2V0UA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (cryo dark structure of lov2 (404-546))
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
b'GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase
total genus 48
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v0uA00
2PD8A 1GSVA 3ZQ5A 4NXBA 1TS7A 2QKPA 3GDIA 3BY8A 1DP6A 5AVEA 1OTIA 1Y28A 4XT2B 2KX6A 3T50A 1S4RA 2INWA 5TBMA 2VV7A 2VLGA 4HJ3A 2QHKA 2KDKA 4R38A 2VV6A 2WKQA 4F3LB 3F1OB 2HV1A 2VEAA 3D72A 3MQQA 3LI9A 3H7WB 2PD7A 4KUKA 1TS0A 4K08A 4L9GA 4JGQA 4EXOA 2L1MA 3OLOA 2L0WA 4MN6A 4R70A 5TBMB 2V0WA 3EEHA 3H82A 2PDRA 1LSWA 2QJ5A 2JN7A 2M1CA 3UB8A 2B02A 2V0UA 1S67L 3MXQA 4RQ9A 1NWZA 3UB7A 3CAXA 1OT9A 1D7EA 1LT0A 1P0ZA 1LSXA 1LL8A 4LRYC 5HWTA 2P7JA 4HHDA 5J3WA 4EERA 1S1ZA 3FG8A 4DJ3A 1D06A 4LPZA 3H82B 1S66L 1DP9A 4WUJA 4LRXC 1UGUA 3E4OA 4EETB 4HY8A 3UMDA 3A0SA 4XT2A 2J80A 4HNBA 5J7EA 2CMNA 2PYRA 4NXEA 4E04A 4EEPA 3LYXA 1KOUA 4I3JA 1F98A 1X0OA 1T1BA 2WKPA 5HWWA 4NXGA 3NOPC 3VOLA 3H7WA 1XJ4A 5J4EA 4GS9A 5F69A 3NHQA 3RH8B 4JGOA 3NJAA 1OTDA 2V1BA 4HIAA 3LICA 3IBRA 2W27A 3H9WA 1OT6A 1OJGA 3VE3A 4I3AA 4WF0A 1G28A 4B9OA 4GW9A 1WA9A 3NOTC 2ZBBA 1BYWA 3UMEA 1F9IA 2BASA 5F6AA 3LI8A 4GS9B 1XJ2A 4WLAA 3F1PA 3EWKA 4HP9A 2PR5A 5F68A 2YKFA 3SW1A 2OOLA 1P97A 4DJ2A 3PYPA 2PR6A 3LUQA 3UE6A 5A8BA 2R78A 4BBUA 4M4XA 3UB6A 3IS2A 3RTYA 5HSQA 3LIBA 4HJ4A 3BWLA 4BBVA 1T1AA 1XJ3A 2PHYA 4I38A 1T19A 3F1PB 2D01A 1T1CA 3K3CA 4HJ6A 5F5YA 2OWHA 3LIFA 4R6LA 1N9OA 2A24A 1V9YA 4H6JA 4PKYA 3A0RA 5IU1A 4HOIA 1JNUA 3B33A 3BY9A 3IS2B 1GSWA 2JHEA 3F1NA 1OTAA 3UB9A 4L9FA 1TS6A 5HDCA 4HH3A 2Z6CA 3LIDA 4HP4A 1UWPX 3K3DA 4KQDA 4JGRA 4LLOB 5DJTA 1TS8A 2PYPA 4EW7A 1ODVA 2A24B 2EA9A 5HD3A 5HZHA 4H6JB 1S1YA 4MN5A 1OJ5A 2ZOIA 1XFQA 2GJ3A 1T18A 5HDSA 1EW0A 2H28A 3F1NB 5HDDA 1OTBA 5HWVA 2L4RA 4BBTA 3CWFA 1GSXA 1MZUA 2W0NA 2VV8A 4HQAA 2K7SA 5G4YA 4GCZA 4KUOA 2V9AA 4GHIA 3MQOA 4WN5A 2ZOHA 3MR0A 4HI4A 1LSVA 4I5SA 3HJKA 3A0VA 4YWZA 1N9NA 5KIZA 3LIAA 4NXFA 1XJ6A 4I39A 5G4ZA 3C8CA 4WL9A 4EQ1A 4I3IA 4GHIB 4EESA 3C2WA 3HJIA 5EFWA 3ULFA 5DJUA 2QJ7A 1V9ZA 1UWNX 3GECA 3VE4A 3E4QA 5AVFA 2V1AA 5DKKA 4HH2A 3MFXA 1N9LA 2OWJA 3FC7A 1DP8A 3G6OA 4PKYG 2QWSA 3PHYA 4EEUA 3E4PA 5I5LA 4R3AA 3KX0X 3LIEA 2I9VA 2D02A 3P7NA 1OTEA 3CLOA 3ICYA 5DKLA 1DRMA 3MJQA 1S4SA 3NOUC 2WKRA 4JGPA 5HD5A 5IS1A 4L9EA 1VB6A 1XFNA 2Z6DA 4F3LA 3F1OA 4LRZE 2YKHA
chains in the Genus database with same CATH superfamily
1GSVA 4S2PA 2EX2A 1BULA 4ID4A 2WZZA 1LL5A 5HAIA 1YT4A 1Y28A 2ZLYA 5JYOA 2Y8HA 4JBFA 4MMNA 3HUMA 2EXBA 2VV7A 4N1XA 5EPHA 4HJ3A 3T4TA 4EBNA 2KDKA 5EVEA 4S2IA 2ZL1B 4ZJ1A 4DRTA 4ZAMA 2VEAA 1N4OA 3LEQA 3PAEA 4O7DA 3C4PA 1TS0A 2WZXA 1FSWA 4L9GA 3BM6A 4JGQA 3MSHA 4MDZA 2GZAA 1BLPA 1KDSA 5HL1A 4BL2A 3UB5P 4R70A 1XPBA 4UEYA 5CECA 3IF6C 5L07A 3CHWP 2JN7A 4EBLA 3LEZA 3IX8A 1M40A 3UE3A 1QMEA 5U47A 3C7UA 5FI2A 3ZG9B 1P0ZA 3BLSA 3O86A 2OLUA 4HHDA 4PPRA 5J3WA 4II7A 3GRJA 3PBRA 2OAQ1 2ZMVA 3RJUA 5CEDA 4OPZA 2HP9A 5EVIB 3R7WA 5BOHA 2WK0A 3V5MA 4HY8A 1WE4A 1SKOB 4QHCA 1Y54A 3NDGA 4MBKA 2A49A 1ES5A 5GLCA 4EEPA 2GNXA 1RCJA 4IJGA 3DWZA 3OOVA 1X0OA 3LR3A 2P04A 2RL3A 1E25A 2HDUA 1JWPA 2RCXA 1DJCA 3NOPC 4OOMA 2Z2MB 3IHAA 4FH2A 5J4EA 2LB5A 1H5XA 1YPRA 3QP4A 3Q7VA 4P6BA 3LY3A 5FAPA 2ACGA 2HP6A 2Y2NA 2JKTM 4AFIA 1OJGA 4U3TA 1AXBA 4I3AA 1G28A 1XP4A 1WA9A 2JKRM 1BYWA 4Y0UA 3UMEA 1F9IA 2ZQ7A 4OQHA 2BASA 2XFSA 3NIAA 4GS9B 1XJ2A 4WLAA 5L09A 4Y3IA 4GNUA 5F1FA 1KGEA 2Y91A 3IX4A 4GN2A 4S2KA 4WEJA 4LV1A 2Y2QA 3PXPA 3UE6A 1KE3A 3Q82A 4GDBA 1DY6A 2R78A 3UNWA 3FZCA 1HTZA 1CF0A 1J3WA 3MMHA 5EVIA 4M4XA 3IS2A 3GR2A 3RTYA 3LIBA 2E8JA 2ZQDA 4FCFA 4FUWA 1SKOA 3CUEC 5GL9A 5HAPA 3O5YA 1IYOA 4QJGA 4KQRA 3G32A 2D01A 3BECA 1E3UD 3ZVTA 2JKGA 1XKZA 4DE0A 4PMAA 3T1SA 2J8YA 2A24A 4QY5A 3UPOA 1YM1A 2H0YA 4LGWA 3BY9A 1CEGA 1GHIA 1RP5A 2FFFB 5FI6A 3O88A 3T12B 5D3OA 3S7NA 4ZJ3A 1TS6A 3LFVA 1EROA 1XA7A 1YAXA 2CC1A 2Z6CA 1GA0A 3CG5A 3KYEA 4GJ4A 5FASA 1UWPX 3G4PA 2WGIA 3IF5A 4X56A 5DJTA 1TS8A 4ETZA 2EA9A 3BRMA 5HZHA 4H6JB 1YLZA 1OJ5A 2ZOIA 2VA0A 1IYPA 1CEFA 3JVVA 4WBGA 4DMZA 1T18A 2ZC7A 4GDNA 2K2NA 4ZBEA 1NRJA 1OTBA 3TJZC 2L4RA 2PU2A 4PM6A 2JKRI 3T4SA 1VETA 3CMZA 3T1RA 5DTKA 3N8LA 3ZDJA 1HD8A 4BBTA 4E6WA 5HFOA 4XUXA 2W0NA 4FOFA 5C5KA 4WELA 3A3EA 2K7SA 5IHVA 4NG2A 4GCZA 1RGYA 2OV5A 2V9AA 3ITBA 1MC0A 4Y17A 2IA2A 3W8KA 1PIOA 3GVBA 4HI4A 1LSVA 3MF0A 3FPWA 3NECA 4CPKA 1ONHA 4OQ0A 3LR5A 4I5SA 4WMCD 5EE8A 1LI9A 2W3GA 1YKDA 3OPLA 5KMWA 5KIZA 5DF7A 5IT5A 4WZ5C 4CLCB 4RYEA 4NK3A 4GZBA 3C8CA 3K2NA 4UHUA 4WL9A 2HDSA 4I3IA 4GHIB 1KGFA 4NKPA 3HCYA 1UWNX 2W1RA 3E4QA 4KQQA 3QP5A 5AVFA 4R3BA 3UPPA 1YLJA 2PU4A 4LV2A 4PM9A 1FCOA 1ES3A 3S22A 5CEBA 3MFXA 1CI8A 3W4QA 3ZNYA 2XQZA 2M7VA 1N9LA 3HLBA 4LCLA 1FCNA 1PNEA 2DCFA 1ES2A 5GHXA 4EEUA 3E4PA 3N8RA 1STZA 5HW3A 4XUZA 5FQ9A 4BLMA 3KX0X 3VP0A 2WGWA 1LLBA 3VP3A 2OSUA 5CTNA 4DE1A 5DKLA 3BQAA 4IBRA 3NOUC 1ESIA 4R23A 1W79A 1YSQA 3PR6A 5IS1A 5CGXA 3OC2A 4B4XA 2XLNA 3CITA 4GOGA 1XFNA 3ZG0A 1H8ZA 4F3LA 1IYQA 3R4KA 5CRFA 1TEMA 1KGGA 1JTDA 1NLZA 