2V0UA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (cryo dark structure of lov2 (404-546))
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase
molecule keywords NPH1-1
total genus 48
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v0uA00
1OTAA 1XJ3A 2W0NA 2WKRA 4EEPA 3FC7A 5AVEA 3HJIA 2BASA 4HI4A 1MZUA 3NJAA 1S4RA 2JN7A 1T1CA 5HWTA 2PR6A 5KIZA 4I3JA 1OTIA 3UB8A 1V9ZA 2ZOIA 3KX0X 3RTYA 1P97A 3ULFA 1N9LA 3F1PA 1F9IA 1Y28A 2EA9A 2PD7A 2K7SA 3EEHA 1S67L 3CWFA 1UWPX 3PHYA 3NHQA 3BWLA 1T18A 1OTEA 2A24B 2QHKA 3LIEA 4GS9B 5TBMA 4WN5A 3A0VA 3H9WA 1T1AA 1DP9A 3F1OB 4WUJA 2OWJA 1N9OA 2PD8A 1LSVA 2WKQA 4PKYG 4BBUA 4EEUA 1TS8A 4LPZA 4HHDA 1NWZA 4GHIA 5J4EA 2J80A 1N9NA 3F1PB 4KUOA 5HSQA 3CLOA 3MR0A 1XFNA 4NXEA 4MN6A 1VB6A 3A0RA 2V1AA 2QKPA 3BY9A 3BY8A 3F1OA 3H82A 4HP4A 3K3DA 4EQ1A 5J7EA 1DRMA 4XT2B 3UMEA 4L9GA 2A24A 1OTBA 2WKPA 3F1NA 3H7WB 1S66L 5HD3A 4EERA 5IS1A 3NOUC 3HJKA 1XFQA 2PHYA 3EWKA 4NXGA 4KUKA 5HD5A 2CMNA 3VE3A 5J3WA 1D7EA 4JGQA 4HJ3A 1T19A 2ZOHA 3UB9A 4HH2A 3D72A 5HWVA 1ODVA 1X0OA 3F1NB 4WLAA 4LLOB 1OT9A 3LI8A 2PYPA 1LSXA 2L0WA 2L1MA 3MJQA 3UMDA 4LRZE 3VOLA 3H82B 4F3LB 3C8CA 2D02A 5DKKA 3NOTC 2JHEA 5F5YA 1UGUA 4L9EA 2OOLA 1LL8A 4LRXC 5A8BA 1TS7A 2D01A 4R38A 1D06A 2VV7A 4HOIA 3ZQ5A 1KOUA 3UB6A 2KDKA 3E4PA 4DJ3A 4HQAA 4E04A 3ICYA 3LI9A 3C2WA 4RQ9A 5HDSA 2P7JA 1S1ZA 4JGPA 5F69A 5HWWA 3UE6A 4F3LA 1WA9A 1BYWA 3LUQA 3VE4A 1F98A 2QJ5A 5HDDA 3G6OA 1XJ2A 2OWHA 2INWA 4GCZA 1DP6A 3LICA 3E4QA 3CAXA 3IBRA 4KQDA 1XJ4A 4WL9A 5G4YA 3RH8B 2B02A 4HNBA 2I9VA 1OJ5A 3A0SA 3MXQA 4GHIB 2V1BA 4XT2A 2Z6CA 4PKYA 3SW1A 4JGRA 3H7WA 3IS2A 4L9FA 4HY8A 1OT6A 3MQOA 4H6JA 4JGOA 4B9OA 3E4OA 1S4SA 3MQQA 2VV8A 4R3AA 5G4ZA 5HDCA 1GSXA 1T1BA 3NOPC 3UB7A 2KX6A 2M1CA 2V0WA 3OLOA 4R6LA 1XJ6A 2PR5A 2YKHA 4EXOA 5HZHA 4I3IA 4BBTA 3IS2B 1TS6A 2QJ7A 4EETB 4M4XA 4R70A 2H28A 1GSVA 2HV1A 3LIBA 4H6JB 3T50A 2V0UA 1JNUA 5F6AA 1G28A 5TBMB 5EFWA 1DP8A 2Z6DA 4GS9A 4HP9A 4MN5A 5DJUA 5IU1A 4LRYC 4HH3A 3LIAA 4I39A 4HJ6A 4I3AA 2VLGA 2W27A 2QWSA 4YWZA 5I5LA 4EESA 1LT0A 1OTDA 5DJTA 4EW7A 1S1YA 1LSWA 2R78A 1V9YA 1OJGA 2PYRA 2V9AA 3MFXA 4GW9A 5F68A 4NXFA 3LIFA 1EW0A 4WF0A 2YKFA 2VV6A 4K08A 4HJ4A 1UWNX 3LYXA 4NXBA 5DKLA 2PDRA 4I5SA 2ZBBA 3B33A 3PYPA 4I38A 4DJ2A 5AVFA 3LIDA 2VEAA 1GSWA 3FG8A 3GECA 3GDIA 2GJ3A 1P0ZA 4HIAA 1TS0A 3K3CA 3P7NA 2L4RA 4BBVA
chains in the Genus database with same CATH superfamily
4ARZA 3BQAA 2B95A 4HI4A 1MZUA 4ZJ1A 5L10A 2PD7A 3PHYA 1OTEA 3BLMA 4H8RA 1N9OA 5HAQA 1NJ4A 2A2LA 4CLCE 4OP5A 4S2IA 3F1PB 3UO9A 1KDWA 4Y17A 3K3DA 5CHJA 4NEED 1C3BA 2PHYA 5EV0A 5DF8A 1D7EA 5HWVA 2VA0A 3UB9A 3D72A 5FEFA 2DNSA 4MLLA 2L1MA 3LR3A 3O87A 5GLAA 3H82B 4PHTA 1FSWA 5F5YA 3IXGA 3UB6A 4E3MA 5FASA 3O3VA 4BL3A 5E2GA 3EGDC 4EBNA 3RH8B 4KZ6A 3DWZA 2HGVA 5GLDA 4AFIA 4XT2A 4JXGA 5CGXA 2ZQ7A 1D1JA 3OPPA 1VETA 2R9WA 2LB5A 1KDSA 1JWPA 2HJ9C 2QJ7A 4M4XA 2O9BA 3WRTA 4GS9A 3LIAA 3EQVA 1LSWA 3MXSA 5G18A 4R1GA 1E4DA 2Y55A 1ONGA 3LFVA 1W8QA 1IYQA 3PBOA 4UQIM 4ME4A 2A3UA 3AGEA 3TJZC 2BASA 5HW3A 4ZJ3A 3WS4A 3ULFA 4GOGA 3V67A 2WUQA 1S67L 4EBPA 2ZQDA 3PTEA 2ZQ8A 1DP9A 4B4ZA 4EEUA 1JTGA 4DRTA 5HPFA 4NG2A 5EVIB 4ZAMA 5FI7A 5JYPA 3H82A 4QU3A 2VGLS 1ESUA 4QB8A 3S22A 1DJBA 3AGDA 2FFFB 4B4XA 4Y15A 5DF7A 1F2KA 3DWKA 3HL9A 3IH8A 4ID4A 2H10A 3WS5A 5A91A 5CTNA 1Z09A 5HL1A 1YMXA 1FOFA 1PWGA 3A3JA 1QMEA 4Y0OA 1XX2A 4Y5FA 1FQGA 1NLZA 4NETA 4Q8IA 1K57A 1PI4A 1NRFA 1N9BA 2M1CA 2V0WA 1PW8A 2ZJ9A 2PR5A 3MZFA 4BBTA 2Y2MA 1RP5A 1OPXA 2A49A 3Q81A 3A3FA 4K0XA 1DJCA 1ES3A 3EQUA 4R4RA 4QJGA 3PBSA 1Y4OA 2R78A 3IX4A 4NXFA 2JKRI 3A3EA 4Y0TA 2PT7A 1PZPA 4E3IA 5GHYA 2Y2PA 3LIDA 3DTIA 1GSWA 3M2KA 3D3OA 3Q82A 2EWWA 3UB8A 2VX8A 3Q07A 4IJGA 2XA7M 3LO7A 2WZXA 1CI8A 3HBRA 3ZG9B 4KG2A 1H8MA 5J7EA 2K31A 2HDSA 3L7HA 3DTMA 3EWKA 3DTKA 1K6SA 5BOHA 4Z1WA 3T4OA 4UEYA 3GR2A 2L0WA 3N4IA 3IF5A 2WADA 5KSCA 4L9EA 3VFHA 3OBFA 5L07A 4HQAA 4LV2A 1YLWA 3V39A 1TEMA 2HDRA 2H0YA 4S2NA 3UE6A 2V8CA 3G6OA 3VP1A 4RVAA 1BLSA 1MWUA 1K55C 4XUXA 5F1FA 2NUPC 5EOEA 1ONHA 4G3WA 3MQQA 1NZUA 4UA9A 5CGSA 2KX6A 3OLOA 4I3IA 2W1TB 4KQRA 3PXPA 1TDGA 3LIBA 1L0EA 5F6AA 2LB9A 4P6ZS 1ES2A 1DP8A 2O99A 4Q0JA 1ZC2A 4PM6A 2FFYA 2XR0A 2ZBBA 3JPUA 3T4QA 4MNRA 1M40A 3KYQA 3QP5A 2ZQ9A 1FCOA 5HPIA 1BLHA 3BFCA 2BLSA 1KGEA 5E43A 3A0VA 5CERA 1LSVA 2WKQA 1A0KA 2ACGA 3C38A 1NYYA 2P9VA 3PBNA 1VB6A 1FILA 3BY9A 1OTBA 3ZG0A 5CRFA 1ZG4A 4LCLA 5J3WA 1MPLA 1Y54A 3ZNTA 1IYOA 3MXRA 1KE3A 1XGJA 3C8CA 3FYZA 4FCFA 3CITA 4LRXC 3IF6C 5TR7A 2JCHA 4P0MA 5HWWA 3D4FA 2XRNA 3FZCA 4CLCD 1XJ2A 2INWA 1DP6A 1K6RA 4OH0A 3TE8A 2UV0E 2X71A 1PIOA 3IXBA 5KSHA 3IWQA 1H0MA 1GHIA 5A90A 1SDNA 4O0PA 2PRFA 3ZGAB 3OZHA 1XGIA 2Y2GA 4HJ6A 2Y91A 3VOZA 4E6WA 1K38A 4ETZA 4KZ5A 4HJ4A 2ZQAA 3HLDA 4NXBA 3NDGA 3N8LA 4HIAA 2L4RA 4QHCA 5EUAA 3R7WA 4EEPA 2JN7A 4WMCA 2ZOIA 2HP9A 2ZM8A 4RX3A 4MBFA 3ZG5A 5J4EA 1SKFA 4KQOA 1XFNA 4HP4A 1NY0A 4EQ1A 4XT2B 1XA7A 3H7WB 4X68A 4IUKA 1IOUA 1XFQA 4KUKA 4DE3A 1T19A 3LI8A 3VP0A 4KG5A 4RA7A 2M7UA 1D06A 4DJ3A 3G30A 1AXBA 2DMWA 4DF6A 1NYMA 3LUQA 1F98A 