 4L9IA 1DS5A 5EYDA 5HNGA 3LMHA 5T3QA 1WFCA 2EXEA 2W4OA 3L9MA 3FQHA 3G0FA 4IVBA 4USFA 4ZZNA 3ZMMA 3S95A 4RFMA 3V5JA 2XKDA 5D1JA 2XNMA 3D2KA 4DFZE 4N4SA 4FSWA 3OF0A 3UOHA 2R3LA 4A07A 5L3AA 5LWNA 4I24A 4QMNA 2BCJA 4C7TA 3PRIA 3N4UA 3OW3A 2PMLX 2WPAA 1T46A 3Q32A 4OLIA 2DWBA 2X39A 2HXLA 4JIKA 1CTPE 3BELA 3MW1A 4GSBA 5HVJA 4L68A 4IVCA 4QNYA 1JSUA 4CKIA 3MH0A 3MH3A 3TDWA 5EQYA 3QQLA 4HYHA 1M7NA 3CEKA 4EHVA 3R9HA 3E8NA 4HCVA 5AP1A 5L6PA 2FVDA 3R63A 5IH5A 5I0BA 2XF0A 4NTSA 2W0JA 3DKGA 3NZ0A 4N6YA 2J0JA 4WNOA 5JRSA 5AP2A 5KMIA 1G8SA 3GC8A 2XRUA 4F7LA 1P4FA 3F3TA 4CFVA 4HGSA 2YLEA 3PFQA 4IC7A 4D9TA 5JEBA 2YIYA 1IRKA 3QRUA 4CT2A 4C59A 4DHFA 2XCHA 4JBVA 5CALA 2R3RA 3D94A 3ZM9A 4KIKB 4GS6A 4BDHA 4OUCA 1YWVA 2HENA 2X2LA 2YIWA 4XG3A 3G90X 3QKMA 3MIAA 2XM9A 1W7HA 3CQWA 2CCIA 5J8IA 3T8OA 3F5PA 4FVPA 4EQMA 3TIZA 1U5RA 3TZ7A 1H07A 5D12A 3COKA 3UVRA 3F7WA 2GFSA 3MPAA 2IWIA 3KF4A 3OCBA 3VUMA 1OPLA 3EKKA 1M14A 4AS0A 4MBIA 5LMAA 3KXZA 3KN5A 1ZMVA 2P33A 2W1HA 4MF1A 3D0EA 3GC0A 2ZMCA 4NM7A 4QMYA 4C58A 4QPSA 1JAMA 4D2PA 4LGGA 3CTQA 3FMMA 2XM8A 3PE2A 1CMKE 4KS7A 4RRVA 3U6JA 2VD5A 4X2NA 4YSMA 5M57A 4QTCA 4DLIA 5HOAA 3SRVB 5J1WA 2X7FA 2ZB0A 2OXDA 2X4ZA 1NVRA 2YCFA 1FINA 2YITA 4JXFA 4BCJA 3SW4A 4DFNA 4IB1A 5J1VA 1X8BA 3E63A 2J2IB 5DN3A 1OKVA 2YISA 4DYMA 4EOIA 5L8LA 2WTKC 1M7QA 3CD3A 3DNEA 3KCFA 3HMPA 4IW0A 4MKCA 2ESMA 3NR9A 3PPJA 3JY0A 2WTDA 3CQEA 4XP0A 3R8LA 4CQGA 4MD8E 3QUPA 3EQRA 4LL0A 3WZJA 4JBOA 2GS6A 3GQLA 4YZ9A 3RZBA 4I0TA 1R0PA 2VWYA 2HY0A 3EFWA 4N6ZA 5DBXA 3DY7A 2OO8X 3UQFA 4DE4A 5HLWA 3CPCA 2C6LA 4GMYA 1T45A 2PSQA 2HWPA 2Y4IC 5KMJA 2RGPA 4XLVA 4GU6A 5LMBA 1P2AA 3D4QA 3O0GA 5EK7A 3ZOSA 4QMQA 3C4XA 3IOKA 3NAXA 4DINA 5I9VA 2PMNX 3KMWA 4PP7A 4ZJVA 2P4IA 3FC1X 4O82A 3C5UA 5CAVA 5LVLA 3DJ6A 5FTQA 3RHKA 3KF7A 2QODA 4UALA 3FWQA 4FIGA 5HD4A 5BNJA 1SM2A 1P5EA 3IOPA 5J5TA 2O3PA 3GU8A 4NSTA 2C5NA 1Q8TA 3B2WA 2W5HA 2CN5A 4FTAA 3NUUA 2W1ZA 4RJ6A 3RCJA 4FL2A 4Z7GA 1TKIA 4YTIA 1XBCA 4O0RA 4DT9A 3I81A 4AX8A 1ZZ2A 4XNEA 3ZO4A 4ZAUA 3VUGA 2PVLA 4X3FB 3FBVA 3VAPA 4J7BA 3VO3A 2B52A 4OBQA 3BYMA 5CSPA 3UQCA 2WQMA 4D1ZA 5IMEA 4IJ9A 3LJ1A 3ZDUA 3FI8A 1GOLA 5AAEA 2GHGA 3FKOA 3R1SA 4QT1A 4WKQA 3FZ1A 4IHPA 5EOBA 3RNIA 3F2RA 4NL0A 4WD5A 3PPKA 3M11A 2I7QA 3TT0A 2A19B 3I7CA 4S33A 4EKKA 3LFAA 4UXQA 3AQVA 3R8MA 3QQUA 1W0XC 2J5EA 3HRCA 3ZONA 3OUKA 1WMKA 3F6XA 4FSZA 4FTKA 2XK3A 3RWQA 4BL1A 4ZSAA 5E8ZA 3H9OA 4U81A 4IEBA 4O7WA 4JX3A 3BU6A 1Z9XA 4BKZA 4CD0A 3BLHA 5HG8A 3V5WA 2CMWA 4FEQA 2QVSE 4RZWA 1A06A 3NUPA 2WMTA 3G5DA 3BE9A 4NJ3A 3SOAA 4O0TA 3CCNA 3VWAA 4O86A 3HDNA 2WTJA 5T6KA 4I1ZA 3NNWA 3WE8A 4FV2A 2ONLC 4FSMA 3COIA 3PJ2A 3KK8A 2G9XA 4E5BA 2P2IA 3TIYA 3CP9A 3ZRMA 3C9WA 4D4YA 4F9CA 4IE9A 4FA2A 4V0GB 3DBCA 5LQFA 4I6BA 5EH0A 4MNEB 2OZOA 4KKGA 2ZYBA 4WA9A 1BX6A 1OIUA 3EQFA 4JNWA 4O96A 4H58A 3REPA 4FTCA 4FV6A 1RW8A 2LAVA 5CEOA 3HMOA 3KN6A 2C47A 4A9SA 4FUXA 4UMRA 5KKRB 3KGAA 4DGMA 3FZPA 4AT5A 4D2TA 4U6RA 1ZZLA 3MDYA 4QMUA 2PE1A 5FDXA 4X2JA 4G3EA 4KABA 3DJ5A 4IACA 4M3QA 2YIXA 3AT3A 4QQ5A 3WI6A 5CAPA 5J9LA 3FZSA 4GKIA 2VWXA 3UZTA 2YM4A 3RP9A 4KUJA 4G9CA 4K11A 4CMTA 3I6UA 3MVJA 4CZTA 3BV3A 4FT7A 5CANA 2OSCA 5IQHA 1H0WA 1NVQA 1REKA 5L2QA 2WZJA 4BDGA 2YCQA 2BZIB 4MF0A 2XEZA 4Y83A 2JDVA 5G6VA 3RALA 3D7ZA 3CQUA 3TDVA 4EUTA 3ZLSA 4Q5EA 5HZNA 1JVPP 3PJ3A 1NVSA 3IKAA 4FZ6A 5IU2A 3T3VA 5J9ZA 2BMCA 3QL8A 5AV4A 4ACMA 2UZDA 2WTCA 1XO2B 4CLIA 4L3JA 4DTAA 1SVGA 4UMQA 2VTRA 3Q5IA 3G15A 4G3GA 1H28A 4JR3A 3BV2A 5D7AA 5CEIA 5JFVA 2CCHA 1OM1A 1OBDA 4U3YA 4FT5A 2XMYA 4N0SA 4PQNA 3NX8A 5KMKA 3TWJA 3ODYX 1IG1A 1VZOA 4I6FA 5ANEA 3ZRLA 4WG4A 4ZTQA 5CX9A 3R02A 4U8ZA 2PUIA 4PDPA 4F9YA 4LRMA 4YJUA 4XBUA 2BRBA 4FX3A 3RPSA 2QHMA 3IO7A 4DCAA 1PW2A 5EYKA 5A6NA 1OIRA 5DEWA 4FC0A 1NXKA 4XOYA 4O7VA 4U0IA 4QP1A 3ZYAA 4J96A 4YLJA 4FZFB 3BBTB 1HOWA 5H8BA 5LOHA 2BRMA 2VWUA 2BFYA 3F5UA 3UDBA 4YPSA 1JOWB 3EH9A 3LZBA 1XH7A 3H3CA 3RBWA 3W2OA 3CKWA 4FF8A 2YJSA 3OWPA 3ZSHA 4DH8A 1OPKA 1I09A 2YFXA 3QRTA 4JG7A 4R7HA 5HE1A 2XUUA 5AFVA 5DVRA 1ZYLA 3LJ2A 4BBEA 4EOQA 5AA8A 3EJ1A 4USEA 3NDMA 3BYVA 5L6OA 4FNXA 4HPUE 4XH6A 4EWHA 5GJGA 5E8VA 4YMJA 3DKOA 3FXWA 1WBVA 5JZJA 5DLSA 4F6WA 5KHWA 5IA0A 4BCMA 4MXXA 2OJ9A 1UWJA 2HZ0A 3BRBA 3IDBA 3BQRA 3DFCB 4RJ4A 3ET7A 3R00A 4LRKA 4EORA 3TEIA 4R3PA 2JKMA 4CFFA 2VZ6A 2VTIA 4IWDA 3RI1A 5BUIA 4L8MA 5JN2A 5HCXA 3LIJA 3ORMA 3H4JA 2FSOX 4F9WA 2QI8A 3K3IA 4PMPA 4MX9A 3RAHA 3R8UA 3QTUA 2DUVA 2YN8A 3CE3A 3QKKA 1OKYA 4HCTA 1J7LA 5HX6A 3M1SA 5HVYA 4A4XA 2GS2A 4PRJA 3EHAA 2UW4A 4ZSEA 4RIXA 4HVHA 4JOAA 3PE1A 2O65A 1SVHA 3BYOA 2B53A 3D15A 3QLGA 4GW8A 4LUEA 3MB6A 4MXZA 3WYXA 3AT4A 3VS4A 5M06A 3LOKA 4BDBA 2HELA 4FG8A 2VTOA 1LEWA 3FLYA 2G15A 3OXIA 3Q3BA 2QQ7A 1PKGA 3W18A 4ACDA 4C4HA 4D0WA 1YXTA 4PTCA 3TZ8A 5LJJA 3GCUA 4AGWA 4ZLYA 2V62A 5DR2A 4DGGA 3HV4A 4WBOA 1M2PA 3W2QA 3L9NA 3LFEA 