4X1LA 2PD8A 2A3UA 3VSKA 4CLCA 3ZG5A 1TS7A 3DBAA 1FCMA 4JXVA 3GDIA 2ZM8A 4S2NA 4EWFA 3BY8A 5FAOA 5HPFA 5AVEA 2J9OA 1OTIA 4DN0A 4X1MA 3NCKA 4S2LA 1SKFA 3V39A 3KYQA 1Q2QA 3ZNTA 5TBMA 3S7OA 1E4DA 3VMAA 4R38A 3E2LA 4R3JA 3C4OA 2WKQA 3F1OB 4QU3A 2HV1A 4MBFA 3QNCA 3MQQA 3H7WB 1HVBA 3ITAA 2PD7A 2KOIA 1MBLA 1PWGA 4EUZA 4LV3A 4EXOA 1W8QA 1HZOA 4IVKA 5FSRA 1IEMA 1BTLA 2ZQ8A 3OLOA 3P01A 2L0WA 1TDGA 1TF1A 3H82A 3QP2A 3GMWA 3B47A 2M1CA 3UDFA 3UB8A 2V0UA 1MWTA 3MXQA 3IXDA 3VOZA 5TJJA 4WM9A 3LO7A 3UB7A 2VGLS 4P6ZS 1K55C 1D7EA 3VP4A 3HLWA 4K91A 4LRYC 3ISGA 4KENB 1DJAA 3Q7ZA 1L0GA 3FYZA 3V3RA 3FG8A 4DJ3A 4X55A 4EU0A 5E2GA 5I94A 2WYXA 2HDRA 1E3UA 3EQVA 4KZ9A 3E4OA 4EETB 1ZTUA 2NUPC 1LL9A 4FH4A 1NZOA 4HNBA 2CMNA 2QMIA 2EX9A 3DWKA 3KSFA 1ONGA 4L0LA 4NXEA 3GTCA 5FDHA 4DDSA 2J3WA 1KOUA 3T4KA 1PRQA 1J9MA 3G35A 3VP2A 4ESPA 2R9XA 3H7WA 3NDEA 4CLCE 3VSLA 1PWCA 4BWIA 3R7WB 2XA7M 2J7VA 4ZJ2A 3S7QA 3IXBA 3NJAA 1OTDA 2V1BA 4HIAA 3JVUA 3PBNA 3MZDA 1I2SA 1SHVA 2W27A 3N6IA 3BFFA 1ACFA 2P9VA 3V50A 1P9RA 1CI9A 1OT6A 1VQQA 1MWSA 3VE3A 4DE3A 4DKIA 4WF0A 1BLHA 4B9OA 4GW9A 4O8GA 1K0KA 3IWOA 3RXWA 3BQ8A 1PI5A 1KVMA 1K4EA 3Q7VB 3ZVWA 4HP9A 5CHUA 2XK1A 3E2KA 4R4RA 4DDYA 3DTMA 3MBZA 2XSSA 3LUQA 5A8BA 3BYDA 2OAP1 1ES4A 1K56D 3UB6A 3OCLA 2EX6A 1D1JA 4OPRA 3BWLA 2HF6A 2QPNA 4R4SA 2PAVP 3K3CA 4GD6A 1N9BA 5F5YA 1H0MA 1H3QA 3AGEA 1PZPA 3VV4A 3SH9A 5KSHA 2XRNA 3L9KA 4PKYA 2XEPA 3ZHHA 3B33A 3IS2B 3F1NA 4ZTKA 4PHTA 4LFUA 2IWDA 4YNRA 4Q0IA 5G18A 1MPLA 5HDCA 4HH3A 1Y4OA 3BFGA 3MFDA 1JVJA 4JGRA 3LCEA 2HJEA 3SOIA 3MQ0A 2PYPA 4EW7A 5F83A 2A24B 3E98A 1S1YA 5DTSA 3V67A 1TD5A 4IVIA 2EXAA 3O3VA 4OOYA 2Y2LA 1EW0A 5E2FA 4N92A 5HWVA 2G2WA 1Q2PA 4Y7PA 4B93A 3TSGA 1CQAA 3CWFA 1LHYA 2VX8A 5CERA 4FSFA 2HP5A 1MWUA 3AGDA 5G4YA 4S2JA 4KUOA 2W3FA 2MJ6A 4WN5A 1GCEA 3MR0A 2Y2MA 1GHMA 4S2OA 1U60A 2Y2JA 1VETB 3E0YA 1K54C 4LCMA 3B3XA 3A0VA 1ZC2A 4OPYA 1S0WA 1PZOA 1YMSA 1DJBA 4RA7A 5E2EA 4GLQA 4EESA 3C2WA 1IELA 3HJIA 4X25A 1YMXA 1G6OA 3DTIA 2Y79A 2VKSA 5FATA 3VE4A 5FL3A 1IYSA 2WKHA 1OPXA 2EFXA 3M6HA 2Y4AA 2WADA 4XXRA 4ZDXA 3Q81A 5GHYA 5CHMA 2IWCA 2JE5A 4X6TA 1BLCA 1NYYA 1FILA 1KE0A 4EBPA 3IXGA 4R3AA 4E3NA 1WYCA 2HPBA 4JXWA 3KO6A 3SH7A 2OLVA 3P7NA 4JPMA 3CLOA 3ICYA 1L0FA 1DRMA 2JKTI 1EWZA 2XH9A 4JGPA 1Z6FA 3A3IA 3OZHA 5HPIA 1M6KA 3SS4A 4L9EA 3SZTA 5TFQA 4EQIA 2JCHA 2W3HA 4LRZE 2WKEA 2WGWB 3WS4A 2FZ0A 3EGDC 3ZQ5A 4NXBA 4QB8A 3IF6B 3WS0A 2GDNA 2V1ZA 2AVXA 1K57A 3HLEA 4XT2B 1FR6A 2KX6A 4MEZA 1NJ4A 3UE1A 2INWA 4C3QA 2DRWA 2VLGA 2QHKA 4MN7A 4PM7A 1SDEA 4N9KA 4F3LB 1YSPA 2K31A 5FEGA 4KG2A 3G2ZA 4X53A 3D4FA 2M7UA 4Q8IA 4IUKA 3UE0A 4E6XA 2FFYA 1L3LA 3T1XA 4IEDA 3B42A 3IH8A 3C38A 1MY8A 3QP8A 5AQ9A 2UV0E 3FPVA 5TBMB 1LSWA 2QJ5A 2B5RA 3ZYTA 2W3EA 2Y59A 4IUHA 2HGVA 3HBRA 3PBTA 5GLAA 4RQ9A 1YLYA 3UDXA 3GV9A 5M19A 5EUAA 4DXCA 1OT9A 4FD8A 1K56A 4EUVA 1CJFA 1YLPA 1LSXA 4ARZB 3C7VA 5HWTA 1A0KA 5LBRA 1VEUA 4EERA 1S1ZA 4MNRA 1D06A 1G5UA 4LPZA 4N9LA 1PW1A 1FSYA 3H82B 1IKGA 3IF6A 1S66L 2GX5A 1NYMA 4LV0A 2WAFA 1UGUA 1PYYA 2X71A 3CZDA 3OPHA 3HL9A 2EFUA 3UMDA 4GKUA 3WRZA 2IWBA 4XT2A 5FQQA 4HESA 5J7EA 5FQKA 2R9WA 2PYRA 2XD1A 4HEFA 1TDLA 4E04A 5AQAA 2WAEA 2BTFP 4E3OA 1ALQA 3T4OA 4Q0JA 1K25A 1T1BA 4FTXA 3VOLA 4X69A 3A3FA 1XJ4A 5F69A 3NHQA 5A91A 3VP1A 1GA9A 3IHBA 3RH8B 5FEFA 5FAQA 4BD0A 1NRFA 3LICA 5FI7A 3BLMA 3H9WA 1VHMA 3MZFA 3ZFZA 1OMEA 5EVIC 4OQGA 3FKWA 5CX7A 5EOOA 3NOTC 2ZBBA 1W63Q 4PM5A 4OVDA 4YFMA 5F6AA 2DNSA 2P74A 1MKIA 3F1PA 3NULA 2Q0OA 1TVFA 4Y15A 3ZCZA 4ARZA 4RVAA 4C6YA 1K4FA 5EVID 2W3DA 5F68A 3SW1A 4E3MA 5M1AA 3BEBA 1BT5A 3QNBA 1P97A 4LENA 4DJ2A 1ERMA 2P9VB 1G6AA 4K0WA 3GSGA 4PAUA 1C3BA 3RFBA 3UY6A 5HSQA 2VK3A 4HJ4A 1SCWA 1SZVA 3P98A 3N8SA 1T1AA 4BBVA 1XJ3A 1T19A 2V20A 4Y2FA 2OWHA 3G30A 3HLGA 1N9OA 1NY0A 4ETXA 2Y2PA 3T4QA 1V9YA 4Z1WA 5J8XA 3KSIA 5IU1A 1GSWA 2JHEA 2O9CA 1L0EA 1BSGA 3CI6A 4KG5A 1ZHHB 4L9FA 5GLDA 4Y0OA 3UB9A 5DF8A 4RX3A 1XX2A 3CUEA 3MKFA 3BW6A 3NBLA 5DFXA 1FQGA 2Q9NA 3K3DA 3ZG7B 3DW0A 1YLWA 1PW8A 1YQSA 4BQMA 2G2UA 4DF6A 1IKIA 5HD3A 2X02A 3PBSA 1XFQA 4P0MA 1JWZA 3S7PA 1MWRA 2BLSA 2H28A 3F1NB 3OBFA 4NEED 2ZD8A 3LR0A 4A5RA 3SH8A 3A3DA 1NZUA 5GHZA 3BFDA 4KG6A 3FWLA 2B18A 2H5SA 4G3VA 1GSXA 4U0TA 2JC7A 1MZUA 4N1HA 1K6RA 4F94A 4KZ4A 4HQAA 3VOYA 3DTEA 3M6BA 2ZC5B 3LY4A 1ZG4A 3S1YA 1W5DA 3G34A 1ZKJA 2ZOHA 5A93A 2ZMAA 2Z2LB 5EOEA 5CHJA 1QMFA 1FIKA 2J9PA 3HJKA 4JF4A 5K5BA 3EGXC 4MBHA 2G7UA 4UA6A 1N9NA 2ZM2A 4O0PA 2XA7S 1PWDA 1XA1A 4KQOA 5HX9A 2XR0A 1HLUP 5G4ZA 2WGVA 2O9AA 4WMCA 5CGWA 4EQ1A 1XXMA 2HDQA 4DE2A 3L7HA 1NXYA 3DAVA 1I5QA 2QJ7A 1V9ZA 2EWWA 3N7WA 3GECA 2I72A 3HLCA 2ZJ9A 4Y5FA 3T4LA 2Y2OA 4H8RA 3EEAA 4R1GA 4ME4A 3M2JA 2ZC6B 5CTMA 4WZ5A 1DP8A 3G6OA 4PKYG 3WS1A 2Y2KA 4JF6A 4WEKA 5A90A 3Q1FA 4JLFA 5M18A 5L8MA 2I9VA 1H8MA 4CLCC 4Y0TA 2Y2IA 2D02A 4S2NC 3W4PA 1K6SA 2XF3A 5AJGA 4GB7A 5F1GA 4JF5A 1OTEA 1F2KA 3MJQA 1IOUA 4HBUA 1JTGA 5HD5A 3WWXA 4CLCD 4C75A 2JKFA 4Q0HA 4YOFA 2ZL1A 2PT7A 3IWQA 1W63M 2Y55A 3WRTA 3CJMA 2WKIA 1ERQA 4UQIM 3KYZA 4QD4A 3TRCA 4BJPA 3M2KA 4OPQA 2QKPA 4NETA 1YLTA 