2V0UA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (cryo dark structure of lov2 (404-546))
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
b'GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1
molecule tags Transferase
source organism Avena sativa
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
total genus 48
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v0uA00
1P0ZA 2R78A 3MJQA 4MN6A 1OJ5A 1T19A 4H6JA 5DJUA 3C8CA 4HNBA 3F1PA 4NXBA 4WF0A 4R3AA 5IU1A 2KX6A 3BY8A 5HZHA 1T1CA 4I3AA 5J4EA 3LIAA 3NOPC 4I3JA 3UB6A 2PHYA 3ZQ5A 3E4PA 2VV6A 1OTBA 4GHIB 4JGPA 2W0NA 4HP4A 4WN5A 4DJ2A 4F3LA 3LUQA 1G28A 4GS9A 2J80A 5AVFA 3LIFA 3C2WA 1GSWA 4I39A 1BYWA 2PD8A 4WUJA 2M1CA 2V1AA 5DKKA 4HIAA 2YKHA 3RTYA 5HWVA 1TS6A 1OTAA 2P7JA 2EA9A 1F9IA 2V9AA 3MR0A 2PR5A 4RQ9A 1UWNX 5DKLA 5F6AA 4LLOB 3LI8A 1D7EA 3K3CA 1N9LA 4HP9A 4LRZE 1Y28A 2H28A 2A24B 3A0SA 4JGQA 1LSVA 4KUOA 3RH8B 3UMDA 4DJ3A 2PD7A 5TBMA 2V0UA 5I5LA 1T18A 5KIZA 4M4XA 3CWFA 2V1BA 4LPZA 4GCZA 4PKYG 4H6JB 5HWWA 4EESA 1D06A 5HSQA 3F1PB 4I5SA 2I9VA 3CLOA 1NWZA 1S1YA 4XT2B 1N9NA 4R6LA 3VE4A 1S66L 3H7WB 3NJAA 4HJ4A 3H9WA 4EEPA 1OTDA 1V9YA 2KDKA 5HDCA 3SW1A 2L0WA 5AVEA 4HI4A 1OT6A 3E4OA 3EEHA 3K3DA 3PYPA 1DRMA 3HJKA 4NXGA 1LT0A 1OTIA 2WKQA 5F69A 2OOLA 3VOLA 1KOUA 1S67L 4L9EA 3H82B 4KUKA 4WL9A 1X0OA 2QWSA 4L9GA 3UE6A 2GJ3A 3PHYA 1LL8A 1LSWA 3F1NB 2HV1A 5J3WA 1GSXA 1XFNA 2BASA 1S4RA 3FC7A 3IS2A 2D02A 4JGOA 3UB9A 2OWJA 3MXQA 2PYPA 3NOTC 1DP8A 5J7EA 1UGUA 2D01A 2JHEA 3BY9A 4HJ3A 3UMEA 2YKFA 3ICYA 4HH2A 5HD5A 2VV8A 1XFQA 1VB6A 4HY8A 2VEAA 4NXEA 2L4RA 2B02A 3B33A 1LSXA 1N9OA 1OT9A 2K7SA 3A0RA 3D72A 1MZUA 4HOIA 4WLAA 5HWTA 4EETB 4EERA 2PR6A 1JNUA 2WKRA 3MQOA 3KX0X 1TS7A 1T1BA 2PYRA 4GHIA 3LYXA 4HQAA 1DP9A 3MFXA 5HD3A 3UB8A 2JN7A 4F3LB 4GS9B 5A8BA 1S4SA 3IBRA 4LRYC 3HJIA 2V0WA 2W27A 3LIEA 1XJ2A 2L1MA 3LICA 3F1OA 5HDDA 5EFWA 3UB7A 4BBUA 3LIBA 4NXFA 3EWKA 1OJGA 3F1NA 4BBTA 3GECA 1DP6A 3LIDA 3MQQA 3P7NA 1F98A 3IS2B 4MN5A 4YWZA 2A24A 3ULFA 1TS8A 1UWPX 2QJ5A 3NOUC 2Z6DA 3G6OA 4I38A 1S1ZA 2VLGA 4L9FA 5F5YA 4LRXC 4B9OA 3CAXA 5F68A 4E04A 5IS1A 1XJ3A 4EEUA 4EQ1A 1TS0A 3A0VA 4R70A 5DJTA 5G4ZA 3H7WA 2WKPA 2OWHA 1P97A 4HHDA 2PDRA 4XT2A 4KQDA 2VV7A 1EW0A 3OLOA 2ZBBA 4EW7A 3E4QA 3NHQA 5HDSA 4HJ6A 1T1AA 3FG8A 3GDIA 3LI9A 1ODVA 2CMNA 4HH3A 2QJ7A 2ZOIA 4K08A 3VE3A 2QHKA 1XJ6A 3BWLA 1GSVA 4GW9A 2Z6CA 3H82A 4R38A 3F1OB 2QKPA 3T50A 2INWA 4EXOA 5G4YA 4PKYA 1XJ4A 2ZOHA 4JGRA 1V9ZA 1OTEA 4I3IA 4BBVA 5TBMB 1WA9A
chains in the Genus database with same CATH superfamily
1P0ZA 1IYPA 4MN6A 3L7HA 4R3AA 5IU1A 5EECA 1Q2QA 3LUQA 3DBAA 1KVMA 1BYWA 3BQ8A 3LEZA 3LCEA 1TS6A 2ZQDA 1W5DA 4MBKA 4RQ9A 4LLOB 4GLQA 5FEFA 5CX7A 2QMIA 1EWZA 1YPRA 5FQMA 1RCJA 4G3KA 3PYPA 4NXGA 4KZ8A 2BTFP 3AGDA 4E6XA 4DDSA 4EUZA 3I7JA 3LR5A 5DFXA 5CTMA 3IXBA 2OAP1 2OWJA 3FYZA 2LB5A 2PYPA 4MN7A 1UGUA 1IKGA 4B93A 5EM1A 3CMZA 4N92A 4EBNA 1L0FA 3T4LA 4NKPA 3N8RA 4C6YA 1TS7A 1DP9A 4GS9B 4WZ4A 1CI8A 1GHIA 4HBUA 1IELA 3BFEA 1KGGA 2GX5A 4KZBA 1QMFA 1MKIA 3EWKA 4P0MA 4CLCB 1Y4OA 1YMXA 5HX9A 3IS2B 4S2NC 4KG5A 2QJ5A 2Y2QA 1PRQA 4OQ0A 4NK3A 3M6BA 1MWRA 2XEPA 3SH8A 5FI7A 4DDYA 3HLEA 3WS4A 1GHPA 2V1ZA 2FZ0A 3BEBA 2EFUA 3LI9A 2O0YA 1BLPA 5CGXA 3UDXA 3VFHA 3IBJA 4OONA 2WGWA 2J8YA 2R78A 3MJQA 4KENB 3OZHA 3SS3A 4QJGA 1YMSA 5AQ7A 4GHIB 2V8FA 4DKIA 4EWFA 2J80A 1BT5A 5FAPA 2V1AA 4P87A 1EI5A 1VEUA 4HIAA 3ZNYA 5HWVA 2P7JA 1MWUA 2XSSA 2PR5A 3IWQA 4OKPA 3E2LA 3UMDA 4OPQA 3O5YA 2DCFA 5L8MA 3HLBA 1H8YA 4HBTA 4JF4A 1IEMA 3BECA 1N9NA 2K2NA 5FASA 5L2FA 3SW1A 2IWDA 3D9YA 1OTIA 1PW1A 3SS4A 4EQIA 3TW8A 3LY3A 3Q07A 4LFUA 3LFVA 4KQQA 4X25A 1DP8A 1JWVA 1JWZA 5L10A 1VHMA 4HY8A 1W63M 1N9OA 4U3TA 2VGLM 3O86A 4JXWA 2PYRA 3IH8A 4UAAA 3UB8A 3MFXA 1OPXA 4QWOA 2JN7A 4F3LB 2H10A 3B3XA 5AQAA 4KZ6A 3PAEA 3W4OA 4YNRA 1O07A 1IOUA 5BOHA 3A3EA 3IHBA 4LV1A 2A24A 3D4FA 3S7PA 2VLGA 4OOMA 4KZAA 4YFMA 3VP2A 4C75A 4OOLA 5FQKA 4Z9QA 4K91A 4QPRA 3M2JA 5D3OA 1CEGA 2WUQA 4Y17A 3HCYA 5AQ9A 4LCLA 2QKPA 5HW3A 5DF8A 2ZM8A 2ZOHA 4EV4A 3MFDA 3UO9A 4LV0A 5CGWA 1T1CA 4PM6A 3LIAA 3ZQ5A 2PAVP 3E4PA 4IVKA 4K0WA 3OPLA 2WZXA 5GLAA 3MR0A 1IYQA 3NDEA 1YLTA 2Q9NA 1P9RA 1F2KA 4E3OA 1SKOA 1S66L 3NJAA 4HJ4A 2ZMAA 2L0WA 1ES4A 3EEHA 3K3DA 2WKQA 3PBSA 2XLNA 3OPRA 5GHYA 4KUKA 2QWSA 3IF6A 4AFIA 3UPOA 4Y0OA 2JKFA 1S4RA 3IS2A 4R1GA 3NC8A 3ICYA 1VB6A 4HOIA 2O9CA 3MQOA 4O8GA 2EWVA 4CLCC 1K0KA 3HLWA 2W27A 2O9BA 1IFQA 4Y5FA 3LIBA 1PWCA 3MQQA 3T1RA 4CJNA 4ZAMA 3LGOA 4X1MA 3OLOA 2X02A 3NHQA 4HJ6A 3EQUA 4ARZA 1ZHHB 4FTXA 4X55A 5E2GA 2QHKA 1ZC2A 3BLSA 3CHWP 5EVID 1MXOA 4I3IA 4QY5A 3UY6A 3GV9A 5EVIB 4ZDXA 2O9AA 4I39A 1CQAA 3IWOA 3HLCA 4KZ4A 1D7EA 5AQBA 1YSPA 5KIZA 1T18A 5E2EA 1L3LA 2V1BA 2ZC6B 5KMWA 4Q0HA 4LENA 3WRZA 3UPNA 3KSIA 4R6LA 1MWTA 5CERA 2XRNA 2H0TA 2JBFA 2Z2MB 5HDCA 2JKRM 3A3DA 3T1QB 1BULA 2GJ3A 2HV1A 2ZQ9A 3C4OA 2BASA 4NG2A 1NYYA 4N1HA 4UHUA 2YKFA 1XKZA 5KZHA 2M7VA 2WKRA 1IYOA 4R23A 2HDUA 4S2OA 3FPWA 3HJIA 1ONHA 1FR1A 3ZGAB 3LICA 2PT7A 3DWZA 1PI4A 3IF6B 4CPKA 3MBZA 3JYIA 4E04A 3Q82A 4Q0JA 1G6OA 5F68A 