1M17A 3CIKA 3MFTA 3QQJA 5ITAA 3BLRA 2QHNA 4E4LA 4IANA 4BFMA 5J5SA 4QYGA 4UMPA 2FSLX 3GBZA 3ANRA 2R9SA 3E8EA 4RC4A 4DCEA 4DEBA 5M53A 3FAAA 3PVBA 3ZSIA 2G2HA 3FY0A 4ANOA 4BTFA 3V01A 3AGMA 2UW9A 5AUZA 3TTIA 4KINA 2XZSA 2A2AA 3DJ7A 3I5ZA 4I20A 2UZUE 4XS2A 1L8TA 2HK5A 2YZAA 3QWJA 4ANSA 2OI4X 3BPRA 3OUNB 2Z7LA 4DN5A 2RFEA 3QRJA 3ID6C 3PVGA 5AUUA 3P78A 3NYVA 2BAKA 4CYJA 5KCVA 2UVZA 4FICA 1YXUA 3D5WA 4GEOA 2JD5A 4AWIA 1JWHA 2LGCA 5M09A 4KSPA 4NWMA 4APCA 4ANLA 2OW3A 3ENHA 3QLFA 3DZQA 4B99A 4FV1A 2WXVA 3QD2B 1FMOE 3RTPA 4L7SA 1WBNA 4GJ2A 4BB4A 3EYGA 3LM5A 2VO3A 3BEAA 3IECA 4W9WA 5HVKA 3MVLA 1RDQE 5TOZA 1ZAOA 5EW8A 2UZBA 3OD6X 5M4UA 3ULZA 3FMHA 4QP8A 1OIYA 4M15A 4O7RA 2QOFA 3I60A 4WSQA 5GZ8A 1DAYA 4UN0C 4XLIA 1SMHA 5D11A 5F1ZA 2I0VA 2W1GA 3PIZA 3FPQA 4QNAA 5HQ0A 2UZWE 1MRYA 2R5TA 3KRRA 4C2VA 5HE0A 5TE0A 3C50A 3Q4CA 5CASA 2GSFA 4FIEA 4O0VA 3UYTA 5D7VA 5EKNA 2GNFA 5EHLA 4XOZA 2JIIA 3O96A 4GT3A 2PTKA 5KMOA 4FKQA 3MY0A 3PSBA 5CVFA 1WVYA 4C61A 4EJNA 4E4NA 3A7IA 3QTXA 1SYKA 2BHEA 3BX5A 2QKWB 3KVWA 3Q04A 4QMSA 5J7BA 3UO5A 2IG7A 3RVGA 5BVOA 5CTPA 4G17A 4U41A 2YM3A 3D14A 3HECA 4I0RA 3AXWA 1TVOA 1UNGA 3NNVA 3P5KA 4L52A 1H24A 4YHFA 2WIHA 4F9AA 3EYHA 5E7RA 4AN2A 5C26A 5I3RA 3AG9A 4D58A 4EQUA 1CKPA 3N4VA 1F0QA 3OC1A 4TXCA 2UZEA 3CKXA 4O7SA 3WZDA 5A4CA 2I6LA 5CNOA 3ROYA 3PXKA 4P90A 3UZRA 1PXOA 3EFJA 4PDOA 3CSVA 2HIWA 4KKEA 2OJFE 4EHEA 4IIRA 4EC9A 3QX4A 3CPBA 3QFVA 3N4TA 4TWPA 2HZ4A 4WNKA 3BYSA 3VS7A 4CFNA 5HO6A 1AD5A 3RM6A 5DT4A 1HCLA 5L8JA 4EOJA 3EQDA 3NYXA 2VTAA 2BRNA 2ZB1A 5AP5A 4ACHA 2ZV8A 4F0IA 4L01A 3PSCA 4H1MA 4GL9A 4MQ2A 4WO5A 2VWVA 2XIKA 2ZVAA 3OEZA 3DFAA 5H9BA 5EOLA 2JDOA 3R8PA 3C0HA 3PUPA 3KREA 5HESA 4EZ7A 3I4BA 5E8SA 2WMSA 4ZS4A 5E9EA 1VJYA 4R7IA 1O6LA 2X1NA 4JG8A 5EI6A 2REIA 3FL4A 4ASZA 1PY5A 4FSTA 2H96A 3C4EA 4XCUA 4J1RA 4FG7A 2IZSA 3O2MA 4C4JA 3ETAA 3GUBA 3I5NA 4ZSLA 3AD4A 1OMWA 3QC4A 2JKQA 3D7TA 4HYUA 4YJQA 1KV1A 3VUTA 3DK3A 1Q97A 3KXMA 4CQEA 3VJOA 2Y8OA 2XKCA 3O71A 5JGAA 3FHIA 3QYZA 3QTRA 2Z2WA 1JSVA 5KMNA 1OL6A 3AC8A 5IKWA 2YIRA 4C35A 5CT0A 4IDTA 5AR8A 5AX9A 4FTMA 4ITJA 3V04A 5LVMA 3KXGA 3KFAA 2ITQA 3KEXA 2UVXA 3G33A 4O0XA 4TYIA 2X4FA 4E3CA 4F7SA 1BL7A 4PMSA 4ALWA 2X8IA 1PKDA 5E4HA 3MY1A 3RJCA 4PDSA 5A3XA 2W1EA 5JGBA 4H1JA 4OTIA 3LXPA 5ANJA 3LPBA 4WRSA 3QTWA 5IQFA 4QMZA 4Q2AA 4R8QA 3O7LD 4X2KA 3HUCA 4RA5A 4FEXA 3DV3A 2G01A 1UU7A 4YJTA 4JS8A 3R9NA 3PRFA 4FV4A 3KCKA 3LXLA 4PMTA 4F09A 5CWZA 3IQ7A 4M84A 1ND4A 4L7FA 4Y8DA 3IPHA 5EDRA 1XH4A 3TV4A 2J6MA 4KBKA 4EH2A 4MNFA 3F5XA 4BI0A 4FTNA 1OUYA 4AQCA 2WU7A 3EN4A 4R3CA 4JBQA 3NVMB 2X8EA 4GG5A 1ZYJA 5ANKA 4OT6A 5FXSA 3TV6A 4ZSJA 4TRLA 5CU3A 5DH3A 3TNHA 4LFIA 2R4BA 3SOCA 4NCTC 4G6OA 4RT7A 2J50A 3GU6A 3FQEA 4A9YA 3P86A 3ZO1A 2X2KA 4UWCA 5A14A 2XIYA 2E9OA 3MB7A 3CJFA 4PL4A 5A4TA 2JKKA 2XK4A 4W4WA 4AXAA 2JFLA 1BI7A 3CY2A 4QQTA 1F3MC 3BWFA 5KX8A 4D2RA 5KZIA 3O8TA 3EN6A 5KO1A 3F3VA 2CGWA 3A7JA 2V0DA 5K9IA 3R6XA 5A6OA 4IMYA 4EH5A 3C13A 4ASEA 4F0FA 3EN9A 3FMJA 5AV1A 5GHVA 4E6AA 1Q8UA 2CNQA 3S2PA 3L9PA 3TCPA 4C02A 3E62A 4I21A 2WMQA 4DITA 3PIYA 1YOJA 4PV0A 4F7JA 1V0BA 3PY0A 1Q3DA 3V6SA 4RC2A 2ZJWA 2F2UA 4BVUA 3GNIB 4ITHA 4FSRA 2I40A 1GZ8A 4RQKA 1B6CB 3VQUA 4BKJA 5BUJA 4YZDA 3DK7A 3SAYA 1YHSA 4L53A 2QURA 2BIKB 3Q5ZA 4QTDA 4OTHA 5L2SA 3LXNA 4FOCA 4G6NA 5EI2A 4B4LA 4FV5A 5ICPA 5I3OA 3NS9A 1PXIA 1I44A 3R7UA 3ZXZA 3L9LA 3RPOA 3HV6A 1JPAA 3VVHA 2Y6MA 4IB5A 4E7WA 3OP5A 4C3RA 4CVAA 5ACBC 1J3HA 3RK7A 3FZOA 4AZVA 4ZTHA 4YURA 4EOPA 5CAOA 4EZ5A 5HO7A 1R3CA 3GOKA 4KB8A 2R3JA 3G2FA 1QL6A 3TUCA 4RWJA 4YC8A 5EHOA 3TNPC 4BZOA 2JDRA 4QYEA 2QO7A 3TN8A 2WU6A 2WB8A 3FC2A 4RIOA 3V5PA 3SLSA 2PE0A 3OXZA 3E5AA 3FDNA 5F95A 4AZSA 3BQCA 2OIQA 2W7XA 4BDKA 2YAAA 2Q0NA 3P4KA 2YZLA 5DA3A 4JDJA 1Z57A 3VUHA 4R3RA 4GCJA 3V8WA 3NWWA 4OGRA 3VC4A 5AAGA 4H36A 2C6MA 4IX4A 3LXKA 1MQ4A 3FE3A 4FKWA 3VBVA 4EH8A 3QCQA 4XV2A 3OW4A 3EQBA 3HKOA 1E9HA 3MTFA 2YIQA 3WE4A 2BAQA 3O23A 4U97A 4RVLA 3R7IA 3EKNA 5IH6A 5J79A 2QOCA 1YW2A 1XWSA 4G16A 2O64A 2X9EA 3PY3A 3W2CA 1WBSA 1XH6A 2UW8A 1F5QA 3GQIA 2R3GA 4JQ7A 2C1BA 4YBKA 5LVPA 3BYUA 3BGZA 2PVYA 4LOOA 5AP4A 4BR3A 5IEVA 4NU1A 4TYEA 3L8XA 5HTIA 4A4LA 5C8NA 2ZV7A 4JBPA 4X6QC 2PY3A 4FYOA 4BCPA 5FQDC 4FIJA 3FMNA 4TWCA 5BVEA 4EJ7A 2VTPA 2ETRA 4PP9A 1P4OA 3P23A 3W16A 4DH3A 2XNNA 4FTQA 2IJMA 3OWJA 3LLAA 4H05A 4LOPA 3TNQB 4FV7A 2UZNA 1OL2A 3KA0A 2ITUA 2UW5A 4F6SA 4B0GA 4GYIA 5GIPE 3P1AA 4S32A 4YZBA 4D2WA 1QPDA 3ZRKA 3D5UA 3E7VA 5BMMA 4L46A 3PSDA 2BALA 2JKOA 2QO9A 3EFKA 3MS9A 1G3NA 3R8ZA 2XB7A 4YZMA 4RX5A 3D83A 3T9IA 4DEDA 5B2KA 3NCZA 5D41A 2X2MA 1JKLA 4UYNA 3Q4TA 5HBJA 1H0VA 2BTRA 2F7ZE 2GS7A 3NPCA 5L2WA 2C5YA 3F3UA 4X3JA 1YXXA 3LFFA 4ZS0A 3UNZA 3WILA 3MESA 1Q8YA 3TUBA 4XHKB 4OTFA 4F9BA 4F70A 3C51A 4DGOA 4MD9E 2PWLA 2Q0BA 2X6EA 3F2NA 3IS5A 4JDIA 3ZBXA 4BZDA 4C36A 3ANQA 1QPEA 2WMAA 