2V0UA

N- and c-terminal helices of oat lov2 (404-546) are involved in light-induced signal transduction (cryo dark structure of lov2 (404-546))
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase
total genus 48
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v0uA00
3HJKA 2WKRA 4GS9B 2I9VA 3LIBA 1S1YA 3VOLA 3LICA 3IBRA 4L9EA 1OJ5A 5HZHA 4NXBA 4L9FA 4WL9A 5A8BA 5G4YA 1XJ3A 3K3DA 3F1PA 1WA9A 2A24A 4EESA 1MZUA 4HP9A 2V0WA 4EW7A 3NOTC 2PDRA 1P0ZA 3MFXA 1LSXA 3T50A 1UWNX 2J80A 3PYPA 4HOIA 2YKHA 3F1NB 2QKPA 3LYXA 4BBVA 1GSWA 3GECA 4I5SA 5HD5A 5DJTA 2V1BA 1V9YA 3LUQA 2Z6CA 1JNUA 4PKYA 4K08A 3UB9A 4I3IA 1XFNA 1T18A 4NXGA 3A0SA 5G4ZA 1UGUA 1F98A 3MR0A 3RTYA 1T1BA 2PD8A 4DJ2A 5TBMA 3EEHA 2R78A 2HV1A 1P97A 3F1PB 4M4XA 3F1OA 1DP8A 4KUKA 3ICYA 3NOPC 4WLAA 4R70A 3D72A 4DJ3A 1S4RA 4PKYG 5DJUA 1T19A 2QJ7A 3B33A 3H82B 4MN5A 1TS6A 1XJ6A 2GJ3A 1OTAA 1XJ4A 2YKFA 2V9AA 1DRMA 2PR5A 3CAXA 2WKQA 2D02A 1OTBA 3HJIA 1N9OA 3A0VA 1LL8A 1OTIA 3LIEA 5IU1A 4NXFA 1N9LA 3F1OB 4LRZE 3LIAA 4F3LB 4I38A 5DKLA 3NJAA 3BWLA 4I3JA 4JGRA 3IS2A 1N9NA 1BYWA 3VE3A 3ZQ5A 3A0RA 2QHKA 1X0OA 1LT0A 4EQ1A 2OWHA 2L1MA 4I39A 3LIFA 2OOLA 4HI4A 1G28A 3CWFA 4GCZA 3UMEA 2JN7A 3E4OA 4HJ6A 4YWZA 1NWZA 2PD7A 3H82A 4H6JB 4EETB 3MJQA 5HSQA 3C8CA 4BBUA 4KUOA 5IS1A 1D06A 1S4SA 3IS2B 1TS8A 2W0NA 1TS7A 5F5YA 2V1AA 4F3LA 4HHDA 5HDCA 3FC7A 1S67L 2K7SA 2CMNA 4RQ9A 3VE4A 4HH3A 2VLGA 4EXOA 2PR6A 1GSXA 3PHYA 4XT2A 4BBTA 2VV6A 1KOUA 3BY8A 1LSVA 4EEPA 5DKKA 2VV7A 2V0UA 1LSWA 2L4RA 4R3AA 1VB6A 2PHYA 2INWA 1XFQA 1Y28A 4LPZA 4L9GA 3UMDA 5KIZA 1DP9A 4H6JA 1TS0A 3G6OA 2Z6DA 2VV8A 4HY8A 4HJ4A 4LRYC 1OTDA 1DP6A 3RH8B 1S1ZA 4LLOB 4GHIB 1V9ZA 4HIAA 3UB7A 2B02A 1F9IA 2PYPA 2ZOIA 4XT2B 3ULFA 5F68A 4I3AA 3FG8A 4WN5A 2W27A 2OWJA 4EEUA 4MN6A 1OT9A 5HDSA 1GSVA 3C2WA 3UB6A 4KQDA 1OT6A 4NXEA 2P7JA 5AVEA 2JHEA 3OLOA 4R6LA 4WF0A 4JGQA 4EERA 4E04A 3LIDA 3SW1A 5HWTA 4B9OA 2D01A 1D7EA 1T1CA 5J7EA 3CLOA 1UWPX 3E4PA 4GW9A 3H7WA 2QWSA 3NHQA 4HNBA 1XJ2A 2WKPA 2KX6A 4HQAA 3LI9A 4GHIA 4WUJA 3P7NA 5HDDA 5HWVA 2PYRA 5AVFA 5I5LA 4HJ3A 2A24B 4GS9A 4LRXC 1EW0A 2H28A 2ZOHA 2VEAA 5J3WA 2M1CA 3MXQA 5HD3A 3LI8A 1T1AA 1OJGA 4JGOA 2EA9A 4HH2A 5J4EA 3NOUC 2QJ5A 3MQQA 3H9WA 5EFWA 2ZBBA 3K3CA 5F69A 2BASA 3GDIA 5HWWA 3F1NA 1S66L 3H7WB 1ODVA 3EWKA 3UE6A 5F6AA 2L0WA 3KX0X 2KDKA 3MQOA 4R38A 3BY9A 3UB8A 5TBMB 1OTEA 4HP4A 4JGPA 3E4QA
chains in the Genus database with same CATH superfamily
2WGVA 1ZG6A 5FATA 4X68A 2DCFA 4GLQA 4CQHA 2HZ5A 1S1YA 2X01A 3VOLA 2C6WB 4P85A 3PXPA 1OJ5A 1XA1A 5HZHA 2HP6A 4NXBA 4L9FA 5G4YA 3K3DA 2A24A 3OPLA 1ERQA 2XK1A 4C6YA 3ISGA 4HP9A 3NOTC 1P0ZA 3LEQA 4LV0A 3T50A 4DN0A 2EFUA 4OLGA 2QKPA 4BBVA 1FR6A 1SKOA 5CTNA 5DVAA 4HEFA 3IWIA 2Y8HA 1VETB 2Y2LA 3KYZA 3LUQA 2QPNA 3HVFA 2Z6CA 4K08A 2WK0A 3UB9A 1XFNA 4PM9A 4P87A 3GV9A 5G4ZA 5I94A 2O9CA 5CHUA 3UY6A 2PD8A 2VZWA 2XA7S 5M1AA 3N8SA 3EEHA 3GVBA 4N92A 2XEPA 4GKUA 3IXHA 5FAQA 4ESPA 4M4XA 5A92A 1W63M 1DP8A 4N1XA 5DTSA 1G6OA 4JXGA 1E25A 1DJCA 1YSQA 3LFVA 2HDQA 4F94A 1S4RA 4EQIA 2WAFA 2OV5A 4C75A 1T19A 3G35A 1MWTA 5GHZA 4BJPA 3BFDA 2JE5A 1Y54A 3DTEA 4QU3A 1VETA 4WZ5A 4BD1A 4UA9A 3N8RA 1JWPA 3U2AA 1KDWA 3W4OA 2ZL1B 3C4OA 4ETZA 4EUZA 4S2KA 3G30A 1OTIA 5EOEA 4P6ZS 3OBFA 3PAEA 2K31A 1ONGA 4JXWA 3DBAA 4NXFA 3F1OB 3FKVA 4LRZE 5L10A 4F3LB 3VP4A 4FH4A 5DKLA 4LV2A 1MWUA 4O0PA 1W8YA 4JGRA 2WGIA 3ZYTA 1N9NA 1BYWA 4JPMA 3HLBA 1YQSA 2M7UA 2ZJ9A 3QP2A 4IUHA 3V3RA 3SZTA 2H10A 3SH9A 2JKGA 2WYXA 1TD5A 2OWHA 5G18A 1LL5A 4GCZA 3UMEA 5KSHA 3A3EA 3ITBA 4B88A 4HJ6A 4D60A 1NWZA 3BFEA 4YOFA 2ZC7A 2VX8A 1ERMA 2R9WA 1N9BA 1SKFA 2ZD8A 1VEUA 2W3DA 5IS1A 1D06A 2ZL1A 4KG6A 3S4XA 1S4SA 4GDBA 3PBOA 3KO6A 1TS8A 1CEGA 2DRWA 4S2IA 1W8QA 3CMZA 4RX3A 4F3LA 3E2LA 5FAOA 3KSHA 2ZQCA 4IBRA 3VOZA 3HCYA 4WBGA 3C30A 3FV7A 2CMNA 3VE4A 3ZHHA 4HESA 1TF1A 1Z6FA 1NRJA 2M7VA 3GMWA 2VV6A 4B4ZA 1TEMA 2IWDA 3EQUA 3BY8A 1HTZA 4FCFA 1LSVA 1K57C 2V0UA 3LCEA 3P09A 4UHUA 1VB6A 3NDEA 2XFTA 1GHIA 1ES3A 3BW6A 4ID4A 2XF3A 5L2FA 5EOOA 1Y28A 4LPZA 4QJGA 4R3BA 4L9GA 2V1ZA 4X53A 3MXRA 2Y55A 1W7FA 5FA7A 3G6OA 3Q82A 4HY8A 3BQ8A 1L0EA 1KE4A 5HL6A 2W3FA 3JVUA 5CXWA 1WE4A 1PWGA 4HJ4A 3D9YA 4G3VA 4KZ4A 5EVIC 1VM1A 3IWQA 4HIAA 3BJNA 4Y2FA 3R7WB 1W5DA 1GHMA 2OLVA 2GX5A 2Y2PA 2R9XA 3JPUA 5KSCA 2O9AA 5FASA 3UDFA 3OC2A 3RXXA 4LENA 4OOLA 3VMAA 4WN5A 3PR6A 3UE1A 1MWRA 4KZ9A 4MN6A 1OT9A 2WAEA 3LY3A 1D1JA 1GA0A 1NJ4A 1NLZA 3OLOA 4OP5A 5MC7A 3PBNA 1CEFA 3LIDA 4LCMA 3E2KA 4B9OA 2IWBA 3HLDA 4Y17A 5EVLA 5L09A 4KZ6A 1T1CA 3CLOA 2XSSA 1PZPA 4GW9A 2PU4A 5A90A 2O0YA 4HNBA 3IXGA 4QD4A 1JTDA 5EE8A 4HQAA 1J9MA 3LI9A 1K54C 4WUJA 2OLUA 1ES2A 3UE0A 3RXWA 3HLGA 1PYYA 5FL3A 5AQ9A 3IT9A 5I5LA 1PW8A 1EW0A 2H28A 1K56A 2ZOHA 2VEAA 3SS5A 3GQZA 1QMFA 3ZDJA 1G68A 3RJUA 4UAAA 2LB5A 3UNWA 4HH2A 4KZ5A 5CHJA 2A2LA 3S22A 1A0KA 5GHYA 5EFWA 3K3CA 1YLZA 2BASA 3T4QA 3F1NA 1GA9A 4P0MA 3H7WB 1ODVA 3MS6A 5EPHA 4FD8A 2L0WA 1ONHA 3M2KA 2KDKA 3KSIA 2G2UA 2ZM0A 5HX9A 2EXAA 4OKPA 5EV0A 2W1TB 5CGWA 3HJKA 2WKRA 3S7NA 1MXOA 2ZQ8A 2I9VA 4X25A 3S7QA 2EX6A 1XXMA 