2VV7A 1FCMA 3KSHA 4ID4A 3FG8A 4ZJ3A 1SCWA 2CMNA 4IHQA 4P85A 3EQVA 3V50A 4E3LA 4MDZA 1WYCA 1XA1A 3NECA 5EV0A 3S1YA 3MMHA 3O88A 1ALQA 4WYYA 2KOIA 2Y4AA 1XX2A 4WN5A 4Q8IA 4OVDA 2JKRI 2EX6A 2ZQAA 3ZG5A 1SDNA 1ZG6A 3KSGA 5LBRA 5FQQA 4GCZA 1XPBA 4RYEA 5GLBA 3VE4A 4BQMA 3EGXC 2G7UA 4GN2A 2XROA 4GKUA 1S67L 2Y2OA 2PU2A 1GSXA 2KLIA 5CEDA 5FQJA 4Y13A 3A3JA 3C5AA 3BY9A 1HD8A 3FZCA 5HD5A 3TG9A 5HSQA 3SOIA 1OT9A 3TE8A 1BTLA 1ZKJA 3WS2A 2QZ6A 1K38A 1AXBA 1PWDA 5HL1A 3UB7A 4Y3IA 1K54C 5C5KA 4RX2A 3PBOA 3T1XA 1YLWA 4WZ5A 5FAQA 1BUEA 3QNCA 5FAOA 2Z6DA 2IA2A 1NLZA 4R70A 1YT4A 2ZC5B 2V20A 5FDHA 4JF6A 1H8ZA 4ZRRA 4GW9A 1GSVA 2A49A 3H82A 3V67A 4MCWA 1YAXA 4GOGA 4GJ4A 2WGVA 4KQRA 4GD8A 4MLLA 4UQIS 3T4JA 3LY4A 4S2KA 4R3JA 5AVFA 1JWPA 2ZL1A 4GZBA 3WS5A 4OOYA 5DKKA 3IF5A 2HP6A 3R7WA 3V3SA 3Q7VB 1CK3A 3MKEA 1Y28A 4OLDA 5EPHA 4BL2A 3NCKA 2VGJA 4LPZA 4EESA 3F1PB 4UA9A 3BYDA 3WS0A 1H3QA 1J9MA 2Y2NA 4UQIM 5AVEA 3HLDA 3SS5A 5F69A 3BRMA 4L9EA 1X0OA 5FDSA 4IJGA 3UB9A 1SKFA 2JHEA 2Y59A 2VEAA 3M2KA 2HF6A 5DFYA 4DE2A 2PU4A 2XA7M 2BG1A 3IH9A 5EVIA 1ES5A 4BD1A 3MS6A 4RX3A 1K57C 2HPBA 3T4QA 1AWIA 2OV5A 1XJ2A 4X53A 5J8XA 2PBYA 3Q81A 3CUEC 3GECA 3NOUC 2Q0OA 1K57A 1E25A 1DJCA 4HHDA 2PDRA 1EW0A 2PRFA 2VX8A 2EX9A 2B5RA 2LB9A 2QJ7A 3LR3A 3AGFA 1L2SA 2FFYA 3F1OB 2O99A 4WEKA 5G4YA 1SDEA 1OTEA 3C4PA 4H6JA 5HZHA 1HTZA 3UE1A 4ZJ2A 4F3LA 1PFLA 1YLPA 1PW8A 2M1CA 2JKTI 4JF5A 4DJ3A 4Q0IA 2ZQ8A 3V3RA 2W3HA 5G18A 1MWSA 1SZVA 1XA7A 1N9BA 3H9WA 1OTDA 4E3KA 4ESPA 1WE4A 3LR4A 1KOUA 2WKIA 1TDLA 1KE3A 5CGSA 1XXMA 1GA0A 2D01A 3S4XA 3N8SA 2W1TB 4NXEA 4EERA 4WLAA 4IVIA 2W3DA 3DAVA 4IBXA 2XF3A 1YQSA 5K5BA 5MC7A 4X68A 3GR2A 4NXFA 1S6RA 1F98A 3ZG8B 4MBFA 1TVFA 3CAXA 4EQ1A 3A0VA 2WK0A 3G31A 3B47A 2R9WA 4WELA 2EXAA 3GDIA 3NIAA 1HLUP 4PM9A 4B4ZA 3R7WB 2BLSA 5HPIA 3VOYA 4PKYA 2A3UA 2Z2LB 5FEGA 1IKIA 3MZFA 4HESA 1KE4A 2J9OA 1A0KA 3F1PA 3VSLA 3BQAA 4I3JA 1OTBA 3B42A 4LV3A 2NUPC 5F1FA 2FFFB 3GRJA 5E2HA 1W7FA 4H8RA 4OPYA 5FQIA 5L09A 3VP1A 4KZ3A 3S22A 3K3CA 4KUOA 3A0SA 2PD7A 3AGEA 2V0UA 4G3WA 1P9WA 3U4LP 4H6JB 2UV0E 4I5SA 3UDIA 1NWZA 2P08A 4XT2B 5EUAA 5A90A 2Y55A 3O87A 3P09A 3VP3A 4CQHA 4WL9A 3UE6A 5EE8A 1I2WA 5FI6A 3UNWA 2G2WA 4PM5A 1NXYA 2K7SA 1MZUA 3W4QA 1JNUA 1T1BA 4B4XA 2NUTC 3G2ZA 1BZAA 5FL3A 4OQIA 5I94A 3F1OA 1YKDA 4QD4A 1OJGA 2P74A 3P7NA 1GHMA 3QP2A 5HPFA 1C3BA 3NULA 1SKOB 4KQDA 3MKFA 1CEFA 3LO7A 1DJBA 3PBTA 4FD8A 2FH5A 3VE3A 2VJWA 2W3EA 1G68A 4FSFA 1STZA 5TBMB 4JGQA 4ME4A 3P98A 3BFDA 2E8IA 4XUXA 2C5WB 4WF0A 3RXWA 3CUEA 3BY8A 1N4OA 1NLYA 1G28A 3S7OA 4GS9A 3T4SA 4YOFA 1OTAA 5EVIC 2Q9MA 2W3GA 1N9LA 1NZUA 4KZ5A 3KO6A 3PXPA 3DTIA 4PM8A 1H5XA 5F83A 5TFQA 1S0WA 3GMWA 3E4OA 1RGZA 3OPHA 1VETB 4JXSA 1LT0A 1MC0A 2UWXA 2Y79A 4L9GA 1LSWA 3VSKA 1ESUA 2WYXA 3F1NB 3OBFA 1M40A 1XFNA 4UA7A 1PNEA 2WZZA 3G2YA 4P6ZM 2VV8A 3D3OA 2XR0A 5HD3A 3LYXA 4IUKA 4RA7A 4JKTA 3HBRA 5E43A 3IHAA 3PAGA 5L07A 3IXDA 2Y2PA 3V39A 1TS8A 3V5MA 1TS0A 2HJEA 2ZMVA 3N6IA 1ZG4A 3JVVA 5TJJA 3NY4A 5IHVA 3C30A 5JYPA 5CHJA 1PZOA 3ZDJA 4D60A 3C38A 4HH3A 3VMAA 5HFOA 3VFFA 3IWIA 1RGYA 4S2JA 2E8JA 3FKVA 3OCLA 1T19A 3ZVWA 3CPTB 2DRWA 5J4EA 3RJUA 4JGPA 4DJ2A 5HAIA 3W2ZA 3C2WA 2J3TC 4Y15A 2YKHA 1K6SA 5KSHA 2P9VB 3W4PA 2QPNA 1XGIA 3DW0A 3P01A 1WYBA 5TBMA 4EBLA 1D06A 2G2UA 3N4IA 1HVBA 4F94A 4FUWA 1BLSA 4KZ7A 4OP8A 1G6AA 1ACFA 3HJKA 4OH0A 4U0XA 4BMWA 1K54A 1K55C 3FC7A 3OPPA 2HGVA 3Q7ZA 1JTDA 1MKMA 1YLYA 3EGDC 1BLCA 4NEED 5HAQA 2OAQ1 4EETB 5A8BA 3QP4A 2WKHA 1KVLA 3TOIA 5A93A 2XD1A 1W63Q 1FSYA 3HLGA 4OPZA 3F1NA 2JE5A 2ZC4B 3KYQA 1S1ZA 5F5YA 3HVFA 1U60A 5A92A 3QP1A 3R4KA 3G4PA 4EW7A 1ESIA 3KSFA 4N9LA 5HDSA 4PM7A 4MBHA 3T12B 2ZOIA 3ZVTA 3MZDA 2Y91A 2VZWA 2Y2LA 2INWA 2HJ9C 1H0MA 3ISGA 2JKGA 2ACGA 3SH7A 5DF7A 1YM1A 4QB8A 2PHYA 4X6TA 2I72A 3NI9A 4DN0A 3IXGA 2V9AA 1LI0A 3BW6A 5F6AA 4MNRA 3ITAA 2ZMFA 5AJGA 5FA7A 3MQ0A 4LV2A 5EVEA 5TGFA 2B95A 2XQZA 2ZJ9A 1W8YA 4EUVA 1S1YA 3OC2A 4N9KA 4M3KA 3JPUA 1CI9A 2Y2MA 5CHUA 2J9PA 3ZG7B 4ARZB 5CTNA 4DXCA 2J3WA 4JBFA 5DTSA 5DVAA 4MMNA 3QP5A 4JGOA 3NOTC 3CG5A 5CHMA 5J7EA 4HJ3A 4EXOA 4ZTKA 1XFQA 4JPMA 5HWTA 3IQAA 4ETXA 1FCOA 3T1SA 4O01A 1S4SA 5EOOA 2B18A 3TRCA 3C7UA 2IWBA 1LLBA 3LIEA 5HDDA 4S2IA 5FI2A 3IXHA 3BFFA 1NRJA 2EWWA 4OQHA 3CPTA 3SH9A 4L9FA 1HZOA 3G32A 4U0TA 3ZHHA 4BLMA 4BENA 1XJ3A 3G34A 1L0GA 1G5UA 4DE1A 3G30A 4CLCD 2OLUA 4UEYA 1PWGA 3U2AA 3VOZA 5FQ9A 5GLCA 3HUMA 2Y2KA 1ONGA 1ES2A 1GCEA 2HP9A 4WEJA 2K31A 2Y2JA 4HNBA 2W1TA 4NXBA 1E4DA 3NOPC 1FIKA 3DTKA 1PI5A 5TR7A 2EX2A 3ZG9B 1GSWA 2WAEA 3GTCA 5U47A 2Y2HA 1W79A 1J3WA 1PIOA 2WKEA 5GHZA 5M19A 4HP9A 4A5RA 4M4XA 2R9XA 4BD0A 1SHVA 1VQQA 4KG6A 4FH2A 3NBLA 3H7WB 4WZ5C 3QP6A 4S2PA 4ETZA 4ZJ1A 3UDFA 1Y54A 2GZAA 2VK3A 2W1RA 3ZG0A 4GNUA 4OP5A 1FQGA 1FILA 3MXQA 2ZQCA 3OOVA 2DMWA 2EFXA 4BBVA 3IX4A 4O7DA 2L4RA 3A0RA 3ZYTA 3QP8A 2RCXA 4N1XA 1BLHA 1ERQA 3DTMA 3IBRA 4EU0A 3PBRA 3IX3A 2L1MA 2V2FF 3DTEA 3GVBA 2ZLYA 4YWZA 3G6OA 5CEBA 4R4RA 3BLMA 3IF6C 3KYEA 3BFCA 4L0LA 4RVAA 4QHCA 2JKTM 4R4SA 4K08A 3O3VA 5JYOA 4CLCA 3S7QA 5IT5A 4CLCE 4GD6A 5DJUA 2KX6A 3UE3A 1NYMA 1K55A 