3BEBA 3W4OA 2ZC5B 3KYEA 4DXCA 2V1BA 4P6BA 2Y2JA 2Y2OA 3IS2A 2OSUA 3UPNA 1GSXA 1T1BA 5CEBA 3B3XA 2IWCA 3IS2B 4R70A 2H28A 4WM9A 4QD4A 1MWRA 5TBMB 1G6OA 1FR6A 1PI5A 1S1YA 2JKTI 3IXDA 3G32A 1EW0A 3IHAA 3PAGA 3MBZA 4K08A 5CXWA 3EEAA 3T4TA 3VP4A 3MQ0A 3T4JA 1OMEA 3GDIA 3G4PA 3BRMA 1MWSA 3N8SA 1OTAA 1Q2PA 1EI5A 1T1CA 1I2SA 4KZAA 3IHBA 3BW6A 1N9LA 4KQDA 4WEKA 4HBTA 3BFDA 1KGGA 1TDLA 3H9WA 1L0FA 3EGXC 4HHDA 3G31A 1BTLA 1N9NA 3CLOA 4E3JA 3W4QA 1DRMA 3IT9A 5HD5A 4S2MA 3VE3A 4X69A 1NXYA 4HJ3A 5DTKA 3R7WB 2G2UA 2WGIA 2ZMAA 5CGWA 3CHWP 3OC2A 1W63Q 5FAOA 4R38A 2XEPA 2JKRM 4E04A 3C5AA 2I72A 3BFEA 5DTSA 3DW0A 5HDDA 1K56D 4OQHA 4NK3A 4R23A 3CPTB 3CAXA 5G4YA 2NUTC 5F82A 4Y0UA 4O01A 1K56A 5CHMA 4DE2A 2HF6A 3MZDA 4WBGA 3UB7A 1LI9A 4EETB 4OONA 3OPHA 2XSSA 1ALQA 4U0TA 5EM0A 1OTDA 3C4OA 4OP8A 4KENB 2XD5A 3LYXA 1ZHHB 5E2EA 3FV7A 4G3KA 3C4PA 3E98A 1CI9A 1MKMA 1AWIA 4EQIA 3RJUA 3VMAA 4ZJ2A 1P9WA 4L0LA 3NCKA 1VETB 5TJJA 3ZDJA 2B18A 4WN5A 1LL9A 2OWJA 4O8GA 4WMCD 1IKGA 2AVXA 1GA9A 3ZNYA 4PM7A 5HSQA 1VEUA 4NXEA 4BL2A 3A0RA 3OCNA 2HDUA 3BY8A 4HBUA 3FKWA 2EFXA 5IS1A 5I94A 1YLYA 3KSGA 3QP8A 2Z2MB 2ZC7A 3T1SA 2Q9NA 1YLPA 5FQIA 3O5YA 3F1NB 2ZM0A 1OT9A 3IH9A 4QY5A 3VOLA 4WELA 2PBDP 1K57C 2EWVA 2W3DA 3O88A 3GTCA 3TW8A 2D01A 3PBRA 5F1GA 1KOUA 4U0XA 5HDSA 3A3DA 4S2JA 3VE4A 3P01A 3LGOA 3UE1A 3SW1A 4IUHA 1LI0A 3ISGA 4GLQA 2ZC3B 4WZ5C 3IF6A 2XQZA 1JTDA 1H8YA 5CX7A 3K2NA 3HVFA 1CF0A 2W3FA 1SCWA 2O9CA 2XA7S 3EOIA 1YAXA 1MXOA 2XK1A 5CTMA 2EXBA 2KLIA 3CUEA 2J9OA 2XF3A 1EROA 2H5SA 3FPVA 2JKTM 1M6KA 3BFFA 5FSRA 3GECA 4PKYG 4OKPA 3UDFA 1E25A 3E2LA 4JKTA 3IQAA 1OTIA 2V1ZA 1WYBA 1P97A 1TVFA 4DXBA 2GDNA 1PNEA 2PAVP 4X56A 1MWTA 1N4OA 2XDMA 3Q1FA 3UY6A 3PBQA 3UPPA 2J80A 3VSKA 2JBFA 2V1AA 2QKPA 4UA6A 5HD3A 4DKIA 4EERA 1IEMA 4CLCA 4YINA 2EXAA 4CQHA 3B47A 3BECA 1CEGA 1VEUB 3GVBA 1K55A 2MJ6A 4BMWA 2GZAA 1SKOB 2IWBA 1J9MA 1W79A 3E2KA 1J3WA 3ZYTA 3S7QA 1PWCA 3HREA 2KDKA 3E4PA 5TGFA 5HX9A 4FTXA 3C2WA 2P7JA 5F69A 4F3LA 2Y2QA 1LHYA 2QJ5A 2HP5A 1W8YA 4GCZA 2JC7A 5M18A 4HNBA 5DTTA 2I9VA 1W63M 2PU2A 5L09A 4JBFA 5GL9A 2FZ0A 2VV8A 2Y4AA 1S6RA 4JLFA 4BENA 3IX3A 4X25A 1PW1A 5DJUA 3G35A 3W2ZA 4I3AA 2OAP1 5I5LA 1LT0A 4MBHA 1DY6A 2G2WA 2R9XA 3LEQA 4JXVA 4GW9A 5F68A 1YT4A 4LV0A 5M1AA 4WF0A 1SZVA 5MC7A 4P6ZM 4XUZA 1G6AA 2VJWA 5HAIA 5FI2A 1GCEA 4UAAA 5C5KA 3IX8A 1K25A 4WZ4A 4OPQA 2VEAA 3FG8A 2GJ3A 2CC1A 2JKFA 3ITAA 5AJGA 3K3CA 1FSYA 1ZG6A 2HZ5A 5KIZA 3KX0X 1WE4A 5KZHA 2H0TA 3F1PA 1F9IA 3U2AA 3EEHA 5FA7A 3CWFA 4GS9B 4OPRA 2QHKA 5FQKA 3QP1A 4JF4A 2HJEA 3JVUA 2Y8HA 4NKPA 4X55A 3SZTA 1CJFA 1STZA 1VM1A 3F1NA 1YLTA 4K0WA 4G3VA 3V3RA 4CJNA 3BJNA 4F3LB 4B88A 2X02A 5DKKA 5FAPA 2OOLA 2JE5A 5A8BA 5EOOA 2ZM2A 3HCYA 5DF9A 2Y79A 5FQJA 5AQAA 4RQ9A 1SKOA 3UN7A 1KVMA 4IEDA 2W3HA 4PPRA 2B02A 2J3WA 1W5DA 2Z6CA 3H7WA 3ZFZA 2W3EA 4OLDA 1TF1A 4D2OA 4N1XA 5E2FA 1XJ6A 5DVAA 3LY4A 2C5WB 5AQBA 3T50A 2XH9A 4HP9A 4Y3IA 4GKUA 2V9AA 3WS1A 3GMWA 3VOYA 4A5RA 5DKLA 3NBLA 4S2LA 3RFBA 1CEFA 4LENA 4Q0HA 1G5UA 1P0ZA 3SS5A 1ESIA 2EX8A 4EUZA 2EX9A 3WWXA 3HUNA 5HWTA 3RTYA 3UE0A 2GNXA 4Y7PA 1RGYA 5GHZA 4N92A 3F1OB 2PD8A 4BBUA 5A93A 4GHIA 1L2SA 2XLNA 4PAUA 2WGWA 2W3GA 4GDBA 3SS4A 5FDSA 2J3TD 4JXWA 4R4SA 2Q0OA 1X0OA 3FPWA 3HLEA 3MJQA 4LFUA 4OLGA 3UMDA 4EUVA 5EVEA 3Q7VB 1LL8A 3M2JA 2BTFP 4ZRRA 1FIKA 1ERQA 4GJ4A 4MN7A 3ZG8B 3W8KA 4WL9A 2V20A 4PKYA 4F94A 2HP6A 3UB5P 2DCFA 3FWLA 3IWIA 2XFTA 4R3AA 4CPKA 3NOPC 3HLFA 3LR0A 2EX6A 2W1RA 3BQ8A 1NLYA 2IWDA 4I39A 4O7DA 4EW7A 2QWSA 3QHYA 5GHXA 4Y13A 3LIFA 3V5MA 1K54C 3HLGA 4OQGA 2PDRA 3P09A 4DMZA 1EWZA 1H5XA 4K91A 1YLJA 3ZVTA 2OV5A 2WYXA 2GX5A 3NULA 2W1TA 2VZWA 4KZ4A 4DDSA 3T1RA 1UWPX 3LIEA 2ZL1A 5TBMA 4GD6A 2WKIA 1QMFA 5EECA 4UHUA 4BLMA 3LY3A 2WKPA 3TOIA 4P85A 4X6TA 4KZ7A 4C3QA 5GLCA 2WAFA 4FH2A 4E3LA 3IBJA 1RGZA 3IXHA 3N7WA 1UGUA 3MSHA 2WKEA 2UWXA 3ITBA 3OCLA 4JGPA 1BYWA 4CLCC 1HD8A 1O7EA 3E4QA 3IBRA 3LR5A 3N8RA 4UQIS 4GHIB 1OJ5A 3A0SA 4GNUA 1Z6FA 4U3TA 4OQIA 4QY6A 4IVIA 1PYYA 5HDCA 1SDEA 4R6LA 5DFXA 3VP3A 4KZ8A 3HLBA 4N1HA 3TRCA 3O86A 1GSVA 2OLVA 4HEFA 2P9VB 3M6HA 2W27A 3LR4A 2VGLM 3C30A 4KZBA 3ZVWA 3KSIA 1LL5A 3C7UA 4E3KA 5F83A 2RL3A 5AVFA 3MKEA 3MZEA 3SH7A 1XPBA 3CJMA 4NXGA 4X1MA 3FC7A 3T4KA 4PM8A 3S7NA 2VGKA 2PR6A 4I3JA 3HLCA 4ZTKA 4ETXA 4XXRA 3LCEA 2X01A 4M3KA 3S7OA 5FQMA 2ZQCA 3RXWA 5FQQA 2Y2IA 1E3UA 4WLAA 2PYPA 4X53A 3DAVA 2Y2HA 1IYPA 3BYDA 3UDXA 5EVLA 1ES5A 1JWZA 2K2NA 4WZ5A 3KYZA 3ZQ5A 3V3SA 2G7UA 4S2PA 4DE1A 3LI9A 1S1ZA 3VV4A 1KE4A 2B5RA 3QP4A 4ZBEA 3LICA 3GV9A 5FI6A 1K4EA 3CUEC 3MQOA 4B9OA 1NRJA 3NECA 3G2YA 1TS6A 2HDQA 2ZD8A 4GD8A 3MKFA 4YOFA 4MN5A 3SOIA 3GQZA 2O9AA 1PZOA 1HTZA 3UNWA 3T1QB 3RXXA 4P87A 2WKRA 5AQ9A 1IKIA 4OPZA 3HUMA 4BWIA 3SH8A 1Y28A 2OAQ1 2K7SA 3CMZA 3BWLA 3BLSA 4BD1A 5D3OA 4UA7A 4E3NA 1F5MA 4LPZA 3C7VA 2P08A 1I2WA 3NDEA 4MCWA 3UMEA 2A24A 1XP4A 2V2FF 4JGQA 5EVIA 3QNBA 5EPHA 2FH5A 1BLCA 4LRZE 1P9RA 3NOTC 1RCJA 1HVBA 3KSHA 3FKVA 1ZTUA 4Y2FA 1CQAA 1JVJA 5KMWA 3WS2A 3A3IA 5CHUA 2VK3A 3P98A 3MFDA 3BM6A 5CECA 1ES4A 3B42A 1WA9A 3R4KA 5J8XA 3PBTA 