2IA2A 4L9EA 4E3IA 3M6HA 4PPRA 1XJ3A 1NY0A 5HFOA 4PAUA 4EESA 4IEDA 3VSLA 2V0WA 4EW7A 1CJFA 4U0TA 3BECA 4LGWA 1PZOA 1LSXA 1KGGA 3CUEA 4WYYA 1PI5A 2Y2NA 3C38A 4KQRA 2J80A 5CTMA 3JVVA 3TE8A 3CJMA 1IKIA 1Z09A 1GSWA 4X69A 3GECA 4I5SA 2EWWA 1PI4A 4DMZA 1YLWA 1ZHHB 4N9KA 4OQ0A 4PMAA 1JNUA 4OQHA 2P9VA 4I3IA 1G5UA 3HUMA 4ZTKA 2JC7A 3RTYA 1K56D 3HLCA 1K55C 2NUTC 4KZBA 5D3OA 4E6XA 5HW3A 4B93A 2EX9A 3T1SA 1P97A 5E2HA 5CHMA 5HPIA 1FR1A 3VP3A 1BUEA 1HZOA 4PM7A 2G7UA 4DE0A 3IBJA 4RA7A 2WKEA 5HL1A 3VP1A 1YAXA 2VA0A 3NY4A 3NI9A 4HBTA 3IWOA 3IXDA 2B5RA 4WM9A 2PT7A 1BSGA 1JTGA 2QJ7A 3B33A 3H82B 4MN5A 1K25A 3R4KA 5FSRA 2VGJA 2GJ3A 4AFIA 4E3MA 4KQOA 4N9LA 1XJ4A 2HGVA 2P74A 3Q81A 3CAXA 2WKQA 3HJIA 3ZGAB 5GLCA 5DTKA 4Q8IA 2Y79A 2ZM8A 5IU1A 4XXRA 2PRFA 4DKIA 4ME4A 4UQIM 3BWLA 4KZ8A 4PHTA 3FYZA 5KMWA 5CEBA 2Y2GA 1U60A 3O3VA 4IUKA 3ITAA 2EX8A 2XLNA 4EQ1A 3AGEA 5EECA 5F1GA 1I2WA 2L1MA 3LIFA 5GL9A 1IKGA 3ZNYA 3CWFA 1FCMA 3LGOA 1AWIA 3E4OA 3QNBA 4YINA 1K6RA 3WS5A 4GNUA 3GTCA 4YWZA 4E3KA 3MFDA 2ZM2A 3H82A 1BLHA 1L0GA 2HDUA 4EETB 1S6RA 5HSQA 3U4LP 3MXSA 2LB9A 2UWXA 3V5MA 3S1YA 4ZJ1A 2H5SA 2W0NA 4KZ3A 4X55A 3MZDA 3IF6C 2W3EA 4NETA 4ETXA 1GCEA 2J9PA 5HPFA 2EFXA 1G6AA 3FC7A 2UV0E 1K57A 4OLDA 1S67L 2K7SA 5CEDA 5TFQA 3WS4A 1MBLA 2VLGA 5FQMA 2V8FA 3ZG9B 1J3WA 3LR5A 2MJ6A 1XGIA 2VGLM 1CF0A 1ESIA 5GHXA 2Y2KA 3G2YA 5EM1A 2HPBA 4EEPA 5CECA 2ZC6B 3NC8A 2VV7A 4GJ4A 5TR7A 1LSWA 1YLTA 2XH9A 2L4RA 4LCLA 4DE2A 4R3AA 3MBZA 2RCXA 1SZVA 1PRQA 1VEUB 3FKWA 5EVIA 3TG9A 1H8YA 2VV8A 4FSFA 3VP2A 3NULA 4BL3A 3IH8A 3A3IA 1NYYA 1S1ZA 2Y2JA 4CJNA 4LLOB 1VQQA 1V9ZA 4S2NA 1WYCA 3UB7A 5M19A 4BLMA 3HUOA 2B02A 2Y2HA 1MWSA 4S2MA 3VFHA 3V67A 4BD0A 1TVFA 4I3AA 3FG8A 2W27A 2OWJA 1K4EA 3EGXC 3P98A 4G3WA 1CK3A 4Y3IA 2P04A 5DFXA 1OT6A 1NYMA 2P7JA 1ESUA 5AVEA 4JKTA 3OOVA 1F5MA 5FI6A 5TJJA 4EERA 1S0WA 2HDSA 4JF5A 3HL9A 3LEZA 3LR4A 2ZC3B 2H0YA 3ZCZA 2OAP1 2XA7M 1MKMA 2Y4AA 1P9WA 5L8MA 1K54A 2XRNA 5CX7A 3P01A 3NHQA 4NK3A 1XJ2A 4S2JA 1Y4OA 2KX6A 3ZNTA 3BEBA 1EI5A 3MKEA 4MNRA 4Y13A 2EXBA 4KENB 3Q07A 5LBRA 2H0TA 3MZEA 2B95A 5HDDA 3CITA 3HBRA 4KG5A 5HWVA 4FTXA 4S2PA 2ZLYA 1MC0A 3FPVA 4HJ3A 4GS9A 4LRXC 4Y5FA 3CPTB 3EQVA 3HREA 3UB5P 2WZZA 2QYBA 1SHVA 4MN7A 4JBFA 3WS1A 3BLSA 2KOIA 3IH9A 3RFBA 4JGOA 5J4EA 4S2OA 2GDNA 3T1XA 2QJ5A 4RYEA 3OPRA 4U3TA 1STZA 3DWKA 3UPOA 1SDEA 5F69A 3T1RA 3DW0A 4ZJ2A 4KZAA 4P6ZM 3SS3A 3GSGA 5F82A 1CI8A 3QHYA 3UE6A 1XA7A 4DXCA 2DNSA 4KG2A 3KX0X 3CI6A 1I2SA 3C7VA 5L07A 2E8JA 2XGNA 1FOFA 3SS4A 5TBMB 1OTEA 1KE3A 2JKFA 2V8CA 4DF6A 3E4QA 3NECA 5FQQA 4OVDA 4Q0JA 4HBUA 4X1MA 4WZ5C 5HAIA 3LR0A 4UA7A 1LL9A 2GNXA 3S7OA 3Q7ZA 4LV1A 3IF5A 1JWZA 4WL9A 5A8BA 3F1PA 1WA9A 4N1HA 3CPTA 1LLBA 4OH0A 3OPHA 1MZUA 2Y59A 5KZHA 1IYSA 2PDRA 4Z1WA 3ZG7B 2PU2A 1UWNX 3EGDC 3PYPA 2YKHA 3F1NB 4O01A 3LYXA 3FPWA 2VKSA 4NKPA 1H5XA 4OONA 2BLSA 1MY8A 2V1BA 2X71A 2JKRI 4WMCA 1VHMA 4X6TA 2G2WA 1FQGA 1T18A 4NXGA 4GD8A 4II7A 3QNCA 1FCNA 1F98A 1N4OA 3VOYA 1T1BA 4R4SA 5TBMA 2V20A 4CLCA 3LO7A 3QP1A 2HV1A 4DXBA 1Q2QA 3BQAA 5AJGA 3CG5A 4BENA 4PM8A 2J7VA 3AGFA 3IX4A 4KUKA 3PTEA 3ICYA 3NIAA 4JLFA 3TW8A 1W63Q 5F83A 4R70A 4DJ3A 1DY6A 5TGFA 3HLFA 4PKYG 5DF7A 1IFQA 3SH7A 2P9VB 1TDLA 1XJ6A 4X1LA 1ZG4A 1OMEA 1TDGA 2HP5A 5E2FA 5CRFA 3SH8A 2YKFA 3HLWA 1DRMA 1FSWA 4Q0HA 3LIEA 4OPZA 4ARZA 5K5BA 5A93A 1N9LA 3G34A 3LIAA 3BYDA 3NJAA 4I3JA 5AQAA 2O9BA 3IS2A 3VE3A 4EBNA 3V39A 4OP8A 3ZQ5A 3KSFA 1K6SA 1O07A 2CC1A 3A0RA 4O8GA 2QHKA 2XD1A 5IHVA 1X0OA 1L0FA 3UDIA 5M18A 3QP5A 3OZHA 5GLBA 3PAGA 2XROA 1NXYA 1BTLA 3DAVA 1BLCA 2FFYA 1K0KA 2J3WA 3M6BA 4WMCD 2OOLA 4HI4A 3B47A 3PBQA 2KLIA 3A3JA 1G28A 4MBKA 3OPPA 2FH5A 4DDYA 4PM5A 2V2FF 5C5KA 4OPQA 4M3KA 3NDGA 3T4TA 4H6JB 1H8ZA 4IVIA 3IF6A 3MJQA 5FI2A 1FIKA 4BBUA 3GRJA 3MZFA 5E43A 4P6BA 2X02A 4XUXA 3BFFA 1TS7A 5F5YA 4E3JA 2Y2MA 4Y7PA 1HLUP 2V1AA 3V50A 4BMWA 1IYPA 3KSGA 4OQIA 2HJEA 4RQ9A 4HH3A 4E3LA 4EXOA 5HARA 1QMEA 4L0LA 3K2NA 2ZQ9A 3ZG5A 4MCWA 4XT2A 4BBTA 5F1FA 1HVBA 1PNEA 3G31A 3TOIA 1C3BA 2QMIA 2PHYA 3ZVTA 1WYBA 3LR3A 2QZ6A 3NCKA 1FCOA 3BFCA 4H6JA 5J8XA 2ZC5B 1SCWA 2OAQ1 4G3KA 1IOUA 2EWVA 1ACFA 3CHWP 4LRYC 1OTDA 3D4FA 1DP6A 4GHIB 4DE1A 3UDXA 1IELA 4H8RA 1F9IA 2PYPA 3ZFZA 2ZOIA 2J8YA 3ULFA 5F68A 3N4IA 1PIOA 1KGEA 5EVEA 5AQ7A 1YT4A 3PBSA 4FOFA 1GSVA 4RX2A 4BWIA 3UPPA 3GR2A 2JHEA 4WF0A 1I5QA 1DJBA 1L2SA 1AXBA 5EVIB 4E04A 3SW1A 1NLYA 3L9KA 4OOMA 3FWLA 1BZAA 2PBDP 3TJZC 1D7EA 3M2JA 5GLDA 4EBLA 2ZQDA 2WKHA 2Q0OA 4OPYA 5GLAA 4KZ7A 3IXBA 3CUEC 4QPRA 3N6IA 4QY6A 3WWXA 4Y0TA 3CZDA 1K38A 4FH2A 1XX2A 4GHIA 5CERA 4Y0UA 1BULA 3T4JA 2XR0A 3S7PA 3VSKA 5AVFA 4GB7A 4GOGA 5JYOA 1H0MA 3B42A 4E3NA 2M1CA 5HD3A 1H3QA 2VGKA 3DTMA 2HF6A 1LHYA 2PBYA 3VP0A 1ALQA 3JYIA 1OJGA 3BM6A 5JYPA 3NOUC 3UE3A 1M40A 3MQQA 3H9WA 1IYOA 2ACGA 4R3JA 3GDIA 1MPLA 5HWWA 3AGDA 5EM0A 1S66L 2RL3A 3B3XA 1ZKJA 3DWZA 2J3TD 5F6AA 2W3HA 2XFSA 4R38A 4QWOA 3HLEA 4OQGA 4GDNA 2DMWA 1Q2PA 3BY9A 3W4PA 3BRMA 5HAPA 4JXVA 4HP4A 4BL2A 3O87A 2Z2LB 4IBXA 2Q9MA 1IEMA 3V3SA 5DF9A 1YM1A 3IQAA 2ZQ7A 4GS9B 1KE0A 1JWVA 4Q0IA 4EV4A 3LIBA 