3E2KA 4HP4A 5EOEA 4KZ9A 4Z1WA 4DRTA 4JLFA 2VGKA 1I5QA 3HREA 4LRZE 4Y0UA 1NZOA 3T4KA 1LSVA 2WGWB 5I5LA 3FPVA 4S2NA 3TJZC 2I9VA 2XFSA 3CLOA 1XGJA 3PTEA 2C6WB 3DWKA 4EEPA 4HEFA 4HI4A 2ZC3B 2WGIA 2HDQA 4E3JA 4PPRA 4WM9A 1LL8A 5J3WA 4II7A 3K2NA 1K6RA 1TF1A 4IUHA 3FV7A 1NY0A 5GL9A 3Q1FA 2WAFA 4GHIA 3MF0A 5CRFA 4S2LA 2ZM2A 4LRYC 5M18A 4B88A 5M1AA 3ITBA 3Q7VA 2OSUA 5FATA 4G3VA 3LIDA 3CI6A 3LEQA 4R3BA 1FOFA 4PHTA 1NJ4A 1IYSA 4ZBEA 2OWHA 2A2LA 1VETA 2V8CA 2XK1A 1ODVA 2IWCA 2OLVA 2XH9A 3BM6A 1V9ZA 1F5MA 1TEMA 1OJ5A 4JXVA 1YLZA 2JC7A 2VV6A 1ZTUA 2QYBA 4OLGA 2W0NA 4FCFA 5GHXA 1CF0A 1Z6FA 3BFGA 3TSGA 4WUJA 3RTYA 2GDNA 5DTKA 1K4FA 1W8QA 1LL5A 3G35A 3CJMA 1LI9A 5DKLA 4XUZA 2PBDP 1L0EA 1VM1A 1CJFA 1K25A 4E3NA 5HWWA 1LHYA 2X01A 3UN7A 4LGWA 1RP5A 4DE3A 1OT6A 4QU3A 4QY6A 4X69A 2P04A 3C7VA 4C3QA 2Y2IA 5CXWA 3PHYA 4S2MA 1L0DA 1E3UD 3PBQA 1H8MA 4HH2A 4GDNA 3B33A 1LSXA 2H5SA 1YLJA 2M7UA 3KX0X 4DXBA 1FSWA 3WS1A 2H0YA 3OCNA 2P9VA 1Q2PA 2JCHA 3T4OA 1ES3A 4BJPA 5F82A 4Y0TA 1FCNA 1QMEA 1DP6A 4MN5A 3ULFA 4I38A 3HUOA 4DF6A 4LRXC 4B9OA 4IEDA 4EEUA 2XD5A 3CITA 3MXRA 4X1LA 4PMAA 4OQGA 3KYZA 3PBNA 3JVUA 2HDRA 3FKWA 4LCMA 1DJAA 3BJNA 3E0YA 4MEZA 3MSHA 1WA9A 1JTGA 5DF9A 1D1JA 3UB6A 4DMZA 5KSCA 4X56A 1KDSA 4GDBA 3LIFA 3W8KA 2PD8A 1I2SA 1TD5A 2RL3A 2EA9A 1F9IA 3QHYA 1UWNX 3VP4A 1K56A 3ZCZA 1PYYA 3GSGA 1TDGA 4PKYG 1BSGA 3RFBA 4FH4A 1KGFA 2J3TD 3EEAA 2AVXA 1MBLA 2Y8HA 2CC1A 1GA9A 2OOLA 3SZTA 2ZD8A 5EVLA 1OMEA 3HUNA 2D02A 5A91A 1O7EA 3WWXA 2VA0A 1KGEA 5F1GA 2HDSA 2B02A 3QNBA 4E6WA 4KG2A 4HQAA 2W3FA 3M6HA 1K4EA 3NDGA 1E3UA 4NETA 1MPLA 1LL9A 5HAPA 2XGNA 1YSQA 2MJ6A 1UWPX 1ERMA 1NRFA 4Y2FA 3LR0A 4FOFA 5G4ZA 4BWIA 1P97A 2ZBBA 3S7NA 4GB7A 1T1AA 3MXSA 3MZEA 3BWLA 3T50A 2Z6CA 2XFTA 1PZPA 4P6ZS 1XJ4A 1Z09A 2X71A 2VKSA 4YINA 1JVJA 3C8CA 3UE0A 1M6KA 5EM0A 4Y7PA 4I3AA 1K56D 4BL3A 3A3IA 2WADA 5HARA 1EROA 2XA7S 4E3MA 3FWLA 4DE0A 4KQOA 2GNXA 4P6BA 4R0QA 3LI8A 3E98A 3CZDA 2A24B 2H28A 5GLDA 3RH8B 3CWFA 3IT9A 3RXXA 4D2OA 4E3IA 4XXRA 2J7VA 2HP5A 4PAUA 4EBPA 1V9YA 2KDKA 4IBRA 3N7WA 2HZ5A 1DRMA 3VOLA 3WRTA 3ZFZA 4WBGA 3T4TA 3H82B 5DTTA 5FSRA 3L9KA 1FR6A 3UMEA 4JXGA 2DNSA 3D72A 2PR6A 1DY6A 1KDWA 1XP4A 4WMCA 2ZL1B 5E2FA 2ZC7A 3PR6A 3N8LA 3UPPA 2V0WA 3A3FA 4K0XA 4BBUA 5EFWA 2ZM0A 5HL6A 2EX8A 4BBTA 5CECA 2XDMA 2VGLS 1KE0A 3GQZA 2Y2GA 5IS1A 3HLFA 2ZQ7A 5DJTA 3H7WA 2WKPA 4WMCD 3VP0A 4O0PA 4XT2A 3UB5P 3E4QA 4UA6A 1VEUB 3EOIA 3ZNTA 2EXBA 3VV4A 1XJ6A 3IX8A 4R38A 3HL9A 4JGRA 4OPRA 1MY8A
chains in the Genus database with same CATH topology
4ME4A 3S7QA 1P0ZA 4MN6A 4CLCE 5IT5A 5DJUA 4WF0A 4R3AA 3MMHA 3CUEA 2KX6A 3BY8A 5IU1A 3UE3A 2KOIA 1NLYA 4HP4A 4WN5A 3LUQA 1G28A 3S7OA 4GS9A 2JKRI 3DBAA 3T4SA 1BYWA 3BQ8A 4YOFA 4Z1WA 1TS6A 1OTAA 4RQ9A 4LLOB 3KSGA 4GLQA 2W3GA 1N9LA 4LRZE 5LBRA 3T4KA 1LSVA 5CX7A 5I5LA 3FPVA 3KO6A 4GCZA 3TJZC 3PXPA 2I9VA 3CLOA 3VE4A 3EGXC 2G7UA 4EEPA 4G3KA 4HI4A 3E4OA 3PYPA 4NXGA 1LT0A 2XROA 1MC0A 1S67L 2Y79A 4L9GA 1LL8A 1LSWA 3OBFA 3F1NB 5J3WA 1GSXA 1XFNA 3LR5A 5DFXA 2KLIA 2OAP1 2OWJA 2LB5A 2PYPA 4MN7A 1UGUA 3BY9A 3K2NA 4II7A 4B93A 4P6ZM 5HD5A 5HSQA 2VV8A 1TF1A 3D3OA 4IUHA 3T4LA 1OT9A 3TE8A 4NKPA 1TS7A 4GHIA 5HD3A 3LYXA 1DP9A 3MF0A 4IUKA 4GS9B 4LRYC 3UB7A 4Y3IA 5C5KA 2GX5A 3PBOA 3EWKA 4CLCB 4G3VA 3LIDA 3CI6A 3IS2B 1TS8A 2QJ5A 2Z6DA 2IA2A 4PHTA 1NLZA 1TS0A 2HJEA 2ZMVA 4R70A 2OWHA 2A2LA 3JVVA 2FZ0A 5TJJA 3C30A 3LI9A 1ODVA 3C38A 4HH3A 2O0YA 4ZRRA 4GW9A 1GSVA 3H82A 3V67A 4MCWA 1YAXA 3IBJA 1V9ZA 4GJ4A 1F5MA 2R78A 3MJQA 1OJ5A 3OCLA 1T19A 4UQIS 3T4JA 5J4EA 2VV6A 1ZTUA 2QYBA 4GHIB 4JGPA 2W0NA 4DJ2A 2J80A 5AVFA 3W2ZA 3C2WA 2J3TC 4WUJA 2V1AA 5DKKA 4HIAA 2YKHA 3RTYA 5HWVA 5KSHA 2P7JA 3R7WA 2XSSA 2PR5A 5DKLA 1Y28A 3UMDA 3P01A 5TBMA 3O5YA 4LPZA 5HWWA 4EESA 1D06A 3F1PB 5L8MA 1N9NA 1H3QA 2K2NA 3SW1A 4UQIM 5AVEA 1OT6A 2P04A 3HJKA 1OTIA 5F69A 4BMWA 4L9EA 1X0OA 3PHYA 4IJGA 3TW8A 3FC7A 2HGVA 3UB9A 3LFVA 1DP8A 1MKMA 2JHEA 1VHMA 3EGDC 3PBQA 4HH2A 1H8MA 4HY8A 4NEED 2VEAA 2HF6A 3B33A 1W63M 1LSXA 1N9OA 2OAQ1 5DFYA 4EETB 2XA7M 2VGLM 2M7UA 3KX0X 2PYRA 3UB8A 3MFXA 1OPXA 4F3LB 2JN7A 5A8BA 3T4QA 3OCNA 1XJ2A 3T4OA 4YNRA 4BJPA 1W63Q 1IOUA 3F1NA 3CUEC 1DP6A 3GECA 4MN5A 2A24A 3ULFA 3S7PA 3NOUC 4I38A 3KYQA 1S1ZA 2VLGA 5F5YA 4LRXC 4B9OA 4OOMA 4EEUA 3CITA 3KYZA 3R4KA 3PBNA 3JVUA 4HHDA 2PDRA 1EW0A 4EW7A 4OOLA 2VX8A 3KSFA 5HDSA 4QPRA 2LB9A 3BJNA 2QJ7A 2ZOIA 3LR3A 2VZWA 3HCYA 3F1OB 2QKPA 2INWA 2O99A 4WEKA 2HJ9C 5G4YA 2ZOHA 3E0YA 1OTEA 1WA9A 4H6JA 5DF9A 5HZHA 1T1CA 3LIAA 3UB6A 2PHYA 3ZQ5A 3E4PA 4DMZA 4F3LA 3LIFA 2PD8A 2M1CA 4DN0A 1TD5A 2JKTI 2EA9A 1F9IA 2V9AA 3MR0A 3BW6A 1UWNX 5F6AA 2ZMFA 1P9RA 4DJ3A 5AJGA 4Q0IA 3MQ0A 4PKYG 3RFBA 2W3HA 4EUVA 2J3TD 1S1YA 3EEAA 3OC2A 1S66L 3NJAA 4HJ4A 3H9WA 1OTDA 2L0WA 3EEHA 3K3DA 2Y8HA 4ARZB 2WKQA 3LR4A 3PBSA 2OOLA 1KOUA 2J3WA 4KUKA 2QWSA 4MMNA 4AFIA 4JGOA 1S4RA 3IS2A 2D02A 3NOTC 5J7EA 2D01A 4HJ3A 3ICYA 4EXOA 1XFQA 1VB6A 2VA0A 2W1TB 4NXEA 2B02A 4HOIA 5HWTA 4EERA 4WLAA 4ETXA 2O9CA 3MQOA 4HQAA 4O8GA 2W3DA 2EWVA 4CLCC 2W3FA 4O01A 1S4SA 3TRCA 2B18A 5K5BA 2W27A 3LIEA 2O9BA 