3KXHA 5AMNA 4A7CA 2A4LA 4FBXA 1U59A 2ITVA 4ZIMA 4V04A 4RX9A 1DI8A 3Q9WA 4ZTNA 4YJRA 4B9DA 3HAMA 2BDFA 3QWKA 2VTTA 2OIBA 4C34A 4FK3A 4IAYA 2JFMA 4FKRA 4X2FA 4O7TA 3IONA 4W4XA 5AP6A 3NUXA 5HORA 3OROA 1E1XA 4EZ3A 2X9FA 2QD9A 4L43A 3WZUA 4C4IA 3PP0A 1FVVA 2W1FA 1UNHA 3R04A 4F1MA 3LFCA 4FIIA 4JL9A 4BGHA 3O51A 5CI6A 2W9ZB 3UC3A 5AM7A 4M14A 5LMKA 1GJOA 2BVAA 4GG7A 4EK6A 4BICA 4DFBA 4IAIA 3ACJA 1PMEA 4AU8A 2JEDA 3S1HA 2R7BA 2CPKE 3OT8A 3CC6A 2GNHA 3VUKA 2PULA 2XRWA 4TWNA 2P3GX 4R1VA 2UZTA 3BE2A 5AUVA 3R30A 4FKUA 4D55A 3LLTA 4AZTA 4PTGA 4M68A 4QD6A 4RIXB 3R2BA 2IZTA 3W8QA 4IM2A 3QGYA 3COMA 3FPMA 2PHKA 3LQ5A 4TNDA 4S34A 3U54A 4OW8A 1FOTA 3OMVA 3UGCA 1FMKA 3L8SA 5HG7A 1XQZA 4TZRA 3OS3A 4O0WA 4E73A 4QP4A 4CCBA 3M2WA 1CSNA 2OH0E 5B2LA 2J0IA 3G9LX 5DIAA 3DQWA 1PJKA 2WMUA 3A4PA 4F1TA 3ELJA 3PLSA 4HPTE 4EI4A 3FEGA 2RG5A 4FR4A 4WRGA 2C6DA 4FKGA 2PUPA 4JJRA 4HYIA 3PP1A 4C3PA 5EFQA 3R2YA 3QBNA 3F69A 4FSUA 2C30A 3CTHA 5E8UA 5ACKA 1MQBA 5T68A 3SD0A 4CG9A 2B55A 4M7IA 4E6CA 4H3PA 3SC1A 3NCGA 3VS6A 4UY9A 1PRYA 2YDKA 4AGUA 4MXAA 2BKZA 4RVMA 4O21A 3HUBA 4AFJA 4NM0A 3QZHA 4DG0E 1ZOGA 3E92A 4UEUA 4ID7A 4ZTSA 2B7AA 2EXCX 3UPZA 4DBNA 3PXZA 4H39A 5JFXA 4G3DA 4U79A 5FEQA 3UMWA 3PYYA 4MD7E 1CKIA 1YDRE 3GXLA 4GRBA 5TO8A 4USDA 4EC8A 5KE0A 4CGAA 1J7UA 3MA6A 4M69A 2QONA 1GZKA 2G1TA 2VGPA 3QXPA 2DQ7X 3ORZA 5FEDA 4U44A 3RGFA 4DG3E 4L67A 3QRKA 1LPUA 3UOLA 3TG1A 4E5WA 3ZCLA 1YHWA 3GU4A 5I9WA 1GIIA 3PXRA 4A06A 5CZHA 4ZSGA 2ZDUA 3EQIA 3LM0A 3UNJA 3QUDA 3F66A 3ZC5A 5BVKA 3OEFX 5IG1A 1GAGA 4Q9ZA 4KSQA 5AIKA 2I0EA 4CRSA 4C38A 1VEBA 3GFWA 2IW8A 1K9AA 3NUYA 5EQEA 4QYFA 3H0ZA 3ZLWA 3ZEWA 4K8AA 4ZZMA 5JKGA 1H1SA 4G2FA 5HTBA 2VTSA 3OT3A 3PA3A 2YWPA 5I5ZA 3TL8A 2B9HA 4AT3A 3A60A 1W83A 2BR1A 3DDQA 4RPVA 5BVDA 4RJ8A 1IASA 4PWNA 3WF8A 3ZUVA 2C6TA 3JVSA 4NKSA 4AN3A 5CEPA 1Z5MA 4DEGA 1KV2A 2AYPA 3QD4A 3H30A 4Y73A 5HCZA 2F49A 5AR7A 3ITZA 3VIDA 3BU5A 3KRJA 2IVSA 4NIFB 3E64A 3RCDA 3UE4A 5HNIX 4XEYA 3MPTA 1PXJA 3UG1A 4JIAA 2VWBA 2B0QA 5H3QA 4FSNA 4IX6A 5AWMA 5JT2A 2BROA 4L3PA 3IW4A 4MAOA 4TTHB 2R3HA 4O81A 1KSWA 1PMUA 3QTZA 2WEIA 4PNIA 4L42A 4MWIA 3RNYA 1TQIA 3F3ZA 4I0SA 4I22A 5AX3A 1Q4LA 3E8CA 3KVXA 2C0TA 2EB3A 4FTTA 3B8QA 4IM3A 4R5SA 2O2UA 4F1OA 4YO6A 3HDMA 1JLUE 1ZY5A 3C1XA 2WOTA 3GC9A 2EWAA 1PMVA 4XYFA 4PUZA 2B9JA 5DRDA 4G6LA 5EM6A 3VQHA 1YDTE 4QPAA 4P4CA 1YWRA 2XKEA 3DQXA 1OECA 4O7YA 5L8KA 4KIKA 4KAOA 4EH6A 1SZMA 2RSVA 2BKKA 4XG8A 3G0EA 3HGKA 3E8DA 1OL7A 3QQGA 3G9NA 3QF9A 5BVWA 3KMUA 5I9UA 1UVRA 4FTRA 3QCYA 3JR1A 2W4KA 3TZ9A 4EEVA 1J1CA 3FSKA 3R8VA 3W2RA 1JKTA 2WIPA 2UW3A 2QR8A 2WTKB 4RSSA 4U9AA 3E93A 5CU6A 3ZHPC 3VRZA 4CXAA 5IUGA 3DB6A 3LCOA 4HZRA 4M0ZA 3ALNA 4ZXTA 5LCKA 3PWDA 1WBTA 2YJRA 4FG9A 4V05A 2PZ5A 3FZTA 3SXFA 1KE9A 4JLCA 2VX1A 4I5MA 3AMYA 3POOA 4NKAA 4AW1A 2R3MA 2VX0A 2JBPA 2C1AA 5CNNA 3OFMA 5EYCA 3DU8A 4F0GA 2SRCA 3AC3A 4EH3A 3SRVA 1FPUA 4PDYA 2QOLA 2VUWA 2VGOA 3R0TA 4R5YA 4TYJA 1STCE 2WTIA 3D7TB 4V01A 5DT0A 4YJSA 5AV2A 2JIUA 4O0SA 2QR7A 4QP7A 1Q8WA 4RBLA 4BCNA 2QOBA 4CFWA 2GQGA 4D9UA 3KXNA 3LCSA 3OY3A 4NCTA 5B2MA 4UZDA 3ATTA 5C01A 2VO7A 5IISA 5HO8A 1O6YA 2WD1A 4RVTA 3RAWA 4Y72A 3OWLA 2WMRA 2ZM3A 4M8TA 4FV9A 3QHRA 3HV5A 5HD7A 3S00A 3VF8A 4NTTA 5ETCA 2C3LA 4D28A 4PMMA 5EW9A 3UZPA 2ZDTA 4IB3A 3FYKX 4FE2A 5EYMA 3WZKA 4CFUA 5A46A 4FVRA 4FGRA 4YPDA 3ORXA 3QA0A 4FKSA 1BL6A 2BILB 4N57A 4IC8A 2BDWA 3G6HA 2HY81 4NUSA 5FEEA 2J5FA 3A2CA 3HMIA 3HRFA 3LQ8A 1DI9A 4EOLA 5CU2A 4BIEA 4FKVA 2YHVA 4D4SA 4BGQA 3V51A 4D4RA 2OU7A 4J53A 2X7OA 2DYLA 3LCKA 1YI4A 5CY3A 2C68A 2XK6A 3DNDA 4ITIA 2Y9QA 4C0TA 4PL3A 4GH2A 3SKCA 4GUBA 2BHHA 3VW8A 3KL8A 5LMKC 3ZDIA 4I23A 3EMGA 4A9RA 5F9EA 2BUJA 4H3QA 3FKLA 4IX3A 4X3FA 4JDHA 5AR2A 3VBYA 1IEPA 4O2ZA 1J7IA 2GNGA 2W05A 2ZMDA 3G6GA 4JVGA 2CJMA 2OZAB 5HE2A 5L6WL 3KRXA 3PZEA 4BDFA 5HLNA 4O7LA 3KK9A 3UC4A 1OVEA 2QKRA 2XIZA 3VF9A 1B38A 2H8HA 3FYJX 1O9UA 2CNVA 1Q24A 2KULA 2NRYA 2X6DA 4L6QA 2RF9A 1H4LA 4J97A 3FL5A 3AT2A 1FVRA 3DTCA 4GT5A 4U80A 5AADA 3RWPA 4YR8A 5JSMA 3CJGA 4IAKA 3S4QA 4I6QA 4C57A 2CDZA 2FH9A 4U3ZA 5IDNA 4NT4A 4QRCA 4QTBA 2P55A 3C7QA 5CI7A 5HG5A 3R83A 3U87A 5IEXA 4IAFA 4XBRA 2R3KA 4NJDA 5E90A 2VWZA 4QTEA 3R1YA 3NAYA 4ZMEA 2WELA 3KULA 4FT9A 4L44A 2JDTA 3ATSA 2RG6A 1Q41A 1OZ1A 3R22A 4OBOA 4OBPA 4RIWB 1WVWA 2OH4A 3UIUA 4E6QA 4QP9A 4JI9A 4QTAA 2RKUA 5FLFA 4EUUA 3VBTA 3AOXA 2NO3A 3OZ6A 4KBCA 1WCCA 2W96B 4TPTA 4B6LA 1WBPA 1W98A 4YU2A 4ZOGA 4FKIA 4XMOA 5HCYA 3SXSA 4CEGA 2GDOA 5BQ0A 2PVRA 5IA5A 4BWPA 3ZSGA 5IA1A 4E20A 4CV8A 4EKLA 2JDSA 4MNEA 3Q4ZA 5HIBA 1ZOEA 3E3BX 2WMBA 3FKNA 2QO2A 4TY1A 3GB2A 4DFLA 3K5VA 5HGIA 3ZZWA 4A9UA 5C27A 2PZIA 4BYIA 4DEEA 1OKZA 3VUIA 5K4JA 4HGLA 1PHKA 5E1EA 4KKHA 1Q62A 3GCVA 4BN1A 4IQ6A 1OUKA 1NY3A 2FGIA 1K2PA 2I0YA 2W99B 4OTRA 4BDEA 4E5AX 5BMSA 5KNJA 3A7FA 3ZO2A 4AZFA 2HW7A 4PY1A 3FMEA 1ZYCA 4FTIA 