1Z09A 3HLFA 4KZ8A 1DP6A 1PFLA 3T50A 1S4RA 2DMWA 2H10A 3DTKA 4KZ7A 3PTEA 3V3SA 3TG9A 3KSGA 2EX8A 3OCNA 2VV6A 3TOIA 1SDNA 3GQZA 4KZ6A 1VM1A 3D72A 3LI9A 3IH9A 2ZQCA 4E3IA 4KUKA 4K08A 5DFYA 1XGIA 3NC8A 2QYBA 4UQIS 2HJ9C 4D2OA 2L1MA 2WUQA 4HBTA 3EOIA 5DF9A 4MN6A 3BFCA 4JXGA 3D3OA 2V0WA 3EEHA 2ZM0A 2PDRA 1MKMA 3NI9A 2B02A 2PBDP 5FQIA 4UA7A 1S67L 4WYYA 3VFHA 3LR4A 3IXHA 4EV4A 1NWZA 5GLBA 3W4OA 3CAXA 3P09A 1LT0A 3UDIA 1LL8A 1KVLA 3JPUA 2P7JA 3QHYA 3EQUA 3QP6A 2ZC4B 4G3KA 2W1TB 4O01A 4UAAA 4P85A 4OKPA 5FDSA 1DP9A 4WUJA 4LRXC 5L10A 2ZQ9A 2QZ6A 1XGJA 1MXOA 5CGSA 3A0SA 3U2AA 2J80A 4QWOA 3T4JA 3UO9A 5F82A 2ZMFA 1K55A 2X01A 2E8IA 1GHPA 4K0XA 5DVAA 3OPPA 3SS5A 1KDWA 3LYXA 4OOLA 1W7FA 4I3JA 1F98A 1VEUB 5EECA 3QP1A 2XFTA 1JWVA 4OP8A 2WKPA 4S2MA 3HLDA 5HWWA 4NXGA 2A2LA 3S4XA 5EM0A 4YINA 4GS9A 4B88A 3IT9A 2V8CA 2O0YA 5E2HA 1ESUA 3RXXA 4JGOA 3U4LP 3C5AA 3A3JA 4OLDA 3LGOA 3IBRA 5JYPA 1BZAA 1NLYA 2C5WB 4GD8A 4X68A 4KZAA 1BUEA 5A92A 3CPTB 2XD5A 2VZWA 4E3JA 3NY4A 1IFQA 5TR7A 1G68A 4KZBA 1AWIA 3HUOA 3LI8A 3EWKA 3MZEA 4OH0A 5FA7A 2PR5A 2YKFA 3TW8A 3Q07A 2B95A 4JKTA 2OOLA 4QPRA 3TE8A 3W2ZA 1WYBA 4JXSA 5CXWA 2W1TA 4MCWA 3PYPA 2PR6A 1S6RA 4BBUA 2LB9A 4KZ5A 3G31A 3HVFA 1PI4A 1K38A 3ZG8B 3IQAA 3WS5A 5HARA 3D9YA 2PHYA 4I38A 4WZ4A 4CQHA 3F1PB 3MXSA 4UA9A 1T1CA 4HJ6A 3LIFA 4R6LA 5EM1A 5FQMA 4H6JA 2XDMA 3A0RA 4HOIA 1JNUA 4E3LA 5AQ7A 4Z9QA 2O99A 5DTTA 1EI5A 3I7JA 3AGFA 5L2FA 1OTAA 5KSCA 5EV0A 2VGKA 2XROA 2XGNA 3LIDA 3CPTA 5E43A 4HP4A 1LI0A 1CK3A 4KQDA 4LLOB 2V2FF 3N4IA 2Y2HA 1ODVA 4OLGA 2C6WB 4RX2A 4KZ3A 2V8FA 4MN5A 2PRFA 4OONA 4B4ZA 5EVLA 2GJ3A 1F5MA 5HDSA 5KZHA 5HDDA 3BJNA 4DXBA 3HREA 3HUNA 3VFFA 2KLIA 2ZQAA 4G3WA 5FQJA 2VV8A 5TGFA 3SS3A 4OQIA 1O7EA 2UWXA 4GHIA 3MQOA 5MC7A 4MLLA 3BFEA 4BENA 4BMWA 4BL3A 3MXRA 3C30A 3PAGA 4Y13A 2VGLM 4P6ZM 2NUTC 1W8YA 3T1QB 3G2YA 4ZRRA 1O07A 3MS6A 3UPNA 4YWZA 3LIAA 4NXFA 1XJ6A 2ZC3B 3ZGAB 4I39A 3UN7A 4CJNA 3MKEA 2HZ5A 1BLSA 2Q9MA 3FV7A 2P08A 5EFWA 3ULFA 5DJUA 4QY6A 3JYIA 1RGZA 3PBQA 1K54A 4D60A 1L0DA 2V1AA 5DKKA 3PBOA 4HH2A 4P87A 1FR1A 2EWVA 1ZG6A 3OPRA 2OWJA 3FC7A 1L2SA 2H0TA 2VGJA 2J3TC 4R0QA 2QWSA 5AQBA 1I2WA 3PHYA 5I5LA 1KE4A 1P9WA 2Y2GA 3LIEA 2VJWA 2FH5A 2O9BA 4IHQA 3O87A 4OP5A 1K57C 1H8YA 2J3TD 4IBXA 1S4SA 5HAQA 3WS2A 3IWIA 2WKRA 1FOFA 4M3KA 5HL6A 4PM8A 3KSHA 3IX3A 2JBFA 2PBYA 1VB6A 4U0XA 4E3KA 2BG1A 2Z6DA 3F1OA 3FKVA 4BD1A 2YKHA 3IBJA
chains in the Genus database with same CATH topology
2PD8A 1GSVA 3KYZA 2FZ0A 3EGDC 3TRCA 4BJPA 3ZQ5A 4NXBA 4CLCA 1TS7A 3DBAA 2QKPA 3GDIA 3BY8A 1DP6A 5HPFA 5AVEA 1OTIA 4DN0A 1Y28A 4XT2B 2KX6A 3T50A 1S4RA 2Y8HA 3KYQA 2INWA 2DMWA 5TBMA 4MMNA 3S7OA 2VV7A 2VLGA 4HJ3A 2QHKA 3T4TA 2KDKA 3KSGA 4R38A 3OCNA 4MN7A 2VV6A 2WKQA 4F3LB 3F1OB 2HV1A 1YSPA 2K31A 2VEAA 3D72A 3MQQA 3LI9A 2M7UA 3H7WB 4IUKA 2PD7A 4KUKA 1TS0A 4K08A 2KOIA 5DFYA 4L9GA 3B42A 4JGQA 3C38A 4MDZA 2GZAA 2QYBA 4UQIS 2HJ9C 4EXOA 2L1MA 3OLOA 3EOIA 2L0WA 3P01A 4MN6A 5DF9A 4R70A 4UEYA 3FPVA 5TBMB 1TF1A 3D3OA 2V0WA 3EEHA 3H82A 2PDRA 1LSWA 1MKMA 2QJ5A 3B47A 2JN7A 2M1CA 3ZYTA 3UB8A 2B02A 2V0UA 2W3EA 4IUHA 1S67L 3MXQA 2HGVA 5TJJA 3LR4A 3PBTA 3UE3A 4RQ9A 1NWZA 3UB7A 2VGLS 4P6ZS 3CAXA 1OT9A 1D7EA 4EUVA 1LT0A 1P0ZA 1LSXA 4ARZB 1LL8A 4LRYC 5HWTA 2P7JA 5LBRA 4HHDA 3EQUA 5J3WA 4EERA 1S1ZA 3FG8A 4DJ3A 4II7A 4G3KA 1D06A 4EU0A 2W1TB 4LPZA 4O01A 3PBRA 2OAQ1 2ZMVA 3H82B 1S66L 1DP9A 4WUJA 2GX5A 3R7WA 3EQVA 4LRXC 1UGUA 3E4OA 4EETB 1ZTUA 2NUPC 4HY8A 3UMDA 3A0SA 4XT2A 2J80A 3U2AA 3T4JA 4HNBA 5J7EA 2ZMFA 2CMNA 3KSFA 2PYRA 4L0LA 4NXEA 4E04A 4EEPA 2GNXA 2J3WA 3LYXA 1KOUA 4IJGA 4OOLA 3T4KA 4I3JA 3OOVA 1F98A 1X0OA 3T4OA 3LR3A 2P04A 4Q0JA 1T1BA 2WKPA 5HWWA 4NXGA 2A2LA 3NOPC 4OOMA 3VOLA 3H7WA 1XJ4A 4CLCE 5J4EA 2LB5A 4GS9A 5F69A 4BWIA 3NHQA 3R7WB 2O0YA 3RH8B 2XA7M 3S7QA 4JGOA 3NJAA 1OTDA 2V1BA 4HIAA 3JVUA 3PBNA 3LICA 3IBRA 2W27A 3H9WA 1NLYA 1VHMA 1P9RA 2JKTM 1OT6A 4AFIA 1OJGA 3VE3A 4I3AA 4WF0A 1G28A 4B9OA 5CX7A 2VZWA 4GW9A 4O8GA 1WA9A 3NOTC 1IFQA 2JKRM 2ZBBA 1W63Q 1BYWA 3UMEA 3BQ8A 1F9IA 2BASA 5F6AA 3LI8A 4GS9B 1XJ2A 4WLAA 3F1PA 4Y3IA 3EWKA 4HP9A 4ARZA 2PR5A 2W3DA 5F68A 2YKFA 3TW8A 3SW1A 2OOLA 4QPRA 3TE8A 3W2ZA 1P97A 4WEJA 4DJ2A 3PXPA 2W1TA 4MCWA 2XSSA 3PYPA 2PR6A 3LUQA 3UE6A 5A8BA 2OAP1 2R78A 4PAUA 4BBUA 2LB9A 3RFBA 3MMHA 4M4XA 3UB6A 3IS2A 3OCLA 3RTYA 5HSQA 3LIBA 4HJ4A 3BWLA 2HF6A 3CUEC 1T1AA 3O5YA 4BBVA 1XJ3A 2PHYA 4I38A 4CQHA 1T19A 3F1PB 2D01A 1T1CA 3K3CA 4HJ6A 5F5YA 4Y2FA 2OWHA 3LIFA 1H3QA 4R6LA 1N9OA 3VV4A 5KSHA 4ETXA 2A24A 2XRNA 3T4QA 1V9YA 4H6JA 4PKYA 4Z1WA 3A0RA 3KSIA 5IU1A 4HOIA 1JNUA 3B33A 3BY9A 3IS2B 1GSWA 2JHEA 2O9CA 2O99A 3F1NA 4PHTA 3CI6A 4YNRA 3S7NA 1OTAA 1ZHHB 4L9FA 1TS6A 4Q0IA 3UB9A 3LFVA 3CUEA 1YAXA 2XROA 3BW6A 5HDCA 4HH3A 2Z6CA 3LIDA 5DFXA 4GJ4A 4HP4A 1UWPX 3K3DA 4KQDA 4JGRA 2HJEA 4LLOB 5DJTA 1TS8A 3MQ0A 2PYPA 4EW7A 1ODVA 4ETZA 2A24B 2EA9A 3E98A 5HD3A 5HZHA 4H6JB 1S1YA 4MN5A 1OJ5A 3PBSA 1TD5A 3V67A 2ZOIA 1XFQA 2VA0A 3JVVA 2GJ3A 1F5MA 4DMZA 3S7PA 1T18A 5HDSA 1EW0A 2K2NA 2H28A 1NRJA 3F1NB 1OTBA 3BJNA 3OBFA 4NEED 5HDDA 