4MDZA 3IHBA 3VFFA 3LICA 4RVAA 3W8KA 3IBRA 1GHPA 3A3DA 4MLLA 5BOHA 1W79A 4DDSA 1LI0A 3N8LA 3MFXA 4MBHA 4HOIA 4NEED 3T4LA 1RGYA 2J3TC 2O99A 1E3UA 5HD5A 5DJTA 2BG1A 5FQ9A 1V9YA 5FQKA 3G4PA 4PKYA 4ZJ3A 3A0SA 3N7WA 1UGUA 3O88A 5FAPA 3MR0A 3KYQA 4DJ2A 5FEFA 2R78A 1YLPA 1NZUA 4LV3A 2WADA 3F1PB 3F1OA 3A3FA 5EUAA 4MBFA 5EVID 3DTKA 3NOPC 4WLAA 2A3UA 3O86A 5FDSA 1RGZA 1XKZA 3D72A 3WS2A 1PWDA 5FQIA 4JF4A 3ZVWA 4R23A 3IX3A 5DJUA 3BLMA 4O7DA 4WZ4A 4UEYA 2GZAA 2B18A 1K4FA 3IX8A 3E98A 1TS6A 1YKDA 1L0DA 1OTAA 1M6KA 4YNRA 4B4XA 1CI9A 2V9AA 4QB8A 4ZBEA 2PR5A 4CLCB 2JKRM 2HDRA 3VV4A 2D02A 1OTBA 1O7EA 1N9OA 3A0VA 5CGXA 1LL8A 5HAQA 4FUWA 2FFFB 3C5AA 4Y0OA 3QP4A 4E3OA 1RP5A 4I38A 2E8IA 3MF0A 2NUPC 2XDMA 1YMSA 5E2GA 4OOYA 1SDNA 1LT0A 1E3UD 4EUVA 2Y2OA 2ZQAA 3C7UA 4ZRRA 4JF6A 4I39A 4S2NC 4CLCE 1XGJA 2JN7A 4MEZA 1YLJA 4X56A 3W2ZA 1YPRA 4KQQA 1K55A 5FEGA 3WS0A 2PD7A 5E2EA 1KDSA 4EWFA 2VJWA 1EWZA 5DFYA 3UPNA 4EU0A 1KGFA 1EROA 4ARZB 3C8CA 4KUOA 1FSYA 3UO9A 3G32A 2P08A 3WRTA 3IS2B 4NG2A 4U0XA 1XPBA 3BFGA 2ZMAA 3QP6A 3NBLA 1RCJA 3MMHA 4HHDA 2JCHA 4WELA 3T4OA 1XP4A 3OCLA 2K2NA 5HDCA 1PW1A 2Y91A 4A5RA 2C5WB 2HP9A 4R0QA 5AQBA 3R7WA 4PM6A 3WRZA 4DRTA 2ZMVA 2PR6A 4IHQA 1GSXA 3PHYA 3SOIA 4QY5A 2ZMFA 1KOUA 3G2ZA 5FI7A 4EBPA 3LY4A 1P9RA 1KVMA 5DKKA 1FILA 3IF6B 2INWA 4K0XA 1XFQA 3EOIA 3UMDA 1PWCA 3KYEA 5KIZA 1DP9A 2Q9NA 5FDHA 1TS0A 2Z6DA 5CGSA 3FZCA 3D3OA 3L7HA 1YLYA 1L3LA 4GD6A 4Y15A 3PBTA 3RH8B 3Q7VB 2J9OA 5DF8A 3EEAA 1YMXA 3MKFA 1BLPA 2Y2IA 1H8MA 4QHCA 3W4QA 4Z9QA 1BT5A 2FZ0A 4WEKA 4XT2B 2OSUA 3MQ0A 2Z2MB 3MSHA 4UQIS 1ES5A 5FQJA 4EEUA 2W3GA 4OPRA 5HDSA 4ZDXA 2VK3A 3C2WA 3UB6A 4KQDA 4NXEA 1E4DA 5IT5A 4R6LA 3C4PA 4BQMA 4JGQA 3UN7A 2IWCA 2JKTM 4E6WA 3IHAA 4CLCD 5DTTA 3DTIA 4IJGA 4CPKA 4UA6A 5HWTA 3ZG8B 1NRFA 3T4SA 2D01A 2XQZA 5J7EA 1NZOA 1UWPX 2WUQA 3TSGA 1PFLA 1CQAA 3E4PA 4JXSA 4D2OA 4DE3A 4C3QA 3T12B 3H7WA 2QWSA 4XUZA 2PAVP 2Y2QA 2WGWB 5A91A 3ZG0A 2WKPA 2JBFA 5U47A 2AVXA 4S2LA 3Q7VA 4MMNA 4GZBA 3Q1FA 3P7NA 1KVLA 4K91A 2PYRA 1ZTUA 1OPXA 4K0WA 3TRCA 2W1TA 2A49A 2A24B 2JKTI 4R4RA 1MKIA 5J3WA 4GN2A 3E0YA 3MXQA 1YSPA 4CLCC 3LI8A 1T1AA 4R1GA 4ZAMA 2EA9A 2WKIA 4WEJA 1SKOB 4YFMA 1HD8A 2I72A 2VGLS 1BLSA 1F2KA 2ZBBA 1IYQA 1JVJA 2ZC4B 1ZC2A 2WZXA 3T4KA 3I7JA 1DJAA 4IVKA 3EWKA 4LFUA 3O5YA 3T1QB 3OCNA 2BTFP 2XD5A 1LI9A 3MQOA 2EX2A 2HJ9C 3PBRA 2W1RA 3UB8A 3QP8A 3HUNA 2WGWA 1ES4A 4JGPA
chains in the Genus database with same CATH topology
3HJKA 2WKRA 3S7NA 3LR0A 4GS9B 2I9VA 4GLQA 4Q0IA 4CQHA 3LIBA 2GNXA 1S1YA 4MDZA 3S7OA 3VOLA 3S7QA 3LICA 2IA2A 3PXPA 3IBRA 4L9EA 1OJ5A 5HZHA 4NXBA 4L9FA 4WL9A 5A8BA 5G4YA 1XJ3A 3K3DA 3F1PA 1WA9A 2A24A 4PAUA 4EESA 1MZUA 4HP9A 2V0WA 4EW7A 3NOTC 2PDRA 4Z1WA 1P0ZA 3MFXA 1LSXA 3CUEA 3T50A 4DN0A 1UWNX 3EGDC 3C38A 2J80A 3PYPA 4HOIA 2YKHA 3F1NB 3JVVA 4NEED 3TE8A 4O01A 2QKPA 3LYXA 3FPWA 3T4LA 4BBVA 2VKSA 4NKPA 1GSWA 2J3TC 2Y8HA 3GECA 4I5SA 2O99A 2EWWA 5HD5A 5DJTA 4DMZA 3KYZA 2V1BA 1ZHHB 1V9YA 3LUQA 2JKRI 2Z6CA 1JNUA 1VHMA 4K08A 4PKYA 3UB9A 4I3IA 1XFNA 1T18A 4NXGA 3A0SA 5G4ZA 4II7A 1UGUA 2O9CA 1F98A 3MR0A 1T1BA 3RTYA 2PD8A 2VZWA 2XA7S 3KYQA 4DJ2A 5TBMA 4CLCA 2NUTC 3EEHA 2R78A 2HV1A 4B93A 1P97A 3F1PB 4M4XA 5HPIA 1W63M 3BQAA 5AJGA 3F1OA 1DP8A 2G7UA 3IBJA 4KUKA 3ICYA 1G6OA 1YAXA 3NOPC 4WLAA 3TW8A 2VA0A 1W63Q 4R70A 3D72A 1YSQA 4DJ3A 3LFVA 1S4RA 2PT7A 4PKYG 5DJUA 1T19A 1IFQA 4UEYA 2GZAA 2QJ7A 2B18A 4BJPA 3B33A 3H82B 3E98A 4MN5A 1TS6A 1XJ6A 3R4KA 1YKDA 2GJ3A 4AFIA 1OTAA 4KQOA 4YNRA 1XJ4A 3U2AA 2HGVA 2YKFA 2V9AA 1DRMA 2PR5A 4CLCB 2JKRM 3CAXA 4ETZA 2WKQA 4Q0HA 3VV4A 2D02A 1OTBA 3HJIA 1N9OA 3A0VA 1LL8A 1OTIA 4P6ZS 2Y79A 3LIEA 3OBFA 4ARZA 5K5BA 2K31A 5IU1A 3DBAA 4NXFA 1N9LA 3F1OB 4LRZE 3LIAA 4F3LB 4I38A 4ME4A 4UQIM 3MF0A 5DKLA 2NUPC 3NJAA 4O0PA 3BWLA 4I3JA 4JGRA 4PHTA 2O9BA 3IS2A 3ZYTA 1N9NA 1BYWA 3VE3A 3ZQ5A 2M7UA 3KSFA 4IUHA 3A0RA 4IUKA 4O8GA 2QHKA 1X0OA 1LT0A 4EUVA 1TD5A 4EQ1A 2OWHA 2XROA 4ZRRA 2L1MA 4I39A 2J3WA 3LIFA 2OOLA 4HI4A 3B47A 3PBQA 2KLIA 1G28A 3CWFA 4GCZA 2FH5A 3UMEA 4CLCE 5KSHA 2JN7A 3E4OA 3W2ZA 4HJ6A 4YWZA 1NWZA 5C5KA 2PD7A 4YOFA 3H82A 3T4TA 2VJWA 4H6JB 2VX8A 5DFYA 3MJQA 4EETB 4EU0A 5HSQA 4ARZB 3C8CA 4BBUA 4KUOA 2W3DA 5IS1A 1D06A 2LB9A 1S4SA 2P08A 3PBOA 3KO6A 3IS2B 1TS8A 2W0NA 1TS7A 5F5YA 2W3EA 4ETXA 2V1AA 4F3LA 3MMHA 4HHDA 4WELA 4BMWA 3T4OA 3OCLA 5HPFA 3KSHA 2K2NA 5HDCA 3KSGA 3FC7A 3HCYA 2HJEA 1S67L 2K7SA 3C30A 2CMNA 4RQ9A 3R7WA 3VE4A 4HH3A 2VLGA 4EXOA 1TF1A 2ZMVA 2PR6A 4IHQA 4L0LA 1GSXA 3LR5A 3K2NA 1NRJA 3PHYA 2ZMFA 2MJ6A 2M7VA 4MCWA 2VGLM 4XT2A 4BBTA 2VV6A 1KOUA 3EQUA 3BY8A 1LSVA 4EEPA 1P9RA 5DKKA 2VV7A 2V0UA 4GJ4A 1LSWA 2L4RA 4R3AA 1VB6A 2PHYA 2INWA 3LR3A 3BW6A 1XFQA 1Y28A 4LPZA 3EOIA 4L9GA 3UMDA 5KIZA 1DP9A 4H6JA 1TS0A 3G6OA 2Z6DA 2VV8A 4FSFA 2OAQ1 4HY8A 3BQ8A 4G3KA 5HL6A 1IOUA 2W3FA 2EWVA 3JVUA 4HJ4A 3D3OA 4LRYC 1OTDA 4G3VA 1DP6A 3PBTA 3RH8B 1S1ZA 4LLOB 4GHIB 1V9ZA 4HIAA 3BJNA 4Y2FA 3EEAA 3R7WB 3UB7A 1H8MA 2GX5A 1F9IA 2B02A 2PYPA 2O9AA 2FZ0A 2ZOIA 4WEKA 3OC2A 3V67A 4XT2B 3ULFA 4OOLA 5F68A 3MQ0A 4I3AA 3FG8A 4UQIS 