4RIYA 4JDKA 2VTMA 5HG9A 5HTCA 2H6DA 2OWBA 4QMXA 1U46A 1QMZA 4DFXE 3HV7A 3KRLA 4QMWA 3VS3A 4CMOA 5B7VA 4IADA 4AF3A 3CGOA 3RKBA 3HRBA 1XHAA 2CGUA 3PXQA 4DG2E 2B9IA 3FZRA 3GOPA 3VUDA 5CU0A 5D9HA 4MXOA 3PLAE 3UG2A 3VNTA 1SVEA 3RHXA 4D4VA 1Y8GA 3EQGA 4XG2A 1H25A 4U42A 2QNJA 1FGKA 1U5QA 5CVHA 2VTLA 4EBVA 4DFUA 2WMWA 4KIQA 1OGUA 1BMKA 3IG7A 4FNZA 5DPVA 3KC3A 4NH1A 3QU0A 1JSTA 2WHBA 4NW5A 5ANGA 2HAKA 4JRNA 4EH4A 4ONAA 4AW0A 4FOBA 1PYXA 2BPMA 3HP5A 1IA8A 2QOHA 3QKLA 4CMUA 5J9YA 3Q53A 4G31A 4S31A 4E26A 2PMOX 4DEAA 4MK0A 4EOOA 4X6RA 3R9DA 3ALOA 1UKHA 2CNUA 3KY2A 4FK6A 4AT4A 4FKOA 2XK7A 2NNWB 3A99A 3DT1A 2PU8A 4WNPA 2OXYA 3LMIA 4GFGA 4O2PA 2CGXA 3CGFA 5I4NA 3NMUF 4XG7A 1V0OA 4LL5A 1M2QA 2GTNA 2ITTA 4N70A 2Q83A 5B0XA 4TT7A 5HEZA 4CLJA 3U51A 2XK8A 3VS0A 5JZNA 5LCJA 4J98A 3RAIA 2I0HA 2XK9A 3BHVA 4YTFA 5IA2A 5M51A 3RPVA 2YEXA 3ACKA 5IQDA 2ZM1A 3DA6A 4DTBA 3Q2JA 2J9MA 3FQSA 4BTMA 4HVSA 3OTVA 4YZCA 4W4VA 5KZ0A 4GVAA 2QLUA 2WNTA 4HNIA 1IR3A 3V8SA 3F61A 2PVMA 4MEDA 5F94A 2CLQA 5HIDA 3SQQA 1UU3A 4A9TA 4FEUA 2YDIA 3MJ1A 3QC9A 3UYSA 2A1AB 3QYWA 3BGPA 3C0GA 4D1XA 2IW6A 3MH2A 5AUWA 3MVHA 2FSMX 5ETIA 3BLQA 5CEQA 2XJ2A 4O0UA 4L3LA 4OAVB 2NPQA 2R0UA 3DKCA 4I3ZA 3UO4A 3JYAA 3QD0A 3TKHA 3VBWA 1XR1A 3IDPA 2OICA 5HI2A 3DBQA 4OTGA 3QGWA 4F7NA 3F9NA 3MWUA 2GNLA 2RFSA 2W5BA 5CVGA 2J4ZA 4IH8A 3C4CA 3F2AA 3MFRA 2IN6A 2VO0A 2JBOA 3FJQE 4LV8A 3F82A 5DG5A 4BCIA 3QQFA 5K5XA 2JAMA 4U5JA 4E4XA 2VTHA 3CY3A 3PA5A 4K77A 4X21A 4ANBA 5BYZA 5FM2A 4JRVA 2GTMA 3CR0A 4Y46A 2UW6A 3LQ3A 3AD6A 4M67A 3DTWA 3TXOA 3VW6A 1QPCA 5DWRA 3DLZA 1CM8A 4R6VA 5H2UA 5ETAA 3NUSA 4DF3A 2OLCA 4JX7A 5M4IA 4MBLA 4BHZA 1H1RA 3FI2A 3GGFA 2GFCA 4FNYA 5AUTA 2W1CA 4JAIA 2BDJA 3OVVA 5E92A 2VTQA 5A54A 3PXYA 1FQ1B 3OWKA 1MRUA 2PVHA 4KWPA 4BWKA 4UMUA 3HYHA 5GZ9A 1V0PA 3HEGA 3D5XA 4O84A 4FV0A 4EYMA 3UQGA 3H9RA 3VHEA 3MJ2A 3QQHA 4F64A 1J1BA 2HWOA 4QP2A 5CQUA 1BYGA 3H10A 1LUFA 1PXPA 2F9GA 5FD2A 3TTJA 2VO6A 3W55A 2XIXA 3EZVA 3CBLA 4RWIA 4FL1A 1YI3A 2AUHA 3OCGA 1FGIA 4FEWA 3QCXA 5E91A 5DYJA 4NK9A 2C6EA 4P5QA 3NVKI 3D9VA 4IWPA 2CSNA 3P7BA 4YLKA 5ANDA 4CCUA 4BDAA 5C4LA 3U9NA 5K4IA 1GZNA 2YACA 3UP2A 2BFXA 3C0IA 5JRQA 3ZFMA 4CTBA 5KHXA 3UOKA 4YSJA 2PZPA 5CSHA 5C8MA 5AP3A 5TF9A 4GIIA 2E2BA 3EWHA 4RX8A 5DOSA 1PMNA 1OPJA 4L00A 4C4EA 2CLXA 2FO0A 3VN9A 3AGLA 4ZLZA 3PIXA 2OKRA 2IVVA 4I41A 3HAVA 4FV8A 4S30A 3FY2A 2GCDA 3JS2A 3QA8A 1UNLA 2GHLA 4O6LA 3TI1A 2Z7SA 3ZEPA 2JITA 3E3PA 4KNBA 3NUAA 4CV9A 4Y95A 2ZAZA 5DNRA 4AACA 3U4WA 5HICA 3NNXA 3RPYA 3LAUA 4JQ8A 4X3FC 3L1SA 2VV9A 4OTPA 4FKTA 4C4GA 4FL3A 4AZEA 3W10A 4TKSA 4M69B 1IAJA 4S2ZA 5GZAA 4YLLA 1P14A 2C3KA 4LI5A 3DAJA 5LARA 3QAME 3WF7A 3C4FA 3PJCA 4XUFA 4BWXA 1KE7A 3C5IA 4FSYA 4EWQA 5BYLA 5C4KA 3PA4A 5CT7A 3SG9A 4RJ7A 3U4UA 1YWNA 4C37A 4WBBB 3IK3A 3O8PA 1VR2A 1UA2A 2J90A 3HNGA 1PYEA 3JY9A 5HU3A 4YGAA 2YM5A 2GQSA 1NT2A 2I1MA 2YABA 2JLDA 1YHVA 3LMGA 5CEKA 3D5VA 2XH5A 3FLSA 1BI8A 1Q61A 1GZOA 4BIBA 4E6DA 4AOJA 2PVFA 3HV3A 4CZUA 4GJ3A 5DFPA 4EOMA 5AUYA 4PPCA 2YCRA 3AMBA 3HLLA 4KIOA 4ENYA 2VRXA 3FHRA 5LVNA 3ULIA 4Y85A 1Q8ZA 4KIPA 4KS8A 5CSXA 5FUTA 3GCSA 2PPQA 3KQ7A 4ZEGA 4EBWA 5FXRA 5FM3A 2Y6OA 2YCSA 4DGNA 1GY3A 2C4GA 2OBJA 3EQPA 3D2IA 2C5XA 3ORNA 1J91A 2F57A 4ERWA 4QP3A 4CFXA 4EH7A 3UO6A 2P2HA 1R78A 4OT5A 5HHWA 2BTSA 4EH9A 3ZXTA 4E4MA 4LRJA 4FTUA 3HP2A 3LCTA 4WUAA 5BUEA 3FXZA 5KUPA 5M07A 2J0LA 4NZWB 3BIZA 4ZY6A 3O17A 3JXWA 4NM3A 5HBEA 3IW7A 1GIHA 5KKRC 3K3JA 4FT0A 2X7GA 3UTOA 4IDVA 3GFEA 5FRIA 4HZSA 3DOGA 2QOQA 3O7LB 4BZNA 4DH7A 4CYIA 3TJDA 3F5GA 3UVQA 4AN9A 4O1OA 3EOCA 4RG0A 3DXPA 4TL0A 2NRUA 2ERZE 3P9JA 4Q9SA 4XX9A 4O6EA 4ASXA 1OB3A 3LJ0A 3VHKA 3EB0A 5DGZA 4OAUC 1QPJA 2GNJA 3LFSA 1KE5A 3LE6A 5DR6A 4HVGA 4RC3A 1YQJA 2VWWA 4CNHA 2QU6A 4J8NA 1OKWA 4C33A 4GU9A 5IH4A 4M13A 4EK3A 4BY9E 4BI1A 4DFYA 4A4OA 4GKHA 2F7XE 1XBBA 3CS9A 4ZY5A 3R7GA 5IQEA 4UYAA 2OF4A 5EM8A 2V5QA 1KE6A 3ZBFA 3DCVA 4EL9A 3PXFA 5AV0A 2VTNA 3QX2A 4QMVA 3WF6A 2WKMA 4RVKA 2Y7JA 5IF1A 4XRJA 4U40A 3PPZA 5FBOA 4IFGA 2BZJA 3MSSA 4FV3A 3DKFA 4PX6A 5FG8A 5FTOA 4D5HA 5JQ8A 1M2RA 2PZRA 2F7EE 3QQKA 3W33A 2FSTX 4MWHA 3HZTA 4EK4A 2CN8A 5FBNC 3WOWA 3ROCA 4ANMA 3R9RA 3SGCA 4E8AA 3IW6A 5CLPA 2JAVA 1FBNA 3C4WA 2UV2A 2YDJA 4XG6A 2V55A 2HYYA 1V1KA 3EN7A 3EQHA 3TACA 5A4LA 2WMVA 1TQPA 2W5AA 2XBJA 1ZOHA 3CXWA 1FVTA 4FUYA 3ORKA 4MYGA 4QMTA 4BDIA 3GI3A 2W9FB 3HA8A 1ZY4A 4P2KA 5CYIA 3MN3A 3AMAA 4ENXA 2R3OA 3NW5A 4O22A 4ZTLA 4RX7A 3W32A 3PVWA 3BBWA 1U54A 3JPVA 3B2TA 4KRCA 2QC6A 1XJDA 5H8EA 3OCSA 3KB7A 5ANIA 3OCTA 4HYSA 2UUEA 5LXMA 5CXZA 3GVUA 4GFMA 4FKJA 3POZA 4IZ5A 1H1PA 4FNWA 4YO4A 4OTWA 3WBLA 2C3JA 2XIRA 3JUHA 1YVJA 3R21A 2OJGA 3FI3A 4G3FA 3NNUA 4TYHA 3FLQA 3NYNA 3OOMA 3FMLA 3NW6A 4Q5HA 1Y91A 5IDPA 5IPJA 1JKSA 3NSZA 4F6UA 4R7BA 4I5PA 2XBAA 4FTLA 5AR4A 3ORIA 3R1NA 1WZYA 2A27A 1LEZA 3QTSA 5F20A 5IQAA 5KBRA 