1IFQA 5MC7A 5HDDA 4Y5FA 3LIBA 4NXFA 1YSQA 2MJ6A 1NRJA 3MQQA 1F98A 2EWWA 1UWPX 4L9FA 3CAXA 1XJ3A 4Y2FA 4EQ1A 3A0VA 3LR0A 4FOFA 5G4ZA 4BWIA 4CLCD 1P97A 3OLOA 2ZBBA 3B47A 3NHQA 3S7NA 4HJ6A 1T1AA 4WELA 3GDIA 3EQUA 4UEYA 4ARZA 1ZHHB 3U2AA 3R7WB 2QHKA 3BWLA 3T50A 2Z6CA 5HPIA 4P6ZS 4PKYA 1XJ4A 2VKSA 4I3IA 4WEJA 2K31A 3C8CA 2W1TA 3F1PA 4HNBA 4NXBA 4I3AA 3BQAA 3NOPC 4I3JA 1OTBA 3B42A 2NUPC 1GSWA 2XA7S 2O9AA 4I39A 4KQOA 2GNXA 3LI8A 1D7EA 3E98A 3K3CA 4HP9A 2A24B 2H28A 3A0SA 4KUOA 3RH8B 2PD7A 1YSPA 2V0UA 5KIZA 1T18A 4M4XA 3CWFA 2V1BA 1P9WA 4G3WA 4Q0HA 4H6JB 4I5SA 1NWZA 2P08A 4PAUA 4XT2B 3KSIA 4R6LA 3H7WB 2XRNA 1V9YA 2KDKA 5HDCA 2JKRM 4ETZA 1DRMA 3VOLA 3T4TA 2GZAA 3H82B 4CQHA 2W1RA 4WL9A 3UE6A 2GJ3A 2HV1A 2BASA 3MXQA 3OOVA 2DMWA 2YKFA 3UMEA 4BBVA 2L4RA 3D72A 3A0RA 2K7SA 3ZYTA 1MZUA 2M7VA 2PR6A 1JNUA 2WKRA 1T1BA 2NUTC 3PR6A 5FL3A 3FPWA 3IBRA 4EU0A 3HJIA 3PBRA 2V0WA 3LICA 2L1MA 4BBUA 3F1OA 1YKDA 2PT7A 5EFWA 5HL6A 1OJGA 4BBTA 3P7NA 2VGLS 4YWZA 5HPFA 3G6OA 5IS1A 4E04A 4Q0JA 5DJTA 1G6OA 3H7WA 2WKPA 4L0LA 5F68A 4O0PA 4KQDA 2VV7A 4XT2A 3KSHA 3E4QA 3FG8A 2JKTM 3EOIA 3PBTA 2CMNA 2FH5A 4K08A 2VJWA 4IHQA 3VE3A 3VV4A 2W3EA 1XJ6A 4R38A 3EQVA 4FSFA 4JGRA 4CLCA 4MDZA 1STZA 5TBMB 4JGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0Z A;  2R78 A;  3MJQ A;  4MN6 A;  1OJ5 A;  1T19 A;  4H6J A;  5DJU A;  3C8C A;  4HNB A;  3F1P A;  4NXB A;  4WF0 A;  4R3A A;  5IU1 A;  2KX6 A;  3BY8 A;  5HZH A;  1T1C A;  4I3A A;  5J4E A;  3LIA A;  3NOP C;  4I3J A;  3UB6 A;  2PHY A;  3ZQ5 A;  3E4P A;  2VV6 A;  1OTB A;  4GHI B;  4JGP A;  2W0N A;  4HP4 A;  4WN5 A;  4DJ2 A;  4F3L A;  3LUQ A;  1G28 A;  4GS9 A;  2J80 A;  5AVF A;  3LIF A;  3C2W A;  1GSW A;  4I39 A;  1BYW A;  2PD8 A;  4WUJ A;  2M1C A;  2V1A A;  5DKK A;  4HIA A;  2YKH A;  3RTY A;  5HWV A;  1TS6 A;  1OTA A;  2P7J A;  2EA9 A;  1F9I A;  2V9A A;  3MR0 A;  2PR5 A;  4RQ9 A;  1UWN X;  5DKL A;  5F6A A;  4LLO B;  3LI8 A;  1D7E A;  3K3C A;  1N9L A;  4HP9 A;  4LRZ E;  1Y28 A;  2H28 A;  2A24 B;  3A0S A;  4JGQ A;  1LSV A;  4KUO A;  3RH8 B;  3UMD A;  4DJ3 A;  2PD7 A;  5TBM A;  2V0U A;  5I5L A;  1T18 A;  5KIZ A;  4M4X A;  3CWF A;  2V1B A;  4LPZ A;  4GCZ A;  4PKY G;  4H6J B;  5HWW A;  4EES A;  1D06 A;  5HSQ A;  3F1P B;  4I5S A;  2I9V A;  3CLO A;  1NWZ A;  1S1Y A;  4XT2 B;  1N9N A;  4R6L A;  3VE4 A;  1S66 L;  3H7W B;  3NJA A;  4HJ4 A;  3H9W A;  4EEP A;  1OTD A;  1V9Y A;  2KDK A;  5HDC A;  3SW1 A;  2L0W A;  5AVE A;  4HI4 A;  1OT6 A;  3E4O A;  3EEH A;  3K3D A;  3PYP A;  1DRM A;  3HJK A;  4NXG A;  1LT0 A;  1OTI A;  2WKQ A;  5F69 A;  2OOL A;  3VOL A;  1KOU A;  1S67 L;  4L9E A;  3H82 B;  4KUK A;  4WL9 A;  1X0O A;  2QWS A;  4L9G A;  3UE6 A;  2GJ3 A;  3PHY A;  1LL8 A;  1LSW A;  3F1N B;  2HV1 A;  5J3W A;  1GSX A;  1XFN A;  2BAS A;  1S4R A;  3FC7 A;  3IS2 A;  2D02 A;  4JGO A;  3UB9 A;  2OWJ A;  3MXQ A;  2PYP A;  3NOT C;  1DP8 A;  5J7E A;  1UGU A;  2D01 A;  2JHE A;  3BY9 A;  4HJ3 A;  3UME A;  2YKF A;  3ICY A;  4HH2 A;  5HD5 A;  2VV8 A;  1XFQ A;  1VB6 A;  4HY8 A;  2VEA A;  4NXE A;  2L4R A;  2B02 A;  3B33 A;  1LSX A;  1N9O A;  1OT9 A;  2K7S A;  3A0R A;  3D72 A;  1MZU A;  4HOI A;  4WLA A;  5HWT A;  4EET B;  4EER A;  2PR6 A;  1JNU A;  2WKR A;  3MQO A;  3KX0 X;  1TS7 A;  1T1B A;  2PYR A;  4GHI A;  3LYX A;  4HQA A;  1DP9 A;  3MFX A;  5HD3 A;  3UB8 A;  2JN7 A;  4F3L B;  4GS9 B;  5A8B A;  1S4S A;  3IBR A;  4LRY C;  3HJI A;  2V0W A;  2W27 A;  3LIE A;  1XJ2 A;  2L1M A;  3LIC A;  3F1O A;  5HDD A;  5EFW A;  3UB7 A;  4BBU A;  3LIB A;  4NXF A;  3EWK A;  1OJG A;  3F1N A;  4BBT A;  3GEC A;  1DP6 A;  3LID A;  3MQQ A;  3P7N A;  1F98 A;  3IS2 B;  4MN5 A;  4YWZ A;  2A24 A;  3ULF A;  1TS8 A;  1UWP X;  2QJ5 A;  3NOU C;  2Z6D A;  3G6O A;  4I38 A;  1S1Z A;  2VLG A;  4L9F A;  5F5Y A;  4LRX C;  4B9O A;  3CAX A;  5F68 A;  4E04 A;  5IS1 A;  1XJ3 A;  4EEU A;  4EQ1 A;  1TS0 A;  3A0V A;  4R70 A;  5DJT A;  5G4Z A;  3H7W A;  2WKP A;  2OWH A;  1P97 A;  4HHD A;  2PDR A;  4XT2 A;  4KQD A;  2VV7 A;  1EW0 A;  3OLO A;  2ZBB A;  4EW7 A;  3E4Q A;  3NHQ A;  5HDS A;  4HJ6 A;  1T1A A;  3FG8 A;  3GDI A;  3LI9 A;  1ODV A;  2CMN A;  4HH3 A;  2QJ7 A;  2ZOI A;  4K08 A;  3VE3 A;  2QHK A;  1XJ6 A;  3BWL A;  1GSV A;  4GW9 A;  2Z6C A;  3H82 A;  4R38 A;  3F1O B;  2QKP A;  3T50 A;  2INW A;  4EXO A;  5G4Y A;  4PKY A;  1XJ4 A;  2ZOH A;  4JGR A;  1V9Z A;  1OTE A;  4I3I A;  4BBV A;  5TBM B;  1WA9 A; 
#chains in the Genus database with same CATH topology