4WN5A 2W27A 2OWJA 4EEUA 2W3GA 3PR6A 3EGXC 4G3WA 4MN6A 3PBSA 1OT9A 4Y3IA 4FOFA 5HDSA 1GSVA 2P04A 4BWIA 5DFXA 3C2WA 3UB6A 4KQDA 1OT6A 4NXEA 2P7JA 1NLZA 5AVEA 5IT5A 2JHEA 3OLOA 4R6LA 5MC7A 4WF0A 3OOVA 1F5MA 4JGQA 5TJJA 4EERA 3PBNA 2JKTM 4E04A 3LIDA 4CLCD 3SW1A 1NLYA 4OOMA 4IJGA 5HWTA 3LR4A 4B9OA 3T4SA 2D01A 3TJZC 2OAP1 1D7EA 2XA7M 1MKMA 1T1CA 1P9WA 5L8MA 5J7EA 3CLOA 2XRNA 1UWPX 2XSSA 3E4PA 5CX7A 3P01A 4GW9A 3H7WA 2O0YA 2QWSA 3CUEC 3NHQA 4HNBA 4QPRA 1XJ2A 2WKPA 2KX6A 4HQAA 4MMNA 3LI9A 4GHIA 5LBRA 3P7NA 4WUJA 5HDDA 3CITA 3T4JA 5HWVA 2PYRA 3S7PA 1ZTUA 1OPXA 5FL3A 3TRCA 5AVFA 2W1TA 5I5LA 1MC0A 3FPVA 4HJ3A 2A24B 4GS9A 4LRXC 4Y5FA 1EW0A 2H28A 3B42A 2JKTI 2ZOHA 2VEAA 3EQVA 2M1CA 5J3WA 3E0YA 2QYBA 3MXQA 5HD3A 1H3QA 4MN7A 2HF6A 1YSPA 4CLCC 3LI8A 1T1AA 2KOIA 3RFBA 2LB5A 1OJGA 4JGOA 2EA9A 4HH2A 5J4EA 3NOUC 3UE3A 4WEJA 2A2LA 2QJ5A 2VGLS 3MQQA 3H9WA 5EFWA 2ZBBA 1STZA 3K3CA 5F69A 2BASA 3GDIA 5HWWA 3T4QA 3F1NA 1S66L 4P6ZM 3T4KA 3H7WB 1ODVA 3EWKA 3UE6A 2J3TD 3O5YA 5F6AA 2W3HA 2L0WA 3OCNA 3KX0X 3CI6A 2KDKA 3MQOA 4R38A 3KSIA 2HJ9C 3PBRA 3BY9A 2DMWA 2W1RA 3UB8A 5TBMB 1OTEA 4HP4A 4JGPA 3E4QA 4Q0JA 5DF9A 2W1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJK A;  2WKR A;  4GS9 B;  2I9V A;  3LIB A;  1S1Y A;  3VOL A;  3LIC A;  3IBR A;  4L9E A;  1OJ5 A;  5HZH A;  4NXB A;  4L9F A;  4WL9 A;  5A8B A;  5G4Y A;  1XJ3 A;  3K3D A;  3F1P A;  1WA9 A;  2A24 A;  4EES A;  1MZU A;  4HP9 A;  2V0W A;  4EW7 A;  3NOT C;  2PDR A;  1P0Z A;  3MFX A;  1LSX A;  3T50 A;  1UWN X;  2J80 A;  3PYP A;  4HOI A;  2YKH A;  3F1N B;  2QKP A;  3LYX A;  4BBV A;  1GSW A;  3GEC A;  4I5S A;  5HD5 A;  5DJT A;  2V1B A;  1V9Y A;  3LUQ A;  2Z6C A;  1JNU A;  4PKY A;  4K08 A;  3UB9 A;  4I3I A;  1XFN A;  1T18 A;  4NXG A;  3A0S A;  5G4Z A;  1UGU A;  1F98 A;  3MR0 A;  3RTY A;  1T1B A;  2PD8 A;  4DJ2 A;  5TBM A;  3EEH A;  2R78 A;  2HV1 A;  1P97 A;  3F1P B;  4M4X A;  3F1O A;  1DP8 A;  4KUK A;  3ICY A;  3NOP C;  4WLA A;  4R70 A;  3D72 A;  4DJ3 A;  1S4R A;  4PKY G;  5DJU A;  1T19 A;  2QJ7 A;  3B33 A;  3H82 B;  4MN5 A;  1TS6 A;  1XJ6 A;  2GJ3 A;  1OTA A;  1XJ4 A;  2YKF A;  2V9A A;  1DRM A;  2PR5 A;  3CAX A;  2WKQ A;  2D02 A;  1OTB A;  3HJI A;  1N9O A;  3A0V A;  1LL8 A;  1OTI A;  3LIE A;  5IU1 A;  4NXF A;  1N9L A;  3F1O B;  4LRZ E;  3LIA A;  4F3L B;  4I38 A;  5DKL A;  3NJA A;  3BWL A;  4I3J A;  4JGR A;  3IS2 A;  1N9N A;  1BYW A;  3VE3 A;  3ZQ5 A;  3A0R A;  2QHK A;  1X0O A;  1LT0 A;  4EQ1 A;  2OWH A;  2L1M A;  4I39 A;  3LIF A;  2OOL A;  4HI4 A;  1G28 A;  3CWF A;  4GCZ A;  3UME A;  2JN7 A;  3E4O A;  4HJ6 A;  4YWZ A;  1NWZ A;  2PD7 A;  3H82 A;  4H6J B;  4EET B;  3MJQ A;  5HSQ A;  3C8C A;  4BBU A;  4KUO A;  5IS1 A;  1D06 A;  1S4S A;  3IS2 B;  1TS8 A;  2W0N A;  1TS7 A;  5F5Y A;  2V1A A;  4F3L A;  4HHD A;  5HDC A;  3FC7 A;  1S67 L;  2K7S A;  2CMN A;  4RQ9 A;  3VE4 A;  4HH3 A;  2VLG A;  4EXO A;  2PR6 A;  1GSX A;  3PHY A;  4XT2 A;  4BBT A;  2VV6 A;  1KOU A;  3BY8 A;  1LSV A;  4EEP A;  5DKK A;  2VV7 A;  2V0U A;  1LSW A;  2L4R A;  4R3A A;  1VB6 A;  2PHY A;  2INW A;  1XFQ A;  1Y28 A;  4LPZ A;  4L9G A;  3UMD A;  5KIZ A;  1DP9 A;  4H6J A;  1TS0 A;  3G6O A;  2Z6D A;  2VV8 A;  4HY8 A;  4HJ4 A;  4LRY C;  1OTD A;  1DP6 A;  3RH8 B;  1S1Z A;  4LLO B;  4GHI B;  1V9Z A;  4HIA A;  3UB7 A;  2B02 A;  1F9I A;  2PYP A;  2ZOI A;  4XT2 B;  3ULF A;  5F68 A;  4I3A A;  3FG8 A;  4WN5 A;  2W27 A;  2OWJ A;  4EEU A;  4MN6 A;  1OT9 A;  5HDS A;  1GSV A;  3C2W A;  3UB6 A;  4KQD A;  1OT6 A;  4NXE A;  2P7J A;  5AVE A;  2JHE A;  3OLO A;  4R6L A;  4WF0 A;  4JGQ A;  4EER A;  4E04 A;  3LID A;  3SW1 A;  5HWT A;  4B9O A;  2D01 A;  1D7E A;  1T1C A;  5J7E A;  3CLO A;  1UWP X;  3E4P A;  4GW9 A;  3H7W A;  2QWS A;  3NHQ A;  4HNB A;  1XJ2 A;  2WKP A;  2KX6 A;  4HQA A;  3LI9 A;  4GHI A;  4WUJ A;  3P7N A;  5HDD A;  5HWV A;  2PYR A;  5AVF A;  5I5L A;  4HJ3 A;  2A24 B;  4GS9 A;  4LRX C;  1EW0 A;  2H28 A;  2ZOH A;  2VEA A;  5J3W A;  2M1C A;  3MXQ A;  5HD3 A;  3LI8 A;  1T1A A;  1OJG A;  4JGO A;  2EA9 A;  4HH2 A;  5J4E A;  3NOU C;  2QJ5 A;  3MQQ A;  3H9W A;  5EFW A;  2ZBB A;  3K3C A;  5F69 A;  2BAS A;  3GDI A;  5HWW A;  3F1N A;  1S66 L;  3H7W B;  1ODV A;  3EWK A;  3UE6 A;  5F6A A;  2L0W A;  3KX0 X;  2KDK A;  3MQO A;  4R38 A;  3BY9 A;  3UB8 A;  5TBM B;  1OTE A;  4HP4 A;  4JGP A;  3E4Q A; 
#chains in the Genus database with same CATH topology