4Z7HA 4OTDA 1YRPA 3Q9YA 3ORLA 5GJDA 4GUEA 1ZYDA 2XKFA 4LGHA 5HX8A 4TNBA 3GP0A 2JGZA 1RJBA 3RPRA 4AA5A 3QCSA 2ITZA 4CFMA 1NA7A 3QZFA 4P7EA 4RWKA 5FP6A 3PY1A 4DTKA 1REJA 4QOXA 4QYHA 1CDKA 5E8YA 1ZWSA 2HXQA 3EL8A 4H3BA 3QTIA 1A9UA 2RFDA 4FI1A 5J95A 5TR6A 3W8LA 4BBMA 2OFVA 1EH4A 4FKPA 1UU8A 3LHJA 3IW8A 5C1QB 4BRXA 5M44A 3BHUA 1JQHA 3R7VA 4AW2A 4ZTMA 2C3IB 2H9VA 3FSFA 3K2LA 3HVCA 4D2SA 1W82A 2VU3A 3V3VA 3TJCA 3ZH8A 4EYJA 3W2SA 3MFSA 3PG3A 4YNOA 4Z9LA 4AA4A 4O27B 4D2VA 5G1XA 4BCGA 3ZU7A 3DGKA 2H34A 3GC7A 4XV9A 3KU2A 3GEQA 5D10A 4CKJA 2V22A 4K1BA 5HIEA 4UX9A 1K3AA 2UW0A 2O63A 3TM0A 2QOOA 1JKKA 4RMZA 2IVTA 5TKDA 4DC2A 3KULB 3VBQA 5GIOE 2EU9A 3GT8A 1YXVA 4ALUA 1PXLA 4ZTRA 3LFDA 2HW6A 2PL0A 3NGAA 3ZM4A 4ZJIA 4FZ7A 2E9UA 2QOKA 4DT8A 5EKOA 5EM7A 1JNKA 3VULA 3PJ8A 4YJPA 2B54A 2ITPA 4FT3A 4LUDA 3R1QA 5TT7A 2BIYA 2RIOA 2YA9A 3QZGA 4I94A 4CSVA 3MY5A 3N51A 2FB8A 4W9XA 3P0MA 3WIGA 2AC5A 1KWPA 3PZHA 3WIKA 3IGOA 4PL5A 4I4EA 1VYZA 2WQBA 2HZIA 4PPAA 3EN5A 5M4CA 3KXXA 3SXRA 3CD8A 4NFMA 3EQCA 4FTOA 5HU9A 1KOAA 4O7NA 2XJ1A 3Q6UA 5E8TA 4CT1A 2W1DA 1A48A 5FXQA 2IZUA 3WYYA 4IJPA 5JK3A 4K2RA 4HVIA 2CKQA 4HGTA 4ZLOA 3FXXA 2PUUA 4UMTA 5FP5A 4YTHA 5HLPA 3NIEA 2FUMA 4DLJA 5AP0A 3RAKA 4G34A 4C3FA 4C2WA 4WHZA 3KRWA 4M12A 5DMZA 2R7IA 2B1PA 4J71A 5AR3A 5BX0A 3OG7A 4RIYB 3LFBA 4R1YA 5AIRA 5CF5A 1U4DA 3M42A 3DXNA 4C4FA 3ORPA 4LOQA 3ZC6A 2OIDA 3IW5A 4JT3A 4ACCA 4OR5A 1NW1A 1G8AA 2R3IA 2IPXA 4FEVA 4X0MA 4UWBA 3A62A 3UP7A 3ZUTA 4AOIA 4Z16A 1PXMA 3EZRA 3SG8A 4YC6A 1CKJA 2EB2A 4GK3A 4IWQA 4MXYA 3V5TA 1KOBA 1ZYSA 2PE2A 4F08A 2PVKA 3LFNA 4FMQA 3AC2A 4JQEA 5F4NA 2FYSA 2R3PA 3MV5A 4NW6A 3RINA 1WBWA 2F2CB 2KTYA 4JR7A 4BCOA 4QP6A 2YWVA 2R3NA 1Q3WA 3U9CA 5AR5A 5ETFA 3KMMA 3AC1A 3RK5A 1YXSA 3ERKA 4DH5A 5AEPA 2EUFB 2Y4PA 4W8EA 2XP2A 3IGGA 1E1VA 3DBFA 2Z02A 2X8DA 3IDCA 2YERA 3Q9ZA 2BZKB 3MTLA 4G1WA 4BHNA 3LKMA 2XCKA 3CTJA 2R2PA 4G9RA 4E1ZA 2WO6A 2XA4A 3OXTA 4ALVA 1H08A 4AE9A 2VAGA 4RQVA 5IZFA 2Z60A 5EHYA 3SW7A 3ZTXA 1KUTA 1H8FA 1XH9A 3TNWA 4I92A 5CEMA 3R73A 5LVOA 2W17A 1BKXA 4U7ZA 2XJ0A 3DLSA 3S0OA 3UMXA 1YOLA 3HL7A 2O8YA 4MQ1A 4B8MA 2OJIA 3QALE 1ZMWA 4EHGA 5BVNA 5CZIA 4FTJA 3QUEA 1PXKA 2Y4IB 4W8DA 3EIDA 3ORTA 3V6RA 2CGVA 5K0XA 4RFYA 3K5UA 3Q2MA 5J87A 4ANQA 4BCQA 4CG8A 3P7CA 5KBQA 2GQRA 1XH8A 5EM5A 2J7TA 4G3CA 5I9ZA 3NW7A 4I6HA 3UIMA 2XNBA 2R3FA 4FKLA 4HVDA 3A8XA 3TUDA 1OITA 5E8XA 4J99A 2EXMA 4MVFA 1ZRZA 5JH6A 3DS6A 3G51A 3MPMA 4AUAA 2C0OA 3BWJA 4GYGA 4GK4A 4C62A 2VTJA 4DGLC 3DBDA 1XBAA 2YAKA 3I0QA 1LP4A 3Q60A 4RLKA 4YBJA 3E87A 3TNIA 1WVXA 2QG5A 2YM7A 5BPYA 4GT4A 4F65A 4YP8A 2VX3A 2WQEA 4YUQA 2JC6A 4RJ5A 5HNBA 4FIFA 3OBGA 3UJGA 1HCKA 4CRLA 2QLQA 2AC3A 3UODA 3COHA 4WT6A 4YHJA 3DB8A 2PUNA 4FYNA 2WTVA 4NFNA 1OI9A 3NIZA 5EDQA 2VN9A 3A8WA 3K54A 2OXXA 4JAJA 4AFEA 4AOTA 4EOSA 4BDJA 2E9NA 3A4OX 4WIHA 3RZFA 4HW7A 2F4JA 3AC5A 4G5PA 5CAQA 4DEIA 4OTQA 1YDSE 5IQCA 1S9JA 3PDTA 2CHLA 3FMDA 3E88A 4HCUA 3MIYA 2JIVA 3RM7A 3ODZX 2X0GA 4FIHA 5L4QA 3A7GA 4J8MA 2UW7A 2OFUA 2UVYA 5EDPA 4QQJA 2HOGA 3VS2A 1XKKA 4EK5A 2V7OA 3UOJA 1R1WA 2WMXA 4AG8A 2J0KA 5I9XA 5E1SA 4CKRA 3S3IA 5FWKK 1ERKA 4O83A 3PJ1A 3SDJA 3MH1A 4U45A 4LQMA 3ZUUA 3DAKA 3MVMA 3NLBA 1BLXA 2G2FA 5CF6A 1TQMA 3PVUA 2B9FA 4D5KA 4XG4A 3A61A 3TKUA 2A0CX 4J52A 3CLYA 1YOMA 2ETMA 1URCA 3I7BA 5GNKA 3THBA 4AA0A 3LW0A 5C9CA 3EFLA 4AGDA 4I4FA 2R64A 4ACGA 2RFNA 3UVPA 4Y5HA 5A4QA 1H00A 4UZHA 4ZY4A 5AP7A 3RMFA 3UBDA 4XG9A 5IA3A 1UKIA 2Z8CA 5ANOA 2G2IA 3PG1A 4QO9A 5FTGA 2OGVA 3DXQA 4FZDB 4IFCA 3Q4UA 2R3QA 3GCQA 2XNPA 3UIBA 3Q96A 3QRIA 4QQCA 3FLWA 3EL7A 4MTAA 2IW9A 5JFWA 5C8KA 1Y8YA 2BRGA 4LM5A 2C5VA 4CZYB 2PMIA 5KMLA 2CKEA 3QXOA 4FZAB 4RLLA 4YNEA 4D0XA 5DT3A 4V0GA 4O0YA 5IUIA 2BAJA 4ORKA 3BZ3A 3F3WA 2NP8A 4Z55A 4UV0A 4F4PA 3MFUA 2PZYA 4YJVA 1LR4A 4LG4A 4I5CA 4IXPA 3NUNA 5CS6A 4EOKA 1RQQA 3QTQA 4I5HA 4QMLA 5JFSA 3NYOA 1R0EA 4E93A 4DEHA 4ZP5A 1ZMUA 4BDCA 5AM6A 4IAZA 4RWLA 2OG8A 3BHTA 3P79A 3MGYA 1AQ1A 1WBOA 2ZOQA 2XNGA 4K9YA 4M0YA 4R77A 3I1AA 2ITWA 1ATPE 2QOIA 4DBXA 4II5A 3U55A 5HKMA 3PTGA 4ERKA 3O50A 3BI6A 5CSWA 2PVJA 1UWHA 3N9XA 4UBAA 5DRBA 2J51A 3V8TA 1WAKA 5L2IA 2WOUA 2UZLA 2GU8A 2WAJA 2C5OA 2C6OA 4ZK5A 1OL5A 5K3YA 2C69A 5A4EA 4R78A 4PTEA 3L8PA 4M97A 1UU9A 4NIFA 3B8RA 4BIDA 4AE6A 4GK2A 4FSQA 4IZ7A 3BCEA 4MHAA 3QZIA 1OL1A 4IVAA 4KBAA 4QYYA 2GHMA 2O0UA 3FV8A 1H27A 4BTJA 4YTCA 5IQIA 4EONA 4RZVA 2GPHA 4TN6A 4BCFA 4IB0A 3AC4A 2ITYA 5JQ5A 1QCFA 2B4SB 3VRYA 1OIQA 2ITXA 3BEGA 3ZLXA 3ZZEA 2WQNA 1ZARA 4GIHA 2IZRA 3SA0A 1JBPE 5DHJA 2QU5A 4BTKA 3O8UA 5DEYA 1Q99A 2OJJA 4CTCA 5JMSA 5J7HA 4NEUA 5AUXA 2VNYA 3TKIA 4JG6A 2OK1A 3II5A 5CENA 1IAHA 3T9TA 4UB7A 2P0CA 4YC3A 2UZOA 3VBXA 4B8LA 5CAUA 1MUOA 2QG7A 4LMNA 4O7ZA 4KD1A 1H1WA 1PXNA 2XNOA 4XV1A 5K0KA 5IEYA 1ZLTA 2WEVA 4O1PA 4W4YA 4BCKA 4FODA 5KMMA 1SNUA 3R28A 4M66A 5L2TA 4J95A 2CKOA 1AGWA 1W84A 