3TJZC 3LR0A 2L4RA 5HWVA 3T4SA 2JKRI 2KLIA 4B93A 4BBTA 3CWFA 2B18A 2VX8A 4G3VA 1GSXA 1MZUA 2W0NA 4FOFA 5C5KA 4G3WA 4WELA 2VV8A 4FSFA 4HQAA 2K7SA 5G4YA 4GCZA 4KUOA 2W3FA 2MJ6A 2V9AA 1MC0A 3MQOA 2IA2A 4GHIA 4WN5A 5MC7A 4BMWA 2ZOHA 3MR0A 4HI4A 3C30A 1LSVA 3MF0A 3FPWA 2VGLM 4P6ZM 2NUTC 3LR5A 4I5SA 3HJKA 3E0YA 5K5BA 4ZRRA 3EGXC 2G7UA 2W3GA 1YKDA 3A0VA 4YWZA 1N9NA 5KIZA 3LIAA 4NXFA 4O0PA 1XJ6A 2XA7S 5IT5A 4I39A 4KQOA 4CLCB 5G4ZA 2O9AA 3C8CA 3K2NA 4WL9A 4EQ1A 4I3IA 4GHIB 4GLQA 4EESA 3C2WA 3HJIA 2P08A 5EFWA 1G6OA 3ULFA 5DJUA 2QJ7A 1V9ZA 4NKPA 3HCYA 1UWNX 2EWWA 2Y79A 2VKSA 3GECA 2W1RA 3VE4A 5FL3A 3E4QA 1OPXA 4Y5FA 5AVFA 3PBQA 3T4LA 3EEAA 2V1AA 5DKKA 3PBOA 4ME4A 4HH2A 3MFXA 2M7VA 1N9LA 2EWVA 2OWJA 3FC7A 1DP8A 3G6OA 4PKYG 2J3TC 2QWSA 3PHYA 4WEKA 4EEUA 3E4PA 5I5LA 1STZA 1P9WA 4R3AA 3KX0X 3LIEA 5L8MA 2I9VA 1H8MA 2VJWA 2FH5A 4CLCC 2D02A 2O9BA 3KO6A 4IHQA 3P7NA 5AJGA 1OTEA 3CLOA 3ICYA 2J3TD 5DKLA 1DRMA 3BQAA 3MJQA 1IOUA 1S4SA 3NOUC 2JKTI 2WKRA 1YSQA 4JGPA 5HD5A 3PR6A 5HL6A 5IS1A 3KSHA 4CLCD 3OC2A 5HPIA 4L9EA 4Q0HA 3CITA 4YOFA 2PT7A 1VB6A 1W63M 1XFNA 2Z6DA 4F3LA 3F1OA 3R4KA 2W3HA 4LRZE 4UQIM 2YKHA 3IBJA 1NLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  1GSV A;  3ZQ5 A;  4NXB A;  1TS7 A;  2QKP A;  3GDI A;  3BY8 A;  1DP6 A;  5AVE A;  1OTI A;  1Y28 A;  4XT2 B;  2KX6 A;  3T50 A;  1S4R A;  2INW A;  5TBM A;  2VV7 A;  2VLG A;  4HJ3 A;  2QHK A;  2KDK A;  4R38 A;  2VV6 A;  2WKQ A;  4F3L B;  3F1O B;  2HV1 A;  2VEA A;  3D72 A;  3MQQ A;  3LI9 A;  3H7W B;  2PD7 A;  4KUK A;  1TS0 A;  4K08 A;  4L9G A;  4JGQ A;  4EXO A;  2L1M A;  3OLO A;  2L0W A;  4MN6 A;  4R70 A;  5TBM B;  2V0W A;  3EEH A;  3H82 A;  2PDR A;  1LSW A;  2QJ5 A;  2JN7 A;  2M1C A;  3UB8 A;  2B02 A;  2V0U A;  1S67 L;  3MXQ A;  4RQ9 A;  1NWZ A;  3UB7 A;  3CAX A;  1OT9 A;  1D7E A;  1LT0 A;  1P0Z A;  1LSX A;  1LL8 A;  4LRY C;  5HWT A;  2P7J A;  4HHD A;  5J3W A;  4EER A;  1S1Z A;  3FG8 A;  4DJ3 A;  1D06 A;  4LPZ A;  3H82 B;  1S66 L;  1DP9 A;  4WUJ A;  4LRX C;  1UGU A;  3E4O A;  4EET B;  4HY8 A;  3UMD A;  3A0S A;  4XT2 A;  2J80 A;  4HNB A;  5J7E A;  2CMN A;  2PYR A;  4NXE A;  4E04 A;  4EEP A;  3LYX A;  1KOU A;  4I3J A;  1F98 A;  1X0O A;  1T1B A;  2WKP A;  5HWW A;  4NXG A;  3NOP C;  3VOL A;  3H7W A;  1XJ4 A;  5J4E A;  4GS9 A;  5F69 A;  3NHQ A;  3RH8 B;  4JGO A;  3NJA A;  1OTD A;  2V1B A;  4HIA A;  3LIC A;  3IBR A;  2W27 A;  3H9W A;  1OT6 A;  1OJG A;  3VE3 A;  4I3A A;  4WF0 A;  1G28 A;  4B9O A;  4GW9 A;  1WA9 A;  3NOT C;  2ZBB A;  1BYW A;  3UME A;  1F9I A;  2BAS A;  5F6A A;  3LI8 A;  4GS9 B;  1XJ2 A;  4WLA A;  3F1P A;  3EWK A;  4HP9 A;  2PR5 A;  5F68 A;  2YKF A;  3SW1 A;  2OOL A;  1P97 A;  4DJ2 A;  3PYP A;  2PR6 A;  3LUQ A;  3UE6 A;  5A8B A;  2R78 A;  4BBU A;  4M4X A;  3UB6 A;  3IS2 A;  3RTY A;  5HSQ A;  3LIB A;  4HJ4 A;  3BWL A;  4BBV A;  1T1A A;  1XJ3 A;  2PHY A;  4I38 A;  1T19 A;  3F1P B;  2D01 A;  1T1C A;  3K3C A;  4HJ6 A;  5F5Y A;  2OWH A;  3LIF A;  4R6L A;  1N9O A;  2A24 A;  1V9Y A;  4H6J A;  4PKY A;  3A0R A;  5IU1 A;  4HOI A;  1JNU A;  3B33 A;  3BY9 A;  3IS2 B;  1GSW A;  2JHE A;  3F1N A;  1OTA A;  3UB9 A;  4L9F A;  1TS6 A;  5HDC A;  4HH3 A;  2Z6C A;  3LID A;  4HP4 A;  1UWP X;  3K3D A;  4KQD A;  4JGR A;  4LLO B;  5DJT A;  1TS8 A;  2PYP A;  4EW7 A;  1ODV A;  2A24 B;  2EA9 A;  5HD3 A;  5HZH A;  4H6J B;  1S1Y A;  4MN5 A;  1OJ5 A;  2ZOI A;  1XFQ A;  2GJ3 A;  1T18 A;  5HDS A;  1EW0 A;  2H28 A;  3F1N B;  5HDD A;  1OTB A;  5HWV A;  2L4R A;  4BBT A;  3CWF A;  1GSX A;  1MZU A;  2W0N A;  2VV8 A;  4HQA A;  2K7S A;  5G4Y A;  4GCZ A;  4KUO A;  2V9A A;  4GHI A;  3MQO A;  4WN5 A;  2ZOH A;  3MR0 A;  4HI4 A;  1LSV A;  4I5S A;  3HJK A;  3A0V A;  4YWZ A;  1N9N A;  5KIZ A;  3LIA A;  4NXF A;  1XJ6 A;  4I39 A;  5G4Z A;  3C8C A;  4WL9 A;  4EQ1 A;  4I3I A;  4GHI B;  4EES A;  3C2W A;  3HJI A;  5EFW A;  3ULF A;  5DJU A;  2QJ7 A;  1V9Z A;  1UWN X;  3GEC A;  3VE4 A;  3E4Q A;  5AVF A;  2V1A A;  5DKK A;  4HH2 A;  3MFX A;  1N9L A;  2OWJ A;  3FC7 A;  1DP8 A;  3G6O A;  4PKY G;  2QWS A;  3PHY A;  4EEU A;  3E4P A;  5I5L A;  4R3A A;  3KX0 X;  3LIE A;  2I9V A;  2D02 A;  3P7N A;  1OTE A;  3CLO A;  3ICY A;  5DKL A;  1DRM A;  3MJQ A;  1S4S A;  3NOU C;  2WKR A;  4JGP A;  5HD5 A;  5IS1 A;  4L9E A;  1VB6 A;  1XFN A;  2Z6D A;  4F3L A;  3F1O A;  4LRZ E;  2YKH A; 
#chains in the Genus database with same CATH topology