 1P0Z A;  1IYP A;  4MN6 A;  3L7H A;  4R3A A;  5IU1 A;  5EEC A;  1Q2Q A;  3LUQ A;  3DBA A;  1KVM A;  1BYW A;  3BQ8 A;  3LEZ A;  3LCE A;  1TS6 A;  2ZQD A;  1W5D A;  4MBK A;  4RQ9 A;  4LLO B;  4GLQ A;  5FEF A;  5CX7 A;  2QMI A;  1EWZ A;  1YPR A;  5FQM A;  1RCJ A;  4G3K A;  3PYP A;  4NXG A;  4KZ8 A;  2BTF P;  3AGD A;  4E6X A;  4DDS A;  4EUZ A;  3I7J A;  3LR5 A;  5DFX A;  5CTM A;  3IXB A;  2OAP 1;  2OWJ A;  3FYZ A;  2LB5 A;  2PYP A;  4MN7 A;  1UGU A;  1IKG A;  4B93 A;  5EM1 A;  3CMZ A;  4N92 A;  4EBN A;  1L0F A;  3T4L A;  4NKP A;  3N8R A;  4C6Y A;  1TS7 A;  1DP9 A;  4GS9 B;  4WZ4 A;  1CI8 A;  1GHI A;  4HBU A;  1IEL A;  3BFE A;  1KGG A;  2GX5 A;  4KZB A;  1QMF A;  1MKI A;  3EWK A;  4P0M A;  4CLC B;  1Y4O A;  1YMX A;  5HX9 A;  3IS2 B;  4S2N C;  4KG5 A;  2QJ5 A;  2Y2Q A;  1PRQ A;  4OQ0 A;  4NK3 A;  3M6B A;  1MWR A;  2XEP A;  3SH8 A;  5FI7 A;  4DDY A;  3HLE A;  3WS4 A;  1GHP A;  2V1Z A;  2FZ0 A;  3BEB A;  2EFU A;  3LI9 A;  2O0Y A;  1BLP A;  5CGX A;  3UDX A;  3VFH A;  3IBJ A;  4OON A;  2WGW A;  2J8Y A;  2R78 A;  3MJQ A;  4KEN B;  3OZH A;  3SS3 A;  4QJG A;  1YMS A;  5AQ7 A;  4GHI B;  2V8F A;  4DKI A;  4EWF A;  2J80 A;  1BT5 A;  5FAP A;  2V1A A;  4P87 A;  1EI5 A;  1VEU A;  4HIA A;  3ZNY A;  5HWV A;  2P7J A;  1MWU A;  2XSS A;  2PR5 A;  3IWQ A;  4OKP A;  3E2L A;  3UMD A;  4OPQ A;  3O5Y A;  2DCF A;  5L8M A;  3HLB A;  1H8Y A;  4HBT A;  4JF4 A;  1IEM A;  3BEC A;  1N9N A;  2K2N A;  5FAS A;  5L2F A;  3SW1 A;  2IWD A;  3D9Y A;  1OTI A;  1PW1 A;  3SS4 A;  4EQI A;  3TW8 A;  3LY3 A;  3Q07 A;  4LFU A;  3LFV A;  4KQQ A;  4X25 A;  1DP8 A;  1JWV A;  1JWZ A;  5L10 A;  1VHM A;  4HY8 A;  1W63 M;  1N9O A;  4U3T A;  2VGL M;  3O86 A;  4JXW A;  2PYR A;  3IH8 A;  4UAA A;  3UB8 A;  3MFX A;  1OPX A;  4QWO A;  2JN7 A;  4F3L B;  2H10 A;  3B3X A;  5AQA A;  4KZ6 A;  3PAE A;  3W4O A;  4YNR A;  1O07 A;  1IOU A;  5BOH A;  3A3E A;  3IHB A;  4LV1 A;  2A24 A;  3D4F A;  3S7P A;  2VLG A;  4OOM A;  4KZA A;  4YFM A;  3VP2 A;  4C75 A;  4OOL A;  5FQK A;  4Z9Q A;  4K91 A;  4QPR A;  3M2J A;  5D3O A;  1CEG A;  2WUQ A;  4Y17 A;  3HCY A;  5AQ9 A;  4LCL A;  2QKP A;  5HW3 A;  5DF8 A;  2ZM8 A;  2ZOH A;  4EV4 A;  3MFD A;  3UO9 A;  4LV0 A;  5CGW A;  1T1C A;  4PM6 A;  3LIA A;  3ZQ5 A;  2PAV P;  3E4P A;  4IVK A;  4K0W A;  3OPL A;  2WZX A;  5GLA A;  3MR0 A;  1IYQ A;  3NDE A;  1YLT A;  2Q9N A;  1P9R A;  1F2K A;  4E3O A;  1SKO A;  1S66 L;  3NJA A;  4HJ4 A;  2ZMA A;  2L0W A;  1ES4 A;  3EEH A;  3K3D A;  2WKQ A;  3PBS A;  2XLN A;  3OPR A;  5GHY A;  4KUK A;  2QWS A;  3IF6 A;  4AFI A;  3UPO A;  4Y0O A;  2JKF A;  1S4R A;  3IS2 A;  4R1G A;  3NC8 A;  3ICY A;  1VB6 A;  4HOI A;  2O9C A;  3MQO A;  4O8G A;  2EWV A;  4CLC C;  1K0K A;  3HLW A;  2W27 A;  2O9B A;  1IFQ A;  4Y5F A;  3LIB A;  1PWC A;  3MQQ A;  3T1R A;  4CJN A;  4ZAM A;  3LGO A;  4X1M A;  3OLO A;  2X02 A;  3NHQ A;  4HJ6 A;  3EQU A;  4ARZ A;  1ZHH B;  4FTX A;  4X55 A;  5E2G A;  2QHK A;  1ZC2 A;  3BLS A;  3CHW P;  5EVI D;  1MXO A;  4I3I A;  4QY5 A;  3UY6 A;  3GV9 A;  5EVI B;  4ZDX A;  2O9A A;  4I39 A;  1CQA A;  3IWO A;  3HLC A;  4KZ4 A;  1D7E A;  5AQB A;  1YSP A;  5KIZ A;  1T18 A;  5E2E A;  1L3L A;  2V1B A;  2ZC6 B;  5KMW A;  4Q0H A;  4LEN A;  3WRZ A;  3UPN A;  3KSI A;  4R6L A;  1MWT A;  5CER A;  2XRN A;  2H0T A;  2JBF A;  2Z2M B;  5HDC A;  2JKR M;  3A3D A;  3T1Q B;  1BUL A;  2GJ3 A;  2HV1 A;  2ZQ9 A;  3C4O A;  2BAS A;  4NG2 A;  1NYY A;  4N1H A;  4UHU A;  2YKF A;  1XKZ A;  5KZH A;  2M7V A;  2WKR A;  1IYO A;  4R23 A;  2HDU A;  4S2O A;  3FPW A;  3HJI A;  1ONH A;  1FR1 A;  3ZGA B;  3LIC A;  2PT7 A;  3DWZ A;  1PI4 A;  3IF6 B;  4CPK A;  3MBZ A;  3JYI A;  4E04 A;  3Q82 A;  4Q0J A;  1G6O A;  5F68 A;  2VV7 A;  1FCM A;  3KSH A;  4ID4 A;  3FG8 A;  4ZJ3 A;  1SCW A;  2CMN A;  4IHQ A;  4P85 A;  3EQV A;  3V50 A;  4E3L A;  4MDZ A;  1WYC A;  1XA1 A;  3NEC A;  5EV0 A;  3S1Y A;  3MMH A;  3O88 A;  1ALQ A;  4WYY A;  2KOI A;  2Y4A A;  1XX2 A;  4WN5 A;  4Q8I A;  4OVD A;  2JKR I;  2EX6 A;  2ZQA A;  3ZG5 A;  1SDN A;  1ZG6 A;  3KSG A;  5LBR A;  5FQQ A;  4GCZ A;  1XPB A;  4RYE A;  5GLB A;  3VE4 A;  4BQM A;  3EGX C;  2G7U A;  4GN2 A;  2XRO A;  4GKU A;  1S67 L;  2Y2O A;  2PU2 A;  1GSX A;  2KLI A;  5CED A;  5FQJ A;  4Y13 A;  3A3J A;  3C5A A;  3BY9 A;  1HD8 A;  3FZC A;  5HD5 A;  3TG9 A;  5HSQ A;  3SOI A;  1OT9 A;  3TE8 A;  1BTL A;  1ZKJ A;  3WS2 A;  2QZ6 A;  1K38 A;  1AXB A;  1PWD A;  5HL1 A;  3UB7 A;  4Y3I A;  1K54 C;  5C5K A;  4RX2 A;  3PBO A;  3T1X A;  1YLW A;  4WZ5 A;  5FAQ A;  1BUE A;  3QNC A;  5FAO A;  2Z6D A;  2IA2 A;  1NLZ A;  4R70 A;  1YT4 A;  2ZC5 B;  2V20 A;  5FDH A;  4JF6 A;  1H8Z A;  4ZRR A;  4GW9 A;  1GSV A;  2A49 A;  3H82 A;  3V67 A;  4MCW A;  1YAX A;  4GOG A;  4GJ4 A;  2WGV A;  4KQR A;  4GD8 A;  4MLL A;  4UQI S;  3T4J A;  3LY4 A;  4S2K A;  4R3J A;  5AVF A;  1JWP A;  2ZL1 A;  4GZB A;  3WS5 A;  4OOY A;  5DKK A;  3IF5 A;  2HP6 A;  3R7W A;  3V3S A;  3Q7V B;  1CK3 A;  3MKE A;  1Y28 A;  4OLD A;  5EPH A;  4BL2 A;  3NCK A;  2VGJ A;  4LPZ A;  4EES A;  3F1P B;  4UA9 A;  3BYD A;  3WS0 A;  1H3Q A;  1J9M A;  2Y2N A;  4UQI M;  5AVE A;  3HLD A;  3SS5 A;  5F69 A;  3BRM A;  4L9E A;  1X0O A;  5FDS A;  4IJG A;  3UB9 A;  1SKF A;  2JHE A;  2Y59 A;  2VEA A;  3M2K A;  2HF6 A;  5DFY A;  4DE2 A;  2PU4 A;  2XA7 M;  2BG1 A;  3IH9 A;  5EVI A;  1ES5 A;  4BD1 A;  3MS6 A;  4RX3 A;  1K57 C;  2HPB A;  3T4Q A;  1AWI A;  2OV5 A;  1XJ2 A;  4X53 A;  5J8X A;  2PBY A;  3Q81 A;  3CUE C;  3GEC A;  3NOU C;  2Q0O A;  1K57 A;  1E25 A;  1DJC A;  4HHD A;  2PDR A;  1EW0 A;  2PRF A;  2VX8 A;  2EX9 A;  2B5R A;  