4IZAA 4O38A 4QPMA 4ASDA 3I0OA 1YI6A 2E9PA 3WF5A 2HCKA 3HA6A 1S9IA 2QCSA 3L8VA 2E9VA 2R0IA 4KA3A 1L3RE 4C8BA 2PYWA 3LCDA 3MA3A 3U6IA 3U8WA 3V5QA 2ERKA 2VWIA 5C03A 5JGDA 1PF8A 3T3UA 5AA9A 1H01A 3P7AA 4BI2A 3QD3A 1RE8A 3QHWA 4HJOA 4WUNA 5M4FA 4K18A 3UIXA 4K33A 4TYGA 2J0MB 3OTUA 3OY1A 4XP3A 4WSYA 2WGJA 4ANNA 4K0YA 5IQGA 1MRVA 3BKBA 3WARA 3R01A 3SV0A 5CF4A 4LYNA 3FLNC 5CSVA 3NRMA 2C0IA 1OBGA 4AZWA 4HOKA 5M55A 2ZM4A 3A7HA 4HGEA 2YM6A 5AV3A 3ZO3A 5EG3A 4GVJA 3DBEA 3GU5A 2C6KA 5DE2A 3WZEA 5BVFA 5FDPA 4BCHA 4BYJA 4I93A 3HMMA 3HMNA 4RA4A 2ETKA 1DAWA 3H9FA 4X7QA 3VJNA 2XS0A 3R7YA 3UPXA 4BKYA 3OBJA 3Q52A 3FI4A 4BDDA 4F63A 4RJ3A 4YJNA 4IAAA 2BRHA 3Q9XA 4QMOA 4UXLA 2ITOA 2YM8A 2O5KA 3V5LA 1U54B 2EVAA 4FVQA 5GINE 2ZV9A 4MCVA 5IMXA
chains in the Genus database with same CATH superfamily
4EQCA 2YLFA 1Q5KA 4X2GA 3I79A 2WQOA 2C6IA 3KKVA 1W8CA 4PPBA 5HBHA 2XYNA 4GFOA 4XJ0A 5GJFA 3TV7A 4AAAA 2Y0AA 5CF8A 5BYYA 4NYEA 4IVDA 3SX9A 1H1QA 5IUHA 5I9YA 3I6WA 4HNFA 4MXCA 4QMPA 5HE3A 2V7AA 4MH7A 4YJOA 1Y6BA 3C4ZA 5DR9A 4BBFA 4ZZOA 3ZFYA 3DZOA 3OOGA 2VNWA 4F99A 4TYHB 3GCPA 3NEWA 4DA5A 2IVUA 3ZFXA 2WFYA 3BHYA 3VS5A 4RFZA 4EK8A 1URWA 4FGBA 4LGDA 5H8GA 4MBJA 3ZLYA 4IWOA 5LWMA 4G5JA 3R7OA 5CXHA 3U6HA 2RL5A 3LFQA 2ITNA 5CQWA 5M56A 4BF2A 3Q6WA 4AP7A 3H0YA 4IZYA 3MI9A 4WG3A 3ZS5A 4AGCA 4Z3VA 4DHJA 4P5ZA 4DAWA 2CKPA 3DAEA 2OZAA 3R9OA 4O91A 2Z7RA 1B39A 3MBLA 5EQPA 4YZNA 3LVPA 4YHTA 1VYWA 4D1SA 3DK6A 2ONLA 3VS1A 2OF2A 2WTWA 5EW3A 4DH1A 4TWOA 4LV5A 2W06A 2X81A 4LMUA 3OHTA 5CU4A 4B7TA 1O6KA 2XNEA 4RGJA 3FMKA 1DM2A 4APPA 4L45A 1Y6AA 3UNKA 3W0SA 3WF9A 4PNKA 3FUPA 4IBMA 1H26A 1M52A 4WG5A 3GENA 3P08A 4WOVA 3R7EA 3W0PA 1YKRA 4U43A 4UWYA 4AW5A 1IA9A 3R71A 4NM5A 3RK9A 5AJQA 5DI1A 3F7ZA 4XV3A 2IO6A 3BGQA 3F88A 4XRLA 3E7OA 3SVVA 4WNMA 5AAFA 4TW9A 1GNGA 1KE8A 3W1FA 2UZVA 4RIWA 2PVNA 3ENMA 1MP8A 2XVDA 3BU3A 5IA4A 2W4JA 4Y5QA 1BUHA 4ZMFA 5EI8A 2FA2A 4EHZA 5A9UA 1G5SA 2ACXA 5E8WA 1R39A 1ZXEA 5IQBA 5K5NA 5M08A 1GIJA 2XYUA 1UV5A 4GV1A 4QMMA 2BZHB 5FGKA 3DDPA 1XH5A 2DS1A 3BHHA 3DPKA 2W1IA 2HZNA 1Y57A 3W2PA 3PWYA 2PK9A 1APME 2GMXA 2GNIA 2XEYA 2Z7QA 3MYGA 4BGGA 4K6ZA 3SHEA 3JVRA 3FLZA 3TZMA 4BC6A 4KRDA 3GU7A 4IX5A 3HX4A 1SNXA 4IM0A 4PF4A 4ZJJA 4ARKA 3AD5A 2ZV2A 4XP2A 4L9IA 1DS5A 5EYDA 5HNGA 3LMHA 5T3QA 1WFCA 2EXEA 2W4OA 3L9MA 3FQHA 3G0FA 4IVBA 4USFA 4ZZNA 3ZMMA 3S95A 4RFMA 3V5JA 2XKDA 5D1JA 2XNMA 3D2KA 4DFZE 4N4SA 4FSWA 3OF0A 3UOHA 2R3LA 4A07A 5L3AA 5LWNA 4I24A 4QMNA 2BCJA 4C7TA 3PRIA 3N4UA 3OW3A 2PMLX 2WPAA 1T46A 3Q32A 4OLIA 2DWBA 2X39A 2HXLA 4JIKA 1CTPE 3BELA 3MW1A 4GSBA 5HVJA 4L68A 4IVCA 4QNYA 1JSUA 4CKIA 3MH0A 3MH3A 3TDWA 5EQYA 3QQLA 4HYHA 1M7NA 3CEKA 4EHVA 3R9HA 3E8NA 4HCVA 5AP1A 5L6PA 2FVDA 3R63A 5IH5A 5I0BA 2XF0A 4NTSA 2W0JA 3DKGA 3NZ0A 4N6YA 2J0JA 4WNOA 5JRSA 5AP2A 5KMIA 1G8SA 3GC8A 2XRUA 4F7LA 1P4FA 3F3TA 4CFVA 4HGSA 2YLEA 3PFQA 4IC7A 4D9TA 5JEBA 2YIYA 1IRKA 3QRUA 4CT2A 4C59A 4DHFA 2XCHA 4JBVA 5CALA 4QDVA 2R3RA 3D94A 3ZM9A 4KIKB 4GS6A 4BDHA 4OUCA 1YWVA 2HENA 2X2LA 2YIWA 4XG3A 3G90X 3QKMA 3MIAA 2XM9A 1W7HA 3CQWA 2CCIA 5J8IA 3T8OA 3F5PA 4FVPA 1W2DA 4EQMA 3TIZA 1U5RA 3TZ7A 1H07A 5D12A 2A98A 3COKA 3UVRA 3F7WA 2GFSA 3MPAA 2IWIA 3KF4A 3OCBA 3VUMA 1OPLA 3EKKA 1M14A 4AS0A 4MBIA 5LMAA 3KXZA 3KN5A 1ZMVA 2P33A 2W1HA 4MF1A 3D0EA 3GC0A 2ZMCA 4NM7A 4QMYA 4C58A 4QPSA 4F78A 1JAMA 4D2PA 4LGGA 3CTQA 3FMMA 2XM8A 3PE2A 1CMKE 4KS7A 4RRVA 3U6JA 2VD5A 4X2NA 4YSMA 5M57A 4QTCA 4DLIA 5HOAA 3SRVB 5J1WA 2X7FA 2ZB0A 2XALA 2OXDA 2X4ZA 1NVRA 2YCFA 1FINA 2YITA 4JXFA 4BCJA 3SW4A 4DFNA 4IB1A 5J1VA 1X8BA 3E63A 2J2IB 5DN3A 1OKVA 2YISA 4DYMA 4EOIA 5L8LA 2WTKC 1M7QA 3CD3A 3DNEA 3KCFA 3HMPA 4IW0A 4MKCA 2ESMA 3NR9A 3PPJA 3JY0A 2WTDA 3CQEA 4XP0A 3R8LA 4CQGA 4MD8E 3QUPA 3EQRA 4LL0A 3WZJA 4JBOA 2GS6A 3GQLA 4YZ9A 3RZBA 4I0TA 1R0PA 2VWYA 2HY0A 3EFWA 4N6ZA 5DBXA 3DY7A 3W0OA 2OO8X 3UQFA 4DE4A 5HLWA 3CPCA 2C6LA 4GMYA 1T45A 2PSQA 2HWPA 2Y4IC 5KMJA 2RGPA 4XLVA 4GU6A 5LMBA 1P2AA 3D4QA 3O0GA 5EK7A 3ZOSA 4QMQA 3C4XA 3IOKA 3NAXA 4DINA 5I9VA 2PMNX 3KMWA 4PP7A 4ZJVA 2P4IA 3FC1X 4O82A 3C5UA 5CAVA 5LVLA 3DJ6A 5FTQA 3RHKA 3KF7A 2QODA 4UALA 3FWQA 4FIGA 5HD4A 5BNJA 1SM2A 1P5EA 3IOPA 5J5TA 2O3PA 3GU8A 4NSTA 2C5NA 1Q8TA 3B2WA 2W5HA 2CN5A 4FTAA 3NUUA 2W1ZA 4RJ6A 3RCJA 4FL2A 4Z7GA 1TKIA 4YTIA 1XBCA 4O0RA 4DT9A 3I81A 4AX8A 1ZZ2A 4XNEA 3ZO4A 4ZAUA 3VUGA 2PVLA 4X3FB 3FBVA 2IF8A 4J7BA 3VAPA 2B52A 4OBQA 3BYMA 3VO3A 5CSPA 3UQCA 2WQMA 4D1ZA 5IMEA 4JMQA 4IJ9A 3LJ1A 3ZDUA 3FI8A 1GOLA 5AAEA 2GHGA 3FKOA 2IEWA 3R1SA 4QT1A 4WKQA 3FZ1A 4IHPA 5EOBA 3RNIA 3F2RA 4NL0A 4WD5A 3PPKA 3M11A 2I7QA 3TT0A 2A19B 3I7CA 4S33A 4EKKA 3LFAA 4UXQA 3AQVA 3R8MA 3QQUA 1W0XC 2J5EA 3HRCA 3ZONA 3OUKA 4LV7A 1WMKA 3F6XA 4FSZA 4FTKA 2XK3A 3RWQA 4BL1A 4ZSAA 5E8ZA 3H9OA 4U81A 4IEBA 4O7WA 4JX3A 3BU6A 1Z9XA 4BKZA 4CD0A 3BLHA 5HG8A 3V5WA 2CMWA 4FEQA 