 1GSV A;  4S2P A;  2EX2 A;  1BUL A;  4ID4 A;  2WZZ A;  1LL5 A;  5HAI A;  1YT4 A;  1Y28 A;  2ZLY A;  5JYO A;  2Y8H A;  4JBF A;  4MMN A;  3HUM A;  2EXB A;  2VV7 A;  4N1X A;  5EPH A;  4HJ3 A;  3T4T A;  4EBN A;  2KDK A;  5EVE A;  4S2I A;  2ZL1 B;  4ZJ1 A;  4DRT A;  4ZAM A;  2VEA A;  1N4O A;  3LEQ A;  3PAE A;  4O7D A;  3C4P A;  1TS0 A;  2WZX A;  1FSW A;  4L9G A;  3BM6 A;  4JGQ A;  3MSH A;  4MDZ A;  2GZA A;  1BLP A;  1KDS A;  5HL1 A;  4BL2 A;  3UB5 P;  4R70 A;  1XPB A;  4UEY A;  5CEC A;  3IF6 C;  5L07 A;  3CHW P;  2JN7 A;  4EBL A;  3LEZ A;  3IX8 A;  1M40 A;  3UE3 A;  1QME A;  5U47 A;  3C7U A;  5FI2 A;  3ZG9 B;  1P0Z A;  3BLS A;  3O86 A;  2OLU A;  4HHD A;  4PPR A;  5J3W A;  4II7 A;  3GRJ A;  3PBR A;  2OAQ 1;  2ZMV A;  3RJU A;  5CED A;  4OPZ A;  2HP9 A;  5EVI B;  3R7W A;  5BOH A;  2WK0 A;  3V5M A;  4HY8 A;  1WE4 A;  1SKO B;  4QHC A;  1Y54 A;  3NDG A;  4MBK A;  2A49 A;  1ES5 A;  5GLC A;  4EEP A;  2GNX A;  1RCJ A;  4IJG A;  3DWZ A;  3OOV A;  1X0O A;  3LR3 A;  2P04 A;  2RL3 A;  1E25 A;  2HDU A;  1JWP A;  2RCX A;  1DJC A;  3NOP C;  4OOM A;  2Z2M B;  3IHA A;  4FH2 A;  5J4E A;  2LB5 A;  1H5X A;  1YPR A;  3QP4 A;  3Q7V A;  4P6B A;  3LY3 A;  5FAP A;  2ACG A;  2HP6 A;  2Y2N A;  2JKT M;  4AFI A;  1OJG A;  4U3T A;  1AXB A;  4I3A A;  1G28 A;  1XP4 A;  1WA9 A;  2JKR M;  1BYW A;  4Y0U A;  3UME A;  1F9I A;  2ZQ7 A;  4OQH A;  2BAS A;  2XFS A;  3NIA A;  4GS9 B;  1XJ2 A;  4WLA A;  5L09 A;  4Y3I A;  4GNU A;  5F1F A;  1KGE A;  2Y91 A;  3IX4 A;  4GN2 A;  4S2K A;  4WEJ A;  4LV1 A;  2Y2Q A;  3PXP A;  3UE6 A;  1KE3 A;  3Q82 A;  4GDB A;  1DY6 A;  2R78 A;  3UNW A;  3FZC A;  1HTZ A;  1CF0 A;  1J3W A;  3MMH A;  5EVI A;  4M4X A;  3IS2 A;  3GR2 A;  3RTY A;  3LIB A;  2E8J A;  2ZQD A;  4FCF A;  4FUW A;  1SKO A;  3CUE C;  5GL9 A;  5HAP A;  3O5Y A;  1IYO A;  4QJG A;  4KQR A;  3G32 A;  2D01 A;  3BEC A;  1E3U D;  3ZVT A;  2JKG A;  1XKZ A;  4DE0 A;  4PMA A;  3T1S A;  2J8Y A;  2A24 A;  4QY5 A;  3UPO A;  1YM1 A;  2H0Y A;  4LGW A;  3BY9 A;  1CEG A;  1GHI A;  1RP5 A;  2FFF B;  5FI6 A;  3O88 A;  3T12 B;  5D3O A;  3S7N A;  4ZJ3 A;  1TS6 A;  3LFV A;  1ERO A;  1XA7 A;  1YAX A;  2CC1 A;  2Z6C A;  1GA0 A;  3CG5 A;  3KYE A;  4GJ4 A;  5FAS A;  1UWP X;  3G4P A;  2WGI A;  3IF5 A;  4X56 A;  5DJT A;  1TS8 A;  4ETZ A;  2EA9 A;  3BRM A;  5HZH A;  4H6J B;  1YLZ A;  1OJ5 A;  2ZOI A;  2VA0 A;  1IYP A;  1CEF A;  3JVV A;  4WBG A;  4DMZ A;  1T18 A;  2ZC7 A;  4GDN A;  2K2N A;  4ZBE A;  1NRJ A;  1OTB A;  3TJZ C;  2L4R A;  2PU2 A;  4PM6 A;  2JKR I;  3T4S A;  1VET A;  3CMZ A;  3T1R A;  5DTK A;  3N8L A;  3ZDJ A;  1HD8 A;  4BBT A;  4E6W A;  5HFO A;  4XUX A;  2W0N A;  4FOF A;  5C5K A;  4WEL A;  3A3E A;  2K7S A;  5IHV A;  4NG2 A;  4GCZ A;  1RGY A;  2OV5 A;  2V9A A;  3ITB A;  1MC0 A;  4Y17 A;  2IA2 A;  3W8K A;  1PIO A;  3GVB A;  4HI4 A;  1LSV A;  3MF0 A;  3FPW A;  3NEC A;  4CPK A;  1ONH A;  4OQ0 A;  3LR5 A;  4I5S A;  4WMC D;  5EE8 A;  1LI9 A;  2W3G A;  1YKD A;  3OPL A;  5KMW A;  5KIZ A;  5DF7 A;  5IT5 A;  4WZ5 C;  4CLC B;  4RYE A;  4NK3 A;  4GZB A;  3C8C A;  3K2N A;  4UHU A;  4WL9 A;  2HDS A;  4I3I A;  4GHI B;  1KGF A;  4NKP A;  3HCY A;  1UWN X;  2W1R A;  3E4Q A;  4KQQ A;  3QP5 A;  5AVF A;  4R3B A;  3UPP A;  1YLJ A;  2PU4 A;  4LV2 A;  4PM9 A;  1FCO A;  1ES3 A;  3S22 A;  5CEB A;  3MFX A;  1CI8 A;  3W4Q A;  3ZNY A;  2XQZ A;  2M7V A;  1N9L A;  3HLB A;  4LCL A;  1FCN A;  1PNE A;  2DCF A;  1ES2 A;  5GHX A;  4EEU A;  3E4P A;  3N8R A;  1STZ A;  5HW3 A;  4XUZ A;  5FQ9 A;  4BLM A;  3KX0 X;  3VP0 A;  2WGW A;  1LLB A;  3VP3 A;  2OSU A;  5CTN A;  4DE1 A;  5DKL A;  3BQA A;  4IBR A;  3NOU C;  1ESI A;  4R23 A;  1W79 A;  1YSQ A;  3PR6 A;  5IS1 A;  5CGX A;  3OC2 A;  4B4X A;  2XLN A;  3CIT A;  4GOG A;  1XFN A;  3ZG0 A;  1H8Z A;  4F3L A;  1IYQ A;  3R4K A;  5CRF A;  1TEM A;  1KGG A;  1JTD A;  1NLZ A;  4X1L A;  2PD8 A;  2A3U A;  3VSK A;  4CLC A;  3ZG5 A;  1TS7 A;  3DBA A;  1FCM A;  4JXV A;  3GDI A;  2ZM8 A;  4S2N A;  4EWF A;  3BY8 A;  5FAO A;  5HPF A;  5AVE A;  2J9O A;  1OTI A;  4DN0 A;  4X1M A;  3NCK A;  4S2L A;  1SKF A;  3V39 A;  3KYQ A;  1Q2Q A;  3ZNT A;  5TBM A;  3S7O A;  1E4D A;  3VMA A;  4R38 A;  3E2L A;  4R3J A;  3C4O A;  2WKQ A;  3F1O B;  4QU3 A;  2HV1 A;  4MBF A;  3QNC A;  3MQQ A;  3H7W B;  1HVB A;  3ITA A;  2PD7 A;  2KOI A;  1MBL A;  1PWG A;  4EUZ A;  4LV3 A;  4EXO A;  1W8Q A;  1HZO A;  4IVK A;  5FSR A;  1IEM A;  1BTL A;  2ZQ8 A;  3OLO A;  3P01 A;  2L0W A;  1TDG A;  1TF1 A;  3H82 A;  3QP2 A;  3GMW A;  3B47 A;  2M1C A;  3UDF A;  3UB8 A;  2V0U A;  1MWT A;  3MXQ A;  3IXD A;  3VOZ A;  5TJJ A;  4WM9 A;  3LO7 A;  3UB7 A;  2VGL S;  4P6Z S;  1K55 C;  1D7E A;  3VP4 A;  3HLW A;  4K91 A;  4LRY C;  3ISG A;  4KEN B;  1DJA A;  3Q7Z A;  1L0G A;  3FYZ A;  3V3R A;  3FG8 A;  4DJ3 A;  4X55 A;  4EU0 A;  5E2G A;  5I94 A;  2WYX A;  2HDR A;  1E3U A;  3EQV A;  4KZ9 A;  3E4O A;  4EET B;  1ZTU A;  2NUP C;  1LL9 A;  4FH4 A;  1NZO A;  4HNB A;  2CMN A;  2QMI A;  2EX9 A;  3DWK A;  3KSF A;  1ONG A;  4L0L A;  4NXE A;  3GTC A;  5FDH A;  4DDS A;  2J3W A;  1KOU A;  3T4K A;  1PRQ A;  1J9M A;  3G35 A;  3VP2 A;  4ESP A;  2R9X A;  3H7W A;  3NDE A;  4CLC E;  3VSL A;  1PWC A;  4BWI A;  3R7W B;  2XA7 M;  2J7V A;  4ZJ2 A;  3S7Q A;  3IXB A;  3NJA A;  1OTD A;  2V1B A;  4HIA A;  3JVU A;  3PBN A;  3MZD A;  1I2S A;  1SHV A;  2W27 A;  3N6I A;  3BFF A;  1ACF A;  2P9V A;  3V50 A;  1P9R A;  1CI9 A;  1OT6 A;  1VQQ A;  1MWS A;  3VE3 A;  4DE3 A;  4DKI A;  4WF0 A;  1BLH A;  4B9O A;  4GW9 A;  4O8G A;  1K0K A;  3IWO A;  3RXW A;  3BQ8 A;  1PI5 A;  1KVM A;  1K4E A;  3Q7V B;  3ZVW A;  4HP9 A;  5CHU A;  2XK1 A;  3E2K