2LB9 A;  2QJ7 A;  3LR3 A;  3AGF A;  1L2S A;  2FFY A;  3F1O B;  2O99 A;  4WEK A;  5G4Y A;  1SDE A;  1OTE A;  3C4P A;  4H6J A;  5HZH A;  1HTZ A;  3UE1 A;  4ZJ2 A;  4F3L A;  1PFL A;  1YLP A;  1PW8 A;  2M1C A;  2JKT I;  4JF5 A;  4DJ3 A;  4Q0I A;  2ZQ8 A;  3V3R A;  2W3H A;  5G18 A;  1MWS A;  1SZV A;  1XA7 A;  1N9B A;  3H9W A;  1OTD A;  4E3K A;  4ESP A;  1WE4 A;  3LR4 A;  1KOU A;  2WKI A;  1TDL A;  1KE3 A;  5CGS A;  1XXM A;  1GA0 A;  2D01 A;  3S4X A;  3N8S A;  2W1T B;  4NXE A;  4EER A;  4WLA A;  4IVI A;  2W3D A;  3DAV A;  4IBX A;  2XF3 A;  1YQS A;  5K5B A;  5MC7 A;  4X68 A;  3GR2 A;  4NXF A;  1S6R A;  1F98 A;  3ZG8 B;  4MBF A;  1TVF A;  3CAX A;  4EQ1 A;  3A0V A;  2WK0 A;  3G31 A;  3B47 A;  2R9W A;  4WEL A;  2EXA A;  3GDI A;  3NIA A;  1HLU P;  4PM9 A;  4B4Z A;  3R7W B;  2BLS A;  5HPI A;  3VOY A;  4PKY A;  2A3U A;  2Z2L B;  5FEG A;  1IKI A;  3MZF A;  4HES A;  1KE4 A;  2J9O A;  1A0K A;  3F1P A;  3VSL A;  3BQA A;  4I3J A;  1OTB A;  3B42 A;  4LV3 A;  2NUP C;  5F1F A;  2FFF B;  3GRJ A;  5E2H A;  1W7F A;  4H8R A;  4OPY A;  5FQI A;  5L09 A;  3VP1 A;  4KZ3 A;  3S22 A;  3K3C A;  4KUO A;  3A0S A;  2PD7 A;  3AGE A;  2V0U A;  4G3W A;  1P9W A;  3U4L P;  4H6J B;  2UV0 E;  4I5S A;  3UDI A;  1NWZ A;  2P08 A;  4XT2 B;  5EUA A;  5A90 A;  2Y55 A;  3O87 A;  3P09 A;  3VP3 A;  4CQH A;  4WL9 A;  3UE6 A;  5EE8 A;  1I2W A;  5FI6 A;  3UNW A;  2G2W A;  4PM5 A;  1NXY A;  2K7S A;  1MZU A;  3W4Q A;  1JNU A;  1T1B A;  4B4X A;  2NUT C;  3G2Z A;  1BZA A;  5FL3 A;  4OQI A;  5I94 A;  3F1O A;  1YKD A;  4QD4 A;  1OJG A;  2P74 A;  3P7N A;  1GHM A;  3QP2 A;  5HPF A;  1C3B A;  3NUL A;  1SKO B;  4KQD A;  3MKF A;  1CEF A;  3LO7 A;  1DJB A;  3PBT A;  4FD8 A;  2FH5 A;  3VE3 A;  2VJW A;  2W3E A;  1G68 A;  4FSF A;  1STZ A;  5TBM B;  4JGQ A;  4ME4 A;  3P98 A;  3BFD A;  2E8I A;  4XUX A;  2C5W B;  4WF0 A;  3RXW A;  3CUE A;  3BY8 A;  1N4O A;  1NLY A;  1G28 A;  3S7O A;  4GS9 A;  3T4S A;  4YOF A;  1OTA A;  5EVI C;  2Q9M A;  2W3G A;  1N9L A;  1NZU A;  4KZ5 A;  3KO6 A;  3PXP A;  3DTI A;  4PM8 A;  1H5X A;  5F83 A;  5TFQ A;  1S0W A;  3GMW A;  3E4O A;  1RGZ A;  3OPH A;  1VET B;  4JXS A;  1LT0 A;  1MC0 A;  2UWX A;  2Y79 A;  4L9G A;  1LSW A;  3VSK A;  1ESU A;  2WYX A;  3F1N B;  3OBF A;  1M40 A;  1XFN A;  4UA7 A;  1PNE A;  2WZZ A;  3G2Y A;  4P6Z M;  2VV8 A;  3D3O A;  2XR0 A;  5HD3 A;  3LYX A;  4IUK A;  4RA7 A;  4JKT A;  3HBR A;  5E43 A;  3IHA A;  3PAG A;  5L07 A;  3IXD A;  2Y2P A;  3V39 A;  1TS8 A;  3V5M A;  1TS0 A;  2HJE A;  2ZMV A;  3N6I A;  1ZG4 A;  3JVV A;  5TJJ A;  3NY4 A;  5IHV A;  3C30 A;  5JYP A;  5CHJ A;  1PZO A;  3ZDJ A;  4D60 A;  3C38 A;  4HH3 A;  3VMA A;  5HFO A;  3VFF A;  3IWI A;  1RGY A;  4S2J A;  2E8J A;  3FKV A;  3OCL A;  1T19 A;  3ZVW A;  3CPT B;  2DRW A;  5J4E A;  3RJU A;  4JGP A;  4DJ2 A;  5HAI A;  3W2Z A;  3C2W A;  2J3T C;  4Y15 A;  2YKH A;  1K6S A;  5KSH A;  2P9V B;  3W4P A;  2QPN A;  1XGI A;  3DW0 A;  3P01 A;  1WYB A;  5TBM A;  4EBL A;  1D06 A;  2G2U A;  3N4I A;  1HVB A;  4F94 A;  4FUW A;  1BLS A;  4KZ7 A;  4OP8 A;  1G6A A;  1ACF A;  3HJK A;  4OH0 A;  4U0X A;  4BMW A;  1K54 A;  1K55 C;  3FC7 A;  3OPP A;  2HGV A;  3Q7Z A;  1JTD A;  1MKM A;  1YLY A;  3EGD C;  1BLC A;  4NEE D;  5HAQ A;  2OAQ 1;  4EET B;  5A8B A;  3QP4 A;  2WKH A;  1KVL A;  3TOI A;  5A93 A;  2XD1 A;  1W63 Q;  1FSY A;  3HLG A;  4OPZ A;  3F1N A;  2JE5 A;  2ZC4 B;  3KYQ A;  1S1Z A;  5F5Y A;  3HVF A;  1U60 A;  5A92 A;  3QP1 A;  3R4K A;  3G4P A;  4EW7 A;  1ESI A;  3KSF A;  4N9L A;  5HDS A;  4PM7 A;  4MBH A;  3T12 B;  2ZOI A;  3ZVT A;  3MZD A;  2Y91 A;  2VZW A;  2Y2L A;  2INW A;  2HJ9 C;  1H0M A;  3ISG A;  2JKG A;  2ACG A;  3SH7 A;  5DF7 A;  1YM1 A;  4QB8 A;  2PHY A;  4X6T A;  2I72 A;  3NI9 A;  4DN0 A;  3IXG A;  2V9A A;  1LI0 A;  3BW6 A;  5F6A A;  4MNR A;  3ITA A;  2ZMF A;  5AJG A;  5FA7 A;  3MQ0 A;  4LV2 A;  5EVE A;  5TGF A;  2B95 A;  2XQZ A;  2ZJ9 A;  1W8Y A;  4EUV A;  1S1Y A;  3OC2 A;  4N9K A;  4M3K A;  3JPU A;  1CI9 A;  2Y2M A;  5CHU A;  2J9P A;  3ZG7 B;  4ARZ B;  5CTN A;  4DXC A;  2J3W A;  4JBF A;  5DTS A;  5DVA A;  4MMN A;  3QP5 A;  4JGO A;  3NOT C;  3CG5 A;  5CHM A;  5J7E A;  4HJ3 A;  4EXO A;  4ZTK A;  1XFQ A;  4JPM A;  5HWT A;  3IQA A;  4ETX A;  1FCO A;  3T1S A;  4O01 A;  1S4S A;  5EOO A;  2B18 A;  3TRC A;  3C7U A;  2IWB A;  1LLB A;  3LIE A;  5HDD A;  4S2I A;  5FI2 A;  3IXH A;  3BFF A;  1NRJ A;  2EWW A;  4OQH A;  3CPT A;  3SH9 A;  4L9F A;  1HZO A;  3G32 A;  4U0T A;  3ZHH A;  4BLM A;  4BEN A;  1XJ3 A;  3G34 A;  1L0G A;  1G5U A;  4DE1 A;  3G30 A;  4CLC D;  2OLU A;  4UEY A;  1PWG A;  3U2A A;  3VOZ A;  5FQ9 A;  5GLC A;  3HUM A;  2Y2K A;  1ONG A;  1ES2 A;  1GCE A;  2HP9 A;  4WEJ A;  2K31 A;  2Y2J A;  4HNB A;  2W1T A;  4NXB A;  1E4D A;  3NOP C;  1FIK A;  3DTK A;  1PI5 A;  5TR7 A;  2EX2 A;  3ZG9 B;  1GSW A;  2WAE A;  3GTC A;  5U47 A;  2Y2H A;  1W79 A;  1J3W A;  1PIO A;  2WKE A;  5GHZ A;  5M19 A;  4HP9 A;  4A5R A;  4M4X A;  2R9X A;  4BD0 A;  1SHV A;  1VQQ A;  4KG6 A;  4FH2 A;  3NBL A;  3H7W