 2WGV A;  1ZG6 A;  5FAT A;  4X68 A;  2DCF A;  4GLQ A;  4CQH A;  2HZ5 A;  1S1Y A;  2X01 A;  3VOL A;  2C6W B;  4P85 A;  3PXP A;  1OJ5 A;  1XA1 A;  5HZH A;  2HP6 A;  4NXB A;  4L9F A;  5G4Y A;  3K3D A;  2A24 A;  3OPL A;  1ERQ A;  2XK1 A;  4C6Y A;  3ISG A;  4HP9 A;  3NOT C;  1P0Z A;  3LEQ A;  4LV0 A;  3T50 A;  4DN0 A;  2EFU A;  4OLG A;  2QKP A;  4BBV A;  1FR6 A;  1SKO A;  5CTN A;  5DVA A;  4HEF A;  3IWI A;  2Y8H A;  1VET B;  2Y2L A;  3KYZ A;  3LUQ A;  2QPN A;  3HVF A;  2Z6C A;  4K08 A;  2WK0 A;  3UB9 A;  1XFN A;  4PM9 A;  4P87 A;  3GV9 A;  5G4Z A;  5I94 A;  2O9C A;  5CHU A;  3UY6 A;  2PD8 A;  2VZW A;  2XA7 S;  5M1A A;  3N8S A;  3EEH A;  3GVB A;  4N92 A;  2XEP A;  4GKU A;  3IXH A;  5FAQ A;  4ESP A;  4M4X A;  5A92 A;  1W63 M;  1DP8 A;  4N1X A;  5DTS A;  1G6O A;  4JXG A;  1E25 A;  1DJC A;  1YSQ A;  3LFV A;  2HDQ A;  4F94 A;  1S4R A;  4EQI A;  2WAF A;  2OV5 A;  4C75 A;  1T19 A;  3G35 A;  1MWT A;  5GHZ A;  4BJP A;  3BFD A;  2JE5 A;  1Y54 A;  3DTE A;  4QU3 A;  1VET A;  4WZ5 A;  4BD1 A;  4UA9 A;  3N8R A;  1JWP A;  3U2A A;  1KDW A;  3W4O A;  2ZL1 B;  3C4O A;  4ETZ A;  4EUZ A;  4S2K A;  3G30 A;  1OTI A;  5EOE A;  4P6Z S;  3OBF A;  3PAE A;  2K31 A;  1ONG A;  4JXW A;  3DBA A;  4NXF A;  3F1O B;  3FKV A;  4LRZ E;  5L10 A;  4F3L B;  3VP4 A;  4FH4 A;  5DKL A;  4LV2 A;  1MWU A;  4O0P A;  1W8Y A;  4JGR A;  2WGI A;  3ZYT A;  1N9N A;  1BYW A;  4JPM A;  3HLB A;  1YQS A;  2M7U A;  2ZJ9 A;  3QP2 A;  4IUH A;  3V3R A;  3SZT A;  2H10 A;  3SH9 A;  2JKG A;  2WYX A;  1TD5 A;  2OWH A;  5G18 A;  1LL5 A;  4GCZ A;  3UME A;  5KSH A;  3A3E A;  3ITB A;  4B88 A;  4HJ6 A;  4D60 A;  1NWZ A;  3BFE A;  4YOF A;  2ZC7 A;  2VX8 A;  1ERM A;  2R9W A;  1N9B A;  1SKF A;  2ZD8 A;  1VEU A;  2W3D A;  5IS1 A;  1D06 A;  2ZL1 A;  4KG6 A;  3S4X A;  1S4S A;  4GDB A;  3PBO A;  3KO6 A;  1TS8 A;  1CEG A;  2DRW A;  4S2I A;  1W8Q A;  3CMZ A;  4RX3 A;  4F3L A;  3E2L A;  5FAO A;  3KSH A;  2ZQC A;  4IBR A;  3VOZ A;  3HCY A;  4WBG A;  3C30 A;  3FV7 A;  2CMN A;  3VE4 A;  3ZHH A;  4HES A;  1TF1 A;  1Z6F A;  1NRJ A;  2M7V A;  3GMW A;  2VV6 A;  4B4Z A;  1TEM A;  2IWD A;  3EQU A;  3BY8 A;  1HTZ A;  4FCF A;  1LSV A;  1K57 C;  2V0U A;  3LCE A;  3P09 A;  4UHU A;  1VB6 A;  3NDE A;  2XFT A;  1GHI A;  1ES3 A;  3BW6 A;  4ID4 A;  2XF3 A;  5L2F A;  5EOO A;  1Y28 A;  4LPZ A;  4QJG A;  4R3B A;  4L9G A;  2V1Z A;  4X53 A;  3MXR A;  2Y55 A;  1W7F A;  5FA7 A;  3G6O A;  3Q82 A;  4HY8 A;  3BQ8 A;  1L0E A;  1KE4 A;  5HL6 A;  2W3F A;  3JVU A;  5CXW A;  1WE4 A;  1PWG A;  4HJ4 A;  3D9Y A;  4G3V A;  4KZ4 A;  5EVI C;  1VM1 A;  3IWQ A;  4HIA A;  3BJN A;  4Y2F A;  3R7W B;  1W5D A;  1GHM A;  2OLV A;  2GX5 A;  2Y2P A;  2R9X A;  3JPU A;  5KSC A;  2O9A A;  5FAS A;  3UDF A;  3OC2 A;  3RXX A;  4LEN A;  4OOL A;  3VMA A;  4WN5 A;  3PR6 A;  3UE1 A;  1MWR A;  4KZ9 A;  4MN6 A;  1OT9 A;  2WAE A;  3LY3 A;  1D1J A;  1GA0 A;  1NJ4 A;  1NLZ A;  3OLO A;  4OP5 A;  5MC7 A;  3PBN A;  1CEF A;  3LID A;  4LCM A;  3E2K A;  4B9O A;  2IWB A;  3HLD A;  4Y17 A;  5EVL A;  5L09 A;  4KZ6 A;  1T1C A;  3CLO A;  2XSS A;  1PZP A;  4GW9 A;  2PU4 A;  5A90 A;  2O0Y A;  4HNB A;  3IXG A;  4QD4 A;  1JTD A;  5EE8 A;  4HQA A;  1J9M A;  3LI9 A;  1K54 C;  4WUJ A;  2OLU A;  1ES2 A;  3UE0 A;  3RXW A;  3HLG A;  1PYY A;  5FL3 A;  5AQ9 A;  3IT9 A;  5I5L A;  1PW8 A;  1EW0 A;  2H28 A;  1K56 A;  2ZOH A;  2VEA A;  3SS5 A;  3GQZ A;  1QMF A;  3ZDJ A;  1G68 A;  3RJU A;  4UAA A;  2LB5 A;  3UNW A;  4HH2 A;  4KZ5 A;  5CHJ A;  2A2L A;  3S22 A;  1A0K A;  5GHY A;  5EFW A;  3K3C A;  1YLZ A;  2BAS A;  3T4Q A;  3F1N A;  1GA9 A;  4P0M A;  3H7W B;  1ODV A;  3MS6 A;  5EPH A;  4FD8 A;  2L0W A;  1ONH A;  3M2K A;  2KDK A;  3KSI A;  2G2U A;  2ZM0 A;  5HX9 A;  2EXA A;  4OKP A;  5EV0 A;  2W1T B;  5CGW A;  3HJK A;  2WKR A;  3S7N A;  1MXO A;  2ZQ8 A;  2I9V A;  4X25 A;  3S7Q A;  2EX6 A;  1XXM A;  2IA2 A;  4L9E A;  4E3I A;  3M6H A;  4PPR A;  1XJ3 A;  1NY0 A;  5HFO A;  4PAU A;  4EES A;  4IED A;  3VSL A;  2V0W A;  4EW7 A;  1CJF A;  4U0T A;  3BEC A;  4LGW A;  1PZO A;  1LSX A;  1KGG A;  3CUE A;  4WYY A;  1PI5 A;  2Y2N A;  3C38 A;  4KQR A;  2J80 A;  5CTM A;  3JVV A;  3TE8 A;  3CJM A;  1IKI A;  1Z09 A;  1GSW A;  4X69 A;  3GEC A;  4I5S A;  2EWW A;  1PI4 A;  4DMZ A;  1YLW A;  1ZHH B;  4N9K A;  4OQ0 A;  4PMA A;  1JNU A;  4OQH A;  2P9V A;  4I3I A;  1G5U A;  3HUM A;  4ZTK A;  2JC7 A;  3RTY A;  1K56 D;  3HLC A;  1K55 C;  2NUT C;  4KZB A;  5D3O A;  4E6X A;  5HW3 A;  4B93 A;  2EX9 A;  3T1S A;  1P97 A;  5E2H A;  5CHM A;  5HPI A;  1FR1 A;  3VP3 A;  1BUE A;  1HZO A;  4PM7 A;  2G7U A;  4DE0 A;  3IBJ A;  4RA7 A;  2WKE A;  5HL1 A;  3VP1 A;  1YAX A;  2VA0 A;  3NY4 A;  3NI9 A;  4HBT A;  3IWO A;  3IXD A;  2B5R A;  4WM9 A;  2PT7 A;  1BSG A;  1JTG A;  2QJ7 A;  3B33 A;  3H82 B;  4MN5 A;  1K25 A;  3R4K A;  5FSR A;  2VGJ A;  2GJ3 A;  4AFI A;  4E3M A;  4KQO A;  4N9L A;  1XJ4 A;  2HGV A;  2P74 A;  3Q81 A;  3CAX A;  2WKQ A;  3HJI A;  3ZGA B;  5GLC A;  5DTK A;  4Q8I A;  2Y79 A;  2ZM8 A;  5IU1 A;  4XXR A;  2PRF A;  4DKI A;  4ME4 A;  4UQI M;  3BWL A;  4KZ8 A;  4PHT A;  3FYZ A;  5KMW A;  5CEB A;  2Y2G A;  1U60 A;  3O3V A;  4IUK A;  3ITA A;  2EX8 A;  2XLN A;  4EQ1 A;  3AGE A;  5EEC A;  5F1G A;  1I2W A;  2L1M A;  3LIF A;  5GL9 A;  1IKG A;  3ZNY A;  3CWF A;  1FCM A;  3LGO A;  1AWI A;  3E4O A;  3QNB A;  4YIN A;  1K6R A;  3WS5 A;  4GNU A;  3GTC A;  4YWZ A;  4E3K A;  3MFD A;  2ZM2 A;  3H82 A;  1BLH A;  1L0G A;  2HDU A;  4EET B;  1S6R A;  5HSQ A;  3U4L P;  3MXS A;  2LB9 A;  2UWX A;  3V5M A;  3S1Y A;  4ZJ1 A;  2H5S A;  2W0N A;  4KZ3 A;  4X55 A;  3MZD A;  3IF6 C;  2W3E A;  4NET A;  4ETX A;  