A;  4R4R A;  4DDY A;  3DTM A;  3MBZ A;  2XSS A;  3LUQ A;  5A8B A;  3BYD A;  2OAP 1;  1ES4 A;  1K56 D;  3UB6 A;  3OCL A;  2EX6 A;  1D1J A;  4OPR A;  3BWL A;  2HF6 A;  2QPN A;  4R4S A;  2PAV P;  3K3C A;  4GD6 A;  1N9B A;  5F5Y A;  1H0M A;  1H3Q A;  3AGE A;  1PZP A;  3VV4 A;  3SH9 A;  5KSH A;  2XRN A;  3L9K A;  4PKY A;  2XEP A;  3ZHH A;  3B33 A;  3IS2 B;  3F1N A;  4ZTK A;  4PHT A;  4LFU A;  2IWD A;  4YNR A;  4Q0I A;  5G18 A;  1MPL A;  5HDC A;  4HH3 A;  1Y4O A;  3BFG A;  3MFD A;  1JVJ A;  4JGR A;  3LCE A;  2HJE A;  3SOI A;  3MQ0 A;  2PYP A;  4EW7 A;  5F83 A;  2A24 B;  3E98 A;  1S1Y A;  5DTS A;  3V67 A;  1TD5 A;  4IVI A;  2EXA A;  3O3V A;  4OOY A;  2Y2L A;  1EW0 A;  5E2F A;  4N92 A;  5HWV A;  2G2W A;  1Q2P A;  4Y7P A;  4B93 A;  3TSG A;  1CQA A;  3CWF A;  1LHY A;  2VX8 A;  5CER A;  4FSF A;  2HP5 A;  1MWU A;  3AGD A;  5G4Y A;  4S2J A;  4KUO A;  2W3F A;  2MJ6 A;  4WN5 A;  1GCE A;  3MR0 A;  2Y2M A;  1GHM A;  4S2O A;  1U60 A;  2Y2J A;  1VET B;  3E0Y A;  1K54 C;  4LCM A;  3B3X A;  3A0V A;  1ZC2 A;  4OPY A;  1S0W A;  1PZO A;  1YMS A;  1DJB A;  4RA7 A;  5E2E A;  4GLQ A;  4EES A;  3C2W A;  1IEL A;  3HJI A;  4X25 A;  1YMX A;  1G6O A;  3DTI A;  2Y79 A;  2VKS A;  5FAT A;  3VE4 A;  5FL3 A;  1IYS A;  2WKH A;  1OPX A;  2EFX A;  3M6H A;  2Y4A A;  2WAD A;  4XXR A;  4ZDX A;  3Q81 A;  5GHY A;  5CHM A;  2IWC A;  2JE5 A;  4X6T A;  1BLC A;  1NYY A;  1FIL A;  1KE0 A;  4EBP A;  3IXG A;  4R3A A;  4E3N A;  1WYC A;  2HPB A;  4JXW A;  3KO6 A;  3SH7 A;  2OLV A;  3P7N A;  4JPM A;  3CLO A;  3ICY A;  1L0F A;  1DRM A;  2JKT I;  1EWZ A;  2XH9 A;  4JGP A;  1Z6F A;  3A3I A;  3OZH A;  5HPI A;  1M6K A;  3SS4 A;  4L9E A;  3SZT A;  5TFQ A;  4EQI A;  2JCH A;  2W3H A;  4LRZ E;  2WKE A;  2WGW B;  3WS4 A;  2FZ0 A;  3EGD C;  3ZQ5 A;  4NXB A;  4QB8 A;  3IF6 B;  3WS0 A;  2GDN A;  2V1Z A;  2AVX A;  1K57 A;  3HLE A;  4XT2 B;  1FR6 A;  2KX6 A;  4MEZ A;  1NJ4 A;  3UE1 A;  2INW A;  4C3Q A;  2DRW A;  2VLG A;  2QHK A;  4MN7 A;  4PM7 A;  1SDE A;  4N9K A;  4F3L B;  1YSP A;  2K31 A;  5FEG A;  4KG2 A;  3G2Z A;  4X53 A;  3D4F A;  2M7U A;  4Q8I A;  4IUK A;  3UE0 A;  4E6X A;  2FFY A;  1L3L A;  3T1X A;  4IED A;  3B42 A;  3IH8 A;  3C38 A;  1MY8 A;  3QP8 A;  5AQ9 A;  2UV0 E;  3FPV A;  5TBM B;  1LSW A;  2QJ5 A;  2B5R A;  3ZYT A;  2W3E A;  2Y59 A;  4IUH A;  2HGV A;  3HBR A;  3PBT A;  5GLA A;  4RQ9 A;  1YLY A;  3UDX A;  3GV9 A;  5M19 A;  5EUA A;  4DXC A;  1OT9 A;  4FD8 A;  1K56 A;  4EUV A;  1CJF A;  1YLP A;  1LSX A;  4ARZ B;  3C7V A;  5HWT A;  1A0K A;  5LBR A;  1VEU A;  4EER A;  1S1Z A;  4MNR A;  1D06 A;  1G5U A;  4LPZ A;  4N9L A;  1PW1 A;  1FSY A;  3H82 B;  1IKG A;  3IF6 A;  1S66 L;  2GX5 A;  1NYM A;  4LV0 A;  2WAF A;  1UGU A;  1PYY A;  2X71 A;  3CZD A;  3OPH A;  3HL9 A;  2EFU A;  3UMD A;  4GKU A;  3WRZ A;  2IWB A;  4XT2 A;  5FQQ A;  4HES A;  5J7E A;  5FQK A;  2R9W A;  2PYR A;  2XD1 A;  4HEF A;  1TDL A;  4E04 A;  5AQA A;  2WAE A;  2BTF P;  4E3O A;  1ALQ A;  3T4O A;  4Q0J A;  1K25 A;  1T1B A;  4FTX A;  3VOL A;  4X69 A;  3A3F A;  1XJ4 A;  5F69 A;  3NHQ A;  5A91 A;  3VP1 A;  1GA9 A;  3IHB A;  3RH8 B;  5FEF A;  5FAQ A;  4BD0 A;  1NRF A;  3LIC A;  5FI7 A;  3BLM A;  3H9W A;  1VHM A;  3MZF A;  3ZFZ A;  1OME A;  5EVI C;  4OQG A;  3FKW A;  5CX7 A;  5EOO A;  3NOT C;  2ZBB A;  1W63 Q;  4PM5 A;  4OVD A;  4YFM A;  5F6A A;  2DNS A;  2P74 A;  1MKI A;  3F1P A;  3NUL A;  2Q0O A;  1TVF A;  4Y15 A;  3ZCZ A;  4ARZ A;  4RVA A;  4C6Y A;  1K4F A;  5EVI D;  2W3D A;  5F68 A;  3SW1 A;  4E3M A;  5M1A A;  3BEB A;  1BT5 A;  3QNB A;  1P97 A;  4LEN A;  4DJ2 A;  1ERM A;  2P9V B;  1G6A A;  4K0W A;  3GSG A;  4PAU A;  1C3B A;  3RFB A;  3UY6 A;  5HSQ A;  2VK3 A;  4HJ4 A;  1SCW A;  1SZV A;  3P98 A;  3N8S A;  1T1A A;  4BBV A;  1XJ3 A;  1T19 A;  2V20 A;  4Y2F A;  2OWH A;  3G30 A;  3HLG A;  1N9O A;  1NY0 A;  4ETX A;  2Y2P A;  3T4Q A;  1V9Y A;  4Z1W A;  5J8X A;  3KSI A;  5IU1 A;  1GSW A;  2JHE A;  2O9C A;  1L0E A;  1BSG A;  3CI6 A;  4KG5 A;  1ZHH B;  4L9F A;  5GLD A;  4Y0O A;  3UB9 A;  5DF8 A;  4RX3 A;  1XX2 A;  3CUE A;  3MKF A;  3BW6 A;  3NBL A;  5DFX A;  1FQG A;  2Q9N A;  3K3D A;  3ZG7 B;  3DW0 A;  1YLW A;  1PW8 A;  1YQS A;  4BQM A;  2G2U A;  4DF6 A;  1IKI A;  5HD3 A;  2X02 A;  3PBS A;  1XFQ A;  4P0M A;  1JWZ A;  3S7P A;  1MWR A;  2BLS A;  2H28 A;  3F1N B;  3OBF A;  4NEE D;  2ZD8 A;  3LR0 A;  4A5R A;  3SH8 A;  3A3D A;  1NZU A;  5GHZ A;  3BFD A;  4KG6 A;  3FWL A;  2B18 A;  2H5S A;  4G3V A;  1GSX A;  4U0T A;  2JC7 A;  1MZU A;  4N1H A;  1K6R A;  4F94 A;  4KZ4 A;  4HQA A;  3VOY A;  3DTE A;  3M6B A;  2ZC5 B;  3LY4 A;  1ZG4 A;  3S1Y A;  1W5D A;  3G34 A;  1ZKJ A;  2ZOH A;  5A93 A;  2ZMA A;  2Z2L B;  5EOE A;  5CHJ A;  1QMF A;  1FIK A;  2J9P A;  3HJK A;  4JF4 A;  5K5B A;  3EGX C;  4MBH A;  2G7U A;  4UA6 A;  1N9N A;  2ZM2 A;  4O0P A;  2XA7 S;  1PWD A;  1XA1 A;  4KQO A;  5HX9 A;  2XR0 A;  1HLU P;  5G4Z A;  2WGV A;  2O9A A;  4WMC A;  5CGW A;  4EQ1 A;  1XXM A;  2HDQ A;  4DE2 A;  3L7H A;  1NXY A;  3DAV A;  1I5Q