1W7FA 4GDNA 4HESA 2OWHA 3VFFA 1H3QA 4JPMA 5HFOA 2Y2KA 5LBRA 3MXQA 1FCMA 3VSLA 4L9FA 2O0YA 4JF5A 1KGFA 3OOVA 5G4ZA 5FL3A 1CK3A 3JVVA 3BFGA 4EV4A 4CLCB 3MS6A 2ZMVA 1VHMA 2HV1A 4GB7A 2J9PA 1G28A 4PMAA 2Z6DA 1G68A 5EM1A 2BG1A 4S2OA 4EESA 5M19A 1V9YA 1OJGA 2PYRA 4IBXA 4OVDA 2XGNA 4YNRA 4WEJA 5EVID 3V50A 3WS0A 1HLUP 4Z9QA 2VGJA 2ZL1B 1BUEA 4BBVA 2W0NA 5CEDA 3NJAA 4PM5A 3Q7VA 1V9ZA 3PR6A 2EA9A 3NI9A 2A24B 1T1AA 3ZHHA 2WKHA 1K54A 4BJPA 5L2FA 4FSFA 3DBAA 5U47A 4KZ9A 4MN6A 5EE8A 3GRJA 3F1OA 4II7A 1YSPA 3NOUC 2DRWA 2WGWB 3NIAA 2PBYA 4HH2A 3CI6A 1KVLA 4FOFA 1IFQA 2E8IA 2IA2A 3T4SA 4EU0A 5GLBA 1TS7A 4MBKA 4C6YA 5HL6A 4HOIA 3OPLA 1XKZA 2M7VA 2WGVA 2J3TC 1L3LA 3UDIA 5IHVA 1BT5A 5FDHA 4EWFA 4S2KA 4JGRA 2XROA 4B93A 3TG9A 4MDZA 2YKHA 1NZOA 4BQMA 2V0UA 1WYCA 3AGFA 3HUOA 2ZC4B 3S4XA 4E6XA 2Q9MA 4HH3A 2VLGA 3T1XA 4MMNA 4KG6A 3MMHA 2YKFA 5L8MA 1UWNX 1YM1A 2Y59A 3T4LA 1K4FA 4OQ0A 5TFQA 1ERMA 3B33A 1PFLA 3CPTA 4R3BA 3JYIA 2QMIA 4C75A 5FEGA 3PAEA 3U4LP 1S0WA 2QPNA 4R0QA 3P7NA 4KQQA 5AVEA 4RYEA 4E3OA 4JF6A 1S4RA 3QP2A 1YKDA 4OPYA 2ZLYA 3KSFA 2HPBA 1T18A 1BULA 2QZ6A 4WUJA 2EX2A 2EFUA 3G2ZA 3NC8A 3SH9A 2Y2NA 4X1LA 3QNCA 3G34A 4IHQA 4L9GA 1Q2QA 1S66L 2Y2LA 1I5QA 3N6IA 5AQ7A 3HJKA 4FUWA 1LLBA 3UPOA 2CMNA 3Q7ZA 2ZOHA 1YQSA 4QWOA 3M6BA 1XXMA 4WYYA 3CZDA 1YPRA 1L0DA 3SS3A 1MC0A 4LGWA 3QP6A 3ICYA 1GHPA 4N9LA 5A92A 2WK0A 2VKSA 1DJAA 5HARA 1XJ4A 4FH4A 4PM9A 4OOYA 2XD1A 4H6JA 4JGOA 3E0YA 3E4OA 4R3JA 3DTEA 3KO6A 4ZDXA 4LV1A 4EXOA 5DFYA 3L9KA 4FD8A 1PWDA 2OLUA 4H6JB 3T12B 1JNUA 2J8YA 2XFSA 3GSGA 3OPRA 5EFWA 5JYOA 1FCNA 5IU1A 3IF6B 4LRYC 2QYBA 5IT5A 3UE3A 4YWZA 4DN0A 5DJTA 1E3UD 4Q0IA 4LV3A 1KE0A 2Z2LB 1BSGA 4ARZB 1TD5A 1XA1A 4ESPA 3WRZA 1GA0A 1YSQA 1ACFA 4DJ2A 1XJ3A 1FR1A 3HJIA 2P74A 1MKIA 5E2HA 2JKGA 3ZCZA 4BD0A 3NY4A 3PYPA 1YLZA 4KZ3A 3NHQA 5HAPA 1TS8A 4RX2A 1NWZA 4YFMA 5FQ9A 1SHVA 3HLWA 4KUOA 2RCXA 3MR0A 4GN2A 4DE0A 3S1YA 4S2NC 4OOMA 1O07A 1ODVA 5K5BA 4GZBA 4LLOB 2KOIA 1LSXA 3W4PA 5FAQA 2ZC6B 2D02A 2V8FA 4QPRA 3CG5A 2JHEA 2VV7A 1MY8A 1PRQA 1VQQA 2WAEA 4OOLA 4EBLA 2C6WB 1MBLA 1BLPA 4D60A 4MEZA 2PU4A 2WZZA 5EVIC 1H8ZA 3D9YA 3TSGA 1HZOA 4HY8A 1OT6A 1ZKJA 1BZAA 3MF0A 1S4SA 1GHMA 2ZMFA 4DDYA 5HZHA 1YMSA 4LCMA 4N9KA 2P04A 3LEZA 3I7JA 4JXSA 1IYSA 2E8JA 3MFXA 1IELA 5FATA 1JWVA 3IWOA 2VV6A 3VP2A 4IVKA 3S7PA 3ZG7B 4I5SA 1K0KA 4I38A 4IBRA 1L0GA 2J7VA 1U60A 1TS0A
chains in the Genus database with same CATH topology
4ARZA 2WKRA 3BQAA 3R7WA 4EEPA 4HI4A 1MZUA 2JN7A 4BWIA 5KIZA 2ZOIA 3KX0X 3F1PA 1F9IA 1Y28A 2OAQ1 2PD7A 2K7SA 3EEHA 3PHYA 3CWFA 3U2AA 4GS9B 3BWLA 1OTEA 2QHKA 1N9OA 1F5MA 2A2LA 2HJEA 4LPZA 4CLCE 5J4EA 3JVUA 2Y8HA 3F1PB 4KQOA 4NKPA 2P08A 1XFNA 1STZA 4MCWA 4HP4A 4EQ1A 3K3DA 4XT2B 3UMEA 2A24A 3H7WB 4NEED 3F1NA 4IUKA 1IOUA 1XFQA 2PHYA 4KUKA 1D7EA 4JGQA 2VA0A 1T19A 5HWVA 3UB9A 3D72A 4G3VA 3LI8A 2L1MA 3BJNA 2FH5A 3LR3A 4LRZE 4F3LB 3H82B 4PHTA 5DKKA 1P9RA 3NOTC 2M7UA 3KSHA 5F5YA 1ZTUA 2OOLA 4Y2FA 5A8BA 1D06A 3HCYA 5DF9A 3UB6A 2Y79A 4DJ3A 4RQ9A 3B42A 2DMWA 1WA9A 3LUQA 1F98A 3R4KA 3PBTA 2W3HA 2OWHA 3EGDC 1H3QA 5LBRA 3RH8B 2B02A 2J3WA 2HGVA 3MXQA 4AFIA 2V1BA 4XT2A 2Z6CA 3H7WA 3IS2A 4L9FA 2O0YA 2W3EA 3OOVA 1TF1A 5G4ZA 5FL3A 2LB5A 1GSXA 3JVVA 1T1BA 1XJ6A 4CLCB 2ZMVA 3IS2B 2HJ9C 2QJ7A 4M4XA 4R70A 2H28A 1VHMA 2HV1A 3T50A 1G28A 2O9BA 5TBMB 4HP9A 2Z6DA 4GS9A 4Y3IA 1G6OA 3LIAA 3EQVA 4EESA 1S1YA 1LSWA 1V9YA 1OJGA 2JKTI 2PYRA 2V9AA 1EW0A 4K08A 4YNRA 4WEJA 5DKLA 3LFVA 3EEAA 3T4TA 3RFBA 3MQ0A 3T4JA 3GDIA 4Q0HA 1P0ZA 3PBOA 4UQIM 4ME4A 4BBVA 1OTAA 2W0NA 3TJZC 2BASA 3NJAA 1T1CA 5HWTA 1V9ZA 3RTYA 2GNXA 3ULFA 3BW6A 1N9LA 3V67A 3PR6A 2EA9A 4KQDA 1S67L 4WEKA 2A24B 3H9WA 1T1AA 1DP9A 3F1OB 3EGXC 2PD8A 4EEUA 4BBUA 4BJPA 5HPFA 4HHDA 4GHIA 4FSFA 3DBAA 1N9NA 4PAUA 3CLOA 2W3GA 4MN6A 3H82A 3F1OA 4II7A 1YSPA 1DRMA 2J3TD 2VGLS 3NOUC 5HD5A 3VE3A 4HJ3A 4HH2A 1X0OA 3CI6A 3R7WB 3FPWA 3MJQA 3UMDA 4FOFA 1IFQA 3OC2A 4EUVA 1W63Q 2IA2A 3T4SA 4EU0A 1LL8A 1TS7A 4R38A 5HL6A 4HOIA 2JKRM 4E04A 2M7VA 4ZRRA 2J3TC 5HDDA 4GJ4A 4MN7A 3CAXA 5G4YA 4WL9A 2NUTC 4PKYA 4JGRA 4Y5FA 4O01A 1NLZA 2XROA 2HF6A 4R3AA 3NOPC 3UB7A 4B93A 4MDZA 2M1CA 2V0WA 3LR0A 2PR5A 2YKHA 2W1RA 3BQ8A 4BBTA 4EETB 2V0UA 1NLYA 1OPXA 2XSSA 4HH3A 4I39A 3EQUA 2VLGA 2QWSA 4EW7A 3PBSA 1OTDA 2R78A 4MMNA 3MMHA 3LIFA 4NXFA 2YKFA 5L8MA 2JKRI 1UWNX 3LYXA 3T4LA 1ZHHB 2PDRA 2PT7A 4DMZA 3B33A 4G3KA 3LIDA 1GSWA 3E98A 1MKMA 3P7NA 3D3OA 2GX5A 5AVEA 1S4RA 2W1TA 1YKDA 2EWWA 3UB8A 2VX8A 1P9WA 2VZWA 3KSFA 4L0LA 1UWPX 3LIEA 1T18A 5TJJA 5TBMA 2B18A 4IJGA 4WN5A 2XA7M 4WUJA 2OWJA 4O8GA 5HSQA 1H8MA 4NXEA 3A0RA 3OCNA 3BY8A 5J7EA 2K31A 4IHQA 4L9GA 5IS1A 2WKPA 1S66L 3HJKA 3KSGA 3EWKA 2CMNA 2ZOHA 3O5YA 3F1NB 3IBJA 4UEYA 4Z1WA 1OT9A 3T4OA 2L0WA 3VOLA 4WELA 2EWVA 2W3DA 1UGUA 4L9EA 3TW8A 1MC0A 2D01A 3PBRA 3OBFA 1KOUA 3OCLA 4HQAA 3ICYA 5HDSA 4JGPA 3UE6A 1BYWA 4CLCC 3VE4A 3G6OA 2VKSA 3E4QA 3IBRA 1XJ4A 3P01A 3LR5A 4UQIS 4GHIB 1OJ5A 3A0SA 3SW1A 4IUHA 2NUPC 4H6JA 4GLQA 4G3WA 4JGOA 3E0YA 3E4OA 3MQQA 5HDCA 3KO6A 2KX6A 3OLOA 4R6LA 5DFXA 4EXOA 5DFYA 3TRCA 