B;  4WZ5 C;  3QP6 A;  4S2P A;  4ETZ A;  4ZJ1 A;  3UDF A;  1Y54 A;  2GZA A;  2VK3 A;  2W1R A;  3ZG0 A;  4GNU A;  4OP5 A;  1FQG A;  1FIL A;  3MXQ A;  2ZQC A;  3OOV A;  2DMW A;  2EFX A;  4BBV A;  3IX4 A;  4O7D A;  2L4R A;  3A0R A;  3ZYT A;  3QP8 A;  2RCX A;  4N1X A;  1BLH A;  1ERQ A;  3DTM A;  3IBR A;  4EU0 A;  3PBR A;  3IX3 A;  2L1M A;  2V2F F;  3DTE A;  3GVB A;  2ZLY A;  4YWZ A;  3G6O A;  5CEB A;  4R4R A;  3BLM A;  3IF6 C;  3KYE A;  3BFC A;  4L0L A;  4RVA A;  4QHC A;  2JKT M;  4R4S A;  4K08 A;  3O3V A;  5JYO A;  4CLC A;  3S7Q A;  5IT5 A;  4CLC E;  4GD6 A;  5DJU A;  2KX6 A;  3UE3 A;  1NYM A;  1K55 A;  3E2K A;  4HP4 A;  5EOE A;  4KZ9 A;  4Z1W A;  4DRT A;  4JLF A;  2VGK A;  1I5Q A;  3HRE A;  4LRZ E;  4Y0U A;  1NZO A;  3T4K A;  1LSV A;  2WGW B;  5I5L A;  3FPV A;  4S2N A;  3TJZ C;  2I9V A;  2XFS A;  3CLO A;  1XGJ A;  3PTE A;  2C6W B;  3DWK A;  4EEP A;  4HEF A;  4HI4 A;  2ZC3 B;  2WGI A;  2HDQ A;  4E3J A;  4PPR A;  4WM9 A;  1LL8 A;  5J3W A;  4II7 A;  3K2N A;  1K6R A;  1TF1 A;  4IUH A;  3FV7 A;  1NY0 A;  5GL9 A;  3Q1F A;  2WAF A;  4GHI A;  3MF0 A;  5CRF A;  4S2L A;  2ZM2 A;  4LRY C;  5M18 A;  4B88 A;  5M1A A;  3ITB A;  3Q7V A;  2OSU A;  5FAT A;  4G3V A;  3LID A;  3CI6 A;  3LEQ A;  4R3B A;  1FOF A;  4PHT A;  1NJ4 A;  1IYS A;  4ZBE A;  2OWH A;  2A2L A;  1VET A;  2V8C A;  2XK1 A;  1ODV A;  2IWC A;  2OLV A;  2XH9 A;  3BM6 A;  1V9Z A;  1F5M A;  1TEM A;  1OJ5 A;  4JXV A;  1YLZ A;  2JC7 A;  2VV6 A;  1ZTU A;  2QYB A;  4OLG A;  2W0N A;  4FCF A;  5GHX A;  1CF0 A;  1Z6F A;  3BFG A;  3TSG A;  4WUJ A;  3RTY A;  2GDN A;  5DTK A;  1K4F A;  1W8Q A;  1LL5 A;  3G35 A;  3CJM A;  1LI9 A;  5DKL A;  4XUZ A;  2PBD P;  1L0E A;  1VM1 A;  1CJF A;  1K25 A;  4E3N A;  5HWW A;  1LHY A;  2X01 A;  3UN7 A;  4LGW A;  1RP5 A;  4DE3 A;  1OT6 A;  4QU3 A;  4QY6 A;  4X69 A;  2P04 A;  3C7V A;  4C3Q A;  2Y2I A;  5CXW A;  3PHY A;  4S2M A;  1L0D A;  1E3U D;  3PBQ A;  1H8M A;  4HH2 A;  4GDN A;  3B33 A;  1LSX A;  2H5S A;  1YLJ A;  2M7U A;  3KX0 X;  4DXB A;  1FSW A;  3WS1 A;  2H0Y A;  3OCN A;  2P9V A;  1Q2P A;  2JCH A;  3T4O A;  1ES3 A;  4BJP A;  5F82 A;  4Y0T A;  1FCN A;  1QME A;  1DP6 A;  4MN5 A;  3ULF A;  4I38 A;  3HUO A;  4DF6 A;  4LRX C;  4B9O A;  4IED A;  4EEU A;  2XD5 A;  3CIT A;  3MXR A;  4X1L A;  4PMA A;  4OQG A;  3KYZ A;  3PBN A;  3JVU A;  2HDR A;  3FKW A;  4LCM A;  1DJA A;  3BJN A;  3E0Y A;  4MEZ A;  3MSH A;  1WA9 A;  1JTG A;  5DF9 A;  1D1J A;  3UB6 A;  4DMZ A;  5KSC A;  4X56 A;  1KDS A;  4GDB A;  3LIF A;  3W8K A;  2PD8 A;  1I2S A;  1TD5 A;  2RL3 A;  2EA9 A;  1F9I A;  3QHY A;  1UWN X;  3VP4 A;  1K56 A;  3ZCZ A;  1PYY A;  3GSG A;  1TDG A;  4PKY G;  1BSG A;  3RFB A;  4FH4 A;  1KGF A;  2J3T D;  3EEA A;  2AVX A;  1MBL A;  2Y8H A;  2CC1 A;  1GA9 A;  2OOL A;  3SZT A;  2ZD8 A;  5EVL A;  1OME A;  3HUN A;  2D02 A;  5A91 A;  1O7E A;  3WWX A;  2VA0 A;  1KGE A;  5F1G A;  2HDS A;  2B02 A;  3QNB A;  4E6W A;  4KG2 A;  4HQA A;  2W3F A;  3M6H A;  1K4E A;  3NDG A;  1E3U A;  4NET A;  1MPL A;  1LL9 A;  5HAP A;  2XGN A;  1YSQ A;  2MJ6 A;  1UWP X;  1ERM A;  1NRF A;  4Y2F A;  3LR0 A;  4FOF A;  5G4Z A;  4BWI A;  1P97 A;  2ZBB A;  3S7N A;  4GB7 A;  1T1A A;  3MXS A;  3MZE A;  3BWL A;  3T50 A;  2Z6C A;  2XFT A;  1PZP A;  4P6Z S;  1XJ4 A;  1Z09 A;  2X71 A;  2VKS A;  4YIN A;  1JVJ A;  3C8C A;  3UE0 A;  1M6K A;  5EM0 A;  4Y7P A;  4I3A A;  1K56 D;  4BL3 A;  3A3I A;  2WAD A;  5HAR A;  1ERO A;  2XA7 S;  4E3M A;  3FWL A;  4DE0 A;  4KQO A;  2GNX A;  4P6B A;  4R0Q A;  3LI8 A;  3E98 A;  3CZD A;  2A24 B;  2H28 A;  5GLD A;  3RH8 B;  3CWF A;  3IT9 A;  3RXX A;  4D2O A;  4E3I A;  4XXR A;  2J7V A;  2HP5 A;  4PAU A;  4EBP A;  1V9Y A;  2KDK A;  4IBR A;  3N7W A;  2HZ5 A;  1DRM A;  3VOL A;  3WRT A;  3ZFZ A;  4WBG A;  3T4T A;  3H82 B;  5DTT A;  5FSR A;  3L9K A;  1FR6 A;  3UME A;  4JXG A;  2DNS A;  3D72 A;  2PR6 A;  1DY6 A;  1KDW A;  1XP4 A;  4WMC A;  2ZL1 B;  5E2F A;  2ZC7 A;  3PR6 A;  3N8L A;  3UPP A;  2V0W A;  3A3F A;  4K0X A;  4BBU A;  5EFW A;  2ZM0 A;  5HL6 A;  2EX8 A;  4BBT A;  5CEC A;  2XDM A;  2VGL S;  1KE0 A;  3GQZ A;  2Y2G A;  5IS1 A;  3HLF A;  2ZQ7 A;  5DJT A;  3H7W A;  2WKP A;  4WMC D;  3VP0 A;  4O0P A;  4XT2 A;  3UB5 P;  3E4Q A;  4UA6 A;  1VEU B;  3EOI A;  3ZNT A;  2EXB A;  3VV4 A;  1XJ6 A;  3IX8 A;  4R38 A;  3HL9 A;  4JGR A;  4OPR A;  1MY8 A; 
#chains in the Genus database with same CATH homology