A;  2QJ7 A;  1V9Z A;  2EWW A;  3N7W A;  3GEC A;  2I72 A;  3HLC A;  2ZJ9 A;  4Y5F A;  3T4L A;  2Y2O A;  4H8R A;  3EEA A;  4R1G A;  4ME4 A;  3M2J A;  2ZC6 B;  5CTM A;  4WZ5 A;  1DP8 A;  3G6O A;  4PKY G;  3WS1 A;  2Y2K A;  4JF6 A;  4WEK A;  5A90 A;  3Q1F A;  4JLF A;  5M18 A;  5L8M A;  2I9V A;  1H8M A;  4CLC C;  4Y0T A;  2Y2I A;  2D02 A;  4S2N C;  3W4P A;  1K6S A;  2XF3 A;  5AJG A;  4GB7 A;  5F1G A;  4JF5 A;  1OTE A;  1F2K A;  3MJQ A;  1IOU A;  4HBU A;  1JTG A;  5HD5 A;  3WWX A;  4CLC D;  4C75 A;  2JKF A;  4Q0H A;  4YOF A;  2ZL1 A;  2PT7 A;  3IWQ A;  1W63 M;  2Y55 A;  3WRT A;  3CJM A;  2WKI A;  1ERQ A;  4UQI M;  3KYZ A;  4QD4 A;  3TRC A;  4BJP A;  3M2K A;  4OPQ A;  2QKP A;  4NET A;  1YLT A;  1Z09 A;  3HLF A;  4KZ8 A;  1DP6 A;  1PFL A;  3T50 A;  1S4R A;  2DMW A;  2H10 A;  3DTK A;  4KZ7 A;  3PTE A;  3V3S A;  3TG9 A;  3KSG A;  2EX8 A;  3OCN A;  2VV6 A;  3TOI A;  1SDN A;  3GQZ A;  4KZ6 A;  1VM1 A;  3D72 A;  3LI9 A;  3IH9 A;  2ZQC A;  4E3I A;  4KUK A;  4K08 A;  5DFY A;  1XGI A;  3NC8 A;  2QYB A;  4UQI S;  2HJ9 C;  4D2O A;  2L1M A;  2WUQ A;  4HBT A;  3EOI A;  5DF9 A;  4MN6 A;  3BFC A;  4JXG A;  3D3O A;  2V0W A;  3EEH A;  2ZM0 A;  2PDR A;  1MKM A;  3NI9 A;  2B02 A;  2PBD P;  5FQI A;  4UA7 A;  1S67 L;  4WYY A;  3VFH A;  3LR4 A;  3IXH A;  4EV4 A;  1NWZ A;  5GLB A;  3W4O A;  3CAX A;  3P09 A;  1LT0 A;  3UDI A;  1LL8 A;  1KVL A;  3JPU A;  2P7J A;  3QHY A;  3EQU A;  3QP6 A;  2ZC4 B;  4G3K A;  2W1T B;  4O01 A;  4UAA A;  4P85 A;  4OKP A;  5FDS A;  1DP9 A;  4WUJ A;  4LRX C;  5L10 A;  2ZQ9 A;  2QZ6 A;  1XGJ A;  1MXO A;  5CGS A;  3A0S A;  3U2A A;  2J80 A;  4QWO A;  3T4J A;  3UO9 A;  5F82 A;  2ZMF A;  1K55 A;  2X01 A;  2E8I A;  1GHP A;  4K0X A;  5DVA A;  3OPP A;  3SS5 A;  1KDW A;  3LYX A;  4OOL A;  1W7F A;  4I3J A;  1F98 A;  1VEU B;  5EEC A;  3QP1 A;  2XFT A;  1JWV A;  4OP8 A;  2WKP A;  4S2M A;  3HLD A;  5HWW A;  4NXG A;  2A2L A;  3S4X A;  5EM0 A;  4YIN A;  4GS9 A;  4B88 A;  3IT9 A;  2V8C A;  2O0Y A;  5E2H A;  1ESU A;  3RXX A;  4JGO A;  3U4L P;  3C5A A;  3A3J A;  4OLD A;  3LGO A;  3IBR A;  5JYP A;  1BZA A;  1NLY A;  2C5W B;  4GD8 A;  4X68 A;  4KZA A;  1BUE A;  5A92 A;  3CPT B;  2XD5 A;  2VZW A;  4E3J A;  3NY4 A;  1IFQ A;  5TR7 A;  1G68 A;  4KZB A;  1AWI A;  3HUO A;  3LI8 A;  3EWK A;  3MZE A;  4OH0 A;  5FA7 A;  2PR5 A;  2YKF A;  3TW8 A;  3Q07 A;  2B95 A;  4JKT A;  2OOL A;  4QPR A;  3TE8 A;  3W2Z A;  1WYB A;  4JXS A;  5CXW A;  2W1T A;  4MCW A;  3PYP A;  2PR6 A;  1S6R A;  4BBU A;  2LB9 A;  4KZ5 A;  3G31 A;  3HVF A;  1PI4 A;  1K38 A;  3ZG8 B;  3IQA A;  3WS5 A;  5HAR A;  3D9Y A;  2PHY A;  4I38 A;  4WZ4 A;  4CQH A;  3F1P B;  3MXS A;  4UA9 A;  1T1C A;  4HJ6 A;  3LIF A;  4R6L A;  5EM1 A;  5FQM A;  4H6J A;  2XDM A;  3A0R A;  4HOI A;  1JNU A;  4E3L A;  5AQ7 A;  4Z9Q A;  2O99 A;  5DTT A;  1EI5 A;  3I7J A;  3AGF A;  5L2F A;  1OTA A;  5KSC A;  5EV0 A;  2VGK A;  2XRO A;  2XGN A;  3LID A;  3CPT A;  5E43 A;  4HP4 A;  1LI0 A;  1CK3 A;  4KQD A;  4LLO B;  2V2F F;  3N4I A;  2Y2H A;  1ODV A;  4OLG A;  2C6W B;  4RX2 A;  4KZ3 A;  2V8F A;  4MN5 A;  2PRF A;  4OON A;  4B4Z A;  5EVL A;  2GJ3 A;  1F5M A;  5HDS A;  5KZH A;  5HDD A;  3BJN A;  4DXB A;  3HRE A;  3HUN A;  3VFF A;  2KLI A;  2ZQA A;  4G3W A;  5FQJ A;  2VV8 A;  5TGF A;  3SS3 A;  4OQI A;  1O7E A;  2UWX A;  4GHI A;  3MQO A;  5MC7 A;  4MLL A;  3BFE A;  4BEN A;  4BMW A;  4BL3 A;  3MXR A;  3C30 A;  3PAG A;  4Y13 A;  2VGL M;  4P6Z M;  2NUT C;  1W8Y A;  3T1Q B;  3G2Y A;  4ZRR A;  1O07 A;  3MS6 A;  3UPN A;  4YWZ A;  3LIA A;  4NXF A;  1XJ6 A;  2ZC3 B;  3ZGA B;  4I39 A;  3UN7 A;  4CJN A;  3MKE A;  2HZ5 A;  1BLS A;  2Q9M A;  3FV7 A;  2P08 A;  5EFW A;  3ULF A;  5DJU A;  4QY6 A;  3JYI A;  1RGZ A;  3PBQ A;  1K54 A;  4D60 A;  1L0D A;  2V1A A;  5DKK A;  3PBO A;  4HH2 A;  4P87 A;  1FR1 A;  2EWV A;  1ZG6 A;  3OPR A;  2OWJ A;  3FC7 A;  1L2S A;  2H0T A;  2VGJ A;  2J3T C;  4R0Q A;  2QWS A;  5AQB A;  1I2W A;  3PHY A;  5I5L A;  1KE4 A;  1P9W A;  2Y2G A;  3LIE A;  2VJW A;  2FH5 A;  2O9B A;  4IHQ A;  3O87 A;  4OP5 A;  1K57 C;  1H8Y A;  2J3T D;  4IBX A;  1S4S A;  5HAQ A;  3WS2 A;  3IWI A;  2WKR A;  1FOF A;  4M3K A;  5HL6 A;  4PM8 A;  3KSH A;  3IX3 A;  2JBF A;  2PBY A;  1VB6 A;  4U0X A;  4E3K A;  2BG1 A;  2Z6D A;  3F1O A;  3FKV A;  4BD1 A;  2YKH A;  3IBJ A; 
#chains in the Genus database with same CATH homology