4I3IA 2W1TB 3PXPA 5CX7A 3K2NA 1GSVA 3LIBA 4H6JB 1JNUA 5F6AA 2LB9A 4P6ZS 5EFWA 1DP8A 5IU1A 2W3FA 4LRYC 2QYBA 5IT5A 3UE3A 2O9CA 2O99A 2W27A 2XA7S 3EOIA 3LR4A 4Q0JA 4YWZA 4DN0A 5DJTA 1YAXA 4Q0IA 2VGLM 3C30A 2KLIA 3CUEA 4ARZB 1TD5A 3KSIA 2ZBBA 3FPVA 2JKTM 3T4QA 5AVFA 3GECA 1YSQA 3KYQA 4PKYG 4NXGA 4DJ2A 1XJ3A 3FC7A 3T4KA 3HJIA 3S7NA 2PR6A 4I3JA 1OTIA 1P97A 5HPIA 3PYPA 3NHQA 3A0VA 4ETXA 1LSVA 2WKQA 1TS8A 3C38A 1NWZA 3PBQA 2J80A 4KUOA 3S7OA 3PBNA 3MR0A 1VB6A 2V1AA 2QKPA 3BY9A 4EERA 1OTBA 5HD3A 4OOMA 4CLCA 4CQHA 3B47A 5J3WA 2MJ6A 1ODVA 4WLAA 5K5BA 4LLOB 2KOIA 1LSXA 2PYPA 4BMWA 2GZAA 3C8CA 2D02A 3CITA 2K2NA 4QPRA 2JHEA 3KYZA 4LRXC 3ZYTA 3S7QA 2VV7A 3ZQ5A 2KDKA 3E4PA 2G7UA 3LI9A 3C2WA 2P7JA 1S1ZA 5HWWA 5F69A 4OOLA 4F3LA 2XRNA 2QJ5A 3VV4A 4CLCD 1XJ2A 2INWA 4GCZA 1DP6A 3LICA 4HNBA 3TE8A 2I9VA 1W63M 3CUEC 4HY8A 1OT6A 3MQOA 3MF0A 4B9OA 5KSHA 2FZ0A 1S4SA 2VV8A 1NRJA 5AJGA 2ZMFA 5HZHA 1TS6A 4O0PA 4YOFA 4MN5A 5DJUA 3W2ZA 2P04A 4HJ6A 4I3AA 2OAP1 5I5LA 1LT0A 2O9AA 3MFXA 5F68A 4GW9A 5MC7A 4ETZA 4WF0A 2VV6A 4P6ZM 4HJ4A 4NXBA 2VJWA 3S7PA 4I5SA 5C5KA 4I38A 2VEAA 3FG8A 2GJ3A 4HIAA 1TS0A 3K3CA 2L4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTA A;  1XJ3 A;  2W0N A;  2WKR A;  4EEP A;  3FC7 A;  5AVE A;  3HJI A;  2BAS A;  4HI4 A;  1MZU A;  3NJA A;  1S4R A;  2JN7 A;  1T1C A;  5HWT A;  2PR6 A;  5KIZ A;  4I3J A;  1OTI A;  3UB8 A;  1V9Z A;  2ZOI A;  3KX0 X;  3RTY A;  1P97 A;  3ULF A;  1N9L A;  3F1P A;  1F9I A;  1Y28 A;  2EA9 A;  2PD7 A;  2K7S A;  3EEH A;  1S67 L;  3CWF A;  1UWP X;  3PHY A;  3NHQ A;  3BWL A;  1T18 A;  1OTE A;  2A24 B;  2QHK A;  3LIE A;  4GS9 B;  5TBM A;  4WN5 A;  3A0V A;  3H9W A;  1T1A A;  1DP9 A;  3F1O B;  4WUJ A;  2OWJ A;  1N9O A;  2PD8 A;  1LSV A;  2WKQ A;  4PKY G;  4BBU A;  4EEU A;  1TS8 A;  4LPZ A;  4HHD A;  1NWZ A;  4GHI A;  5J4E A;  2J80 A;  1N9N A;  3F1P B;  4KUO A;  5HSQ A;  3CLO A;  3MR0 A;  1XFN A;  4NXE A;  4MN6 A;  1VB6 A;  3A0R A;  2V1A A;  2QKP A;  3BY9 A;  3BY8 A;  3F1O A;  3H82 A;  4HP4 A;  3K3D A;  4EQ1 A;  5J7E A;  1DRM A;  4XT2 B;  3UME A;  4L9G A;  2A24 A;  1OTB A;  2WKP A;  3F1N A;  3H7W B;  1S66 L;  5HD3 A;  4EER A;  5IS1 A;  3NOU C;  3HJK A;  1XFQ A;  2PHY A;  3EWK A;  4NXG A;  4KUK A;  5HD5 A;  2CMN A;  3VE3 A;  5J3W A;  1D7E A;  4JGQ A;  4HJ3 A;  1T19 A;  2ZOH A;  3UB9 A;  4HH2 A;  3D72 A;  5HWV A;  1ODV A;  1X0O A;  3F1N B;  4WLA A;  4LLO B;  1OT9 A;  3LI8 A;  2PYP A;  1LSX A;  2L0W A;  2L1M A;  3MJQ A;  3UMD A;  4LRZ E;  3VOL A;  3H82 B;  4F3L B;  3C8C A;  2D02 A;  5DKK A;  3NOT C;  2JHE A;  5F5Y A;  1UGU A;  4L9E A;  2OOL A;  1LL8 A;  4LRX C;  5A8B A;  1TS7 A;  2D01 A;  4R38 A;  1D06 A;  2VV7 A;  4HOI A;  3ZQ5 A;  1KOU A;  3UB6 A;  2KDK A;  3E4P A;  4DJ3 A;  4HQA A;  4E04 A;  3ICY A;  3LI9 A;  3C2W A;  4RQ9 A;  5HDS A;  2P7J A;  1S1Z A;  4JGP A;  5F69 A;  5HWW A;  3UE6 A;  4F3L A;  1WA9 A;  1BYW A;  3LUQ A;  3VE4 A;  1F98 A;  2QJ5 A;  5HDD A;  3G6O A;  1XJ2 A;  2OWH A;  2INW A;  4GCZ A;  1DP6 A;  3LIC A;  3E4Q A;  3CAX A;  3IBR A;  4KQD A;  1XJ4 A;  4WL9 A;  5G4Y A;  3RH8 B;  2B02 A;  4HNB A;  2I9V A;  1OJ5 A;  3A0S A;  3MXQ A;  4GHI B;  2V1B A;  4XT2 A;  2Z6C A;  4PKY A;  3SW1 A;  4JGR A;  3H7W A;  3IS2 A;  4L9F A;  4HY8 A;  1OT6 A;  3MQO A;  4H6J A;  4JGO A;  4B9O A;  3E4O A;  1S4S A;  3MQQ A;  2VV8 A;  4R3A A;  5G4Z A;  5HDC A;  1GSX A;  1T1B A;  3NOP C;  3UB7 A;  2KX6 A;  2M1C A;  2V0W A;  3OLO A;  4R6L A;  1XJ6 A;  2PR5 A;  2YKH A;  4EXO A;  5HZH A;  4I3I A;  4BBT A;  3IS2 B;  1TS6 A;  2QJ7 A;  4EET B;  4M4X A;  4R70 A;  2H28 A;  1GSV A;  2HV1 A;  3LIB A;  4H6J B;  3T50 A;  2V0U A;  1JNU A;  5F6A A;  1G28 A;  5TBM B;  5EFW A;  1DP8 A;  2Z6D A;  4GS9 A;  4HP9 A;  4MN5 A;  5DJU A;  5IU1 A;  4LRY C;  4HH3 A;  3LIA A;  4I39 A;  4HJ6 A;  4I3A A;  2VLG A;  2W27 A;  2QWS A;  4YWZ A;  5I5L A;  4EES A;  1LT0 A;  1OTD A;  5DJT A;  4EW7 A;  1S1Y A;  1LSW A;  2R78 A;  1V9Y A;  1OJG A;  2PYR A;  2V9A A;  3MFX A;  4GW9 A;  5F68 A;  4NXF A;  3LIF A;  1EW0 A;  4WF0 A;  2YKF A;  2VV6 A;  4K08 A;  4HJ4 A;  1UWN X;  3LYX A;  4NXB A;  5DKL A;  2PDR A;  4I5S A;  2ZBB A;  3B33 A;  3PYP A;  4I38 A;  4DJ2 A;  5AVF A;  3LID A;  2VEA A;  1GSW A;  3FG8 A;  3GEC A;  3GDI A;  2GJ3 A;  1P0Z A;  4HIA A;  1TS0 A;  3K3C A;  3P7N A;  2L4R A;  4BBV A; 
#chains in the Genus database with same CATH topology