2QVSE 4RZWA 1A06A 3NUPA 2WMTA 3G5DA 3BE9A 4NJ3A 3SOAA 4O0TA 3CCNA 3VWAA 4O86A 3HDNA 2WTJA 5T6KA 4I1ZA 3NNWA 3WE8A 4FV2A 2ONLC 4FSMA 3COIA 3PJ2A 3KK8A 2G9XA 4E5BA 2P2IA 3TIYA 3CP9A 3ZRMA 3C9WA 4D4YA 4F9CA 4IE9A 4FA2A 4V0GB 3DBCA 5LQFA 4I6BA 5EH0A 4MNEB 2OZOA 4KKGA 2ZYBA 4WA9A 1BX6A 1OIUA 3EQFA 3UDTA 4JNWA 4O96A 4H58A 3REPA 4FTCA 4FV6A 1RW8A 2LAVA 5CEOA 3HMOA 3KN6A 2C47A 4A9SA 4FUXA 4UMRA 5KKRB 3KGAA 4DGMA 3FZPA 4AT5A 4D2TA 4U6RA 1ZZLA 3MDYA 4QMUA 3W0QA 2PE1A 5FDXA 4X2JA 4G3EA 4KABA 3DJ5A 4IACA 4M3QA 2YIXA 3AT3A 4QQ5A 3WI6A 5CAPA 5J9LA 3FZSA 4GKIA 2VWXA 3UZTA 2YM4A 3RP9A 4KUJA 4G9CA 4K11A 4CMTA 3I6UA 3MVJA 4CZTA 3BV3A 4FT7A 5CANA 2OSCA 5IQHA 1H0WA 1NVQA 1REKA 5L2QA 2WZJA 4BDGA 2YCQA 2BZIB 4MF0A 2XEZA 4Y83A 2JDVA 5G6VA 3RALA 3D7ZA 3CQUA 3TDVA 4EUTA 3ZLSA 4Q5EA 5HZNA 1JVPP 3PJ3A 1NVSA 3IKAA 4FZ6A 5IU2A 3T3VA 5J9ZA 2BMCA 3QL8A 5AV4A 4ACMA 2UZDA 2WTCA 1XO2B 4CLIA 4L3JA 4DTAA 1SVGA 4UMQA 2VTRA 3Q5IA 4O4BB 4G3GA 3G15A 1H28A 4JR3A 3BV2A 5D7AA 5CEIA 5JFVA 2CCHA 1OM1A 1OBDA 4U3YA 4FT5A 2XMYA 4N0SA 4PQNA 3NX8A 5KMKA 3TWJA 3ODYX 1IG1A 1VZOA 4I6FA 5ANEA 3ZRLA 4WG4A 4ZTQA 5CX9A 3R02A 4U8ZA 2PUIA 4PDPA 4F9YA 4LRMA 4YJUA 4XBUA 2BRBA 4FX3A 3RPSA 2QHMA 3IO7A 4DCAA 1PW2A 5EYKA 5A6NA 1OIRA 5DEWA 4FC0A 1NXKA 4XOYA 4O7VA 4U0IA 4QP1A 3ZYAA 4J96A 4YLJA 4FZFB 3BBTB 1HOWA 5H8BA 5LOHA 2BRMA 2VWUA 2BFYA 3F5UA 3UDBA 4YPSA 1JOWB 3EH9A 3LZBA 1XH7A 3H3CA 3RBWA 3W2OA 3CKWA 4FF8A 2YJSA 3OWPA 3ZSHA 4DH8A 1OPKA 1I09A 2YFXA 3QRTA 4JG7A 4AQKA 4R7HA 5HE1A 2XUUA 5AFVA 5DVRA 1ZYLA 3LJ2A 4BBEA 4EOQA 5AA8A 3EJ1A 4USEA 3NDMA 3BYVA 5L6OA 4FNXA 4HPUE 4XH6A 4EWHA 5GJGA 5E8VA 4YMJA 3DKOA 3FXWA 1WBVA 5JZJA 5DLSA 4F6WA 5KHWA 5IA0A 4BCMA 4MXXA 2OJ9A 1UWJA 2HZ0A 3BRBA 3IDBA 3BQRA 3DFCB 4RJ4A 3ET7A 3R00A 4LRKA 4EORA 3TEIA 4R3PA 2JKMA 4CFFA 2VZ6A 2VTIA 4IWDA 3RI1A 5BUIA 2NYAA 4L8MA 5JN2A 5HCXA 3LIJA 3ORMA 3H4JA 2FSOX 4F9WA 2QI8A 3K3IA 4PMPA 4MX9A 3RAHA 3R8UA 3QTUA 2DUVA 2YN8A 3CE3A 3QKKA 1OKYA 4HCTA 1J7LA 5HX6A 3M1SA 5HVYA 4A4XA 2GS2A 4PRJA 3EHAA 2UW4A 4ZSEA 4RIXA 4HVHA 4JOAA 3PE1A 2O65A 1SVHA 3BYOA 2B53A 3D15A 3QLGA 4GW8A 4LUEA 3MB6A 4MXZA 3WYXA 3AT4A 3VS4A 5M06A 2X0QA 3LOKA 4BDBA 2HELA 4DDGA 4FG8A 2VTOA 1LEWA 3FLYA 2G15A 3OXIA 3Q3BA 2QQ7A 1PKGA 3W18A 4ACDA 4C4HA 4D0WA 1YXTA 4PTCA 3TZ8A 5LJJA 3GCUA 4AGWA 4ZLYA 2V62A 5DR2A 4DGGA 3HV4A 4WBOA 1M2PA 4AXFA 3W2QA 3L9NA 3LFEA 1M17A 3CIKA 3MFTA 3QQJA 5ITAA 3BLRA 2QHNA 4E4LA 4IANA 4BFMA 5J5SA 4QYGA 4UMPA 2FSLX 3GBZA 3ANRA 2R9SA 3E8EA 4RC4A 4DCEA 4DEBA 5M53A 3FAAA 3PVBA 3ZSIA 2G2HA 3FY0A 4ANOA 4BTFA 3V01A 3AGMA 2UW9A 5AUZA 3TTIA 4KINA 2XZSA 2A2AA 3DJ7A 3I5ZA 4I20A 2UZUE 4XS2A 1L8TA 2HK5A 2YZAA 3QWJA 4ANSA 2OI4X 3BPRA 3OUNB 2Z7LA 4DN5A 2RFEA 3QRJA 3ID6C 3PVGA 5AUUA 3P78A 3NYVA 2BAKA 4CYJA 5KCVA 2UVZA 4FICA 1YXUA 3D5WA 4GEOA 2JD5A 4AWIA 4BJJA 1JWHA 2LGCA 5M09A 4KSPA 4NWMA 4APCA 4ANLA 2OW3A 3ENHA 3QLFA 3DZQA 3W0NA 4B99A 4FV1A 2WXVA 3QD2B 1FMOE 3RTPA 4L7SA 1WBNA 4GJ2A 4BB4A 3EYGA 3LM5A 2VO3A 3BEAA 3IECA 4W9WA 5HVKA 3MVLA 1RDQE 5TOZA 1ZAOA 5EW8A 2UZBA 3OD6X 5M4UA 3ULZA 3FMHA 4QP8A 1OIYA 4M15A 4O7RA 2QOFA 3I60A 4WSQA 5GZ8A 1DAYA 4UN0C 4XLIA 1SMHA 5D11A 4FJVA 5F1ZA 2I0VA 2W1GA 3PIZA 3FPQA 4QNAA 5HQ0A 2UZWE 1MRYA 2R5TA 3KRRA 4C2VA 5HE0A 5TE0A 3C50A 3Q4CA 5CASA 2GSFA 4FIEA 4O0VA 3UYTA 5D7VA 5EKNA 2GNFA 5EHLA 4XOZA 2JIIA 3O96A 4GT3A 2PTKA 5KMOA 4FKQA 3MY0A 3PSBA 5CVFA 1WVYA 4C61A 4EJNA 4E4NA 3A7IA 3QTXA 1SYKA 2BHEA 3BX5A 2QKWB 3KVWA 3Q04A 4QMSA 5J7BA 3UO5A 2IG7A 3RVGA 5BVOA 5CTPA 4G17A 4U41A 2YM3A 3D14A 3HECA 4I0RA 3AXWA 1TVOA 1UNGA 3NNVA 3P5KA 2XAOA 4L52A 1H24A 4YHFA 2WIHA 4F9AA 3EYHA 5E7RA 4AN2A 5C26A 5I3RA 3AG9A 4D58A 4EQUA 1CKPA 3N4VA 1F0QA 3OC1A 5M07A 4TXCA 2UZEA 3CKXA 4O7SA 3WZDA 5A4CA 2I6LA 5CNOA 3ROYA 3PXKA 4P90A 3UZRA 1PXOA 3EFJA 4PDOA 3CSVA 2HIWA 4KKEA 2OJFE 4EHEA 4IIRA 4EC9A 3QX4A 3CPBA 3QFVA 3N4TA 4TWPA 2HZ4A 4WNKA 3BYSA 3VS7A 4CFNA 5HO6A 1AD5A 3RM6A 5DT4A 1HCLA 5L8JA 4EOJA 3EQDA 3NYXA 2VTAA 2BRNA 2ZB1A 5AP5A 4ACHA 2ZV8A 4F0IA 4L01A 3PSCA 4H1MA 4GL9A 4MQ2A 4WO5A 2VWVA 2XIKA 2ZVAA 3OEZA 3DFAA 5H9BA 5EOLA 2JDOA 3R8PA 3C0HA 3PUPA 3KREA 5HESA 4EZ7A 3I4BA 5E8SA 2WMSA 4ZS4A 5E9EA 1VJYA 4R7IA 1O6LA 2X1NA 4JG8A 5EI6A 2REIA 3FL4A 4ASZA 1PY5A 4FSTA 2H96A 3C4EA 4XCUA 4J1RA 4FG7A 2IZSA 3O2MA 4C4JA 3ETAA 3GUBA 3I5NA 4ZSLA 3W0MA 3AD4A 1OMWA 3QC4A 2JKQA 3D7TA 4HYUA 4YJQA 1KV1A 3VUTA 3DK3A 1Q97A 3KXMA 4CQEA 3VJOA 2Y8OA 2XKCA 3O71A 5JGAA 3FHIA 3QYZA 3QTRA 2Z2WA 1JSVA 5KMNA 1OL6A 3AC8A 5IKWA 2YIRA 4C35A 5CT0A 4IDTA 5AR8A 5AX9A 4FTMA 4ITJA 3V04A 5LVMA 3KXGA 3KFAA 2ITQA 3KEXA 2UVXA 3G33A 4O0XA 4TYIA 2X4FA 4E3CA 4F7SA 1BL7A 1ST4A 4PMSA 4ALWA 2X8IA 1PKDA 5E4HA 3MY1A 3RJCA 4PDSA 5A3XA 2W1EA 5JGBA 4H1JA 4OTIA 3LXPA 5ANJA 3LPBA 4WRSA 3QTWA 5IQFA 4QMZA 4Q2AA 4R8QA 4AXEA 3O7LD 4X2KA 3HUCA 4RA5A 4FEXA 3DV3A 2G01A 1UU7A 4YJTA 4JS8A 3R9NA 