 2PD8 A;  1GSV A;  3KYZ A;  2FZ0 A;  3EGD C;  3TRC A;  4BJP A;  3ZQ5 A;  4NXB A;  4CLC A;  1TS7 A;  3DBA A;  2QKP A;  3GDI A;  3BY8 A;  1DP6 A;  5HPF A;  5AVE A;  1OTI A;  4DN0 A;  1Y28 A;  4XT2 B;  2KX6 A;  3T50 A;  1S4R A;  2Y8H A;  3KYQ A;  2INW A;  2DMW A;  5TBM A;  4MMN A;  3S7O A;  2VV7 A;  2VLG A;  4HJ3 A;  2QHK A;  3T4T A;  2KDK A;  3KSG A;  4R38 A;  3OCN A;  4MN7 A;  2VV6 A;  2WKQ A;  4F3L B;  3F1O B;  2HV1 A;  1YSP A;  2K31 A;  2VEA A;  3D72 A;  3MQQ A;  3LI9 A;  2M7U A;  3H7W B;  4IUK A;  2PD7 A;  4KUK A;  1TS0 A;  4K08 A;  2KOI A;  5DFY A;  4L9G A;  3B42 A;  4JGQ A;  3C38 A;  4MDZ A;  2GZA A;  2QYB A;  4UQI S;  2HJ9 C;  4EXO A;  2L1M A;  3OLO A;  3EOI A;  2L0W A;  3P01 A;  4MN6 A;  5DF9 A;  4R70 A;  4UEY A;  3FPV A;  5TBM B;  1TF1 A;  3D3O A;  2V0W A;  3EEH A;  3H82 A;  2PDR A;  1LSW A;  1MKM A;  2QJ5 A;  3B47 A;  2JN7 A;  2M1C A;  3ZYT A;  3UB8 A;  2B02 A;  2V0U A;  2W3E A;  4IUH A;  1S67 L;  3MXQ A;  2HGV A;  5TJJ A;  3LR4 A;  3PBT A;  3UE3 A;  4RQ9 A;  1NWZ A;  3UB7 A;  2VGL S;  4P6Z S;  3CAX A;  1OT9 A;  1D7E A;  4EUV A;  1LT0 A;  1P0Z A;  1LSX A;  4ARZ B;  1LL8 A;  4LRY C;  5HWT A;  2P7J A;  5LBR A;  4HHD A;  3EQU A;  5J3W A;  4EER A;  1S1Z A;  3FG8 A;  4DJ3 A;  4II7 A;  4G3K A;  1D06 A;  4EU0 A;  2W1T B;  4LPZ A;  4O01 A;  3PBR A;  2OAQ 1;  2ZMV A;  3H82 B;  1S66 L;  1DP9 A;  4WUJ A;  2GX5 A;  3R7W A;  3EQV A;  4LRX C;  1UGU A;  3E4O A;  4EET B;  1ZTU A;  2NUP C;  4HY8 A;  3UMD A;  3A0S A;  4XT2 A;  2J80 A;  3U2A A;  3T4J A;  4HNB A;  5J7E A;  2ZMF A;  2CMN A;  3KSF A;  2PYR A;  4L0L A;  4NXE A;  4E04 A;  4EEP A;  2GNX A;  2J3W A;  3LYX A;  1KOU A;  4IJG A;  4OOL A;  3T4K A;  4I3J A;  3OOV A;  1F98 A;  1X0O A;  3T4O A;  3LR3 A;  2P04 A;  4Q0J A;  1T1B A;  2WKP A;  5HWW A;  4NXG A;  2A2L A;  3NOP C;  4OOM A;  3VOL A;  3H7W A;  1XJ4 A;  4CLC E;  5J4E A;  2LB5 A;  4GS9 A;  5F69 A;  4BWI A;  3NHQ A;  3R7W B;  2O0Y A;  3RH8 B;  2XA7 M;  3S7Q A;  4JGO A;  3NJA A;  1OTD A;  2V1B A;  4HIA A;  3JVU A;  3PBN A;  3LIC A;  3IBR A;  2W27 A;  3H9W A;  1NLY A;  1VHM A;  1P9R A;  2JKT M;  1OT6 A;  4AFI A;  1OJG A;  3VE3 A;  4I3A A;  4WF0 A;  1G28 A;  4B9O A;  5CX7 A;  2VZW A;  4GW9 A;  4O8G A;  1WA9 A;  3NOT C;  1IFQ A;  2JKR M;  2ZBB A;  1W63 Q;  1BYW A;  3UME A;  3BQ8 A;  1F9I A;  2BAS A;  5F6A A;  3LI8 A;  4GS9 B;  1XJ2 A;  4WLA A;  3F1P A;  4Y3I A;  3EWK A;  4HP9 A;  4ARZ A;  2PR5 A;  2W3D A;  5F68 A;  2YKF A;  3TW8 A;  3SW1 A;  2OOL A;  4QPR A;  3TE8 A;  3W2Z A;  1P97 A;  4WEJ A;  4DJ2 A;  3PXP A;  2W1T A;  4MCW A;  2XSS A;  3PYP A;  2PR6 A;  3LUQ A;  3UE6 A;  5A8B A;  2OAP 1;  2R78 A;  4PAU A;  4BBU A;  2LB9 A;  3RFB A;  3MMH A;  4M4X A;  3UB6 A;  3IS2 A;  3OCL A;  3RTY A;  5HSQ A;  3LIB A;  4HJ4 A;  3BWL A;  2HF6 A;  3CUE C;  1T1A A;  3O5Y A;  4BBV A;  1XJ3 A;  2PHY A;  4I38 A;  4CQH A;  1T19 A;  3F1P B;  2D01 A;  1T1C A;  3K3C A;  4HJ6 A;  5F5Y A;  4Y2F A;  2OWH A;  3LIF A;  1H3Q A;  4R6L A;  1N9O A;  3VV4 A;  5KSH A;  4ETX A;  2A24 A;  2XRN A;  3T4Q A;  1V9Y A;  4H6J A;  4PKY A;  4Z1W A;  3A0R A;  3KSI A;  5IU1 A;  4HOI A;  1JNU A;  3B33 A;  3BY9 A;  3IS2 B;  1GSW A;  2JHE A;  2O9C A;  2O99 A;  3F1N A;  4PHT A;  3CI6 A;  4YNR A;  3S7N A;  1OTA A;  1ZHH B;  4L9F A;  1TS6 A;  4Q0I A;  3UB9 A;  3LFV A;  3CUE A;  1YAX A;  2XRO A;  3BW6 A;  5HDC A;  4HH3 A;  2Z6C A;  3LID A;  5DFX A;  4GJ4 A;  4HP4 A;  1UWP X;  3K3D A;  4KQD A;  4JGR A;  2HJE A;  4LLO B;  5DJT A;  1TS8 A;  3MQ0 A;  2PYP A;  4EW7 A;  1ODV A;  4ETZ A;  2A24 B;  2EA9 A;  3E98 A;  5HD3 A;  5HZH A;  4H6J B;  1S1Y A;  4MN5 A;  1OJ5 A;  3PBS A;  1TD5 A;  3V67 A;  2ZOI A;  1XFQ A;  2VA0 A;  3JVV A;  2GJ3 A;  1F5M A;  4DMZ A;  3S7P A;  1T18 A;  5HDS A;  1EW0 A;  2K2N A;  2H28 A;  1NRJ A;  3F1N B;  1OTB A;  3BJN A;  3OBF A;  4NEE D;  5HDD A;  3TJZ C;  3LR0 A;  2L4R A;  5HWV A;  3T4S A;  2JKR I;  2KLI A;  4B93 A;  4BBT A;  3CWF A;  2B18 A;  2VX8 A;  4G3V A;  1GSX A;  1MZU A;  2W0N A;  4FOF A;  5C5K A;  4G3W A;  4WEL A;  2VV8 A;  4FSF A;  4HQA A;  2K7S A;  5G4Y A;  4GCZ A;  4KUO A;  2W3F A;  2MJ6 A;  2V9A A;  1MC0 A;  3MQO A;  2IA2 A;  4GHI A;  4WN5 A;  5MC7 A;  4BMW A;  2ZOH A;  3MR0 A;  4HI4 A;  3C30 A;  1LSV A;  3MF0 A;  3FPW A;  2VGL M;  4P6Z M;  2NUT C;  3LR5 A;  4I5S A;  3HJK A;  3E0Y A;  5K5B A;  4ZRR A;  3EGX C;  2G7U A;  2W3G A;  1YKD A;  3A0V A;  4YWZ A;  1N9N A;  5KIZ A;  3LIA A;  4NXF A;  4O0P A;  1XJ6 A;  2XA7 S;  5IT5 A;  4I39 A;  4KQO A;  4CLC B;  5G4Z A;  2O9A A;  3C8C A;  3K2N A;  4WL9 A;  4EQ1 A;  4I3I A;  4GHI B;  4GLQ A;  4EES A;  3C2W A;  3HJI A;  2P08 A;  5EFW A;  1G6O A;  3ULF A;  5DJU A;  2QJ7 A;  1V9Z A;  4NKP A;  3HCY A;  1UWN X;  2EWW A;  2Y79 A;  2VKS A;  3GEC A;  2W1R A;  3VE4 A;  5FL3 A;  3E4Q A;  1OPX A;  4Y5F A;  5AVF A;  3PBQ A;  3T4L A;  3EEA A;  2V1A A;  5DKK A;  3PBO A;  4ME4 A;  4HH2 A;  3MFX A;  2M7V A;  1N9L A;  2EWV A;  2OWJ A;  3FC7 A;  1DP8 A;  3G6O A;  4PKY G;  2J3T C;  2QWS A;  3PHY A;  4WEK A;  4EEU A;  3E4P A;  5I5L A;  1STZ A;  1P9W A;  4R3A A;  3KX0 X;  3LIE A;  5L8M A;  2I9V A;  1H8M A;  2VJW A;  2FH5 A;  4CLC C;  2D02 A;  2O9B A;  3KO6 A;  4IHQ A;  3P7N A;  5AJG A;  1OTE A;  3CLO A;  3ICY A;  2J3T D;  5DKL A;  1DRM A;  3BQA A;  3MJQ A;  1IOU A;  1S4S A;  3NOU C;  2JKT I;  2WKR A;  1YSQ A;  4JGP A;  5HD5 A;  3PR6 A;  5HL6 A;  5IS1 A;  3KSH A;  4CLC D;  3OC2 A;  5HPI A;  4L9E A;  4Q0H A;  3CIT A;  4YOF A;  2PT7 A;  1VB6 A;  1W63 M;  1XFN A;  2Z6D A;  4F3L A;  3F1O A;  3R4K A;  2W3H A;  4LRZ E;  4UQI M;  2YKH A;  3IBJ A;  1NLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...