1GCE A;  2J9P A;  5HPF A;  2EFX A;  1G6A A;  3FC7 A;  2UV0 E;  1K57 A;  4OLD A;  1S67 L;  2K7S A;  5CED A;  5TFQ A;  3WS4 A;  1MBL A;  2VLG A;  5FQM A;  2V8F A;  3ZG9 B;  1J3W A;  3LR5 A;  2MJ6 A;  1XGI A;  2VGL M;  1CF0 A;  1ESI A;  5GHX A;  2Y2K A;  3G2Y A;  5EM1 A;  2HPB A;  4EEP A;  5CEC A;  2ZC6 B;  3NC8 A;  2VV7 A;  4GJ4 A;  5TR7 A;  1LSW A;  1YLT A;  2XH9 A;  2L4R A;  4LCL A;  4DE2 A;  4R3A A;  3MBZ A;  2RCX A;  1SZV A;  1PRQ A;  1VEU B;  3FKW A;  5EVI A;  3TG9 A;  1H8Y A;  2VV8 A;  4FSF A;  3VP2 A;  3NUL A;  4BL3 A;  3IH8 A;  3A3I A;  1NYY A;  1S1Z A;  2Y2J A;  4CJN A;  4LLO B;  1VQQ A;  1V9Z A;  4S2N A;  1WYC A;  3UB7 A;  5M19 A;  4BLM A;  3HUO A;  2B02 A;  2Y2H A;  1MWS A;  4S2M A;  3VFH A;  3V67 A;  4BD0 A;  1TVF A;  4I3A A;  3FG8 A;  2W27 A;  2OWJ A;  1K4E A;  3EGX C;  3P98 A;  4G3W A;  1CK3 A;  4Y3I A;  2P04 A;  5DFX A;  1OT6 A;  1NYM A;  2P7J A;  1ESU A;  5AVE A;  4JKT A;  3OOV A;  1F5M A;  5FI6 A;  5TJJ A;  4EER A;  1S0W A;  2HDS A;  4JF5 A;  3HL9 A;  3LEZ A;  3LR4 A;  2ZC3 B;  2H0Y A;  3ZCZ A;  2OAP 1;  2XA7 M;  1MKM A;  2Y4A A;  1P9W A;  5L8M A;  1K54 A;  2XRN A;  5CX7 A;  3P01 A;  3NHQ A;  4NK3 A;  1XJ2 A;  4S2J A;  1Y4O A;  2KX6 A;  3ZNT A;  3BEB A;  1EI5 A;  3MKE A;  4MNR A;  4Y13 A;  2EXB A;  4KEN B;  3Q07 A;  5LBR A;  2H0T A;  3MZE A;  2B95 A;  5HDD A;  3CIT A;  3HBR A;  4KG5 A;  5HWV A;  4FTX A;  4S2P A;  2ZLY A;  1MC0 A;  3FPV A;  4HJ3 A;  4GS9 A;  4LRX C;  4Y5F A;  3CPT B;  3EQV A;  3HRE A;  3UB5 P;  2WZZ A;  2QYB A;  1SHV A;  4MN7 A;  4JBF A;  3WS1 A;  3BLS A;  2KOI A;  3IH9 A;  3RFB A;  4JGO A;  5J4E A;  4S2O A;  2GDN A;  3T1X A;  2QJ5 A;  4RYE A;  3OPR A;  4U3T A;  1STZ A;  3DWK A;  3UPO A;  1SDE A;  5F69 A;  3T1R A;  3DW0 A;  4ZJ2 A;  4KZA A;  4P6Z M;  3SS3 A;  3GSG A;  5F82 A;  1CI8 A;  3QHY A;  3UE6 A;  1XA7 A;  4DXC A;  2DNS A;  4KG2 A;  3KX0 X;  3CI6 A;  1I2S A;  3C7V A;  5L07 A;  2E8J A;  2XGN A;  1FOF A;  3SS4 A;  5TBM B;  1OTE A;  1KE3 A;  2JKF A;  2V8C A;  4DF6 A;  3E4Q A;  3NEC A;  5FQQ A;  4OVD A;  4Q0J A;  4HBU A;  4X1M A;  4WZ5 C;  5HAI A;  3LR0 A;  4UA7 A;  1LL9 A;  2GNX A;  3S7O A;  3Q7Z A;  4LV1 A;  3IF5 A;  1JWZ A;  4WL9 A;  5A8B A;  3F1P A;  1WA9 A;  4N1H A;  3CPT A;  1LLB A;  4OH0 A;  3OPH A;  1MZU A;  2Y59 A;  5KZH A;  1IYS A;  2PDR A;  4Z1W A;  3ZG7 B;  2PU2 A;  1UWN X;  3EGD C;  3PYP A;  2YKH A;  3F1N B;  4O01 A;  3LYX A;  3FPW A;  2VKS A;  4NKP A;  1H5X A;  4OON A;  2BLS A;  1MY8 A;  2V1B A;  2X71 A;  2JKR I;  4WMC A;  1VHM A;  4X6T A;  2G2W A;  1FQG A;  1T18 A;  4NXG A;  4GD8 A;  4II7 A;  3QNC A;  1FCN A;  1F98 A;  1N4O A;  3VOY A;  1T1B A;  4R4S A;  5TBM A;  2V20 A;  4CLC A;  3LO7 A;  3QP1 A;  2HV1 A;  4DXB A;  1Q2Q A;  3BQA A;  5AJG A;  3CG5 A;  4BEN A;  4PM8 A;  2J7V A;  3AGF A;  3IX4 A;  4KUK A;  3PTE A;  3ICY A;  3NIA A;  4JLF A;  3TW8 A;  1W63 Q;  5F83 A;  4R70 A;  4DJ3 A;  1DY6 A;  5TGF A;  3HLF A;  4PKY G;  5DF7 A;  1IFQ A;  3SH7 A;  2P9V B;  1TDL A;  1XJ6 A;  4X1L A;  1ZG4 A;  1OME A;  1TDG A;  2HP5 A;  5E2F A;  5CRF A;  3SH8 A;  2YKF A;  3HLW A;  1DRM A;  1FSW A;  4Q0H A;  3LIE A;  4OPZ A;  4ARZ A;  5K5B A;  5A93 A;  1N9L A;  3G34 A;  3LIA A;  3BYD A;  3NJA A;  4I3J A;  5AQA A;  2O9B A;  3IS2 A;  3VE3 A;  4EBN A;  3V39 A;  4OP8 A;  3ZQ5 A;  3KSF A;  1K6S A;  1O07 A;  2CC1 A;  3A0R A;  4O8G A;  2QHK A;  2XD1 A;  5IHV A;  1X0O A;  1L0F A;  3UDI A;  5M18 A;  3QP5 A;  3OZH A;  5GLB A;  3PAG A;  2XRO A;  1NXY A;  1BTL A;  3DAV A;  1BLC A;  2FFY A;  1K0K A;  2J3W A;  3M6B A;  4WMC D;  2OOL A;  4HI4 A;  3B47 A;  3PBQ A;  2KLI A;  3A3J A;  1G28 A;  4MBK A;  3OPP A;  2FH5 A;  4DDY A;  4PM5 A;  2V2F F;  5C5K A;  4OPQ A;  4M3K A;  3NDG A;  3T4T A;  4H6J B;  1H8Z A;  4IVI A;  3IF6 A;  3MJQ A;  5FI2 A;  1FIK A;  4BBU A;  3GRJ A;  3MZF A;  5E43 A;  4P6B A;  2X02 A;  4XUX A;  3BFF A;  1TS7 A;  5F5Y A;  4E3J A;  2Y2M A;  4Y7P A;  1HLU P;  2V1A A;  3V50 A;  4BMW A;  1IYP A;  3KSG A;  4OQI A;  2HJE A;  4RQ9 A;  4HH3 A;  4E3L A;  4EXO A;  5HAR A;  1QME A;  4L0L A;  3K2N A;  2ZQ9 A;  3ZG5 A;  4MCW A;  4XT2 A;  4BBT A;  5F1F A;  1HVB A;  1PNE A;  3G31 A;  3TOI A;  1C3B A;  2QMI A;  2PHY A;  3ZVT A;  1WYB A;  3LR3 A;  2QZ6 A;  3NCK A;  1FCO A;  3BFC A;  4H6J A;  5J8X A;  2ZC5 B;  1SCW A;  2OAQ 1;  4G3K A;  1IOU A;  2EWV A;  1ACF A;  3CHW P;  4LRY C;  1OTD A;  3D4F A;  1DP6 A;  4GHI B;  4DE1 A;  3UDX A;  1IEL A;  4H8R A;  1F9I A;  2PYP A;  3ZFZ A;  2ZOI A;  2J8Y A;  3ULF A;  5F68 A;  3N4I A;  1PIO A;  1KGE A;  5EVE A;  5AQ7 A;  1YT4 A;  3PBS A;  4FOF A;  1GSV A;  4RX2 A;  4BWI A;  3UPP A;  3GR2 A;  2JHE A;  4WF0 A;  1I5Q A;  1DJB A;  1L2S A;  1AXB A;  5EVI B;  4E04 A;  3SW1 A;  1NLY A;  3L9K A;  4OOM A;  3FWL A;  1BZA A;  2PBD P;  3TJZ C;  1D7E A;  3M2J A;  5GLD A;  4EBL A;  2ZQD A;  2WKH A;  2Q0O A;  4OPY A;  5GLA A;  4KZ7 A;  3IXB A;  3CUE C;  4QPR A;  3N6I A;  4QY6 A;  3WWX A;  4Y0T A;  3CZD A;  1K38 A;  4FH2 A;  1XX2 A;  4GHI A;  5CER A;  4Y0U