3PRFA 1G8JA 4FV4A 3KCKA 3LXLA 4PMTA 4F09A 5CWZA 3IQ7A 4M84A 1ND4A 4L7FA 4Y8DA 3IPHA 5EDRA 1XH4A 3TV4A 2J6MA 4KBKA 4EH2A 4MNFA 3F5XA 4BI0A 4FTNA 1OUYA 4AQCA 2WU7A 3EN4A 4R3CA 4JBQA 3NVMB 2X8EA 4GG5A 1ZYJA 5ANKA 4OT6A 5FXSA 3TV6A 4ZSJA 4TRLA 5CU3A 5DH3A 3TNHA 4LFIA 2R4BA 3SOCA 4NCTC 4G6OA 4RT7A 2J50A 3GU6A 3FQEA 4A9YA 3P86A 3ZO1A 2X2KA 4UWCA 5A14A 2XIYA 2E9OA 3MB7A 3CJFA 4PL4A 5A4TA 2JKKA 2XK4A 4W4WA 4AXAA 2JFLA 1BI7A 3CY2A 4QQTA 1F3MC 3BWFA 5KX8A 4D2RA 5KZIA 3O8TA 3EN6A 5KO1A 3F3VA 2CGWA 3A7JA 4AXDA 2V0DA 5K9IA 3R6XA 5A6OA 4IMYA 4EH5A 3C13A 4ASEA 4F0FA 3EN9A 3FMJA 5AV1A 5GHVA 4E6AA 1Q8UA 2CNQA 3S2PA 3L9PA 3TCPA 4C02A 3E62A 4I21A 2WMQA 4DITA 3PIYA 1YOJA 4PV0A 4F7JA 1V0BA 3PY0A 1Q3DA 3V6SA 4RC2A 2ZJWA 2F2UA 4BVUA 3GNIB 4ITHA 4FSRA 2I40A 1GZ8A 4RQKA 1B6CB 3VQUA 4BKJA 5BUJA 4YZDA 3DK7A 3SAYA 1YHSA 4L53A 2QURA 2BIKB 3Q5ZA 4DHIB 4QTDA 4OTHA 5L2SA 3LXNA 4FOCA 4G6NA 5EI2A 4B4LA 4FV5A 5ICPA 5I3OA 3NS9A 1PXIA 1I44A 3R7UA 3ZXZA 3L9LA 3RPOA 3HV6A 1JPAA 3TMOA 3VVHA 2Y6MA 4IB5A 4E7WA 3OP5A 4C3RA 4CVAA 5ACBC 1J3HA 3RK7A 3FZOA 4AZVA 4ZTHA 4YURA 4EOPA 5CAOA 4EZ5A 5HO7A 1R3CA 3GOKA 4KB8A 2R3JA 3G2FA 1QL6A 3TUCA 4RWJA 4YC8A 5EHOA 3TNPC 4BZOA 2JDRA 4QYEA 2QO7A 3TN8A 2WU6A 2WB8A 3FC2A 4RIOA 3V5PA 3SLSA 3AKKA 2PE0A 3OXZA 3E5AA 3FDNA 5F95A 4AZSA 3BQCA 2OIQA 2W7XA 4BDKA 2YAAA 2Q0NA 3P4KA 2YZLA 5DA3A 4JDJA 1Z57A 3VUHA 4R3RA 4GCJA 3V8WA 3NWWA 4OGRA 3VC4A 5AAGA 4H36A 2C6MA 4IX4A 3LXKA 1MQ4A 3FE3A 4FKWA 3VBVA 4EH8A 3QCQA 4XV2A 3OW4A 3EQBA 3HKOA 1E9HA 3MTFA 2YIQA 3WE4A 2BAQA 3O23A 4U97A 4RVLA 3R7IA 3EKNA 5IH6A 5J79A 2QOCA 1YW2A 1XWSA 4G16A 2O64A 2X9EA 3PY3A 3W2CA 1WBSA 1XH6A 2UW8A 1F5QA 3GQIA 2R3GA 4JQ7A 2C1BA 4YBKA 5LVPA 3BYUA 3BGZA 2PVYA 4LOOA 5AP4A 4BR3A 5IEVA 4NU1A 4TYEA 3L8XA 5HTIA 4A4LA 5C8NA 2ZV7A 4JBPA 4X6QC 2PY3A 4FYOA 4BCPA 5FQDC 3W0RA 4FIJA 3FMNA 4TWCA 5BVEA 4EJ7A 2VTPA 2ETRA 4PP9A 1P4OA 3P23A 3W16A 4DH3A 2XNNA 4FTQA 2IJMA 3OWJA 3LLAA 4H05A 4LOPA 3TNQB 4FV7A 2UZNA 1OL2A 3KA0A 2ITUA 2UW5A 4F6SA 4B0GA 4GYIA 5GIPE 3P1AA 4S32A 4YZBA 4D2WA 1QPDA 3ZRKA 3D5UA 3E7VA 5BMMA 4L46A 3PSDA 2BALA 2JKOA 2QO9A 3EFKA 3MS9A 1G3NA 3R8ZA 2XB7A 4YZMA 4RX5A 3D83A 3VONA 3T9IA 4DEDA 5B2KA 3NCZA 5D41A 2X2MA 1JKLA 4UYNA 3Q4TA 5HBJA 1H0VA 2BTRA 2F7ZE 2GS7A 3NPCA 5L2WA 2C5YA 3F3UA 4X3JA 1YXXA 3LFFA 4ZS0A 3UNZA 3WILA 3MESA 1Q8YA 3TUBA 3ML1A 4XHKB 4OTFA 4F9BA 4QDEA 4F70A 3C51A 4DGOA 4MD9E 2PWLA 2Q0BA 2X6EA 3F2NA 3IS5A 4JDIA 3ZBXA 4BZDA 4C36A 3ANQA 1QPEA 2WMAA 3KXHA 5AMNA 4A7CA 2A4LA 4FBXA 1U59A 2ITVA 4ZIMA 4V04A 4RX9A 1DI8A 3Q9WA 4ZTNA 4YJRA 4B9DA 3HAMA 2BDFA 3QWKA 2VTTA 2OIBA 4C34A 4FK3A 4IAYA 2JFMA 4FKRA 4X2FA 4O7TA 3IONA 4W4XA 5AP6A 3NUXA 5HORA 3OROA 1E1XA 4EZ3A 2X9FA 2QD9A 4L43A 3WZUA 4C4IA 3PP0A 1FVVA 2W1FA 1UNHA 3R04A 4F1MA 3LFCA 4FIIA 4JL9A 4BGHA 3O51A 5CI6A 2W9ZB 3UC3A 5AM7A 4M14A 5LMKA 1GJOA 2BVAA 4GG7A 4EK6A 4BICA 4DFBA 4IAIA 3ACJA 1PMEA 4AU8A 2JEDA 3S1HA 2R7BA 2CPKE 3OT8A 3CC6A 2GNHA 3VUKA 2PULA 2XRWA 4TWNA 2P3GX 4R1VA 2UZTA 3BE2A 5AUVA 3R30A 4FKUA 4D55A 3LLTA 4AZTA 4PTGA 4M68A 4QD6A 4RIXB 3R2BA 2IZTA 3W8QA 4IM2A 3QGYA 3COMA 3FPMA 2PHKA 3LQ5A 4TNDA 4S34A 3U54A 4OW8A 1FOTA 3OMVA 3UGCA 1OGYA 1FMKA 3L8SA 5HG7A 1XQZA 4TZRA 3OS3A 4O0WA 4E73A 4QP4A 4CCBA 3M2WA 1CSNA 2OH0E 5B2LA 2J0IA 3G9LX 5DIAA 3DQWA 1PJKA 2WMUA 3A4PA 4F1TA 3ELJA 3PLSA 4HPTE 4EI4A 3FEGA 2RG5A 4FR4A 4WRGA 2C6DA 4FKGA 2PUPA 4JJRA 4HYIA 3PP1A 4C3PA 5EFQA 3R2YA 3QBNA 3F69A 4FSUA 2C30A 3CTHA 5E8UA 5ACKA 1MQBA 5T68A 3SD0A 4CG9A 2B55A 4M7IA 4E6CA 4H3PA 3SC1A 3NCGA 3VS6A 4UY9A 1PRYA 2YDKA 4AGUA 4MXAA 2BKZA 4RVMA 4O21A 3HUBA 4AFJA 4NM0A 3QZHA 4DG0E 1ZOGA 3E92A 4UEUA 4ID7A 4ZTSA 2B7AA 2EXCX 3UPZA 4DBNA 3PXZA 4H39A 5JFXA 4G3DA 4U79A 5FEQA 3UMWA 3PYYA 4MD7E 1CKIA 1YDRE 3GXLA 4GRBA 5TO8A 4USDA 4EC8A 5KE0A 4CGAA 1J7UA 3MA6A 4M69A 2QONA 1GZKA 2G1TA 2VGPA 3QXPA 2DQ7X 3ORZA 5FEDA 4U44A 3RGFA 4DG3E 4L67A 3QRKA 1LPUA 3UOLA 3TG1A 4E5WA 3ZCLA 1ST0A 1YHWA 3KIOC 3GU4A 5I9WA 1GIIA 3PXRA 4A06A 5CZHA 4ZSGA 2ZDUA 3EQIA 3LM0A 3UNJA 3QUDA 3F66A 3ZC5A 5BVKA 3OEFX 5IG1A 1GAGA 4Q9ZA 4KSQA 5AIKA 2I0EA 4CRSA 4C38A 1VEBA 3GFWA 2IW8A 1K9AA 3NUYA 5EQEA 4QYFA 3H0ZA 3ZLWA 3ZEWA 4K8AA 4ZZMA 5JKGA 1H1SA 4G2FA 5HTBA 2VTSA 3OT3A 3PA3A 2YWPA 5I5ZA 3TL8A 2B9HA 4AT3A 3A60A 1W83A 2BR1A 3DDQA 4RPVA 5BVDA 4RJ8A 1IASA 4PWNA 3WF8A 3ZUVA 2C6TA 3JVSA 4NKSA 4AN3A 5CEPA 1Z5MA 4DEGA 1KV2A 2AYPA 3QD4A 3H30A 4Y73A 5HCZA 2F49A 5AR7A 3ITZA 3VIDA 3BU5A 3KRJA 2IVSA 4NIFB 3E64A 3RCDA 3UE4A 5HNIX 4XEYA 3MPTA 1PXJA 3UG1A 4JIAA 2VWBA 2B0QA 5H3QA 4FSNA 4IX6A 5AWMA 5JT2A 2BROA 4L3PA 3IW4A 4MAOA 4TTHB 2R3HA 4O81A 1KSWA 1PMUA 3QTZA 2WEIA 4PNIA 4L42A 4MWIA 3RNYA 1TQIA 3F3ZA 4I0SA 4I22A 5AX3A 1Q4LA 3E8CA 3KVXA 2C0TA 2EB3A 4FTTA 1VLRA 3B8QA 4IM3A 4R5SA 2O2UA 4F1OA 4YO6A 3HDMA 1JLUE 1ZY5A 3C1XA 2WOTA 3GC9A 2EWAA 1PMVA 4XYFA 4PUZA 2B9JA 5DRDA