 4ARZ A;  3BQA A;  2B95 A;  4HI4 A;  1MZU A;  4ZJ1 A;  5L10 A;  2PD7 A;  3PHY A;  1OTE A;  3BLM A;  4H8R A;  1N9O A;  5HAQ A;  1NJ4 A;  2A2L A;  4CLC E;  4OP5 A;  4S2I A;  3F1P B;  3UO9 A;  1KDW A;  4Y17 A;  3K3D A;  5CHJ A;  4NEE D;  1C3B A;  2PHY A;  5EV0 A;  5DF8 A;  1D7E A;  5HWV A;  2VA0 A;  3UB9 A;  3D72 A;  5FEF A;  2DNS A;  4MLL A;  2L1M A;  3LR3 A;  3O87 A;  5GLA A;  3H82 B;  4PHT A;  1FSW A;  5F5Y A;  3IXG A;  3UB6 A;  4E3M A;  5FAS A;  3O3V A;  4BL3 A;  5E2G A;  3EGD C;  4EBN A;  3RH8 B;  4KZ6 A;  3DWZ A;  2HGV A;  5GLD A;  4AFI A;  4XT2 A;  4JXG A;  5CGX A;  2ZQ7 A;  1D1J A;  3OPP A;  1VET A;  2R9W A;  2LB5 A;  1KDS A;  1JWP A;  2HJ9 C;  2QJ7 A;  4M4X A;  2O9B A;  3WRT A;  4GS9 A;  3LIA A;  3EQV A;  1LSW A;  3MXS A;  5G18 A;  4R1G A;  1E4D A;  2Y55 A;  1ONG A;  3LFV A;  1W8Q A;  1IYQ A;  3PBO A;  4UQI M;  4ME4 A;  2A3U A;  3AGE A;  3TJZ C;  2BAS A;  5HW3 A;  4ZJ3 A;  3WS4 A;  3ULF A;  4GOG A;  3V67 A;  2WUQ A;  1S67 L;  4EBP A;  2ZQD A;  3PTE A;  2ZQ8 A;  1DP9 A;  4B4Z A;  4EEU A;  1JTG A;  4DRT A;  5HPF A;  4NG2 A;  5EVI B;  4ZAM A;  5FI7 A;  5JYP A;  3H82 A;  4QU3 A;  2VGL S;  1ESU A;  4QB8 A;  3S22 A;  1DJB A;  3AGD A;  2FFF B;  4B4X A;  4Y15 A;  5DF7 A;  1F2K A;  3DWK A;  3HL9 A;  3IH8 A;  4ID4 A;  2H10 A;  3WS5 A;  5A91 A;  5CTN A;  1Z09 A;  5HL1 A;  1YMX A;  1FOF A;  1PWG A;  3A3J A;  1QME A;  4Y0O A;  1XX2 A;  4Y5F A;  1FQG A;  1NLZ A;  4NET A;  4Q8I A;  1K57 A;  1PI4 A;  1NRF A;  1N9B A;  2M1C A;  2V0W A;  1PW8 A;  2ZJ9 A;  2PR5 A;  3MZF A;  4BBT A;  2Y2M A;  1RP5 A;  1OPX A;  2A49 A;  3Q81 A;  3A3F A;  4K0X A;  1DJC A;  1ES3 A;  3EQU A;  4R4R A;  4QJG A;  3PBS A;  1Y4O A;  2R78 A;  3IX4 A;  4NXF A;  2JKR I;  3A3E A;  4Y0T A;  2PT7 A;  1PZP A;  4E3I A;  5GHY A;  2Y2P A;  3LID A;  3DTI A;  1GSW A;  3M2K A;  3D3O A;  3Q82 A;  2EWW A;  3UB8 A;  2VX8 A;  3Q07 A;  4IJG A;  2XA7 M;  3LO7 A;  2WZX A;  1CI8 A;  3HBR A;  3ZG9 B;  4KG2 A;  1H8M A;  5J7E A;  2K31 A;  2HDS A;  3L7H A;  3DTM A;  3EWK A;  3DTK A;  1K6S A;  5BOH A;  4Z1W A;  3T4O A;  4UEY A;  3GR2 A;  2L0W A;  3N4I A;  3IF5 A;  2WAD A;  5KSC A;  4L9E A;  3VFH A;  3OBF A;  5L07 A;  4HQA A;  4LV2 A;  1YLW A;  3V39 A;  1TEM A;  2HDR A;  2H0Y A;  4S2N A;  3UE6 A;  2V8C A;  3G6O A;  3VP1 A;  4RVA A;  1BLS A;  1MWU A;  1K55 C;  4XUX A;  5F1F A;  2NUP C;  5EOE A;  1ONH A;  4G3W A;  3MQQ A;  1NZU A;  4UA9 A;  5CGS A;  2KX6 A;  3OLO A;  4I3I A;  2W1T B;  4KQR A;  3PXP A;  1TDG A;  3LIB A;  1L0E A;  5F6A A;  2LB9 A;  4P6Z S;  1ES2 A;  1DP8 A;  2O99 A;  4Q0J A;  1ZC2 A;  4PM6 A;  2FFY A;  2XR0 A;  2ZBB A;  3JPU A;  3T4Q A;  4MNR A;  1M40 A;  3KYQ A;  3QP5 A;  2ZQ9 A;  1FCO A;  5HPI A;  1BLH A;  3BFC A;  2BLS A;  1KGE A;  5E43 A;  3A0V A;  5CER A;  1LSV A;  2WKQ A;  1A0K A;  2ACG A;  3C38 A;  1NYY A;  2P9V A;  3PBN A;  1VB6 A;  1FIL A;  3BY9 A;  1OTB A;  3ZG0 A;  5CRF A;  1ZG4 A;  4LCL A;  5J3W A;  1MPL A;  1Y54 A;  3ZNT A;  1IYO A;  3MXR A;  1KE3 A;  1XGJ A;  3C8C A;  3FYZ A;  4FCF A;  3CIT A;  4LRX C;  3IF6 C;  5TR7 A;  2JCH A;  4P0M A;  5HWW A;  3D4F A;  2XRN A;  3FZC A;  4CLC D;  1XJ2 A;  2INW A;  1DP6 A;  1K6R A;  4OH0 A;  3TE8 A;  2UV0 E;  2X71 A;  1PIO A;  3IXB A;  5KSH A;  3IWQ A;  1H0M A;  1GHI A;  5A90 A;  1SDN A;  4O0P A;  2PRF A;  3ZGA B;  3OZH A;  1XGI A;  2Y2G A;  4HJ6 A;  2Y91 A;  3VOZ A;  4E6W A;  1K38 A;  4ETZ A;  4KZ5 A;  4HJ4 A;  2ZQA A;  3HLD A;  4NXB A;  3NDG A;  3N8L A;  4HIA A;  2L4R A;  4QHC A;  5EUA A;  3R7W A;  4EEP A;  2JN7 A;  4WMC A;  2ZOI A;  2HP9 A;  2ZM8 A;  4RX3 A;  4MBF A;  3ZG5 A;  5J4E A;  1SKF A;  4KQO A;  1XFN A;  4HP4 A;  1NY0 A;  4EQ1 A;  4XT2 B;  1XA7 A;  3H7W B;  4X68 A;  4IUK A;  1IOU A;  1XFQ A;  4KUK A;  4DE3 A;  1T19 A;  3LI8 A;  3VP0 A;  4KG5 A;  4RA7 A;  2M7U A;  1D06 A;  4DJ3 A;  3G30 A;  1AXB A;  2DMW A;  4DF6 A;  1NYM A;  3LUQ A;  1F98 A;  3BEB A;  3W4O A;  2ZC5 B;  3KYE A;  4DXC A;  2V1B A;  4P6B A;  2Y2J A;  2Y2O A;  3IS2 A;  2OSU A;  3UPN A;  1GSX A;  1T1B A;  5CEB A;  3B3X A;  2IWC A;  3IS2 B;  4R70 A;  2H28 A;  4WM9 A;  4QD4 A;  1MWR A;  5TBM B;  1G6O A;  1FR6 A;  1PI5 A;  1S1Y A;  2JKT I;  3IXD A;  3G32 A;  1EW0 A;  3IHA A;  3PAG A;  3MBZ A;  4K08 A;  5CXW A;  3EEA A;  3T4T A;  3VP4 A;  3MQ0 A;  3T4J A;  1OME A;  3GDI A;  3G4P A;  3BRM A;  1MWS A;  3N8S A;  1OTA A;  1Q2P A;  1EI5 A;  1T1C A;  1I2S A;  4KZA A;  3IHB A;  3BW6 A;  1N9L A;  4KQD A;  4WEK A;  4HBT A;  3BFD A;  1KGG A;  1TDL A;  3H9W A;  1L0F A;  3EGX C;  4HHD A;  3G31 A;  1BTL A;  1N9N A;  3CLO A;  4E3J A;  3W4Q A;  1DRM A;  3IT9 A;  5HD5 A;  4S2M A;  3VE3 A;  4X69 A;  1NXY A;  4HJ3 A;  5DTK A;  3R7W B;  2G2U A;  2WGI A;  2ZMA A;  5CGW A;  3CHW P;  3OC2 A;  1W63 Q;  5FAO A;  4R38 A;  2XEP A;  2JKR M;  4E04 A;  3C5A A;  2I72 A;  3BFE A;  5DTS A;  3DW0 A;  5HDD A;  1K56 D;  4OQH A;  4NK3 A;  4R23 A;  3CPT B;  3CAX A;  5G4Y A;  2NUT C;  5F82 A;  4Y0U A;  4O01 A;  1K56 A;  5CHM A;  4DE2 A;  2HF6 A;  3MZD A;  4WBG A;  3UB7 A;  1LI9 A;  4EET B;  4OON A;  3OPH A;  2XSS A;  1ALQ A;  4U0T A;  5EM0 A;  1OTD A;  3C4O A;  4OP8 A;  4KEN B;  2XD5 A;  3LYX A;  1ZHH B;  5E2E A;  3FV7 A;  4G3K A;  3C4P A;  3E98 A;  1CI9 A;  1MKM A;  1AWI A;  4EQI A;  3RJU A;  3VMA A;  4ZJ2 A;  1P9W A;  4L0L A;  3NCK A;  1VET B;  5TJJ A;  3ZDJ A;  2B18 A;  4WN5 A;  1LL9 A;  2OWJ A;  4O8G A;  4WMC D;  1IKG A;  2AVX A;  1GA9 A;  3ZNY A;  4PM7 A;  5HSQ A;  1VEU A;  4NXE A;  4BL2 A;  3A0R A;  3OCN A;  2HDU A;  3BY8 A;  4HBU A;  3FKW A;  2EFX A;  5IS1 A;  5I94 A;  1YLY A;  3KSG A;  3QP8 A;  2Z2M B;  2ZC7 A;  3T1S A;  2Q9N A;  1YLP A;  5FQI