A;  1BUL A;  3T4J A;  2XR0 A;  3S7P A;  3VSK A;  5AVF A;  4GB7 A;  4GOG A;  5JYO A;  1H0M A;  3B42 A;  4E3N A;  2M1C A;  5HD3 A;  1H3Q A;  2VGK A;  3DTM A;  2HF6 A;  1LHY A;  2PBY A;  3VP0 A;  1ALQ A;  3JYI A;  1OJG A;  3BM6 A;  5JYP A;  3NOU C;  3UE3 A;  1M40 A;  3MQQ A;  3H9W A;  1IYO A;  2ACG A;  4R3J A;  3GDI A;  1MPL A;  5HWW A;  3AGD A;  5EM0 A;  1S66 L;  2RL3 A;  3B3X A;  1ZKJ A;  3DWZ A;  2J3T D;  5F6A A;  2W3H A;  2XFS A;  4R38 A;  4QWO A;  3HLE A;  4OQG A;  4GDN A;  2DMW A;  1Q2P A;  3BY9 A;  3W4P A;  3BRM A;  5HAP A;  4JXV A;  4HP4 A;  4BL2 A;  3O87 A;  2Z2L B;  4IBX A;  2Q9M A;  1IEM A;  3V3S A;  5DF9 A;  1YM1 A;  3IQA A;  2ZQ7 A;  4GS9 B;  1KE0 A;  1JWV A;  4Q0I A;  4EV4 A;  3LIB A;  4MDZ A;  3IHB A;  3VFF A;  3LIC A;  4RVA A;  3W8K A;  3IBR A;  1GHP A;  3A3D A;  4MLL A;  5BOH A;  1W79 A;  4DDS A;  1LI0 A;  3N8L A;  3MFX A;  4MBH A;  4HOI A;  4NEE D;  3T4L A;  1RGY A;  2J3T C;  2O99 A;  1E3U A;  5HD5 A;  5DJT A;  2BG1 A;  5FQ9 A;  1V9Y A;  5FQK A;  3G4P A;  4PKY A;  4ZJ3 A;  3A0S A;  3N7W A;  1UGU A;  3O88 A;  5FAP A;  3MR0 A;  3KYQ A;  4DJ2 A;  5FEF A;  2R78 A;  1YLP A;  1NZU A;  4LV3 A;  2WAD A;  3F1P B;  3F1O A;  3A3F A;  5EUA A;  4MBF A;  5EVI D;  3DTK A;  3NOP C;  4WLA A;  2A3U A;  3O86 A;  5FDS A;  1RGZ A;  1XKZ A;  3D72 A;  3WS2 A;  1PWD A;  5FQI A;  4JF4 A;  3ZVW A;  4R23 A;  3IX3 A;  5DJU A;  3BLM A;  4O7D A;  4WZ4 A;  4UEY A;  2GZA A;  2B18 A;  1K4F A;  3IX8 A;  3E98 A;  1TS6 A;  1YKD A;  1L0D A;  1OTA A;  1M6K A;  4YNR A;  4B4X A;  1CI9 A;  2V9A A;  4QB8 A;  4ZBE A;  2PR5 A;  4CLC B;  2JKR M;  2HDR A;  3VV4 A;  2D02 A;  1OTB A;  1O7E A;  1N9O A;  3A0V A;  5CGX A;  1LL8 A;  5HAQ A;  4FUW A;  2FFF B;  3C5A A;  4Y0O A;  3QP4 A;  4E3O A;  1RP5 A;  4I38 A;  2E8I A;  3MF0 A;  2NUP C;  2XDM A;  1YMS A;  5E2G A;  4OOY A;  1SDN A;  1LT0 A;  1E3U D;  4EUV A;  2Y2O A;  2ZQA A;  3C7U A;  4ZRR A;  4JF6 A;  4I39 A;  4S2N C;  4CLC E;  1XGJ A;  2JN7 A;  4MEZ A;  1YLJ A;  4X56 A;  3W2Z A;  1YPR A;  4KQQ A;  1K55 A;  5FEG A;  3WS0 A;  2PD7 A;  5E2E A;  1KDS A;  4EWF A;  2VJW A;  1EWZ A;  5DFY A;  3UPN A;  4EU0 A;  1KGF A;  1ERO A;  4ARZ B;  3C8C A;  4KUO A;  1FSY A;  3UO9 A;  3G32 A;  2P08 A;  3WRT A;  3IS2 B;  4NG2 A;  4U0X A;  1XPB A;  3BFG A;  2ZMA A;  3QP6 A;  3NBL A;  1RCJ A;  3MMH A;  4HHD A;  2JCH A;  4WEL A;  3T4O A;  1XP4 A;  3OCL A;  2K2N A;  5HDC A;  1PW1 A;  2Y91 A;  4A5R A;  2C5W B;  2HP9 A;  4R0Q A;  5AQB A;  3R7W A;  4PM6 A;  3WRZ A;  4DRT A;  2ZMV A;  2PR6 A;  4IHQ A;  1GSX A;  3PHY A;  3SOI A;  4QY5 A;  2ZMF A;  1KOU A;  3G2Z A;  5FI7 A;  4EBP A;  3LY4 A;  1P9R A;  1KVM A;  5DKK A;  1FIL A;  3IF6 B;  2INW A;  4K0X A;  1XFQ A;  3EOI A;  3UMD A;  1PWC A;  3KYE A;  5KIZ A;  1DP9 A;  2Q9N A;  5FDH A;  1TS0 A;  2Z6D A;  5CGS A;  3FZC A;  3D3O A;  3L7H A;  1YLY A;  1L3L A;  4GD6 A;  4Y15 A;  3PBT A;  3RH8 B;  3Q7V B;  2J9O A;  5DF8 A;  3EEA A;  1YMX A;  3MKF A;  1BLP A;  2Y2I A;  1H8M A;  4QHC A;  3W4Q A;  4Z9Q A;  1BT5 A;  2FZ0 A;  4WEK A;  4XT2 B;  2OSU A;  3MQ0 A;  2Z2M B;  3MSH A;  4UQI S;  1ES5 A;  5FQJ A;  4EEU A;  2W3G A;  4OPR A;  5HDS A;  4ZDX A;  2VK3 A;  3C2W A;  3UB6 A;  4KQD A;  4NXE A;  1E4D A;  5IT5 A;  4R6L A;  3C4P A;  4BQM A;  4JGQ A;  3UN7 A;  2IWC A;  2JKT M;  4E6W A;  3IHA A;  4CLC D;  5DTT A;  3DTI A;  4IJG A;  4CPK A;  4UA6 A;  5HWT A;  3ZG8 B;  1NRF A;  3T4S A;  2D01 A;  2XQZ A;  5J7E A;  1NZO A;  1UWP X;  2WUQ A;  3TSG A;  1PFL A;  1CQA A;  3E4P A;  4JXS A;  4D2O A;  4DE3 A;  4C3Q A;  3T12 B;  3H7W A;  2QWS A;  4XUZ A;  2PAV P;  2Y2Q A;  2WGW B;  5A91 A;  3ZG0 A;  2WKP A;  2JBF A;  5U47 A;  2AVX A;  4S2L A;  3Q7V A;  4MMN A;  4GZB A;  3Q1F A;  3P7N A;  1KVL A;  4K91 A;  2PYR A;  1ZTU A;  1OPX A;  4K0W A;  3TRC A;  2W1T A;  2A49 A;  2A24 B;  2JKT I;  4R4R A;  1MKI A;  5J3W A;  4GN2 A;  3E0Y A;  3MXQ A;  1YSP A;  4CLC C;  3LI8 A;  1T1A A;  4R1G A;  4ZAM A;  2EA9 A;  2WKI A;  4WEJ A;  1SKO B;  4YFM A;  1HD8 A;  2I72 A;  2VGL S;  1BLS A;  1F2K A;  2ZBB A;  1IYQ A;  1JVJ A;  2ZC4 B;  1ZC2 A;  2WZX A;  3T4K A;  3I7J A;  1DJA A;  4IVK A;  3EWK A;  4LFU A;  3O5Y A;  3T1Q B;  3OCN A;  2BTF P;  2XD5 A;  1LI9 A;  3MQO A;  2EX2 A;  2HJ9 C;  3PBR A;  2W1R A;  3UB8 A;  3QP8 A;  3HUN A;  2WGW A;  1ES4 A;  4JGP A; 
#chains in the Genus database with same CATH homology