 4ME4 A;  3S7Q A;  1P0Z A;  4MN6 A;  4CLC E;  5IT5 A;  5DJU A;  4WF0 A;  4R3A A;  3MMH A;  3CUE A;  2KX6 A;  3BY8 A;  5IU1 A;  3UE3 A;  2KOI A;  1NLY A;  4HP4 A;  4WN5 A;  3LUQ A;  1G28 A;  3S7O A;  4GS9 A;  2JKR I;  3DBA A;  3T4S A;  1BYW A;  3BQ8 A;  4YOF A;  4Z1W A;  1TS6 A;  1OTA A;  4RQ9 A;  4LLO B;  3KSG A;  4GLQ A;  2W3G A;  1N9L A;  4LRZ E;  5LBR A;  3T4K A;  1LSV A;  5CX7 A;  5I5L A;  3FPV A;  3KO6 A;  4GCZ A;  3TJZ C;  3PXP A;  2I9V A;  3CLO A;  3VE4 A;  3EGX C;  2G7U A;  4EEP A;  4G3K A;  4HI4 A;  3E4O A;  3PYP A;  4NXG A;  1LT0 A;  2XRO A;  1MC0 A;  1S67 L;  2Y79 A;  4L9G A;  1LL8 A;  1LSW A;  3OBF A;  3F1N B;  5J3W A;  1GSX A;  1XFN A;  3LR5 A;  5DFX A;  2KLI A;  2OAP 1;  2OWJ A;  2LB5 A;  2PYP A;  4MN7 A;  1UGU A;  3BY9 A;  3K2N A;  4II7 A;  4B93 A;  4P6Z M;  5HD5 A;  5HSQ A;  2VV8 A;  1TF1 A;  3D3O A;  4IUH A;  3T4L A;  1OT9 A;  3TE8 A;  4NKP A;  1TS7 A;  4GHI A;  5HD3 A;  3LYX A;  1DP9 A;  3MF0 A;  4IUK A;  4GS9 B;  4LRY C;  3UB7 A;  4Y3I A;  5C5K A;  2GX5 A;  3PBO A;  3EWK A;  4CLC B;  4G3V A;  3LID A;  3CI6 A;  3IS2 B;  1TS8 A;  2QJ5 A;  2Z6D A;  2IA2 A;  4PHT A;  1NLZ A;  1TS0 A;  2HJE A;  2ZMV A;  4R70 A;  2OWH A;  2A2L A;  3JVV A;  2FZ0 A;  5TJJ A;  3C30 A;  3LI9 A;  1ODV A;  3C38 A;  4HH3 A;  2O0Y A;  4ZRR A;  4GW9 A;  1GSV A;  3H82 A;  3V67 A;  4MCW A;  1YAX A;  3IBJ A;  1V9Z A;  4GJ4 A;  1F5M A;  2R78 A;  3MJQ A;  1OJ5 A;  3OCL A;  1T19 A;  4UQI S;  3T4J A;  5J4E A;  2VV6 A;  1ZTU A;  2QYB A;  4GHI B;  4JGP A;  2W0N A;  4DJ2 A;  2J80 A;  5AVF A;  3W2Z A;  3C2W A;  2J3T C;  4WUJ A;  2V1A A;  5DKK A;  4HIA A;  2YKH A;  3RTY A;  5HWV A;  5KSH A;  2P7J A;  3R7W A;  2XSS A;  2PR5 A;  5DKL A;  1Y28 A;  3UMD A;  3P01 A;  5TBM A;  3O5Y A;  4LPZ A;  5HWW A;  4EES A;  1D06 A;  3F1P B;  5L8M A;  1N9N A;  1H3Q A;  2K2N A;  3SW1 A;  4UQI M;  5AVE A;  1OT6 A;  2P04 A;  3HJK A;  1OTI A;  5F69 A;  4BMW A;  4L9E A;  1X0O A;  3PHY A;  4IJG A;  3TW8 A;  3FC7 A;  2HGV A;  3UB9 A;  3LFV A;  1DP8 A;  1MKM A;  2JHE A;  1VHM A;  3EGD C;  3PBQ A;  4HH2 A;  1H8M A;  4HY8 A;  4NEE D;  2VEA A;  2HF6 A;  3B33 A;  1W63 M;  1LSX A;  1N9O A;  2OAQ 1;  5DFY A;  4EET B;  2XA7 M;  2VGL M;  2M7U A;  3KX0 X;  2PYR A;  3UB8 A;  3MFX A;  1OPX A;  4F3L B;  2JN7 A;  5A8B A;  3T4Q A;  3OCN A;  1XJ2 A;  3T4O A;  4YNR A;  4BJP A;  1W63 Q;  1IOU A;  3F1N A;  3CUE C;  1DP6 A;  3GEC A;  4MN5 A;  2A24 A;  3ULF A;  3S7P A;  3NOU C;  4I38 A;  3KYQ A;  1S1Z A;  2VLG A;  5F5Y A;  4LRX C;  4B9O A;  4OOM A;  4EEU A;  3CIT A;  3KYZ A;  3R4K A;  3PBN A;  3JVU A;  4HHD A;  2PDR A;  1EW0 A;  4EW7 A;  4OOL A;  2VX8 A;  3KSF A;  5HDS A;  4QPR A;  2LB9 A;  3BJN A;  2QJ7 A;  2ZOI A;  3LR3 A;  2VZW A;  3HCY A;  3F1O B;  2QKP A;  2INW A;  2O99 A;  4WEK A;  2HJ9 C;  5G4Y A;  2ZOH A;  3E0Y A;  1OTE A;  1WA9 A;  4H6J A;  5DF9 A;  5HZH A;  1T1C A;  3LIA A;  3UB6 A;  2PHY A;  3ZQ5 A;  3E4P A;  4DMZ A;  4F3L A;  3LIF A;  2PD8 A;  2M1C A;  4DN0 A;  1TD5 A;  2JKT I;  2EA9 A;  1F9I A;  2V9A A;  3MR0 A;  3BW6 A;  1UWN X;  5F6A A;  2ZMF A;  1P9R A;  4DJ3 A;  5AJG A;  4Q0I A;  3MQ0 A;  4PKY G;  3RFB A;  2W3H A;  4EUV A;  2J3T D;  1S1Y A;  3EEA A;  3OC2 A;  1S66 L;  3NJA A;  4HJ4 A;  3H9W A;  1OTD A;  2L0W A;  3EEH A;  3K3D A;  2Y8H A;  4ARZ B;  2WKQ A;  3LR4 A;  3PBS A;  2OOL A;  1KOU A;  2J3W A;  4KUK A;  2QWS A;  4MMN A;  4AFI A;  4JGO A;  1S4R A;  3IS2 A;  2D02 A;  3NOT C;  5J7E A;  2D01 A;  4HJ3 A;  3ICY A;  4EXO A;  1XFQ A;  1VB6 A;  2VA0 A;  2W1T B;  4NXE A;  2B02 A;  4HOI A;  5HWT A;  4EER A;  4WLA A;  4ETX A;  2O9C A;  3MQO A;  4HQA A;  4O8G A;  2W3D A;  2EWV A;  4CLC C;  2W3F A;  4O01 A;  1S4S A;  3TRC A;  2B18 A;  5K5B A;  2W27 A;  3LIE A;  2O9B A;  1IFQ A;  5MC7 A;  5HDD A;  4Y5F A;  3LIB A;  4NXF A;  1YSQ A;  2MJ6 A;  1NRJ A;  3MQQ A;  1F98 A;  2EWW A;  1UWP X;  4L9F A;  3CAX A;  1XJ3 A;  4Y2F A;  4EQ1 A;  3A0V A;  3LR0 A;  4FOF A;  5G4Z A;  4BWI A;  4CLC D;  1P97 A;  3OLO A;  2ZBB A;  3B47 A;  3NHQ A;  3S7N A;  4HJ6 A;  1T1A A;  4WEL A;  3GDI A;  3EQU A;  4UEY A;  4ARZ A;  1ZHH B;  3U2A A;  3R7W B;  2QHK A;  3BWL A;  3T50 A;  2Z6C A;  5HPI A;  4P6Z S;  4PKY A;  1XJ4 A;  2VKS A;  4I3I A;  4WEJ A;  2K31 A;  3C8C A;  2W1T A;  3F1P A;  4HNB A;  4NXB A;  4I3A A;  3BQA A;  3NOP C;  4I3J A;  1OTB A;  3B42 A;  2NUP C;  1GSW A;  2XA7 S;  2O9A A;  4I39 A;  4KQO A;  2GNX A;  3LI8 A;  1D7E A;  3E98 A;  3K3C A;  4HP9 A;  2A24 B;  2H28 A;  3A0S A;  4KUO A;  3RH8 B;  2PD7 A;  1YSP A;  2V0U A;  5KIZ A;  1T18 A;  4M4X A;  3CWF A;  2V1B A;  1P9W A;  4G3W A;  4Q0H A;  4H6J B;  4I5S A;  1NWZ A;  2P08 A;  4PAU A;  4XT2 B;  3KSI A;  4R6L A;  3H7W B;  2XRN A;  1V9Y A;  2KDK A;  5HDC A;  2JKR M;  4ETZ A;  1DRM A;  3VOL A;  3T4T A;  2GZA A;  3H82 B;  4CQH A;  2W1R A;  4WL9 A;  3UE6 A;  2GJ3 A;  2HV1 A;  2BAS A;  3MXQ A;  3OOV A;  2DMW A;  2YKF A;  3UME A;  4BBV A;  2L4R A;  3D72 A;  3A0R A;  2K7S A;  3ZYT A;  1MZU A;  2M7V A;  2PR6 A;  1JNU A;  2WKR A;  1T1B A;  2NUT C;  3PR6 A;  5FL3 A;  3FPW A;  3IBR A;  4EU0 A;  3HJI A;  3PBR A;  2V0W A;  3LIC A;  2L1M A;  4BBU A;  3F1O A;  1YKD A;  2PT7 A;  5EFW A;  5HL6 A;  1OJG A;  4BBT A;  3P7N A;  2VGL S;  4YWZ A;  5HPF A;  3G6O A;  5IS1 A;  4E04 A;  4Q0J A;  5DJT A;  1G6O A;  3H7W A;  2WKP A;  4L0L A;  5F68 A;  4O0P A;  4KQD A;  2VV7 A;  4XT2 A;  3KSH A;  3E4Q A;  3FG8 A;  2JKT M;  3EOI A;  3PBT A;  2CMN A;  2FH5 A;  4K08 A;  2VJW A;  4IHQ A;  3VE3 A;  3VV4 A;  2W3E A;  1XJ6 A;  4R38 A;  3EQV A;  4FSF A;  4JGR A;  4CLC A;  4MDZ A;  1STZ A;  5TBM B;  4JGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...