A;  3O5Y A;  3F1N B;  2ZM0 A;  1OT9 A;  3IH9 A;  4QY5 A;  3VOL A;  4WEL A;  2PBD P;  1K57 C;  2EWV A;  2W3D A;  3O88 A;  3GTC A;  3TW8 A;  2D01 A;  3PBR A;  5F1G A;  1KOU A;  4U0X A;  5HDS A;  3A3D A;  4S2J A;  3VE4 A;  3P01 A;  3LGO A;  3UE1 A;  3SW1 A;  4IUH A;  1LI0 A;  3ISG A;  4GLQ A;  2ZC3 B;  4WZ5 C;  3IF6 A;  2XQZ A;  1JTD A;  1H8Y A;  5CX7 A;  3K2N A;  3HVF A;  1CF0 A;  2W3F A;  1SCW A;  2O9C A;  2XA7 S;  3EOI A;  1YAX A;  1MXO A;  2XK1 A;  5CTM A;  2EXB A;  2KLI A;  3CUE A;  2J9O A;  2XF3 A;  1ERO A;  2H5S A;  3FPV A;  2JKT M;  1M6K A;  3BFF A;  5FSR A;  3GEC A;  4PKY G;  4OKP A;  3UDF A;  1E25 A;  3E2L A;  4JKT A;  3IQA A;  1OTI A;  2V1Z A;  1WYB A;  1P97 A;  1TVF A;  4DXB A;  2GDN A;  1PNE A;  2PAV P;  4X56 A;  1MWT A;  1N4O A;  2XDM A;  3Q1F A;  3UY6 A;  3PBQ A;  3UPP A;  2J80 A;  3VSK A;  2JBF A;  2V1A A;  2QKP A;  4UA6 A;  5HD3 A;  4DKI A;  4EER A;  1IEM A;  4CLC A;  4YIN A;  2EXA A;  4CQH A;  3B47 A;  3BEC A;  1CEG A;  1VEU B;  3GVB A;  1K55 A;  2MJ6 A;  4BMW A;  2GZA A;  1SKO B;  2IWB A;  1J9M A;  1W79 A;  3E2K A;  1J3W A;  3ZYT A;  3S7Q A;  1PWC A;  3HRE A;  2KDK A;  3E4P A;  5TGF A;  5HX9 A;  4FTX A;  3C2W A;  2P7J A;  5F69 A;  4F3L A;  2Y2Q A;  1LHY A;  2QJ5 A;  2HP5 A;  1W8Y A;  4GCZ A;  2JC7 A;  5M18 A;  4HNB A;  5DTT A;  2I9V A;  1W63 M;  2PU2 A;  5L09 A;  4JBF A;  5GL9 A;  2FZ0 A;  2VV8 A;  2Y4A A;  1S6R A;  4JLF A;  4BEN A;  3IX3 A;  4X25 A;  1PW1 A;  5DJU A;  3G35 A;  3W2Z A;  4I3A A;  2OAP 1;  5I5L A;  1LT0 A;  4MBH A;  1DY6 A;  2G2W A;  2R9X A;  3LEQ A;  4JXV A;  4GW9 A;  5F68 A;  1YT4 A;  4LV0 A;  5M1A A;  4WF0 A;  1SZV A;  5MC7 A;  4P6Z M;  4XUZ A;  1G6A A;  2VJW A;  5HAI A;  5FI2 A;  1GCE A;  4UAA A;  5C5K A;  3IX8 A;  1K25 A;  4WZ4 A;  4OPQ A;  2VEA A;  3FG8 A;  2GJ3 A;  2CC1 A;  2JKF A;  3ITA A;  5AJG A;  3K3C A;  1FSY A;  1ZG6 A;  2HZ5 A;  5KIZ A;  3KX0 X;  1WE4 A;  5KZH A;  2H0T A;  3F1P A;  1F9I A;  3U2A A;  3EEH A;  5FA7 A;  3CWF A;  4GS9 B;  4OPR A;  2QHK A;  5FQK A;  3QP1 A;  4JF4 A;  2HJE A;  3JVU A;  2Y8H A;  4NKP A;  4X55 A;  3SZT A;  1CJF A;  1STZ A;  1VM1 A;  3F1N A;  1YLT A;  4K0W A;  4G3V A;  3V3R A;  4CJN A;  3BJN A;  4F3L B;  4B88 A;  2X02 A;  5DKK A;  5FAP A;  2OOL A;  2JE5 A;  5A8B A;  5EOO A;  2ZM2 A;  3HCY A;  5DF9 A;  2Y79 A;  5FQJ A;  5AQA A;  4RQ9 A;  1SKO A;  3UN7 A;  1KVM A;  4IED A;  2W3H A;  4PPR A;  2B02 A;  2J3W A;  1W5D A;  2Z6C A;  3H7W A;  3ZFZ A;  2W3E A;  4OLD A;  1TF1 A;  4D2O A;  4N1X A;  5E2F A;  1XJ6 A;  5DVA A;  3LY4 A;  2C5W B;  5AQB A;  3T50 A;  2XH9 A;  4HP9 A;  4Y3I A;  4GKU A;  2V9A A;  3WS1 A;  3GMW A;  3VOY A;  4A5R A;  5DKL A;  3NBL A;  4S2L A;  3RFB A;  1CEF A;  4LEN A;  4Q0H A;  1G5U A;  1P0Z A;  3SS5 A;  1ESI A;  2EX8 A;  4EUZ A;  2EX9 A;  3WWX A;  3HUN A;  5HWT A;  3RTY A;  3UE0 A;  2GNX A;  4Y7P A;  1RGY A;  5GHZ A;  4N92 A;  3F1O B;  2PD8 A;  4BBU A;  5A93 A;  4GHI A;  1L2S A;  2XLN A;  4PAU A;  2WGW A;  2W3G A;  4GDB A;  3SS4 A;  5FDS A;  2J3T D;  4JXW A;  4R4S A;  2Q0O A;  1X0O A;  3FPW A;  3HLE A;  3MJQ A;  4LFU A;  4OLG A;  3UMD A;  4EUV A;  5EVE A;  3Q7V B;  1LL8 A;  3M2J A;  2BTF P;  4ZRR A;  1FIK A;  1ERQ A;  4GJ4 A;  4MN7 A;  3ZG8 B;  3W8K A;  4WL9 A;  2V20 A;  4PKY A;  4F94 A;  2HP6 A;  3UB5 P;  2DCF A;  3FWL A;  3IWI A;  2XFT A;  4R3A A;  4CPK A;  3NOP C;  3HLF A;  3LR0 A;  2EX6 A;  2W1R A;  3BQ8 A;  1NLY A;  2IWD A;  4I39 A;  4O7D A;  4EW7 A;  2QWS A;  3QHY A;  5GHX A;  4Y13 A;  3LIF A;  3V5M A;  1K54 C;  3HLG A;  4OQG A;  2PDR A;  3P09 A;  4DMZ A;  1EWZ A;  1H5X A;  4K91 A;  1YLJ A;  3ZVT A;  2OV5 A;  2WYX A;  2GX5 A;  3NUL A;  2W1T A;  2VZW A;  4KZ4 A;  4DDS A;  3T1R A;  1UWP X;  3LIE A;  2ZL1 A;  5TBM A;  4GD6 A;  2WKI A;  1QMF A;  5EEC A;  4UHU A;  4BLM A;  3LY3 A;  2WKP A;  3TOI A;  4P85 A;  4X6T A;  4KZ7 A;  4C3Q A;  5GLC A;  2WAF A;  4FH2 A;  4E3L A;  3IBJ A;  1RGZ A;  3IXH A;  3N7W A;  1UGU A;  3MSH A;  2WKE A;  2UWX A;  3ITB A;  3OCL A;  4JGP A;  1BYW A;  4CLC C;  1HD8 A;  1O7E A;  3E4Q A;  3IBR A;  3LR5 A;  3N8R A;  4UQI S;  4GHI B;  1OJ5 A;  3A0S A;  4GNU A;  1Z6F A;  4U3T A;  4OQI A;  4QY6 A;  4IVI A;  1PYY A;  5HDC A;  1SDE A;  4R6L A;  5DFX A;  3VP3 A;  4KZ8 A;  3HLB A;  4N1H A;  3TRC A;  3O86 A;  1GSV A;  2OLV A;  4HEF A;  2P9V B;  3M6H A;  2W27 A;  3LR4 A;  2VGL M;  3C30 A;  4KZB A;  3ZVW A;  3KSI A;  1LL5 A;  3C7U A;  4E3K A;  5F83 A;  2RL3 A;  5AVF A;  3MKE A;  3MZE A;  3SH7 A;  1XPB A;  3CJM A;  4NXG A;  4X1M A;  3FC7 A;  3T4K A;  4PM8 A;  3S7N A;  2VGK A;  2PR6 A;  4I3J A;  3HLC A;  4ZTK A;  4ETX A;  4XXR A;  3LCE A;  2X01 A;  4M3K A;  3S7O A;  5FQM A;  2ZQC A;  3RXW A;  5FQQ A;  2Y2I A;  1E3U A;  4WLA A;  2PYP A;  4X53 A;  3DAV A;  2Y2H A;  1IYP A;  3BYD A;  3UDX A;  5EVL A;  1ES5 A;  1JWZ A;  2K2N A;  4WZ5 A;  3KYZ A;  3ZQ5 A;  3V3S A;  2G7U A;  4S2P A;  4DE1 A;  3LI9 A;  1S1Z A;  3VV4 A;  1KE4 A;  2B5R A;  3QP4 A;  4ZBE A;  3LIC A;  3GV9 A;  5FI6 A;  1K4E A;  3CUE C;  3MQO