 3HJK A;  2WKR A;  3S7N A;  3LR0 A;  4GS9 B;  2I9V A;  4GLQ A;  4Q0I A;  4CQH A;  3LIB A;  2GNX A;  1S1Y A;  4MDZ A;  3S7O A;  3VOL A;  3S7Q A;  3LIC A;  2IA2 A;  3PXP A;  3IBR A;  4L9E A;  1OJ5 A;  5HZH A;  4NXB A;  4L9F A;  4WL9 A;  5A8B A;  5G4Y A;  1XJ3 A;  3K3D A;  3F1P A;  1WA9 A;  2A24 A;  4PAU A;  4EES A;  1MZU A;  4HP9 A;  2V0W A;  4EW7 A;  3NOT C;  2PDR A;  4Z1W A;  1P0Z A;  3MFX A;  1LSX A;  3CUE A;  3T50 A;  4DN0 A;  1UWN X;  3EGD C;  3C38 A;  2J80 A;  3PYP A;  4HOI A;  2YKH A;  3F1N B;  3JVV A;  4NEE D;  3TE8 A;  4O01 A;  2QKP A;  3LYX A;  3FPW A;  3T4L A;  4BBV A;  2VKS A;  4NKP A;  1GSW A;  2J3T C;  2Y8H A;  3GEC A;  4I5S A;  2O99 A;  2EWW A;  5HD5 A;  5DJT A;  4DMZ A;  3KYZ A;  2V1B A;  1ZHH B;  1V9Y A;  3LUQ A;  2JKR I;  2Z6C A;  1JNU A;  1VHM A;  4K08 A;  4PKY A;  3UB9 A;  4I3I A;  1XFN A;  1T18 A;  4NXG A;  3A0S A;  5G4Z A;  4II7 A;  1UGU A;  2O9C A;  1F98 A;  3MR0 A;  1T1B A;  3RTY A;  2PD8 A;  2VZW A;  2XA7 S;  3KYQ A;  4DJ2 A;  5TBM A;  4CLC A;  2NUT C;  3EEH A;  2R78 A;  2HV1 A;  4B93 A;  1P97 A;  3F1P B;  4M4X A;  5HPI A;  1W63 M;  3BQA A;  5AJG A;  3F1O A;  1DP8 A;  2G7U A;  3IBJ A;  4KUK A;  3ICY A;  1G6O A;  1YAX A;  3NOP C;  4WLA A;  3TW8 A;  2VA0 A;  1W63 Q;  4R70 A;  3D72 A;  1YSQ A;  4DJ3 A;  3LFV A;  1S4R A;  2PT7 A;  4PKY G;  5DJU A;  1T19 A;  1IFQ A;  4UEY A;  2GZA A;  2QJ7 A;  2B18 A;  4BJP A;  3B33 A;  3H82 B;  3E98 A;  4MN5 A;  1TS6 A;  1XJ6 A;  3R4K A;  1YKD A;  2GJ3 A;  4AFI A;  1OTA A;  4KQO A;  4YNR A;  1XJ4 A;  3U2A A;  2HGV A;  2YKF A;  2V9A A;  1DRM A;  2PR5 A;  4CLC B;  2JKR M;  3CAX A;  4ETZ A;  2WKQ A;  4Q0H A;  3VV4 A;  2D02 A;  1OTB A;  3HJI A;  1N9O A;  3A0V A;  1LL8 A;  1OTI A;  4P6Z S;  2Y79 A;  3LIE A;  3OBF A;  4ARZ A;  5K5B A;  2K31 A;  5IU1 A;  3DBA A;  4NXF A;  1N9L A;  3F1O B;  4LRZ E;  3LIA A;  4F3L B;  4I38 A;  4ME4 A;  4UQI M;  3MF0 A;  5DKL A;  2NUP C;  3NJA A;  4O0P A;  3BWL A;  4I3J A;  4JGR A;  4PHT A;  2O9B A;  3IS2 A;  3ZYT A;  1N9N A;  1BYW A;  3VE3 A;  3ZQ5 A;  2M7U A;  3KSF A;  4IUH A;  3A0R A;  4IUK A;  4O8G A;  2QHK A;  1X0O A;  1LT0 A;  4EUV A;  1TD5 A;  4EQ1 A;  2OWH A;  2XRO A;  4ZRR A;  2L1M A;  4I39 A;  2J3W A;  3LIF A;  2OOL A;  4HI4 A;  3B47 A;  3PBQ A;  2KLI A;  1G28 A;  3CWF A;  4GCZ A;  2FH5 A;  3UME A;  4CLC E;  5KSH A;  2JN7 A;  3E4O A;  3W2Z A;  4HJ6 A;  4YWZ A;  1NWZ A;  5C5K A;  2PD7 A;  4YOF A;  3H82 A;  3T4T A;  2VJW A;  4H6J B;  2VX8 A;  5DFY A;  3MJQ A;  4EET B;  4EU0 A;  5HSQ A;  4ARZ B;  3C8C A;  4BBU A;  4KUO A;  2W3D A;  5IS1 A;  1D06 A;  2LB9 A;  1S4S A;  2P08 A;  3PBO A;  3KO6 A;  3IS2 B;  1TS8 A;  2W0N A;  1TS7 A;  5F5Y A;  2W3E A;  4ETX A;  2V1A A;  4F3L A;  3MMH A;  4HHD A;  4WEL A;  4BMW A;  3T4O A;  3OCL A;  5HPF A;  3KSH A;  2K2N A;  5HDC A;  3KSG A;  3FC7 A;  3HCY A;  2HJE A;  1S67 L;  2K7S A;  3C30 A;  2CMN A;  4RQ9 A;  3R7W A;  3VE4 A;  4HH3 A;  2VLG A;  4EXO A;  1TF1 A;  2ZMV A;  2PR6 A;  4IHQ A;  4L0L A;  1GSX A;  3LR5 A;  3K2N A;  1NRJ A;  3PHY A;  2ZMF A;  2MJ6 A;  2M7V A;  4MCW A;  2VGL M;  4XT2 A;  4BBT A;  2VV6 A;  1KOU A;  3EQU A;  3BY8 A;  1LSV A;  4EEP A;  1P9R A;  5DKK A;  2VV7 A;  2V0U A;  4GJ4 A;  1LSW A;  2L4R A;  4R3A A;  1VB6 A;  2PHY A;  2INW A;  3LR3 A;  3BW6 A;  1XFQ A;  1Y28 A;  4LPZ A;  3EOI A;  4L9G A;  3UMD A;  5KIZ A;  1DP9 A;  4H6J A;  1TS0 A;  3G6O A;  2Z6D A;  2VV8 A;  4FSF A;  2OAQ 1;  4HY8 A;  3BQ8 A;  4G3K A;  5HL6 A;  1IOU A;  2W3F A;  2EWV A;  3JVU A;  4HJ4 A;  3D3O A;  4LRY C;  1OTD A;  4G3V A;  1DP6 A;  3PBT A;  3RH8 B;  1S1Z A;  4LLO B;  4GHI B;  1V9Z A;  4HIA A;  3BJN A;  4Y2F A;  3EEA A;  3R7W B;  3UB7 A;  1H8M A;  2GX5 A;  1F9I A;  2B02 A;  2PYP A;  2O9A A;  2FZ0 A;  2ZOI A;  4WEK A;  3OC2 A;  3V67 A;  4XT2 B;  3ULF A;  4OOL A;  5F68 A;  3MQ0 A;  4I3A A;  3FG8 A;  4UQI S;  4WN5 A;  2W27 A;  2OWJ A;  4EEU A;  2W3G A;  3PR6 A;  3EGX C;  4G3W A;  4MN6 A;  3PBS A;  1OT9 A;  4Y3I A;  4FOF A;  5HDS A;  1GSV A;  2P04 A;  4BWI A;  5DFX A;  3C2W A;  3UB6 A;  4KQD A;  1OT6 A;  4NXE A;  2P7J A;  1NLZ A;  5AVE A;  5IT5 A;  2JHE A;  3OLO A;  4R6L A;  5MC7 A;  4WF0 A;  3OOV A;  1F5M A;  4JGQ A;  5TJJ A;  4EER A;  3PBN A;  2JKT M;  4E04 A;  3LID A;  4CLC D;  3SW1 A;  1NLY A;  4OOM A;  4IJG A;  5HWT A;  3LR4 A;  4B9O A;  3T4S A;  2D01 A;  3TJZ C;  2OAP 1;  1D7E A;  2XA7 M;  1MKM A;  1T1C A;  1P9W A;  5L8M A;  5J7E A;  3CLO A;  2XRN A;  1UWP X;  2XSS A;  3E4P A;  5CX7 A;  3P01 A;  4GW9 A;  3H7W A;  2O0Y A;  2QWS A;  3CUE C;  3NHQ A;  4HNB A;  4QPR A;  1XJ2 A;  2WKP A;  2KX6 A;  4HQA A;  4MMN A;  3LI9 A;  4GHI A;  5LBR A;  3P7N A;  4WUJ A;  5HDD A;  3CIT A;  3T4J A;  5HWV A;  2PYR A;  3S7P A;  1ZTU A;  1OPX A;  5FL3 A;  3TRC A;  5AVF A;  2W1T A;  5I5L A;  1MC0 A;  3FPV A;  4HJ3 A;  2A24 B;  4GS9 A;  4LRX C;  4Y5F A;  1EW0 A;  2H28 A;  3B42 A;  2JKT I;  2ZOH A;  2VEA A;  3EQV A;  2M1C A;  5J3W A;  3E0Y A;  2QYB A;  3MXQ A;  5HD3 A;  1H3Q A;  4MN7 A;  2HF6 A;  1YSP A;  4CLC C;  3LI8 A;  1T1A A;  2KOI A;  3RFB A;  2LB5 A;  1OJG A;  4JGO A;  2EA9 A;  4HH2 A;  5J4E A;  3NOU C;  3UE3 A;  4WEJ A;  2A2L A;  2QJ5 A;  2VGL S;  3MQQ A;  3H9W A;  5EFW A;  2ZBB A;  1STZ A;  3K3C A;  5F69 A;  2BAS A;  3GDI A;  5HWW A;  3T4Q A;  3F1N A;  1S66 L;  4P6Z M;  3T4K A;  3H7W B;  1ODV A;  3EWK A;  3UE6 A;  2J3T D;  3O5Y A;  5F6A A;  2W3H A;  2L0W A;  3OCN A;  3KX0 X;  3CI6 A;  2KDK A;  3MQO A;  4R38 A;  3KSI A;  2HJ9 C;  3PBR A;  3BY9 A;  2DMW A;  2W1R A;  3UB8 A;  5TBM B;  1OTE A;  4HP4 A;  4JGP A;  3E4Q A;  4Q0J A;  5DF9 A;  2W1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...