A;  4B9O A;  1NRJ A;  3NEC A;  3G2Y A;  1TS6 A;  2HDQ A;  2ZD8 A;  4GD8 A;  3MKF A;  4YOF A;  4MN5 A;  3SOI A;  3GQZ A;  2O9A A;  1PZO A;  1HTZ A;  3UNW A;  3T1Q B;  3RXX A;  4P87 A;  2WKR A;  5AQ9 A;  1IKI A;  4OPZ A;  3HUM A;  4BWI A;  3SH8 A;  1Y28 A;  2OAQ 1;  2K7S A;  3CMZ A;  3BWL A;  3BLS A;  4BD1 A;  5D3O A;  4UA7 A;  4E3N A;  1F5M A;  4LPZ A;  3C7V A;  2P08 A;  1I2W A;  3NDE A;  4MCW A;  3UME A;  2A24 A;  1XP4 A;  2V2F F;  4JGQ A;  5EVI A;  3QNB A;  5EPH A;  2FH5 A;  1BLC A;  4LRZ E;  1P9R A;  3NOT C;  1RCJ A;  1HVB A;  3KSH A;  3FKV A;  1ZTU A;  4Y2F A;  1CQA A;  1JVJ A;  5KMW A;  3WS2 A;  3A3I A;  5CHU A;  2VK3 A;  3P98 A;  3MFD A;  3BM6 A;  5CEC A;  1ES4 A;  3B42 A;  1WA9 A;  3R4K A;  5J8X A;  3PBT A;  1W7F A;  4GDN A;  4HES A;  2OWH A;  3VFF A;  1H3Q A;  4JPM A;  5HFO A;  2Y2K A;  5LBR A;  3MXQ A;  1FCM A;  3VSL A;  4L9F A;  2O0Y A;  4JF5 A;  1KGF A;  3OOV A;  5G4Z A;  5FL3 A;  1CK3 A;  3JVV A;  3BFG A;  4EV4 A;  4CLC B;  3MS6 A;  2ZMV A;  1VHM A;  2HV1 A;  4GB7 A;  2J9P A;  1G28 A;  4PMA A;  2Z6D A;  1G68 A;  5EM1 A;  2BG1 A;  4S2O A;  4EES A;  5M19 A;  1V9Y A;  1OJG A;  2PYR A;  4IBX A;  4OVD A;  2XGN A;  4YNR A;  4WEJ A;  5EVI D;  3V50 A;  3WS0 A;  1HLU P;  4Z9Q A;  2VGJ A;  2ZL1 B;  1BUE A;  4BBV A;  2W0N A;  5CED A;  3NJA A;  4PM5 A;  3Q7V A;  1V9Z A;  3PR6 A;  2EA9 A;  3NI9 A;  2A24 B;  1T1A A;  3ZHH A;  2WKH A;  1K54 A;  4BJP A;  5L2F A;  4FSF A;  3DBA A;  5U47 A;  4KZ9 A;  4MN6 A;  5EE8 A;  3GRJ A;  3F1O A;  4II7 A;  1YSP A;  3NOU C;  2DRW A;  2WGW B;  3NIA A;  2PBY A;  4HH2 A;  3CI6 A;  1KVL A;  4FOF A;  1IFQ A;  2E8I A;  2IA2 A;  3T4S A;  4EU0 A;  5GLB A;  1TS7 A;  4MBK A;  4C6Y A;  5HL6 A;  4HOI A;  3OPL A;  1XKZ A;  2M7V A;  2WGV A;  2J3T C;  1L3L A;  3UDI A;  5IHV A;  1BT5 A;  5FDH A;  4EWF A;  4S2K A;  4JGR A;  2XRO A;  4B93 A;  3TG9 A;  4MDZ A;  2YKH A;  1NZO A;  4BQM A;  2V0U A;  1WYC A;  3AGF A;  3HUO A;  2ZC4 B;  3S4X A;  4E6X A;  2Q9M A;  4HH3 A;  2VLG A;  3T1X A;  4MMN A;  4KG6 A;  3MMH A;  2YKF A;  5L8M A;  1UWN X;  1YM1 A;  2Y59 A;  3T4L A;  1K4F A;  4OQ0 A;  5TFQ A;  1ERM A;  3B33 A;  1PFL A;  3CPT A;  4R3B A;  3JYI A;  2QMI A;  4C75 A;  5FEG A;  3PAE A;  3U4L P;  1S0W A;  2QPN A;  4R0Q A;  3P7N A;  4KQQ A;  5AVE A;  4RYE A;  4E3O A;  4JF6 A;  1S4R A;  3QP2 A;  1YKD A;  4OPY A;  2ZLY A;  3KSF A;  2HPB A;  1T18 A;  1BUL A;  2QZ6 A;  4WUJ A;  2EX2 A;  2EFU A;  3G2Z A;  3NC8 A;  3SH9 A;  2Y2N A;  4X1L A;  3QNC A;  3G34 A;  4IHQ A;  4L9G A;  1Q2Q A;  1S66 L;  2Y2L A;  1I5Q A;  3N6I A;  5AQ7 A;  3HJK A;  4FUW A;  1LLB A;  3UPO A;  2CMN A;  3Q7Z A;  2ZOH A;  1YQS A;  4QWO A;  3M6B A;  1XXM A;  4WYY A;  3CZD A;  1YPR A;  1L0D A;  3SS3 A;  1MC0 A;  4LGW A;  3QP6 A;  3ICY A;  1GHP A;  4N9L A;  5A92 A;  2WK0 A;  2VKS A;  1DJA A;  5HAR A;  1XJ4 A;  4FH4 A;  4PM9 A;  4OOY A;  2XD1 A;  4H6J A;  4JGO A;  3E0Y A;  3E4O A;  4R3J A;  3DTE A;  3KO6 A;  4ZDX A;  4LV1 A;  4EXO A;  5DFY A;  3L9K A;  4FD8 A;  1PWD A;  2OLU A;  4H6J B;  3T12 B;  1JNU A;  2J8Y A;  2XFS A;  3GSG A;  3OPR A;  5EFW A;  5JYO A;  1FCN A;  5IU1 A;  3IF6 B;  4LRY C;  2QYB A;  5IT5 A;  3UE3 A;  4YWZ A;  4DN0 A;  5DJT A;  1E3U D;  4Q0I A;  4LV3 A;  1KE0 A;  2Z2L B;  1BSG A;  4ARZ B;  1TD5 A;  1XA1 A;  4ESP A;  3WRZ A;  1GA0 A;  1YSQ A;  1ACF A;  4DJ2 A;  1XJ3 A;  1FR1 A;  3HJI A;  2P74 A;  1MKI A;  5E2H A;  2JKG A;  3ZCZ A;  4BD0 A;  3NY4 A;  3PYP A;  1YLZ A;  4KZ3 A;  3NHQ A;  5HAP A;  1TS8 A;  4RX2 A;  1NWZ A;  4YFM A;  5FQ9 A;  1SHV A;  3HLW A;  4KUO A;  2RCX A;  3MR0 A;  4GN2 A;  4DE0 A;  3S1Y A;  4S2N C;  4OOM A;  1O07 A;  1ODV A;  5K5B A;  4GZB A;  4LLO B;  2KOI A;  1LSX A;  3W4P A;  5FAQ A;  2ZC6 B;  2D02 A;  2V8F A;  4QPR A;  3CG5 A;  2JHE A;  2VV7 A;  1MY8 A;  1PRQ A;  1VQQ A;  2WAE A;  4OOL A;  4EBL A;  2C6W B;  1MBL A;  1BLP A;  4D60 A;  4MEZ A;  2PU4 A;  2WZZ A;  5EVI C;  1H8Z A;  3D9Y A;  3TSG A;  1HZO A;  4HY8 A;  1OT6 A;  1ZKJ A;  1BZA A;  3MF0 A;  1S4S A;  1GHM A;  2ZMF A;  4DDY A;  5HZH A;  1YMS A;  4LCM A;  4N9K A;  2P04 A;  3LEZ A;  3I7J A;  4JXS A;  1IYS A;  2E8J A;  3MFX A;  1IEL A;  5FAT A;  1JWV A;  3IWO A;  2VV6 A;  3VP2 A;  4IVK A;  3S7P A;  3ZG7 B;  4I5S A;  1K0K A;  4I38 A;  4IBR A;  1L0G A;  2J7V A;  1U60 A;  1TS0 A; 
#chains in the Genus database with same CATH homology
 4ARZ A;  2WKR A;  3BQA A;  3R7W A;  4EEP A;  4HI4 A;  1MZU A;  2JN7 A;  4BWI A;  5KIZ A;  2ZOI A;  3KX0 X;  3F1P A;  1F9I A;  1Y28 A;  2OAQ 1;  2PD7 A;  2K7S A;  3EEH A;  3PHY A;  3CWF A;  3U2A A;  4GS9 B;  3BWL A;  1OTE A;  2QHK A;  1N9O A;  1F5M A;  2A2L A;  2HJE A;  4LPZ A;  4CLC E;  5J4E A;  3JVU A;  2Y8H A;  3F1P B;  4KQO A;  4NKP A;  2P08 A;  1XFN A;  1STZ A;  4MCW A;  4HP4 A;  4EQ1 A;  3K3D A;  4XT2 B;  3UME A;  2A24 A;  3H7W B;  4NEE D;  3F1N A;  4IUK A;  1IOU A;  1XFQ A;  2PHY A;  4KUK A;  1D7E A;  4JGQ A;  2VA0 A;  1T19 A;  5HWV A;  3UB9 A;  3D72 A;  4G3V A;  3LI8 A;  2L1M A;  3BJN A;  2FH5 A;  3LR3 A;  4LRZ E;  4F3L B;  3H82 B;  4PHT A;  5DKK A;  1P9R A;  3NOT C;  2M7U A;  3KSH A;  5F5Y A;  1ZTU A;  2OOL A;  4Y2F A;  5A8B A;  1D06 A;  3HCY A;  5DF9 A;  3UB6 A;  2Y79 A;  4DJ3 A;  4RQ9 A;  3B42 A;  2DMW A;  1WA9 A;  3LUQ A;  1F98 A;  3R4K A;  3PBT A;  2W3H A;  2OWH A;  3EGD C;  1H3Q A;  5LBR A;  3RH8 B;  2B02 A;  2J3W A;  2HGV A;  3MXQ A;  4AFI A;  2V1B A;  4XT2 A;  2Z6C A;  3H7W A;  3IS2 A;  4L9F A;  2O0Y A;  2W3E A;  3OOV A;  1TF1 A;  5G4Z A;  5FL3 A;  2LB5 A;  1GSX A;  3JVV A;  1T1B A;  1XJ6 A;  4CLC B;  2ZMV A;  3IS2 B;  2HJ9 C;  2QJ7 A;  4M4X A;  4R70 A;  2H28 A;  1VHM A;  2HV1 A;  3T50 A;  1G28 A;  2O9B A;  5TBM B;  4HP9 A;  2Z6D A;  4GS9 A;  4Y3I A;  1G6O A;  3LIA A;  3EQV A;  4EES A;  1S1Y A;  1LSW A;  1V9Y A;  1OJG A;  2JKT I;  2PYR A;  2V9A A;  1EW0 A;  4K08 A;  4YNR A;  4WEJ A;  5DKL A;  3LFV A;  3EEA A;  3T4T A;  3RFB A;  3MQ0 A;  3T4J A;  3GDI A;  4Q0H A;  1P0Z A;  3PBO A;  4UQI M;  4ME4 A;  4BBV A;  1OTA A;  2W0N A;  3TJZ C;  2BAS A;  3NJA A;  1T1C A;  5HWT A;  1V9Z A;  3RTY A;  2GNX A;  3ULF A;  3BW6 A;  1N9L A;  3V67 A;  3PR6 A;  2EA9 A;  4KQD A;  1S67 L;  4WEK A;  2A24 B;  3H9W A;  1T1A A;  1DP9 A;  3F1O B;  3EGX C;  2PD8 A;  4EEU A;  4BBU A;  4BJP A;  5HPF A;  4HHD A;  4GHI A;  4FSF A;  3DBA A;  1N9N A;  4PAU A;  3CLO A;  2W3G A;  4MN6 A;  3H82 A;  3F1O A;  4II7 A;  1YSP A;  1DRM A;  2J3T D;  2VGL S;  3NOU C;  5HD5 A;  3VE3 A;  4HJ3 A;  4HH2 A;  1X0O A;  3CI6 A;  3R7W B;  3FPW A;  3MJQ A;  3UMD A;  4FOF A;  1IFQ A;  3OC2 A;  4EUV A;  1W63 Q;  2IA2 A;  3T4S A;  4EU0 A;  1LL8 A;  1TS7 A;  4R38 A;  5HL6 A;  4HOI A;  2JKR M;  4E04 A;  2M7V A;  4ZRR A;  2J3T C;  5HDD A;  4GJ4 A;  4MN7 A;  3CAX A;  5G4Y A;  4WL9 A;  2NUT C;  4PKY A;  4JGR A;  4Y5F A;  4O01 A;  1NLZ A;  2XRO A;  2HF6 A;  4R3A A;  3NOP C;  3UB7 A;  4B93 A;  4MDZ A;  2M1C A;  2V0W A;  3LR0 A;  2PR5 A;  2YKH A;  2W1R A;  3BQ8 A;  4BBT A;  4EET B;  2V0U A;  1NLY A;  1OPX A;  2XSS A;  4HH3 A;  4I39 A;  3EQU A;  2VLG A;  2QWS A;  4EW7 A;  3PBS A;  1OTD A;  2R78 A;  4MMN A;  3MMH A;  3LIF A;  4NXF A;  2YKF A;  5L8M A;  2JKR I;  1UWN X;  3LYX A;  3T4L A;  1ZHH B;  2PDR A;  2PT7 A;  4DMZ A;  3B33 A;  4G3K A;  3LID A;  1GSW A;  3E98 A;  1MKM A;  3P7N A;  3D3O A;  2GX5 A;  5AVE A;  1S4R A;  2W1T A;  1YKD A;  2EWW A;  3UB8 A;  2VX8 A;  1P9W A;  2VZW A;  3KSF A;  4L0L A;  1UWP X;  3LIE A;  1T18 A;  5TJJ A;  5TBM A;  2B18 A;  4IJG A;  4WN5 A;  2XA7 M;  4WUJ A;  2OWJ A;  4O8G A;  5HSQ A;  1H8M A;  4NXE A;  3A0R A;  3OCN A;  3BY8 A;  5J7E A;  2K31 A;  4IHQ A;  4L9G A;  5IS1 A;  2WKP A;  1S66 L;  3HJK A;  3KSG A;  3EWK A;  2CMN A;  2ZOH A;  3O5Y A;  3F1N B;  3IBJ A;  4UEY A;  4Z1W A;  1OT9 A;  3T4O A;  2L0W A;  3VOL A;  4WEL A;  2EWV A;  2W3D A;  1UGU A;  4L9E A;  3TW8 A;  1MC0 A;  2D01 A;  3PBR A;  3OBF A;  1KOU A;  3OCL A;  4HQA A;  3ICY A;  5HDS A;  4JGP A;  3UE6 A;  1BYW A;  4CLC C;  3VE4 A;  3G6O A;  2VKS A;  3E4Q A;  3IBR A;  1XJ4 A;  3P01 A;  3LR5 A;  4UQI S;  4GHI B;  1OJ5 A;  3A0S A;  3SW1 A;  4IUH A;  2NUP C;  4H6J A;  4GLQ A;  4G3W A;  4JGO A;  3E0Y A;  3E4O A;  3MQQ A;  5HDC A;  3KO6 A;  2KX6 A;  3OLO A;  4R6L A;  5DFX A;  4EXO A;  5DFY A;  3TRC A;  4I3I A;  2W1T B;  3PXP A;  5CX7 A;  3K2N A;  1GSV A;  3LIB A;  4H6J B;  1JNU A;  5F6A A;  2LB9 A;  4P6Z S;  5EFW A;  1DP8 A;  5IU1 A;  2W3F A;  4LRY C;  2QYB A;  5IT5 A;  3UE3 A;  2O9C A;  2O99 A;  2W27 A;  2XA7 S;  3EOI A;  3LR4 A;  4Q0J A;  4YWZ A;  4DN0 A;  5DJT A;  1YAX A;  4Q0I A;  2VGL M;  3C30 A;  2KLI A;  3CUE A;  4ARZ B;  1TD5 A;  3KSI A;  2ZBB A;  3FPV A;  2JKT M;  3T4Q A;  5AVF A;  3GEC A;  1YSQ A;  3KYQ A;  4PKY G;  4NXG A;  4DJ2 A;  1XJ3 A;  3FC7 A;  3T4K A;  3HJI A;  3S7N A;  2PR6 A;  4I3J A;  1OTI A;  1P97 A;  5HPI A;  3PYP A;  3NHQ A;  3A0V A;  4ETX A;  1LSV A;  2WKQ A;  1TS8 A;  3C38 A;  1NWZ A;  3PBQ A;  2J80 A;  4KUO A;  3S7O A;  3PBN A;  3MR0 A;  1VB6 A;  2V1A A;  2QKP A;  3BY9 A;  4EER A;  1OTB A;  5HD3 A;  4OOM A;  4CLC A;  4CQH A;  3B47 A;  5J3W A;  2MJ6 A;  1ODV A;  4WLA A;  5K5B A;  4LLO B;  2KOI A;  1LSX A;  2PYP A;  4BMW A;  2GZA A;  3C8C A;  2D02 A;  3CIT A;  2K2N A;  4QPR A;  2JHE A;  3KYZ A;  4LRX C;  3ZYT A;  3S7Q A;  2VV7 A;  3ZQ5 A;  2KDK A;  3E4P A;  2G7U A;  3LI9 A;  3C2W A;  2P7J A;  1S1Z A;  5HWW A;  5F69 A;  4OOL A;  4F3L A;  2XRN A;  2QJ5 A;  3VV4 A;  4CLC D;  1XJ2 A;  2INW A;  4GCZ A;  1DP6 A;  3LIC A;  4HNB A;  3TE8 A;  2I9V A;  1W63 M;  3CUE C;  4HY8 A;  1OT6 A;  3MQO A;  3MF0 A;  4B9O A;  5KSH A;  2FZ0 A;  1S4S A;  2VV8 A;  1NRJ A;  5AJG A;  2ZMF A;  5HZH A;  1TS6 A;  4O0P A;  4YOF A;  4MN5 A;  5DJU A;  3W2Z A;  2P04 A;  4HJ6 A;  4I3A A;  2OAP 1;  5I5L A;  1LT0 A;  2O9A A;  3MFX A;  5F68 A;  4GW9 A;  5MC7 A;  4ETZ A;  4WF0 A;  2VV6 A;  4P6Z M;  4HJ4 A;  4NXB A;  2VJW A;  3S7P A;  4I5S A;  5C5K A;  4I38 A;  2VEA A;  3FG8 A;  2GJ3 A;  4HIA A;  1TS0 A;  3K3C A;  2L4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...